5BQUC

Crystal structure of ha17-ha33-lactulose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
144
structure length
144
Chain Sequence
b'VERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HA-33
publication title Inhibiting oral intoxication of botulinum neurotoxin A complex by carbohydrate receptor mimics.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Protein binding
total genus 30
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5bquC00
4P0LA 5BXTA 2GO2A 1G9AA 1BARA 5B2HA 2IHOA 1G9BA 3VT0A 5JLVA 4ISRA 4FVVA 2D23A 3IIRA 1TWMA 1XYFA 1BLDA 4KBBA 2DRYA 2Y9WC 3A23A 4G9NA 1PC8B 1II4A 1FQ9A 2NZ9A 3JUTA 2ET2A 3VUOA 4ZBVB 2DREA 1RMLA 1AVUA 3WINA 3BAHA 3KMVA 2Y9GA 1BFBA 1AVWB 3SNVA 2F2FA 1DZDA 4GAIA 3O3QA 4QKSA 3N0KA 3CA1A 1EVTA 1BA7A 1S0GA 4GOYA 1Q03A 4ISQA 3BX1C 2D24A 2Y9XE 1R8OA 1YXWA 2HZ9A 1ISYA 4JRAA 1DIWA 4G9MA 2WBCA 3HN1A 4J2XA 1S0DA 4L4HA 2IWTB 4Q91A 1W3GA 3OJMA 6I1BA 1FN0A 4R6UB 1G82A 4IZXA 3VSZA 4I4YA 3MALA 4DENA 2P23A 3CRIA 1OQLB 1UPSA 1PWAA 3W9TA 1HWOB 1M2TB 2ZQOA 4I4OA 3O4DA 1KNMA 4Q9PA 21BIA 3WMUA 3BADA 1TP0A 4QC4A 1XHBA 4LO2A 3CU1B 1FWVA 3B9UA 3PUBA 3A22A 3AKFA 2F8XC 4GAFA 1JQZA 5F8YA 5BXSA 2NM1A 4USOA 3N7MA 4I4UA 2HWMA 2D20A 3WMVA 3UJ0A 3A07A 4JP0A 4EKXB 4P6AA 1JT4A 4IZEA 2E4MA 5F8SA 3NBEA 3WO4A 1PUMB 5BQUA 31BIA 5D62A 3H6SE 5DZUA 2DRZA 3BAVA 5F8WA 2D7IA 3BAUA 5EG6C 5BXPA 4QO3A 4D0TA 2XOAA 1TTUA 2NP0A 3RTIB 4Z8SB 1E0OA 3R4SA 1ISZA 4LO0A 1SR4C 3FJAA 5BP5A 4KC3A 4I4RA 1IILA 4LO7C 1JT7A 3OBRA 2HWAA 3AKHA 3O49A 1HIBA 3O4CA 4IY9A 5BP5C 4XFTA 4I3NA 3OGFA 4LO1C 1DLLA 4G1RA 1BFCA 3O5WB 2K43A 4KEIA 2R9KB 2FDBM 1MC9A 2D43A 5JMCA 1PUUB 4KEJA 1ISWA 4P0JA 4XFSA 1AVAC 1VCLA 2MLLB 3NJ5A 2LIQA 3TC2A 3FJCA 3F1RA 4XFUA 4QBVA 3VWCA 3H6RB 1V6XA 1ILR1 3IM5A 1AVXB 3P6IA 2AFGA 4X39A 3BB2A 3RMXA 3UD9A 4I4XA 3FJKA 1L2HA 1DQGA 4HJJA 1DQOA 3D7WB 4ZOTA 1TIEA 4OEFA 2X2TA 4XKIA 1S0CA 2UUSA 4A7ZA 1S0BA 4OWJA 2ESUA 1YBIA 4OWKA 2MC2A 4DCKC 2AXMA 1CVSA 4USPA 1FV3A 3V0BB 3CA3A 3AH1A 3WINC 2WRYA 1TOOA 3BRFA 3NBDA 4L4IA 3NBNA 3FJJA 3BA7A 3WO2A 2F2FC 1FWUA 4H9WA 3FJ8A 4I1EA 4J2SA 3OGGA 3RSJA 1NZKA 2X2SA 3IM7A 3FFZA 2Y9FA 3H6QA 1QXMA 3PHZA 3HOMA 3UDAA 4I0YA 4JAWA 4JKXB 4QD2B 3Q7XA 3R4UA 2VUAA 4ENDA 3I29B 3CQAA 4I2SA 3BA4A 3HALA 4EEEB 2J3PA 4Q9GA 1TFMB 3F62B 3VT2A 5E24E 4EFRA 1JLYA 1WD4A 1FMZA 3O4BA 3LLPA 2VLCA 4ZFUB 5DSSB 4IY8A 2I1BA 4WBCA 1M16A 1W3FA 2VSAA 1IRPA 1DJSB 4PC4A 4P0KA 1Z4SA 4D8HA 3FUOA 4D0ZA 1N4KA 4J2YA 1BASA 