5BQPA

Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with xanthosine and phosphate bound in the nucleotide binding site and with sulfate bound in the pyrophosphate binding site
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
177
structure length
169
Chain Sequence
EYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFSKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine phosphoribosyltransferase (GpT-2)
publication title Sulfolobus solfataricus P2
rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
total genus 47
structure length 169
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bqpA00
1G2PA 1P19A 2VFAA 4P82A 1MZVA 2H07A 2FXVA 2DY0A 1BZYA 2E55A 1I0IA 2WNSA 1G9TA 1G9SA 1O5OA 3OHPA 2JKYA 4TWBA 1FSGA 1VDMA 2PS1A 4ZFNA 1BD4A 5HIAA 3OZGA 5JV5A 5JSQA 1JLRA 1UFRA 3DMPA 1YFZA 4Z1OA 3QW4B 1VSTA 1AO0A 1GRVA 1P4AA 1XTUA 4RHUA 3OZFA 3G6WA 1JLSA 1WD5A 5KAMA 4OHCA 1XZ8A 3H83A 4FYMA 4PFQA 4LZNA 1QCCA 1HMPA 3GEPA 4X45A 4X44A 1VCHA 1G2QA 1L1QA 1W30A 4RHTA 1LH0A 1QK4A 1ECBA 4QYIA 5HKLA 5BQPA 1QCDA 4M0PA 4WMLA 5BQOA 1XTVA 2C4KA 4RAQA 1A98A 4S2UA 4RACA 1A97A 4RABA 1BD3A 1U9YA 4F8EA 2EHJA 3M3HA 2YZKA 4P83A 1OROA 3LRTA 1A3CA 1ZN7A 3ACCA 1DKRA 1A4XA 1ECCA 1STOA 2XBUA 2P1ZA 4RAOA 4PAWA 3N2LA 3S5JA 2IGBA 1PZMA 1XTTA 1GPH1 3HVUA 1ECJA 1OPRA 5BSKA 1A96A 4RQBA 1DBRA 2JKZA 1OREA 2GEBA 4IJQA 4RV4A 3DEZA 3LPNA 4JITA 1ZN9A 2AEEA 1HGXA 4P81A 4QYIB 4RANA 4MB6A 1P17A 2PRZA 2PRYA 1I0LA 1R3UA 1CJBA 1UPUA 3GGJA 3ACBA 4LYGA 1ECFA 4KN6A 4RQAA 1NONA 1ZN8A 4P80A 1QK5A 5ESXA 1O57A 1IBSA 4JLSA 3GGCA 1QB8A 4P3KA 1ECGA 5BRNA 1J7JA 1UPFA 4M0UA 1QB7A 1DQNA 5ESWA 5K51A 1I14A 4RHXA 3MBIA 3KB8A 4LZAA 4QRIA 4LZOA 5EUCA 1XZNA 4P84A 3O7MA 1A95A 2HCRA 1D6NA 1TC1A 2H08A 1V9SA 1DKUA 2H06A 5KAPA 3MJDA 3NAGA 1TC2A 1DQPA 1I5EA 1Y0BA 2JI4A 1L1RA 1P18A 3ACDA 4RHYA 5E38A 3DAHA 5IPFA 4RADA 4P86A 4WN3A 1Z7GA 1I13A 2JBHA 3EFHA 4LYYA 1U9ZA 4M0KA 1NULA 5IAOA 1QK3A
chains in the Genus database with same CATH superfamily
2ZM6B 1GPUA 1V3VA 1KP3A 3TCNA 2VYNA 1T8TA 2JVIA 4H27A 5BMVF 2C20A 4K40A 4AURA 2VRCA 4NSNA 3TE6A 3B12A 3PDIB 3W2EA 2OXIA 4BO8A 4I8XA 4IIEA 5G4KA 4D3FA 3FNBA 2VUIB 5LL6P 1UT5A 3OAAA 3C1TA 3HB4X 3PRKE 1B6TA 4IAOA 5H83A 3ZI0A 1KAEA 1O0SA 1ABFA 1PBNA 1PK9A 3N0XA 4ZT2A 4DMGA 2AR0A 1IY2A 3C7CB 4GRDA 2NYUA 1WKCA 2O1EA 1K5DA 1DXQA 2NV6A 4HNUA 2YVAA 1XTUA 4EW1A 5C4IA 3N7AA 4RORA 1DT3A 2L18A 3OH8A 3PXCX 4NE2A 2OA0A 3K9GA 1WBJB 1AQUA 1X39A 3EWAA 3AR4A 3HM2A 3W1WA 1Q57A 3IQZA 3WGJA 1CUGA 4X44A 5F2KA 3ZY3A 2ATEA 1YVDA 1JEJA 4DNOA 3A9SA 1T35A 4YMIA 4OHFA 1KDZA 3DHEA 3DR5A 3KTFA 2B0CA 3P0EA 1WLSA 1V39A 2JFWA 2A5JA 5AJVB 3ZWYA 4CG3A 2EHJA 3DZFA 3PUKA 4JNCA 4Q4JA 1W0CA 5FORA 1L8LA 2GPTA 4CQLB 2PANA 3B1VA 3P9QA 3Q3HA 4JOBA 3RWOA 1TYCA 1UJMA 1HDRA 5H1YA 3MT0A 3VH3A 1RU3A 2C9ZA 2FRXA 2ZS9A 4H4CA 3QPDA 3EW9A 4YGYA 2H52A 3SHOA 1OHHD 2VAMA 3TLEA 3QKTA 5HZHA 2B9EA 3J7AC 1NNEA 3PC7A 5GOTA 3HXQA 3ICQB 3R3VA 4Q15A 16PKA 4N3CA 4CG1A 4TT3A 3SPXA 3AG6A 3MWDB 1YBMA 4QYTA 1ZOSA 2WWIA 2IVFA 2EFGA 4PS0A 3RM3A 1REQB 1OQAA 3CGGA 2H4HA 2R5FA 3JARA 2APJA 2WIGA 1ZN2A 3CRNA 2NU6B 2BSAA 4I46A 3RCBA 4LC0A 3FR8A 4Q16A 1FP2A 2CXHA 2ZK7A 4R1PA 3ECAA 3ZU2A 1R9JA 1EFCA 2P2LA 3NLLA 5EHNA 4KYTA 1U2EA 4Q4AA 4N40A 2R6JA 2WSMA 2YRFA 2ZSDA 1IVSA 2XQGA 1IZ0A 4O2AF 2XUPA 2VYFA 4AZSA 1N2CA 1VP9A 2EYQA 3BMQB 3V1KA 2V8OA 1JPNA 1U1CA 2BP7A 2C5LA 5A9RA 1UBHS 2GN4A 4DMUB 2GXSA 2YMPA 2CJWB 2VDPB 3U3DA 2R6DA 1RXVA 3T1HB 4HRAA 1J4AA 2H3HA 3U37A 3AJDA 3OA0A 1YK0A 3UGQA 2FX5A 2V7EA 4AN4A 3ESAA 4QU8A 3ANTA 5FUQA 3W5BA 1YOVA 1O95A 4L4XA 1TJ4A 1ZQ9A 4PQFA 3ROTA 4POAA 5EAIA 1UFKA 3RV3A 1T8YA 3PT9A 4TMZA 1PJLA 3PDJA 4BMCA 3IHKA 5C1OA 2DB3A 3NBUA 1SHUX 4II2A 1ZM2A 2PTGA 3VSBA 3DZKA 2X5XA 1ZH8A 3BRWA 4A0QA 1G38A 4HBGA 9GPBA 4FUQA 2FP4A 4Q05A 4ABYA 2WLSA 2J6HA 3O8RA 4KDRA 2V7TA 1RLIA 1GA6A 4BZXA 5LP6F 1I7PA 2VKTA 2FPIA 3HJCA 3JVEA 4DLSA 5CDTA 5IT5A 4JP2A 4KYUA 4RIEA 3PQDA 2C7GA 3P5SA 4B8WA 4KVZA 3VC3A 1OT3A 3D7RA 3PITA 1FRZA 2PJUA 5EXTA 2OO7A 4DXHA 3PC2A 1DJMA 3ZY2A 1QTIA 4XM2A 4PSUA 1OV6A 4M7WA 1YS1X 5B2FA 1E99A 1H93A 2WNSA 3RSGA 4F46A 4GP6A 3UAZA 4TXMA 2A5DA 1ZP6A 2VLIA 4FWTA 3OE1A 4CU2A 3OFSA 2FEWB 1JSLA 5CLQA 1N2CE 2ZWPA 5SV2A 3L8ZA 1Z22A 3OX4A 1CQJA 3I6BA 3CKKA 3N1UA 4G26A 5JAQA 4V24A 4LV8B 4RIHA 4BMZA 4YO8A 2Q8PA 2YVKA 3PIIA 3GOHA 1EWRA 3PPIA 4AM8A 2HPVA 1CUJA 5KVCA 1N4DA 2GTHA 1E5QA 4G1FA 4DUGD 1GPJA 1HQKA 4FSXA 4RFLA 5IAJA 2F4VB 1TLTA 1NMSA 2AVDA 2GKSA 2JRCA 3EB9A 4X1YB 4UCFA 4WVLA 1VLJA 4CCSA 1RLTA 3L02A 1RQGA 4A27A 1RRPA 4JXZA 1QGAA 5ALPA 3E9QA 3IEMA 3WA6A 4R9SA 3SEFA 4BV8A 1ISPA 1BJKA 1TO2E 2QM3A 4AN1A 4QYMA 3RFXA 2H2IA 1YKGA 5DEOA 1ZD4A 1XR3A 2H1SA 1XJQA 1PYDA 1B0AA 2WVGA 2PIAA 4KBYA 1XTKA 3NHAA 4ISCA 4U02A 3QXCA 1ZIDA 4WVFA 4YDHB 5FCDA 3LE8A 4GPZA 3U40A 1MC8A 2QQFA 3P2MA 2ZSKA 3MBOA 3CWCA 3KVVA 1HZJA 4PCAA 2R8XA 1J8DA 1KI8A 4CTJA 5BWLA 5LDHA 1TYBE 5F9HA 2QVXX 1Y3IA 1K6IA 1XT6A 3AEUB 4JEIA 3VR5D 1JEQB 3NCHA 2QRQA 1P73A 1MB2A 1Z7BA 1IPEA 2ECKA 3MWEA 4W1RA 2Y68A 1G3UA 2P69A 4E5NA 4MW9A 1PJBA 4CI9A 4ZVSA 1PJ2A 1POWA 3L6CA 3C87A 4MW2A 1YZKA 3RS3A 1ID1A 1A4RA 1LFAA 5ARDA 3KHTA 1PVDA 3RU2A 3LSYA 2P3OA 3AY0A 4B31A 4BFWA 4URVR 4XYBA 4RTQA 1NRWA 1Y1RA 3A2MA 4TKZA 1T2CA 4BVGA 4RIFA 4KSCA 4I36A 3C15C 3C45A 4JX9A 5D3MA 1K5PA 3DOIA 1TI7A 1QTNA 3DUFB 1UBLS 2P2SA 4K81B 4TRNA 4RTRA 1FPMA 1QOPB 3FDIA 3HUFA 4DWVA 2HNBA 1RYEA 1AVTA 1G0NA 1OFIA 2Y1XA 1VCIA 2AFVA 2X40A 3F0TA 3LK7A 4JGIA 4FE3A 1CNEA 4MI3A 3WV4A 4YUWA 2I8AA 1I1OA 3QEMB 1A4UA 1P9LA 1A95A 3BJZA 5LQRA 1R5OA 2P75A 3BCUA 2EBWA 1JI0A 3HGQA 3LHIA 4UXIA 4YXWD 1UC5B 2KLHA 4DLLA 3O1JC 1AK9A 1SCIA 1KJNA 2WQ6A 4ZVNA 3I2FA 3B20A 1C1XB 4W8OA 5ED0A 3A6PC 4TLBA 3N2KB 2AOVA 3U7QA 3O92A 3NHZA 1KVSA 5LYJB 3KSBC 4DY4A 3AM5A 2WWVD 3W5CA 2PZJA 3FHLA 2CLEB 4O4LA 2C4VA 3WAJA 4YRBA 3A37A 1DX9A 2PR2A 2B4TO 3VX4A 2C8JA 1Q2UA 2VJAA 1JTVA 2P91A 2A0WA 3IGFA 3E9CA 3R3UA 3BFXA 4BYGA 1ZUWA 3BGWA 1SU7A 2OB2A 1DV2A 2GEJA 3GDFA 1WPXA 3HWWA 1PJQA 4TLLB 3TVTA 3NDPA 5L53A 4IRXA 3OJCA 1QFZA 3B52X 3BFVA 5E7JA 1OXBB 1NSYA 3EHDA 4MI6A 4P5DA 5HJ7A 2HMWA 4D8UA 4QOHA 4YAWA 2E4VA 3AP1A 4IGKA 2HCTA 4KAXA 5AM0A 5E3IA 1UMDB 4JEUA 2GZMA 1IZ7A 4B45A 3B82A 1T4MA 4JS0A 1RC8A 2XZLA 2HRCA 1UKZA 2YYSA 3H9JA 2ODBA 3LGAA 4UNIA 2X0DA 1KKUA 2RGNA 4WY8A 3RUFA 2FEPA 4Q4CA 3V8BA 2EKPA 3VPSA 2DEUA 1BMTA 2VAXA 1UFQA 4JYAB 4PX2A 4URYR 3ROGA 2O14A 4YV7A 3JQFA 3JASA 1NN1A 3FROA 3AOEC 3D6TB 4UNQA 3CPSA 3SLKA 5JC8A 1DO0A 2G4VA 3NOVA 2P6MA 4MULA 3MCZA 3S5JA 5IT0A 2VSNA 3WBFA 2CL0X 3D1VA 5EUQB 2OPBA 4WA7A 5IT4A 2QX6A 4EPTA 4KGXA 1ZI6A 2C03A 5HBRA 1E63A 3GFOA 3ZOZA 4LRUA 3ZCUA 1NW6A 2EX4A 4DC0A 4L78A 3SF8B 4TV9F 1SXJD 4HTFA 5B1DA 3LK6A 1DEXA 2BR4A 3JATA 3NHBA 4E21A 2HJ9A 3GQVA 4Q66C 3UJ3X 4JK3A 4A3SA 3R3SA 2Z9BA 4OXQA 1CUEA 4L5JA 2J67A 4KR9A 2OMEA 4J29A 2HYDA 4L8VA 2WJ6A 4IPTA 1Y9ZA 1SQ0A 3JR3A 2WFLB 1WZ2A 1HURA 3Q3IA 3AYXB 4TZKA 2EZTA 1Q6ZA 3IUPA 2XT9A 2LXNA 2BTQA 3FW1A 2I22A 4J4TA 4DLYA 3D0KA 4LCBA 1CSEE 4ZMRA 1VE5A 1GAEO 3G88A 5M29A 3U7RA 5BN5A 4C3UA 1IAVA 2C2KA 3K8ZA 4ZGWA 2QLJA 1NVDA 4A8JC 4KQ2A 4G0NA 2EV9A 2G1AA 1FRVA 3HCBA 5KOJA 1OZGA 1XYGA 2J30A 3ED1A 5C5IA 4P7BA 4V1CA 1OFUX 3V2UA 1ULTA 1BMDA 2J3DA 2ZPTX 3CH7A 2YVUA 3QNUA 4C06A 4C4PA 4LF4B 2HL6A 2J3IA 2OZVA 2ZAIA 5ALUA 1OU0A 2WILA 1JFLA 4XM1A 5FADA 3U5ZB 4BMYA 1H4TA 3QEOA 1O7JA 2VJKA 3WGVA 1CKEA 5EE1A 3I2GA 2GF0A 4MVXA 1ECLA 4BQRA 5A04A 3JVVA 2DKFA 2XRZA 3HMKA 1J0BA 3NYWA 4RLHA 4CTNA 2O2EA 2C9YA 4W99A 5GWXA 3SBOA 2HT6A 1AV7A 4ESEA 2O5VA 4WZ6A 1GYPA 1ZX1A 3EF0A 2QTHA 3UT6A 1NVVQ 3AUTA 3TZQA 4RY0A 1XJCA 4L5YA 5K9ZA 4A4DA 1JDSA 1EQAA 2X6RA 3O8QB 1XSEA 5JV5A 2ZRDA 2IP4A 1A8UA 4CUJA 2CXTA 4R8LA 1XXLA 1RVDA 3V1MA 3LI2A 4MDYA 5EG5A 2CNDA 2MTBA 3DV0B 3OIUA 1RBQA 5B6IA 2D62A 5HJ5A 4FHEA 1WZUA 4E09A 1YHNA 1PWYE 3GAZA 4K2HA 4LJLA 4WXHA 1BHJA 4UHDA 3MWFA 1JKJB 2XLBA 2XUDA 4ZO9A 2OV8A 3LFTA 3V7YA 1PD1A 1D5CA 2IUEA 3KELA 3GJXC 2Z5VA 3E70C 4R5MA 3WYBA 5BW5A 1T1JA 1G2QA 2GFQA 1T5TA 4OP1A 4XJTA 3C98A 3TDNA 3KP1A 3ENWA 3NATA 3VR5H 2B5OA 3PDCA 4FFDA 5GGXA 1DQZA 3R5XA 2I4MA 2IIPA 3LVFO 3WMEA 3W34A 3FWKA 4DUPA 3BGIA 1AZWA 1O8CA 1A9OA 3CVJA 4UBJA 4BMNA 4A5SA 3CIOA 4FJ1A 4IVPA 4IIDA 3F5FA 5A0VA 1O4VA 1S1MA 4OCZA 3V2HA 3QKIA 3UXMA 3C1UA 3KLBA 4QHTA 4KGZA 1M34B 5DCLA 1ZAKA 3OWXA 5IC5A 2Q3LA 3AHCA 4OI2A 4YAUA 2R6ZA 3KB6A 3RTDA 3TEFA 3WL5A 4A91A 1U5BB 2NAPA 3DVAA 3FUVA 3TGLA 4CGYA 1CZHA 1PS8A 1ULUA 4IHAA 3U7FB 1SKQA 4D97A 3E9EA 3VUEA 1KDOA 3DFUA 2OKCA 3WBKA 3A9RA 3F4KA 3PJDA 1SVNA 1T34A 1C1DB 2LBPA 3P0HA 4HATA 4IUYA 2PKXA 3DBLB 5KB3A 4Q4HB 2FDCA 3NHPA 2R5WA 4XLTA 1Z2PX 3IP5A 3OCXA 5J2TF 2H57A 3OEED 2XWQA 4EL5A 3NAQA 1VE1A 1V3UA 4C3VA 1MMFB 3KKZA 1IRXA 3GJZA 3C39A 4ND4A 2XE4A 3CN7A 1WQ4A 1ABEA 3H9EO 4NEGA 1CY0A 1QQBA 2R8EA 2AEJA 3IV6A 3LQKA 1RACA 1L7RA 3R20A 4MS4A 5JMTA 3IDFA 3GLIB 2C3YA 5K3CA 5JJLA 4UOQA 3AUFA 1WKBA 1BW9A 3LW7A 1IOVA 5JWOA 3QE0A 3E1GA 3WGLA 3T9EA 2ZQYA 1T2VA 1HI9A 3NXSA 1XTIA 2BOVA 2GHIA 1QO9A 1EQUA 4IGIA 4NK5A 2D4HA 2ODNA 3MC1A 4CLXA 4EG5A 3ZS9A 4UC0A 3HJGA 2W9XA 3TLBA 5IN4A 4N12A 1DIRA 1M1ZA 2C8KA 3NBFA 4BTEA 5ALTA 1JQBA 2CLDX 4IJMA 2IY7A 4M4SA 4HWPA 1D5WA 4DV3B 5ALNA 4F4JA 3H0EA 1GARA 4I4TB 3UHOA 3CX6A 2NU8B 3SSNA 4E13A 5HKOA 3HO1A 4HD8A 4IGFA 3WB9A 4CG0A 3UAVA 3V3KA 3CM0A 3L79A 1X1CA 4QBIA 3WO1A 4EJ0A 3EVNA 3VPAA 3EFHA 5JRDS 3ELWA 3AM1A 3M6LA 1H6CA 4E5MA 2W6QA 4BDTA 3I09A 3ELDA 3TE7A 2G8LA 4P3NA 5LSAA 5D84A 4FWIB 3K6KA 1GXSA 3OIYA 1ORWA 2DLDA 3LX5A 1Z06A 4RE5A 1F7VA 3HCOA 1U4OA 1CEEA 1G9SA 4JLBA 4CIBA 2Q3EA 2VA8A 2CVQA 2JD2A 1SRQA 1SG0A 4IFBA 5HVNA 3M8KA 4YP5A 1R0SA 4G8CA 3DMHA 4BY9E 3OC0A 4GR5A 3L92A 3RRBA 2OGUA 1L4GA 4MNTA 1JGTA 4IP0A 2JAOA 4PQRA 4F91B 5IYZB 1Y7PA 3CZRA 4OKNA 4EYOA 4TS9A 3OSUA 5BV1A 3RASA 1XCBA 4KW7A 4R1UA 4ZARA 1D4AA 3QVXA 1O96A 1RQXA 3MOGA 3MIZA 5FTMA 3IDQA 3UMRA 3CVVA 1PGOA 4PFQA 3C24A 5DLPA 2IOFA 2AQ8A 2FCAA 2JK1A 1ZHHA 1R27A 4WK0B 1I2CA 3ICOA 1C4KA 2OK7A 3ZGOA 3IIJA 2FV8A 4W9NA 4YRIA 1ODIA 4UPEA 1H1LA 3R6GA 3W9YA 2QENA 1B0PA 1MTOA 1X1QA 2JI8A 5FA8A 1VMEA 3O47A 3CC8A 4M8NE 2WJGA 4BZZA 4JYCA 2WV7A 5HA5A 1OV4A 1JTFA 1H2XA 5ICEA 4TT8A 3U44B 3RWBA 1LRLA 4DPMA 1MC4A 3JSXA 4Y2VA 4ZREA 1W59A 5J4VA 1DXYA 2PZFA 2YHIB 4GSLA 2P11A 3LGXA 3I4LA 3AXTA 3LDFA 3OQIA 4MTCA 2I9KA 1BDHA 5KTRA 3HYLA 4ETNA 4MV1A 5HZKA 1KP2A 1T5BA 2JIRA 2IPOA 2ISCA 3FIUA 4P3XA 3ZEAA 1Z34A 2YWFA 3MK31 1AQ6A 1RQ7A 2RKWA 4XGRA 3HYRA 1V8BA 5L3RA 3BIFA 3EC1A 3IRUA 1E2BA 4FGSA 1GPDG 2OBYA 1AKVA 4PSVA 3SKYA 1YL5A 5ALEA 5I8WA 3S81A 1NIPA 4CMEA 3D4IA 4J3FA 1G8GA 3HDYA 4BNIA 2NO4A 1UBUS 4HWTA 4K03A 3UMYA 2Q07A 4L8FA 4J1NA 1HG1A 4CMJA 4JJGA 5KSYA 1VBKA 5CIQA 4XB2A 2NYAA 1XN4A 2IS4A 1ZW6A 3USCS 3GG2A 2I6SA 3IDAA 4NOKA 1O89A 4UTZA 4R8KA 2ZYAA 4QKQA 1YKSA 1CERA 1NBMA 3GZTB 2GM9A 1OZFA 1V7ZA 1I9CA 2RAVA 4NABA 4Q00A 3RK1A 1E0SA 1KMHB 2AKAB 3B36A 3DJYA 5A62A 3KZ1E 1C5KA 2ZI5A 1XDWA 1XWFA 2O1SA 3I2HA 3AL2A 4L5BA 4OLHA 4HQRA 3UJ9A 1Z75A 1ISJA 2E5LB 2FLVA 2IEIA 1TPYA 2DZDA 4XEHA 4NRDA 1G20A 5A3QA 1NXPA 3A3KA 5T8KA 1X80A 3QPUA 2BZ0A 1XVUA 5BNIA 3EK2A 1ZWLA 4Q6BA 4PQGA 1H6DA 3L4BC 3WGMA 4YCBA 2XVMA 4I3HA 2Z2KA 1P8JA 1PSDA 3BE8A 1Y0BA 2Q3HA 3WLAA 2D3TA 2I7CA 5KC8A 1UOPA 4MARA 5D8DA 2VKQA 4YX9A 1ARZA 1O87A 2WHEA 3IMKA 5JS8A 2R1VB 4YGXB 3EEFA 3WZ2A 1VGVA 2QAGA 5JVDF 1H65A 2Q0XA 5KWIA 4JBHA 5DGTA 2BD0A 4F2PA 4HPJB 1NWHA 2HEIA 3LT0A 4U9HS 1Z6TA 3AF3A 4IZIA 4ZI2A 3IPXA 4YRCA 2RARA 2YUIA 1T2UA 2JGDA 3BF7A 3RUIA 3RS2A 3TLZA 4C3ZA 1TK2A 5L3SA 3PFKA 3OT1B 2AYYA 1JEDA 2XNKA 3TLGB 2R1ZA 4GC5A 4J6EA 4S1TA 4UTNA 1NLMA 5A3SA 2NSJA 3DVQX 3P9NA 3NBAA 3X1XA 2BLLA 1E69A 2P27A 1TZMA 3BE4A 2G0AA 1KGDA 4R2MA 2E1PA 4YAIA 5D5PA 1NBME 1OX4B 4IXTA 4RU1A 2PGJA 3A4TA 1V96A 4FOLA 2QN2A 4L75A 4AJEA 1QGED 1AQJA 3S2YA 3VBCA 1U28C 2DR2A 2DM6A 3F6CA 1E6KA 4YCCA 1RJDA 3WL8A 1VTKA 2DFNA 2XNDD 3RVRA 2UZ1A 3NAMA 7GPBA 1G20E 1VG1A 3IPAA 3N07A 2Q5OA 2ZTMA 3EVTA 2IT1A 2OCGA 3CNHA 3ST7A 4V0OA 3Q85A 4B2YA 2PD6A 3DZ8A 2QQ0A 4QSMA 4JENA 2CNBA 4ALMA 1Z0FA 1XZBA 1W9MA 3BDAA 2XGOA 3D81A 2VDRB 4OI4A 4DFDA 5LKAA 3UWMA 1Y5LA 4BNMA 4ENVA 3KTAB 4KP7A 4E33A 2C7OA 1XTBA 2H7VA 5FR2A 4DR6B 1VDZA 3OECA 5L40A 1UXIA 1Z0ZA 1U3TA 1H94A 1QGUB 1CWUA 1RBYA 1YCFA 3MQ4A 3PDUA 4HAWA 2NSYA 4WHMA 3F3KA 5BYJA 5M3BA 4N47A 3UV7A 3KPYA 3L8EA 3DYIA 2ZDQA 1VBFA 3ODGA 3NOQA 3DQPA 3NTXA 3OP4A 5A0TA 1CRWG 2BRUC 2AC2A 3K0FB 1P6UA 1NXVA 3F9IA 3SZUA 3X0DA 3DEZA 3EQ8A 2FMIA 4IVQA 4WAUA 5DNEA 4DPLA 2X8AA 3E0QA 4GI5A 4GMFA 6NULA 2AUMA 3C41J 1L4LA 2PS9A 3C7DB 3UFXB 4CI0B 3VR3A 4MWBA 2PAAA 1N5MA 1PL6A 2RHWA 1RPAA 3PLNA 4YR9A 1H0RA 1K6EA 4PZPA 3H7IA 1CUWA 4Q21A 3ZR4B 2QP3A 3GA7A 5ICFA 2OB1A 4DLWA 4EG0A 2HA4A 1JVNA 1Z0AA 3OPYI 5CXXA 4CQMD 2TSYB 4LYAA 4YTEA 1CW2B 6YASA 3TR6A 1Z28A 4JP8A 3RSZA 1DKLA 4XUGB 1H9AA 1XD2A 5JH7F 4DADA 4TWRA 5FBWB 4P0PB 2WB4A 3KDSE 4A0GA 2CD7A 2HUNA 3LDHA 4QM6A 5JDCC 5F23A 3JXEA 2GX6A 4QBFA 1U4SA 1CUYA 4LBWA 1S8AA 3PHIA 3O6VA 1HV8A 4H17A 1YA6A 3QENA 4R7ZA 4G41A 4LY0A 2HREA 3WVNA 3AB7A 4MRMB 4QL3A 4N9QA 4NPAA 1U1FA 3Q8WA 1G5PA 4YYEA 3V4ZA 4J91A 5K1ZA 3I64A 4Z3KA 1SC6A 1Y3AA 2VH2A 2Y8EA 1WSWA 1AKRA 2NYRA 1MUUA 4H4EA 3ZJYA 1XD9A 5KTPA 1UQRA 3HU2A 2ZYTX 1G21A 2Q50A 2QLNA 4HQKA 3UWKA 2JARA 4TS4A 4IXWA 1ECPA 3FLMA 4EYKA 4YRZA 5CB4B 3I1IA 1QS0B 1NMYA 5LMCA 1BU5A 4LF8B 3LF2A 1KF0A 2FZCA 4TSFD 2NW6A 3SC2B 3CG0A 3SIRA 4G1VA 2YXDA 4TOIA 1HMYA 1IIRA 2AG0A 1X8JA 3ZH2A 3SEZA 4CM4B 5GONF 1NE2A 3F7TA 1KO8A 4HX5A 5I45A 4YCJA 4C7XA 3DAOA 3PHCA 1BVYF 1CU1A 1YNOA 4XFKA 4D02A 2FW6A 5H4GA 5JAUA 1E9AA 2YZ2A 3D6AA 3RKSA 3PQEA 4I3FA 3HY3A 1ZZEA 4JXKA 2CUTA 1PJTA 4G24A 1X6VA 3TIGA 4EVRA 3C6KA 4WIAA 4EIWA 5HRUA 5DB4A 1CUZA 1D1TA 4D6YA 1VLLA 3V8PA 4KG7A 5MF6A 5DM2A 1XNJA 4XWYA 5D2CA 5IKOA 3UJHA 2GNAA 1O0BA 1LQ2A 2QB5A 5JZVA 4WQMA 4PC7A 5CVVA 2ODTX 2OVFA 4JD5A 4JUCA 4X91A 4ZAWA 2GZSA 5F5NA 3T3GA 2Q2NA 3AF5A 4D9GA 5ITWA 2C83A 3BIXA 1UDRA 1QG0A 3PXUA 4LZWA 3KQLA 5IH3A 4XTRA 4W6ZA 3S2GA 4ALJA 1R8XA 4B40A 1Y8ZA 3OBIA 3P0IA 5ENDA 4R2IA 4OQYA 5FOUA 3L93A 3MFQA 4DZTA 1K88A 4UTPA 4E2YA 2AKEA 4TL9A 1TXGA 2SCUA 1URPA 5AVXA 4RACA 3ZHUA 3WP0A 1XP8A 3OURA 1G5HA 1NW3A 1L3IA 4BEVA 4UHHA 1G21E 4MWOA 3ROMA 3RS9A 1Z8NA 5JS6A 5FO0A 3VKFA 2ECOA 2RJOA 2RHHA 4BIMA 2QM7A 2FJPA 2FPGA 2P0AA 2Y4NA 4II3A 1NKVA 4R2WA 1PFKA 2VSYA 2XJ9A 1P1RA 1P74A 1HUQA 1LK0A 1WUHS 1UZUA 3EF1A 4PLHA 3W5DA 3EZXA 3FA2A 4PEVA 2I67A 2OQ2A 3DMGA 1LNQA 1SU8A 4OPMA 2UYGA 3QPBA 1QPBA 1ZJYA 5AK3A 1PW5A 5JNTA 4MWGA 2NU9B 2CKMA 2DU8A 4QFBA 1ULAA 2HRRA 3RF7A 3DCYA 3JZDA 3SC4A 1TK3A 1XU9A 4N49A 4HT3B 1E1RA 3DBRA 4KLZA 3DYVA 5BW8A 1GZUA 1SCKA 2XVZA 1IN7A 3FRIA 3SHWA 5KYTA 2X8LA 2Z4SA 4YJFB 3EOBI 1D4FA 2Z1NA 3QRWA 2F00A 4P81A 3HU1A 3E15A 1XZDA 4QXOA 4XASA 5K8IA 3BB1A 3IQHX 4NCBA 2CB0A 1J33A 1O94D 2V58A 3G68A 4ZIRA 3CSUA 1G18A 1BQEA 5C35A 3NIBA 4ASUA 1ZRMA 1H42A 3VTFA 2B8NA 5JEDA 1GNTA 2ZBUA 1W5BA 5ER6A 1ILEA 3BF8A 1WP4A 3BRCA 1D7OA 1OFTA 3EGDB 4MUHA 5L9AA 4V03A 3HN2A 4PHGA 2ECFA 1YU9A 2BT4A 1EUQA 1PV1A 1PVVA 2CZGA 4X8MA 4Z8XA 4NMHA 4Z0HO 5T4HA 4D3DA 3KHUA 4N39A 2HLPA 4YUVA 2BELA 4Y0AA 4TLMB 3E5HA 3L8DA 2O2SA 1N2OA 4HB4A 1L4UA 4R0MA 5K3SA 2TYSB 3JQCA 4G67A 3ZVKA 3IAM6 3EFBA 2ORIA 2LDXA 4LE1A 1OH7A 2ZWMA 4DWWA 2VZ8A 1TC1A 1G2IA 3GEDA 3UAXA 4OKIA 3SC3A 3GXOA 5HW0A 3J7TA 4XIYA 1DQPA 1PJRA 2YWHA 4KRXA 1ISHA 1YQUA 4WBNF 5BQ3A 3HY4A 3QBTA 1A5TA 3HZZA 1CVLA 2M1ZA 4PGAA 2IPXA 2A9QA 5IPFA 4MR8A 2C5FA 1GCAA 4HWRA 3ANNA 4KBFA 1OI3A 1LJ8A 3JTMA 2I66A 1RYNA 4HS9A 1EP2B 3GQBB 2RH5A 1W46A 4Y6OA 5FOTA 2QE7D 3E3LA 4MRPA 5CG1A 2O8CB 1SWWA 1EX6A 1WUJS 4WTOA 5YASA 1Q0QA 5TF0A 1GNVA 3AUUA 4E6EA 1RWKA 2OORC 2GPJA 1G0OA 2BJVA 2PJDA 1DLIA 1GEEA 1NKSA 4R1NA 3OX2A 3VJKA 4CKBA 1LPPA 3T9BA 3IT0A 4WNYA 4AX8A 1EFRD 3HFGA 4M99A 4ZV9A 4D41A 4M36A 4DSOA 4EHNA 3EXHC 2I62A 1P1KA 3QXSA 5GADl 3R7SA 1JIUA 1COZA 3G82C 5CM8B 4NX2A 5C51B 1Q1QA 4TTAA 1CRZA 4ON9A 3UZUA 1V43A 2XRMA 4C1BA 3DVSX 1K27A 4U63A 4HB3A 3OZFA 2UUAB 2HHJA 2F3TA 5A4AA 4MOWA 4ZYLA 4CIAA 3B8EA 3CF6R 3IUYA 4WD3A 2H1RA 2I4IA 3JALA 1ZGJA 4BQQA 3GWGA 3DS8A 4G84A 1UXHA 4D0SA 1QFYA 5DWDA 1CUBA 1T3LA 2J5RA 2J9ZB 2WD7A 4CM7A 4ISBA 1DWPA 3TLMA 2X3YA 1USVA 2RHCA 4WNAB 1F0PA 1FUUA 4UUPA 1X7YA 2GESA 5FYDA 1D2EA 2UXDB 2PKEA 5EFOA 5DGHA 3C5WP 3ENQA 3FTEA 5BSUA 3LAWA 1UP4A 5IZCC 3RGWS 1MPXA 3UA3A 4F5YA 4REQB 1UM9B 1GTG1 2CJXA 1V25A 1P5JA 1GRNA 2W6ID 3FLEA 3OY7A 4FQ5A 4FR2A 4JJ6A 4YPVA 4EWLA 4LYEA 1LLCA 3FZYA 1CVRA 1VRCA 3DYBA 3T61A 4UULA 1OPRA 1VPTA 1OOEA 2W2NA 2V55B 1O9BA 1RKXA 3LWBA 3FCCA 3CUTA 3LUPA 2QOEA 1MXHA 3AQ4A 5AK4A 5IFKA 1JQKA 5FBQB 3QMWA 3VR4A 5KYWA 1K5HA 2QVLA 2F3PA 4E4YA 5U4QA 5F64A 2NX2A 3ILVA 4OXYA 1LPOA 2O7NA 3ZZUA 2QLMA 2XA1A 4RGYA 3GCDA 3QY0A 2F7SA 2I8LA 4EFLA 5FEUA 3L0YA 2YJZA 3SYTA 2EWMA 4EY8A 5CAEA 3UGTA 2AQKA 4DRXA 2XMDA 2IGTA 1QR6A 3TLJA 5IJZA 2DUNA 4X1OA 3A9TA 1CRQA 3FAKA 3LRPA 4B3CA 2PRSA 4JLPA 4OTZA 3QOWA 5BMVB 1WEHA 2E4YA 1S2NA 1MDBA 2IYWA 2LNDA 1PJAA 3GGOA 4LCJA 3DEYX 1FS6A 2OGWA 1CV2A 3EODA 2P78A 1AHPA 3ZD7A 1FJGB 2YASA 2HIGA 4JR2A 1RRVA 3O0DA 1OLUA 2POQX 3KPJA 5TY0A 3VKUA 1KVUA 1LBSA 2FLWA 4K9NA 4CM9A 1D8TA 1PZHA 3DOOA 3BIOA 3OE4A 2XT0A 4IG9A 2H08A 2HQ1A 2JVJA 3GEHA 4TTRA 5EE0A 2HMYB 4CETA 2DFTA 2WUEA 4EFMA 4FYHA 2JI4A 4WFJA 5IABA 2HJVA 1RHQA 4LHZA 1AXEA 1S3SA 2IIQA 4Y0NA 4KQFA 5IT9A 3KD3A 5JISA 2Y3IA 3IMCA 2JB9A 3BL8A 4POOA 2BZSA 4JJKA 4N5HX 3CLKA 1C50A 4MLCA 4D4LA 2ZW9A 2B61A 2BEWB 3BWBA 4N03A 4Z49A 1T13A 3FCSB 4IEEA 5GM1A 1JKIA 3DOJA 3EA5A 3FHJA 3U9LA 3DOFA 1Q15A 3WQSB 3IURA 3NHKA 3DTVD 1V6AA 3K09A 4FLFA 4X00A 3OIGA 3RYFA 4ZK6A 2OL4A 3VPDA 3VDXA 1YQWA 2DY0A 3BWDD 4KQEA 4D6XA 1LNSA 2DCMA 1QX3A 2TRSB 3BH7A 2BSXA 2PGIA 4O2BA 2NUAB 4KAJA 3RJTA 4BO0A 5EL0A 1MAWA 1UK8A 2ZSBA 1DEOA 3WJ1A 3I5AA 3X43A 1QQTA 3EZFA 1ZOPA 4CL8A 5IC6A 3FPBA 3NHSA 5TMPA 1C3EA 1NP7A 2OHGA 4LRWA 1X7ZB 4EY5A 3L7LA 4JJ4A 3QUSA 1YJ5A 2HH9A 5FOSA 3TG8A 3GRYA 1CY4A 3DZCA 4A7PA 4PYIA 1SBNE 1HETA 1GNQA 2DGDA 2WDZA 3HCAA 1LF0A 3A4VA 1E1CB 3GGGA 1XV5A 3V2IA 4A1OA 2VDUE 4GPEA 3HA3A 1WBDA 4DVJA 4G4SO 2YWCA 4CE6A 4UZEA 1VCHA 3K20A 2A9JA 2GJAA 1VBMA 4XM0A 2PGOA 5CFRA 1T5SA 5E1DA 4Q1VA 3G9ZA 3V80A 5JJKA 4LPSA 4R01A 1L5VA 1XELA 4DSNA 3PS9A 2HU8A 1CR6A 4WOKA 3OCYA 3GA5A 4KFRA 5K20A 2H59A 1EK0A 1MTZA 2G36A 3JQQA 1WW3A 3MSCA 5SYNA 3RIMA 2HCFA 2IYLD 2XWSA 4JIGA 4K6HA 4O2AB 2X5NA 2FUEA 4IHJF 1XLUA 4UREA 1AMUA 3RSSA 1ESNA 5KMGB 4QTYA 1EXDA 3T3MB 5E4FA 2YN2A 2NVWA 1N6KA 4US1R 4V02A 2YBEA 5I9TA 3RLFA 1LZLA 2V03A 3KKPA 4G0OA 2VDWB 3AM4A 4LRSB 3RB8A 1KI1A 4QJ3A 3T3NA 2W2LA 3LX4A 5LQNA 3MW8A 4XCVA 4F56A 2H7XA 2Q4TA 4S05A 1GQ2A 3O4FA 3AWDA 4J0GA 1FF9A 3R5KA 2P30A 1G64A 1EK1A 5CVCA 3ERCA 2IOQA 1NQAO 2VDJA 4Z4IA 3AKEA 4H0NA 2X8WA 3OQJA 4DLXA 2XECA 4JYPA 5DYGA 1HWYA 1QAOA 2ZI4A 4FONA 5DHQA 4ZICA 5LP6B 1JFTA 2JLAA 4M1OA 4B4WA 2WU1A 4QPNA 3WLSA 3HB9A 3OQPA 5EPEA 3I5YA 1ZR2A 1YASA 3BXOA 3NIWA 3QFTA 3KL4A 5C7YA 1Z2NX 3BMOA 1OGYA 3BN3A 3EISA 1T29A 1CZKA 3OTQA 4JN6B 1E4YA 5AW6A 4MPRA 4X6YA 1KY2A 1H0SA 5FWYA 1PJZA 5IUJC 1NRXA 4ZTBA 1ODSA 2JJMA 2QX9A 3EYWA 2CXUA 1TIPA 1P62B 1H3NA 4U4AA 2RFLA 2ZWAA 3UMJA 3ONDA 4L2IA 2H4YA 3IO3A 3OEHA 5HOQA 1MAUA 3TOCA 2QZZA 2CLSA 3MYYA 1E3TA 4GLJA 4MS3B 4O4IA 1Z6ZA 4Q1AA 3ZLVA 4C7JA 5L6MB 1ESZA 2UZ0A 1AS2A 2BHSA 2XODA 5B7GA 1BKSB 1ZJJA 3U7IA 3OJOA 1Z5VA 1FSZA 1KI4A 1L7PA 1X1TA 2XMBA 4D44A 3EGXA 3R7WB 2VPYA 1NJFA 4RTJA 1ZOIA 5BW6B 3R9WA 3KZVA 4C6RA 3FPCA 3X1KA 1DTWB 1EUCB 2JGNA 3AR3A 4CG2A 2BEKA 1NG1A 2I99A 1AQIA 3KQVA 4ZEWA 5KU7A 1E1LA 1WY5A 4GGPA 3I3OA 2W71A 1TEHA 2GAOA 1BZYA 3D2BA 2UYCA 2O8EA 1RYYA 2FSVA 3BE6A 3FY4A 3HRHA 2H5LA 3KVRA 4ENQA 2QVBA 4FP9A 4TMKA 3D6VA 1WULS 3OJWA 4TRJA 4HR7A 5C0OE 2GBIA 1UADA 3ZE8A 3P45A 4KPFC 5JAPA 1R8JA 2BGRA 1VJ0A 4OB7A 2Q5HA 1KQFA 3OM8A 3A27A 4I55F 5DZSA 1BDMA 4NK4A 5F3RA 4Z7QB 1JLSA 2PX8A 4GX0A 3C3EA 4EJSB 4UHBA 4EKEA 4WZBA 3BT7A 1X13A 3L4KA 2A35A 4X1KB 2WMDA 3ZWMA 2XUGA 3FGNA 2HQBA 4IIYA 3BZWA 1WXHA 1SOWA 1JVSA 4OXXA 4RL6A 5EE9A 3OF2A 3USES 4TKUB 1T8UA 3DTVB 3GUZA 1GPBA 3JQ8A 3NNSA 5DF1A 2DOKA 3PEUA 4P4SA 1CC1S 3PTZA 1DBWA 1UBJS 4C43A 2ZIZA 4NJOA 1HDYA 4GBMA 4RDHA 1ID8A 3NWJA 3QLUC 2ZTSA 3B6JA 2GZRA 4LK3A 5E6SB 4OV6B 4G63A 2BUCA 1SCAA 1RLOA 2WUVA 4BWGA 3I04A 4X6LA 1DCFA 3BWVA 3H5WA 3ZLTA 1T2DA 3EFEA 1SOAA 1ZGHA 4KQKA 4PR3A 2DYKA 4M86A 3FWHA 1IG3A 3OZUA 2G0NA 5E95A 3EW7A 3JVIA 3S29A 3DGFC 1PFUA 1H4SA 2I2WA 4EFDA 1KMQA 1R4NA 5G0WA 3HWSA 4LBYA 3I6QA 4PM4A 4EZBA 3IXMA 1GKUB 3WLLA 2J0SA 1JVBA 4KR2A 1FUIA 2QMZA 4IDOA 5BUCA 1AURA 1C4OA 2ZSAA 1NUQA 2PUFA 4XOIA 1I6LA 5C1DA 2B8JA 2EL9A 2ZPAA 3M6XA 3PGA1 4WZBE 3KPUA 2GCEA 4NBRA 4A2QA 4GKAA 3B6ZA 5FBRB 3SQMA 2FPWA 3QFRA 3T4EA 3I9FA 4HEQA 4ID3A 4F6RA 3CVYA 3TXXA 1TO6A 1Q11A 4MKHA 3PE3A 3ZDEA 3IAEA 2BFDB 1NSTA 3WIDA 3FUCA 2GUGA 4RYDA 4KHZA 1XTQA 1FU8A 1PWZA 1RAAA 1QWOA 4KXLA 4WSOA 3OCVA 3TM5A 1I01A 3R41A 2VNAA 1H85A 2GJ8A 1XPOA 3WLPA 4D2IA 4EMBA 5GIPE 1GZ5A 3BVPA 5CFZA 3V00A 3GRUA 4BGUA 1Z5NA 4XPZA 3N2EA 1KS9A 4BKMA 1WB9A 1JMKC 4Z7NB 3D0QA 3ACDA 1VHWA 1T0PA 3CQ9A 3FWNA 5D6OA 5REQB 1N6PA 5I9SA 4HNRA 1YACA 3HHEA 1QQAA 1Q7EA 5EYPA 3EXEB 3DDOA 1RW4A 4INAA 1B4DA 5DCYA 3LQYA 4C5BA 2IYQA 2VA9A 4B6GA 4U2CA 2I4NA 5DM4A 4V3CA 4YJ3F 2IY8A 2C0CA 3H4MA 3K0BA 1L5LA 4KAFA 3FPHA 2QS9A 4Q3NA 3LC0A 1F2TA 2LIVA 2MHCA 4R0VA 4UCXA 3WISA 4PGGA 1N9KA 1U2PA 2D7CA 1EUYA 1YAJA 1E6LA 2GTPA 3T54A 2H16A 5DTRA 1M1UA 2DBQA 3W7AA 4J9VA 2PRKA 5B3LA 2RHGB 1DARA 1NPDA 3PGMA 4K6MA 4X5OA 3QVGB 2H2DA 4XWGA 1C3OA 3HZRA 2P3SA 5IHXA 7MHTA 1O4WA 1UOQA 4ZKEA 1GTJ1 1QIDA 4I8DA 4LFCB 1FMFA 1GUYA 1MB3A 1ODCA 1N33B 1AGYA 2ISQA 1FRQA 1I5OA 2OCYC 2BGKA 2RGAA 2UVDA 2ZIXA 3BYZA 1AC5A 1D1SA 1ZXXA 3OUTA 3GEPA 1VYHA 3H5LA 2IH5A 3TQCA 5TXGA 1EG7A 1PYOA 2GD1O 2LUOA 3AV0B 3AMVA 4OA8A 3CTMA 5FPHA 4BBJA 1PBTA 3MWYW 3PXXA 1K97A 5TQ0A 3LNTA 1ZS9A 3JQ7B 1QZ3A 2Q29A 2QJWA 4N0MA 4CCYA 2IUSA 1U9IA 2X4GA 5FT9A 4D9FA 1CY8A 3WLQA 1E6EA 1T8PA 5HCUA 4RESA 2G5CA 2XJ4A 1U98A 3KEOA 1RZVA 5KKCA 5CLHA 2IUTA 1JU4A 4JP5A 3P19A 3AR9A 5BVHB 2FU5C 3OETA 3PNSA 2HWYA 4EGSA 4ENPA 1Z16A 4MYTA 1GKYA 5LQUA 5L6LB 1TCUA 4QD3A 2ZE8A 2ONCA 1CIJA 1I1QB 3H6KA 1EVQA 3CH5A 1TT5A 1WAMA 4I1IA 4K87A 2FR0A 5AOCA 5HEKA 2O0LA 1O94C 5HHTA 2JIZD 3RVBA 1N3LA 4OFBA 2OLJA 1WR8A 3N8IA 2YN4A 3NGLA 1GL6A 3QUQA 3MCWA 1MP0A 1N8KA 3HCCA 3BREA 3QKRA 3QVOA 2WWWA 1TAGA 4QQRA 2Q28A 4B32A 1NVMB 2O2IA 1G8HA 3O82A 5AJHA 4NBKA 1OA0A 2AMJA 4HP8A 3ZXYA 1HGXA 3H2ZA 4ZZ0A 3QLJA 2ZR7A 3ZIAA 4LHWA 5KVQA 4IIGA 5C31A 3EPPA 1KE2A 3NC1C 3T7RA 4XVUA 1RZUA 1RRGA 3A6KA 2ZBQA 4Q7MB 5CA0F 1JKMA 4JI3B 4AN0A 5T41A 1NJ6A 3D4PA 3UWSA 2FFQA 1L4BA 2DFVA 1KO4A 1N0UA 2BDTA 3K3PA 3RVLA 2E5FA 1BCRA 3ZCRA 5LA6B 2EQBA 4CODB 4OYLA 1CS4C 5JO0A 3E05A 5ALKA 3NWBA 1GTMA 3KB2A 3COSA 3HFRA 2QRVB 4L07A 1YS9A 2ZXEA 4FKMA 4UFNA 3L49A 3ZD6A 1TJPB 2RHDA 4UVGA 1N25A 4DYHA 4S24A 1D8AA 4X1IB 5IJ0A 2A92A 5CURA 5GP1A 2I0FA 5IRCD 5ITZB 3T5CA 3GU3A 1D2MA 1OZ0A 2ZSEA 4GX5A 2GYUA 5E38A 2VUHB 5JOQA 2D00A 1X3SA 2JFUA 3A0RB 3OT5A 3P26A 3DONA 4FOSA 2XAAA 4H60A 3TMKA 3RIYA 3RBXA 3WMWA 3BJIC 1KL7A 1DINA 2PUJA 5CDGA 2WMYA 1WVMA 2PQ2A 3T1YB 1CE8A 1TQ8A 4CIDA 4E2ZA 3NTRA 5MDHA 3RC2A 1QGZA 3CY6A 3OMLA 1DL5A 4ZU1X 5ES4B 3ESBA 1JLMA 3M81A 5KX5A 4ALNA 4M1KA 5CNJA 1C8KA 3PWZA 2LR0A 1JFFB 3AEZA 4LRXA 1GT91 4GBED 5EJEA 1US8A 4HSGA 4I50A 3Q0TA 3HB0A 3O90A 3H1PA 1XX6A 3VQTA 4O4JA 4BP8A 2O06A 1V37A 5JXGA 3MRXA 2B8TA 4IW3B 1AJEA 2O0HA 1OFHA 1UWVA 1WF6A 1M6YA 5CFOA 3E22A 3EVFA 1JSZA 5KHAA 3MN1A 3CCBA 4ZDJA 2GJSA 3LCVB 2QGZA 2HI0A 2ZBEA 1M6WA 4ME6A 5LP6C 3VPCA 2BEUA 2TMKA 1T91A 5CDUA 3DKIA 1V1RB 3K94A 4NG4A 4OQEA 1GTL1 1PZXA 2F17A 3Q6MA 1ND5A 3BD7A 5TT1A 1SKYB 2BHTA 2GCOB 4CDNA 3WLIA 4EKNB 4LY3A 4BPRA 2PUDA 2A3NA 2BJHA 2EJBA 1TVKB 4UAGA 1CIVA 5J2TB 2SICE 3IKTA 2CK3A 4LX8A 1TUBA 4ZOLA 1Z33A 4MIKA 4CFZA 1NJGA 4HRYA 4FLEA 4WOJA 3TKLA 1U02A 3AR8A 1FW6A 3EXFA 1A3CA 4RKEA 2PMFA 3D7LA 1S0UA 2FMKA 1KQPA 3TQOA 5CW1A 1BVUA 1DKRA 2FKAA 2VS1A 3DPUA 3IV9A 2RGEA 5BUQA 3I01A 5FTLA 1PLJA 4DSZA 2CVPA 3DMTA 1RWPA 1J6UA 1GNLA 3OE5A 4FOTA 4PZCA 4OHYA 1H9CA 2V0CA 2Y1KA 1J5PA 2QW0X 4HNQA 4JWKA 4P4GA 3V4OA 1Z4JA 2C8VA 3OZCA 2BF4A 2ZBFA 3U4DA 4BMXA 4E11A 4CKWA 2X19A 1CZOA 4R6WA 4X94A 4Q9NA 1EINA 4RETA 4AUEA 5GZ3A 2ZITA 4OQZA 4KN9S 4PYRA 4MGKR 4KE6A 1U8FO 2NUPA 2CHEA 4TMTA 3TLAA 4DLVA 4EKGA 1HOXA 4NJEB 5D51S 4KH0A 3PGVA 3EH2A 4RVUA 1YZFA 1AUOA 1PR3A 4LTNA 5DIFA 1V6SA 3S44A 4JGGA 3BK1A 3PPWA 1TQ6A 4MITA 4Z4FA 3ANYB 1Q3HA 1OXKB 4XTCS 5I01A 1UC9A 4DEXA 1KEEA 3LS2A 4O1MA 4NAUA 4RM2A 2SHKA 4HDMA 4YP0A 2GLTA 1OUMA 3ILHA 5JSYA 3IBYA 5AHOA 1VJ5A 4G5SA 2DSTA 3ZHYA 1ML3A 2OO3A 4DQVA 5K0SA 5A4FS 3GDWA 2YL2A 2IWRA 1VKOA 3EPRA 2A86A 2WIFA 3W5JA 1Q84A 1RAFA 1ZGAA 4WK6A 5B3JA 3FCXA 2QVCA 2QLTA 4JEMA 3WNVA 4HN2A 2MINA 2HCRA 3JZIA 1YCDA 3H9BA 3WL7A 5DN9A 3CB2A 1EKXA 4CFSA 1K66A 1BEEA 1P77A 1F2DA 1I5EA 1Q0UA 1I3LA 3DO5A 2V6GA 3P94A 4HXYA 1LJUA 3HFSA 3PZBA 4JI6B 5JYDA 4R8SA 3B1JA 1R8QA 2J46A 3UC9A 4BC1A 2W8BA 2JKVA 2OZKA 2WM8A 3II6X 4GIBA 1GU0A 1VHTA 4JSTA 2WYWA 4NESA 4C4YA 4YO7A 5F98A 3PEFA 4W82A 4Q3CA 5EE5B 1ULZA 1NJ1A 5GV7A 4QNMA 2CZCA 4RPIA 2R8ZA 2VFAA 3KM0A 3PKIA 4RLSA 4YQZA 4BNLA 1RAIA 1VL6A 4P82A 5JFOA 3N8HA 4OUDB 1RLJA 4D8YA 2UUOA 5A5FA 1X9IA 1WDKA 4EUHA 2VWHA 1EDOA 4QDZA 5FI3A 3GCGA 4MV3A 1J97A 2JGKA 3D6NB 3HL4A 2YJ5A 5HIAA 4C5AA 2JAPA 2AG6A 4HZUB 1SQFA 1J2UA 1N0IA 1VA4A 5E3HA 3PWTA 1QH1B 3HU3A 3ZDYB 2IV7A 4OIFA 2XHZA 2FPPB 4LFBB 1JR3A 4QTXA 4UHKA 5MN5A 1R2QA 1UF9A 3D8TA 3GLUA 3ULKA 1PQ4A 2QY9A 4QZVA 3QFHA 1KEKA 2C07A 1DWQA 1QORA 3B6IA 3CBGA 3OEYA 5JFTA 2CZQA 4O02B 2C7QA 5EFZA 1QFMA 3TBFA 1KQGA 2ADOA 3F6EX 3BILA 4DJDC 1GQQA 2FNAA 3GNTA 3PDWA 4GP7A 1QQ7A 1HRKA 1SD2A 2WFZA 4PO3X 4ARAA 3IEIA 3KUDA 4IOJA 2FWPA 3EG5A 2OUKA 1KK2A 3AVPA 5JATA 2AGVA 3O9ZA 2WA2A 1BE0A 4TVOA 1V7PC 5DHPA 1JG2A 3IUSA 3MXOA 3N58A 4ND3A 2XGSA 4TMVA 4C0QC 3H1BA 4FTWA 1YRQA 3A1WA 421PA 4LJYA 4MUYA 1O03A 3R23A 4EMUA 1JDVA 3QXJA 5EINA 1DMRA 2P2NA 1XXHE 4IDPA 2A8YA 2C3PA 1T9GR 1ZXLA 2R5NA 1P0IA 1SQSA 4ZEXA 1I4EB 4H1VA 3KPWA 3FD8A 4I5EA 2N3ZA 3GUCA 4KAAA 3K8OE 4RD6A 4M1MA 1WF3A 4HMQA 4E07A 2PH7A 3DDNA 2G04A 5H3HA 1JP7A 2EQAA 3CR7A 1IULA 1DCTA 3GN1A 1T5DX 4OOEA 5LQKA 5FOQA 4MA5A 2YUTA 4U39A 3PVSA 3M82A 1FA9A 5GMOA 1JEYB 2KLBA 1JR3E 2PMWB 4WLOA 1IWPB 4FFLA 4NCIA 5F33A 1UKEA 2BFEA 3R0ZA 1QWSA 2GA9A 4Y1RA 4R6XA 5BT9A 4YIHA 3H18A 3ITDA 2QVYX 5JVDB 1WB6A 4BWYA 3M6VA 1UMCB 1QYRA 3G2PA 3KAJA 4GRIA 4WLNA 3EXIB 2BSQA 3N3AC 1NONA 3OU2A 3CFYA 2IYRA 4QJ4A 3CWZA 1KSGA 1ZK3A 1YMQA 5K4GA 2VJYA 2HAEA 1XAIA 4EDFA 3ZU4A 3CSSA 4R1SA 2ZRGA 3KOMA 1J2EA 4H77A 4ZJUA 3V8QA 3C3WA 4M0UA 3GLHA 2OECA 1KR2A 5ESWA 4UXHA 1OFVA 3JZFA 3N75A 3KQOA 1FP4A 1QLWA 3MG9A 4KWTA 3HG7A 1WU8A 5A6VA 4L4ZA 1Q44A 1QHHA 4OM7A 2B98A 2VTEA 2G9RA 2JEZA 3HGTA 1AB5A 2WFAA 1RI4A 4KR6A 2JD0A 3AHDA 4Q7JB 1FU4A 2A57A 1QG6A 1BGWA 1FUKA 1R1DA 1VXOA 4H16A 2Z56A 1M0EA 4BE4A 3H3XA 2XQJA 3PQ7A 4YRKA 4M0KA 3QQPA 4DTIA 1M0WA 2W58A 3GC6A 1GKIA 5BVGA 1J8FA 2IOYA 5E1OA 5EMLA 2J0UA 4W5RA 3KR9A 3TQQA 5L4LA 4F12A 2PZEA 4UUQA 3W6PA 2I91A 5KBYA 1X7WA 5B6PA 4OF4A 2X2OA 1YDEA 5LB2A 3OHPA 1MGPA 4MDEA 2AN3A 5E4JA 4YCAA 2GBLC 2CLLB 4OQFA 3K9FC 2XB4A 2A4MA 3FPKA 3KT6A 3TH5A 5FNVA 4ND7A 2QBYA 1J0XO 1MOZA 1N5RA 3AV3A 4OBEA 4UEKA 1PUXA 5TSDA 1WSDA 3DE2X 3TZLA 1KZYC 4MB2A 1X7GA 3ASYA 4P0TA 5DNYB 1AO0A 5EIAA 4GNKA 4C4XA 1CD5A 1T3HA 3UPTA 4B4KA 3QE3A 2IPMA 3P9CA 2PEYA 3ZEIA 5DI9A 1GUFA 2PNFA 2V5VA 4JLWA 4A8HA 2HK6A 2W6ZA 4MRSA 1DX6A 2AN5A 3LQ4A 5E3JA 2OHJA 1K3FA 4HN9A 5JJIA 1RJWA 4L5AA 1C2YA 3G0OA 1IZ9A 1DBIA 1R9NA 1SHZA 3A11A 3LMKA 4LXHA 3AR5A 3VYRB 1YR8A 3A26A 2P8SA 4NCAA 3T52A 1Y8QA 2QAIA 3NYIA 2ZWVA 3QVMA 1MF7A 1FMTA 3IUNA 4DIOA 5ENVA 1AH2A 4TTQA 1N6IA 2VN8A 4YMUA 3G02A 4AJJA 4YC7A 4Z4QA 1Z15A 1AIPA 1ZIPA 2E6UX 4KMMA 2FZGA 1YE8A 2MSWA 4ZI3A 4PIVA 1LLQA 2KQUA 1PCXA 2EKZA 1H3FA 1LY1A 1KAGA 3B2QA 3TOXA 1LB1B 3HJFA 3AFNA 4GKJB 3CGWA 3NX4A 1DC5A 3ZLJA 1RYBA 2R2AA 3HBLA 3Q2KA 1G16A 1E2MA 2QF7A 3OKCA 1EH5A 4K8RB 4MV9A 5DBGA 3W8DA 2EAUA 3NALA 5E9AA 5H7XA 1Z5WA 4Y30A 4R2KA 1Z2CA 2AD1A 2BFBB 3OU6A 2JKZA 1TE2A 2XRYA 3R6WA 2AJBA 4J2TA 4M9QA 3GJ0A 2PKQO 4RV4A 2WG1A 3FM9A 1UEJA 2MT9A 4B79A 2RH9B 2WM9B 5DYNA 3BFPA 1WHTA 3DF7A 4DV6B 4U3JB 3HBAA 2Z09A 4AQ7A 3BTOA 5K3BA 3RYHA 3WFJA 2O7RA 3GEIA 3LXUX 3VMFA 2ZRJA 4CKYA 4F9FA 2ZR9A 1RP1A 1Z2OX 2EG9A 1OLXA 5HILA 4EECA 4QRDA 1MD9A 1NNI1 2O7VA 3ELBA 5EMMA 3ZHBA 4ZPJA 2PZGA 8MHTA 3H8WA 2C54A 4RF3A 1SXQA 5KNDD 5LU9A 1ADCA 5C8YA 1UPXA 1WPGA 2JA1A 2MU1A 2R4TA 3CN9A 4YEDA 5M04A 1DAIA 3EMVA 2ZI9A 1MAVA 1CULC 1DO2A 5DHTA 5HKKA 2RSLA 3PX2A 1JLHA 3QMVA 4HNSA 3QKWA 4GVPA 3C3KA 3SYLA 3UJAA 4AKEA 4YDRA 4BAGA 3EY9A 4Q9KA 1VKNA 3WG9A 2E3JA 5KYXB 3G9UA 4ACAA 4OXKA 2QORA 3D31A 2I3AA 1GTRA 4CKEA 1GYQA 1Z36A 2H92A 2PUCA 1UBRS 1SD1A 4IQ4A 4IIBA 3M4XA 5CT8A 3NANA 2ZJZA 3GPIA 1VE3A 5K4AA 4K1XA 3ND9A 4RJLA 3KQTA 2BMVA 2BZGA 4KQHA 5D5HA 4MUAA 1GG8A 2PUVA 3V9PA 3OJFA 1PT8A 2FVYA 1AN0A 2GUWA 4GI7A 3DE1X 2GSDA 2QP4A 2AXPA 4YMSA 1CJKC 4A6XA 4N0QA 1R18A 5KYVA 3ROEA 4DV1B 4GOKA 1Q50A 2PKWA 3REFA 1ADGA 1JWBB 1QQ6A 2C78A 2PXXA 4N0EA 3HFJA 1IJKA 4KX5A 3L6BA 3IEXA 5GY7A 3WDKA 5BPFA 3CONA 2FSSA 1HKUA 5AM3A 1P8AA 3B9PA 3H5VA 1MH9A 4HH3C 2IJGX 4M3NA 1QO0A 1U6IA 4BDSA 2Z2XA 4IJUA 1JILA 2BTOA 2XEXA 3EVDA 4D0NA 4IDCA 4IDFA 3DTYA 5KAMA 4IKPA 1PG5A 4IV5A 2DJ5A 3NDIA 4M55A 1GPNA 2BCEA 4PLVA 2AOWA 3HSSA 2GPNA 3T6KA 4DDHA 3GJRA 3M5PA 2O2JA 1XZIA 2DHDA 4J0DA 2VHUA 3NPMA 3ZWVA 2AV6A 4G8JA 4DANA 3DOCA 1DFGA 3FTQA 4KNYA 1SIOA 1LI4A 1M2FA 1Y6JA 2BVNA 1S5PA 1SB8A 4JELA 1BHO1 1N3YA 4KL8S 1NVFA 1L7AA 2G67A 3W78A 2AOUA 3PPYA 2XBLA 4I9UA 3SR0A 2X9LA 4S2EA 2OHHA 3PE6A 1DBVO 1OROA 3D7NA 3QF4B 4Q3LA 2WINI 3C3BA 1FTWA 4HXFB 3SZRA 4E46A 2JCYA 1OGJA 1JNYA 4MX8A 4ODIA 5DN6A 2HK9A 4BEJA 3VNQA 3SKVA 2OHFA 3VVBA 1X1AA 2RONA 3NS7A 3HUEA 3AI7A 4HQNA 4MTLA 3ZDZB 1YXMA 1AKUA 4A2CA 1JIKA 1NP3A 5KDOA 2JGAA 1CK4A 1XVAA 4RIGA 1JBEA 4MR9B 2IP2A 4XGNA 3RHSA 2C4UA 1BFDA 4RVDA 4YI5A 1SBTA 2ZAOA 1FNDA 2C98A 2A30A 2FZKA 1QUFA 1EUDB 5I3CA 4AMZA 1YCGA 2QQEA 3IPYA 1J42A 1ZN9A 2VH1A 4H6VA 1FJXA 3F96A 4DDMA 3EFOB 1JEOA 4HJRA 4EHIA 4IS3A 2X8JA 4I66A 4PLGA 4BV3A 4WBNB 2PSHA 3QV1A 3FHOA 3X2EA 4ARZA 1WCV1 3A6FA 1UKVY 4R2LA 3VC7A 3VR6D 1BMFA 1XO1A 4XDGA 2XUZA 3A70A 3UJ8A 3IAXA 1W96A 3E18A 4GM0A 4GQIA 3CUUA 1KORA 3ZNOA 4RNCA 3U4MA 4NXMB 2DE0X 1E59A 1K4MA 3UT5B 1VPDA 5CBKA 1BN6A 2Q27A 4PG6A 3WWYA 2IBTA 3N2YA 3X3HA 2ZRQA 2ZUBA 5C18A 1Y82A 1GU7A 2QL5A 3KQWA 3AOEA 4QC2A 2NUTB 4BFCA 2OXEA 3F6RA 1GUDA 2WHPA 4P84A 3HXOA 3KFVA 3Q15C 2AZ4A 1USUA 1YRWA 1HNWB 5L7YA 3V4SA 1T3ZA 2WJ4A 4EI2A 3UHAA 3AKYA 4AFNA 2P6NA 3WSVA 2FEXA 5A1TA 4HB0A 3WWPA 3TK1A 4KDEA 1D1QA 3AI2A 3FI0A 3IVXA 3QOFA 1FYEA 5E7QA 4EHLA 3A3PA 2IQ5A 2WPDA 3EA4A 5BXQC 3AFGA 1YHYA 3NO4A 1VJRA 3K31A 4JZYA 3AESA 4DG5A 1DE0A 1P4GA 3K5PA 3KUKA 3GRFA 5K0LA 3WTBA 1JHDA 3EGVA 3L0PA 4DCVA 4NU8X 5KNLA 5HZMA 5M2QA 3W0LB 2LD4A 2HPHA 1JBKA 2PMCA 2CL6X 2RH4A 2QY6A 4OYYA 3EARA 4QFMA 2WWFA 1RZRA 1DRUA 1JG7A 1VMIA 1PI3A 4DGQA 1MO3A 3ZV6A 2A1UB 3WB1A 4A8JA 1VM6A 2CSUA 2SKCA 1E9FA 4TKLA 4XUEA 2WIBA 5FOVA 4JV5B 3JWHA 4YALA 4EGCB 1TU4A 1ZUNB 2G80A 4MP8A 4AG3A 2VVTA 5BNZA 4A1FA 4B6PA 5CCBA 3K4HA 3QKUA 3WBJA 3VKWA 2FSGA 1P3DA 2GASA 4CR6A 1M54A 1T9AA 4QHYA 2CWWA 2QYOA 4NZMA 3QX7A 3W1EA 4OQDA 4K6GA 3DCIA 1D07A 2VJCA 4RMHA 2G3YA 2NTYC 4S1NA 3U49A 3R9XB 1Z45A 3MINA 2J7PA 3D8SA 3DLAA 3N87A 5T3UA 5ENZA 2B35A 3P9XA 4LV6A 1R0RE 4Z99A 5HIIA 3L84A 1FXSA 1VIAA 4HAZA 1IEWA 3KZCA 3HEAA 5ALOA 3W2GA 1C3JA 1YZNA 4I19A 3MLAA 3OCWA 1GQSA 2J0EA 3AVOA 4ND8A 4QLBA 2NSLA 2OM6A 3O3CA 1SUWA 3SE7A 1MQ8B 2DPGA 2WZDA 5HDBB 4OP2A 4AB1A 4RH0A 3RVJA 1KZ6A 2JFFA 3IO5A 5DX8A 2W90A 1L4MA 3NFRA 3EVCA 4HGZA 4ND5A 2VRWA 4XQ9A 3VR1A 3JWGA 1ZCBA 4CMAA 3ETLA 1M33A 1P29A 1JFVA 4WDQA 1CG6A 3RU9A 3CW2A 1K7EB 1MBZA 3C7TA 3N59A 4U0JA 3GDGA 4B82A 1YRAA 2VNSA 2XTJA 3TRJA 2EZ9A 4NF2A 1GUAA 3AUKA 3VTKA 1IBLB 2C95A 5FLXA 3WNZA 4YWHA 5MGNA 1NC1A 4GLOA 2PD3A 3E5NA 1K06A 7AT1A 1PR5A 2X4LA 2Y6VA 4P58A 1DJNA 2ZYUX 4X6XA 2I2XB 3UA4A 4NDZA 1DXOA 1ENPA 2Y1WA 1QB7A 4MGZR 1S3FA 1QBGA 4INPA 3MBIA 4RENA 1UJBA 3NHFA 1DG3A 2C7BA 2X0EA 2M6SA 1W0KD 1QKJA 1XDGA 3OC6A 4Q24A 4C4AA 5A9SB 4MPJA 4YLEA 3O73A 3SDSA 4HBZA 1J1IA 3RFCA 4KITB 4F0JA 1F0NA 3TTUA 2BTEA 1F14A 1Z0UA 2FEOA 2CB9A 2Z08A 1L5RA 5A71A 3DQZA 3F9CA 1N34B 1DEAA 5CDSA 2QM8A 1I13A 2MYPA 3LQ2A 2OHVA 1WDLA 3FSGA 1Z4KA 4YROA 1TUGA 1A71A 4U5XA 5I9IA 1KOJA 2QN6A 1NDQA 5AI5A 2IODA 1W2WB 4BYMA 4BKQA 4AJOA 4AKTA 1P2SA 1M2HA 2GXQA 4IHJB 4F85A 5L51A 4WGGA 2OK8A 4A0FA 4XX0B 2GN9A 3IVMA 1M7BA 2PFKA 1RXUA 3IVGA 5AXDA 4OBXA 3VRHA 5LLDA 4PU0A 1T6YA 3S1AA 1OLSB 2IYSA 1FYFA 4PC3A 4P92A 1NN3A 2PYDA 4AZ0B 2BMWA 3ZXSA 1L5FA 3BMNA 3H83A 4BXOA 2ZZMA 3LWNA 4PN3A 3DVLA 2JC3A 1D2CA 1JG6A 4V0NA 5K2MA 1CHNA 1NOIA 1ZGBA 1AB6A 2JLWA 1OPXA 1G63A 3B70A 1LU9A 3OIWA 2V7QD 3WL3A 4RZHA 3FNFA 4GZMA 5K0FA 3ILYA 4DR7B 3MJSA 2VHWA 5AT1A 5BQPA 4E51A 5FI5A 3DP7A 3OM1A 3P4UA 1IHPA 4KPUB 4TLAA 5I7SA 2EZ4A 1CDZA 5DBHX 1B6SA 1A27A 5AUPB 2CDAA 4RVFA 4YT5A 4UPDA 1O2DA 5LNK6 1XDDA 1DQYA 2JFBA 2YV5A 4H3VA 3OPYA 1GZHB 3TPCA 3PC8C 4QICA 3VR6H 1Q16A 3BXFA 4DJEC 3DW3X 4L8GA 5EIFA 2E2WA 2J0QA 4Q03A 1GFZA 1GZ7A 4ZD6A 4EZIA 5KSOA 2P5UA 4RFSA 2HPZA 1MEEA 4D0GA 4Y2UA 1M2OA 3AEUA 1AZLA 3R5FA 1NJ5A 3VGJA 2L42A 2R7KA 1GQOA 2BFFA 5DYWA 2V7BA 4M83A 1GGFA 4BQPA 5F5LA 1I32A 3TSYA 3D3KA 1ZA2A 1ESMA 1T43A 4GW3A 3OZVA 3M1IA 3Q11A 2G7MC 3FF1A 4RZXA 4DLAA 4GZLA 3NKLA 1GA1A 2W0MA 5DNAA 1I3CA 1SAYA 3NHWA 2O3UA 3WE7A 2EARA 4URWR 2GZ1A 4H9GA 5EWLB 5J2UB 1DZIA 5K5EA 4YRDA 3PIRA 5FWAA 1SWVA 3GJTA 2VPIA 4PICA 1PFGA 1GRRA 1ZUHA 1T9GS 2XKJE 4GM1A 2GGSA 4RD1A 1Y5RA 4ECAA 5INTA 5JT1A 3KJFA 1GM5A 4DM3A 1NNUA 4XB6B 5KNBD 3PJGA 3EPHA 4AY3A 3H5IA 5H82A 3VZCA 3CE9A 4CEHB 2Y1DA 3DUFA 4MKFA 3BERA 1VIMA 2IXFA 1MC1A 2B0JA 1Y9AA 2BKUA 3S8MA 1PNVA 4RVCA 5EVCA 1ECGA 3IBTA 4WE3A 3TL6A 1NUUA 1E7SA 1SU4A 1JEEA 1EWTA 2CXRA 1KYTA 3HJBA 1L1EA 1SFRA 2Q6VA 3HM9A 4RV5A 1AU9A 3LDGA 3ZHTA 1S9HA 1V5EA 3E81A 3H0KA 4K0RA 2B4KA 3DXFA 4PYKA 1ZK0A 2KPOA 3UN1A 1E2DA 1C9YA 1RWMA 5A02A 4ZV7A 1QTRA 3LUFA 5AJZA 2O0MA 4WDRA 3W3AD 5MFZA 3RREA 3G13A 2XDQA 2XB2A 2WC1A 5KZMB 3RAGA 3CVUA 3IPRA 2OESA 1M6VA 2AWNA 4FSHA 4PZUA 4D4KA 5BWCA 5KOHA 4RSHA 1A9XB 1AK2A 2Q5FA 3I58A 3ORSA 2X7JA 5FA6A 4AZ3A 4BBAA 1XZHA 1J8QA 4UMEA 4FMBB 4Q3KA 4RDXA 1CUVA 2HK7A 3IP6A 5ERYA 3TFQA 2ONZA 4PLYA 3VFDA 1K9SA 2ZSJA 1ISMA 1C0LA 3KKOA 1NDHA 4IIJF 2H07A 4K28A 1WS6A 3SJ7A 4WKNA 4TYPA 1YL7A 5AUNB 4IYRA 1R4AA 2FP3A 4FKBA 1O6ZA 4GWLA 2Z1MA 4Q7QA 3WYEA 5BV0A 3GT0A 4HAOA 3I23A 1ZCJA 1C0KA 3OLWA 4FR0A 1E8NA 2WE8A 4TROA 3CO0S 5D85A 2IUUA 1SVUA 2B34A 4DA4A 4WFQA 2I7XA 1VSQA 3AXSA 3KSRA 4GGMX 1JA1A 4NXNB 1TM2A 4H0CA 2FQYA 4ECEA 2BMJA 2QM0A 4G0WA 1OAKA 3LRXA 3MVEA 1IHDA 5HIJA 4E14A 2QD3A 4FYVA 1M72A 1FJ2A 3PXEA 3BA6A 2HJSA 1YTLA 1JAYA 1SZJG 2P2DA 2W5UA 4Q3OA 1Z7WA 2OV1A 4O3MA 1Y1QA 4LGYA 1Q0LA 2KS6A 3PNOA 5D3ZA 1C9DB 2VATA 1IY9A 2O23A 3I28A 3LT5A 4FGWA 2EW8A 4RWEA 5BQOA 5C37A 1TCCA 8OHMA 3MNFA 4BPBA 3PF9A 4KJXA 3CX3A 2P6OA 3IVAA 3K92A 1J70A 3KQYA 4RA6B 5CXUA 5KTSA 3DDSA 2JHPA 2QMOA 3JX9A 5J2UF 2GYVA 1HDOA 4MWCA 1RHRA 3L8CA 4PWZA 1F60A 4CL3A 3F4LA 2O48X 1Q19A 3NM6B 2XBUA 5ES3A 1SVLA 3FPFA 2H4XA 1QE0A 1U5AA 2JCXA 1J99A 2ZYVX 3OO1A 3MCAA 2QE6A 3IHWA 5FUBA 5SY4A 2ZJOA 1S4MA 4JCOA 5FX2A 4M76B 2RB4A 4WECA 1N75A 3VR2D 1Z62A 2V4MA 3I42A 1U8XX 1LBHA 3VSCA 1JV2B 2C3OA 1U28A 3FJYA 4XYEA 1GVHA 4B3FX 3D4NA 2VF7A 3NTQA 4DC9A 1OA1A 3OUUA 4LG1A 5JWHA 1P1FA 4EZEA 1YJCA 2XDAA 2XBMA 3MCVA 2DC1A 1ZITA 1OILA 3WQRA 1P1HA 1K8ZB 3IMGA 2Q5QA 4P80A 2ZIWB 5KOIA 3ANSA 2OAGA 4AUNA 1RQNA 4YJ3B 1QB8A 3KJZA 2C5EA 4W1SA 1MQSA 3IUQA 3K0AA 3L5OA 3OE7A 4TGLA 1QH8B 4X90A 3WV5A 1KBOA 5ED4A 2TECE 3KUUA 5FXMA 4UU1A 3TQIA 2NZUG 2IF0A 4M6WB 1PQPA 5J5AA 1UEIA 4PS1A 1KYYA 3CLSD 1LEHA 1P33A 2AQIA 1PEDA 3DMFA 2RGGA 1PNTA 4YP1A 1RCTE 3EEYA 2OQVA 4AVYA 2GA8A 4G0QA 4IDAA 1PO7A 4GVLA 1QUEA 3DAYA 3EMBA 1P0FA 5AJUA 5KCZA 1QIFA 4X84A 3PHBE 5H3CA 1SKAA 4IQGA 1Q0ZA 1S4QA 2JA2A 1S02A 1IOWA 1U6JA 2AQHA 3SZMA 3OOSA 3UH0A 3C74A 4WXMA 4D9NA 2ZRIA 1PV4A 4FB5A 4Q7KA 3FDZB 3SXUB 1RC1A 5AUOB 2H4ZA 4KQXA 3CH4B 2D3WA 2EQ5A 3DM9B 2E49A 3INRA 3PA8A 1IDN1 2EL7A 3FDJA 4OIMA 4QU5A 3GG9A 1N6LA 4UVHA 4D6PA 2Q5JA 4FJ0A 2O1WA 4WGFA 1Y80A 4GI3A 3KKNA 4NNOA 3TD9A 1ZD2P 4FKZA 3MMSA 4YFYA 3RPEA 1FW8A 1FS5A 4WH0A 5I9MA 1K86A 2UZIR 4G81A 3G8DA 4PIPA 1AKTA 3DV0A 4NG5A 2IW3A 3R74A 4Z1OA 5I9NA 4KV7A 1R5BA 4LMBA 4E03A 3U3ZA 5JAMA 1Z6QA 5JDCA 1H2EA 2J7KA 2R8BA 1LVHA 4YB8A 3UJDA 4E5PA 2X1LA 4DR2B 2WQ7A 1P9WA 5HJEA 2AB0A 3UK7A 1HZZC 1YV9A 4GFDA 4DG8A 5LQMA 3NTUA 4WKPA 2QX8A 5H70A 3V5NA 1E32A 3R5SA 1LX7A 4MWSA 3L1KA 3AEKB 4DB2A 4XWAA 3JSAA 4X7RA 2FG5A 1BKDR 4Y9UA 4C0BA 4CL0A 1ML4A 4DMRA 4NCKA 2NZWA 1V16A 3KSAC 5CA0B 1NOKA 2VEOA 4PRZA 4MICA 4CKZA 4Z86A 1XYVA 1VE7A 2J41A 4C2UA 4BV2A 1G7CA 3EVZA 2PM8A 1HG0A 3FB1A 3K2QA 3KZOA 4ONEA 1NR5A 3UK6A 5IBCA 1U3CA 5BYAA 1OU4A 1E3SA 3JZAA 1JHPA 1DO8A 4RAOA 4LC1A 1JXOA 1GVNB 3AWIA 2D5LA 4Y2GA 2VJMB 2VTDA 3HI6A 5JY1A 4JI8B 6ABPA 5KNBH 2Q46A 5AKJA 1ZIOA 3PLAE 3TFOA 1FTNA 5BSKA 4ZMBA 2B2XA 2OWDA 1W5AA 1ZESA 4FFMA 1JIJA 1YSCA 3PCRB 4W1QA 1L8XA 2R85A 1U0RA 2HSZA 4TTVA 5D00A 2F2TA 2HXGA 3OSZA 4OJQA 4OQPA 2JGRA 2NT4A 1J5EB 3VH4A 3VMMA 4WKOA 4KN5A 5KJCA 1VG0B 3NV7A 3R3YA 1GGVA 3U4GA 3VZSA 4WEQA 1R3UA 3KE8A 4NWIA 3U4QB 3W3AH 5B4TA 3H5RA 3CLRD 4GF5A 4MGHA 1XBTA 2LWIA 2WK1A 4XVQA 3HYCA 4U00A 3R0VA 5BSRA 4HHEA 3VPFA 4UPVA 5JCJD 4N5LA 2XCOA 2XCSB 1Z08A 3LYHA 3EGWA 3O83A 3HRIA 4HYQA 4HXGA 4MK4A 2V3WA 3VHXA 2V3CC 3UHJA 3NIGB 3FX2A 3K7EA 4KXYA 4KQMA 1GCUA 1K7XB 4YJ2A 5F4BA 4COKA 1CR0A 3RRZA 4LJ8A 3L07A 2QVGA 4AJHA 4GGOA 3DTTA 3W90A 4KACA 1U3VA 3TDKA 4EA8A 4NNJA 2AXNA 1X7HA 3M6UA 4MEBA 3SYRA 2AFIB 4OAQA 1EM8B 4V1CI 2W2XA 3CO5A 2J3EA 2DKOA 3QKSB 3JQEA 3Q3GE 1E98A 1W4CA 1QG2A 4C7BA 3VNVA 3CCFA 3QX8A 4B75A 1Q0PA 5BR7A 2NU8A 1EGVB 2G72A 3HACA 4E7OA 1BDIA 4EG1A 3L8GA 1C8LA 1UUFA 4L02A 2Y6UA 1F1JA 3Q8LA 2V1UA 1M1YA 2GSWA 1UOEA 2JBHA 3FKJA 4TWIA 3T95A 1EIWA 1SUIA 3ZE6A 1GA4A 2X0IA 4P35A 3FF4A 2YXLA 4OGWA 4UUMA 5CP8A 4IHQA 5F5XA 1QDEA 3LPDA 2ZCJA 3DOHA 1UWCA 5EMKA 2I3GA 1Z13A 5JCOA 3ROQA 2WJZB 2AX4A 4M8SA 3CMCO 5AIBA 1CLEA 1BWPA 2VF2A 1O5OA 5K2OA 2ZR8A 2F1HA 4L1KA 2PS1A 3P32A 4RY9A 2PE5A 2ZB7A 4A92A 3OZGA 4OGGA 1KYXA 1NTOA 4YMGA 5IK2D 3R5JA 4TQAA 4JI1B 3EH1A 5JZ9A 3UKJA 3IDSA 1NYQA 1CUUA 4W5JA 2A5YB 4A0RA 1FLDA 4LOLA 1UQTA 3COZA 4ZCTA 3GJ4A 1IIBA 1KHTA 3ADPA 4HXEB 1XC7A 4V0MA 5DI3A 1QVAA 3X2SA 5JZMA 1VI6A 3CR8A 4FYMA 4S0ZA 1XAGA 4HQ0A 4Z8YA 3VNBA 4X63A 5K0ZA 2PT6A 3FZNA 2IYOA 2YQ5A 4JXXA 1JLLA 3BK2A 4YY3B 4YP7A 4B80A 1WXGA 3HPQA 4PZAA 4AY2A 1ANKA 1G6Q1 3FRJA 2H54A 1N1EA 3OCJA 4O25A 5IUKC 3TQSA 1Q14A 3OZAA 5J4YA 5LIPA 2G9UA 1NTRA 1XQWA 2J6CA 3AR2A 3IOYA 4RY8A 3S8EA 4IFIA 4RXUA 4FI3F 1Z5ZA 4UARA 1YI0A 4BBPA 1KSFX 1KO1A 1Z07A 3TQTA 1OBVA 2B3TA 3U44A 2GKOA 1QGYA 3AL0C 3NV9A 1FDOA 4WFKA 3LRTA 1M1YE 1V8ZA 2R65A 2ETXA 1VHDA 2IDMA 5K3FA 3TB6A 1QZTA 2OORA 3ADCA 3H1AA 3NEAA 4BJ5A 4OHRA 4H6XA 5JQGF 1CEQA 1G4UR 5F9MA 4L9RA 3K96A 2VAPA 4ZRMA 3E3NA 3EXHA 4A6PA 1C30A 4Z9FA 2I87A 2FMXA 2Y1GA 4X65B 2H1LA 1KEVA 2H5JA 3GUVA 4GBJA 1VJTA 2HT1A 1ZH4A 4Q3AA 3O4RA 4W8GA 5EIOA 2FQWA 4DE5A 2Q8QA 4TZ0A 1YBFA 1QYVA 3UAYA 1ZR4A 1Z2EA 1SO8A 1RVV1 2ETVA 1W0JD 1DTSA 3NHLA 3DAGA 2O3QA 4RANA 3OQMA 3ZHQA 2PRZA 3AHFA 3WK5A 3VI4B 2XCTB 4MO2A 2VDNB 2Q41A 2EF0A 3AUXA 1QV9A 4V0ME 1E9SA 2M98A 1W44A 3CZ9A 4YIKA 5JPIA 3ANMA 1XEWY 2R25B 4KWEA 4D8XA 5JQWA 3HKDB 2H7YA 1WXDA 3JQ9C 4KK3A 1MO2A 3V6LA 3D0RA 3K9QO 5AQ1A 3T5TA 1NY5A 2O07A 2P9BA 3ASZA 3PEVA 1YGPA 4PSDA 3WWZA 2V7VA 2CDRA 1X2EA 5DVZA 4ER6A 2KI5A 1V95A 3LUDA 2RGUA 5T67A 4B2LA 3U7GA 4IF4A 2JI6A 3R3WA 5G0VA 3VZRA 5IZCA 1U0HC 2FMTA 3IQWA 4OP3A 2ZRFA 3UMFA 1XDZA 2AZDA 4Y6QA 2HADA 2OFPA 3IKLA 3L6EA 4EP1A 3THXB 4BO2A 1B8UA 4NV1A 2GN8A 4HMOA 3P8ZA 1JIXA 2PZAA 1W35A 2XYGA 3O7MA 4GL2A 3GLGB 3H1TA 4GNRA 5E7MA 2ZI6A 4ITRC 1JU3A 3CZPA 4UJ3A 3RTAA 4DRYA 2OUIA 4QNRA 3W05A 4C07A 2IHJA 1MB0A 1MX9A 5DYYA 2H3EA 1G1AA 1T4GA 1W2HA 4EUEA 4O2RA 5FWXB 4A36A 1W4RA 2R1VA 3AETB 2FWNA 3OICA 3JWJA 4MQFB 1KZ4A 4NBUA 4R68A 5TPZD 4WZAB 4CT4B 2VPQA 1I80A 5BV7A 1U2ZA 4GP9A 4GPD1 1E1NA 3L9WA 2WV9A 4J0IA 2QD1A 5AVKA 4EATA 2P4QA 1ETHA 3KWFA 2O57A 3PEWA 5AI9A 1ENYA 3OT1A 3ZLBA 4UHCA 1V0JA 3C3PA 4GXQA 4K7JA 1E66A 3UKOA 1FFBA 3U7EB 2V5UA 4MV0A 1WCXA 4ZC8A 5T64A 2I4OA 2MMGA 1SOMA 2GEVA 2J3LA 2PQ6A 3L18A 1ISSA 1XP5A 4JC8A 3NWEA 1OX4A 4G4IA 1FMLA 3KYCB 1IN5A 1IZZA 2BMEA 1O54A 3JQ6A 3MTIA 3QW4B 2NO5A 3SWWA 4DF3A 1E3IA 1K7FB 1POXA 1RP7A 1R6TA 1VMAA 3PQCA 3BULA 4GBGA 4KR0A 4Q9DA 4OHUA 4QGAA 1NC3A 3K1ZA 3UK2A 4D92A 3KFLA 2VH5R 3HDVA 4AWBA 4I1UA 3LA8A 4AIIA 4E1VA 1X9GA 1L7OA 4KZKA 4YAEA 2J32A 3ESXA 4YWJA 1A5BB 3R9IA 3PX7A 2BR3A 4GPIB 2HTFA 3GT3A 5AKXA 3ZE9A 3BE5A 1I0ZA 2IELA 3I04M 5ALJA 4RQUA 1DCKA 4ZI7A 1XYYA 2B37A 1WMBA 4JJ8A 3FVWA 1FUYB 1Y1TA 2BM8A 2XLCA 4F84A 2Y67A 3AHHA 3T8YA 4F1KA 1JIIA 2FUG6 5AK0A 5AVZA 2NTEA 3F49S 4ER7A 2C92A 2GQ0A 1OJLA 3ETEA 3NASA 2C1ZA 4B3BA 3GP8A 3VDRA