4LO2C 3AZWA 3EF2A 3BAQA 3JRRA 4DEPA 4LO3A 3T8SA 1J0SA 1K5VA 5EC5A 1JTCA 1F31A 5BVPI 4QKRA 2DS0A 2LIEA 1ONKB 3E8LC 3BRGC 2E4MC 3BAOA 5G00A 5BQUC 3ZC9A 2NVHA 2K4AB 1WD3A 3C9ZA 4IONA 3P53A 1NUNA 1V6WA 3I2AA 3H6RA 1Z2VA 2FFUA 3K1XA 4OWLA 3UD8A 3P6JA 3BAGA 3CRHA 1V6UA 2ZR1B 2Q3NB 3V0AB 4EFQA 7I1BA 3Q7YA 1AXMA 3ILAA 1W3AA 3ZC8A 2D22A 1P63A 4LO0C 4ZLBB 3AKGA 3BTAA 5DVHA 3QR5A 2KI6B 1DZCA 2D7RA 4I4VA 3V79C 1DFCA 1RZOB 3AJ5A 3FJDA 4QALA 1V6VA 4AN6A 3NBCA 3HSMA 3BRDA 3V0BA 3A21A 1ISVA 1GGPB 3AZVA 4GP0A 2ZQNA 2MIBA 2AAIB 5FNXA 1T9FA 4IQPA 1XZZA 5EHAA 1I1BA 1MD6A 1XG6A 2KLLA 4G6MA 4X37A 1HKNA 3IM6A 3Q7WA 3S8KA 4ZGRB 8I1BA 3FUQA 1YTOA 3CA5A 3FJEA 4ZA3B 1A8DA 1IRAX 5BXRA 4CJMA 2RQ9A 3S8JA 3RMYA 3VEQA 4JPZA 2D44A 3MPPG 4EB2B 4QBCA 3PMEA 1I1EA 1CE7B 3CA4A 1JLXA 4A7KA 1G9DA 1HWPB 3RTJB 4EFPA 1S0EA 3FJHA 4HA2A 1DFQA 2YUGA 3N7LA 2KI4A 3ZXGA 5FNWA 4LO7B 4I96A 1JT5A 2KH2A 4ZFYB 1HCEA 1D0HA 1ITBA 4OUJA 5F90A 4A7YA 4IYBA 2KKIA 4HR6C 3WO3A 1HCDA 3AH2A 4F83A 1BLAA 4IHZA 3VT1A 2VU9A 4I1BA 1AF9A 2FGFA 2FFVA 5HPZA 3HMYA 1TWEA 2AQZA 2RSTA 1FMMS 3I2XA 4FGFA 4OEEA 1BFGA 1IT0A 1WBCA 4F34A 9ILBA 5FZYA 1YF8B 2P39A 4ZFWB 3OBTA 1IJTA 4JKQA 3CRGA 4KEKA 2NYYA 1HWNB 5GAQA 3V0AA 4ZKTB 2QN4A 3AH4A 1EV2A 41BIA 5FZUA 1EYLA 3ZXDA 1S0LA 3BA5A 4X3AA 3UD7A 2VXTI 4I4SA 1FGAA 1HWMB 2Z49A 4LO8B 3FJ9A 1IOBA 2QYIB 5DUYA 3AKIA 4LO3C 3O44A 5D63A 1AFCA 4I4QA 3CA6A 1FV2A 4I8MA 1QQKA 4OEGA 2ERMA 4J2KA 2M49A 4YOLA 3OJVA 1JY0A 2GZBA 1SZ6B 1Z0HA 3FJIA 2RG9B 3O4OA 3LTQA 3AJ6A 3O4AA 3WA1A 3FJBA 3FGMA 2Q9XA 2L5XA 4H04A 1JT3A 2HW9A 4OW4A 1BFFA 5D61A 4G6JA 3POKA 3QYDA 1RG8A 4I6IA 2BEAA 3OJ2A 3HBWA 4I37A 1Q04A 1T4QA 1RY7A 2NTDA 1PZZA 4AN7B 5BOWA 1SR4A 2D1ZA 1EPWA 2VXRA 2FO1A 4GOVA 3N7JA 3CA0A 3N7KA 3FJFA 4LO1A 2VSEA 3IAGC 1YYNA 4II0A 1ISXA 2BEBA 1G9CA 1QQLA 1IHKA 4I7IA 4I4PA 4JQ0A 4GP3A 3ZX7A 1R8NA 2Z48A 2BFHA 4J23B 3UJ4A 1WBAA 4TLPA 2K8RA 4Z9WB 1K5UA 4QD2C 5FZZA 4X38A 1ABRB 3PG0A 5I1BA 3CAHA 3VSFA 1Q1UA 1S0FA
chains in the Genus database with same CATH superfamily
4H75A 4P0LA 5BXTA 2GO2A 1G9AA 1BARA 5B2HA 2IHOA 1G9BA 3VT0A 5JLVA 4ISRA 4FVVA 2D23A 3IIRA 1TWMA 1XYFA 1BLDA 4KBBA 2DRYA 2Y9WC 3A23A 4G9NA 1PC8B 1II4A 1FQ9A 2NZ9A 3JUTA 2ET2A 3VUOA 4ZBVB 2DREA 1RMLA 1AVUA 3WINA 3BAHA 3KMVA 2Y9GA 1BFBA 1AVWB 3SNVA 2F2FA 1DZDA 4GAIA 3O3QA 4QKSA 3N0KA 3CA1A 4MZHA 1EVTA 1BA7A 1S0GA 4GOYA 4MZFB 1Q03A 4ISQA 3BX1C 2D24A 2Y9XE 1R8OA 1YXWA 2HZ9A 1ISYA 4JRAA 1DIWA 4G9MA 2WBCA 3HN1A 4J2XA 1S0DA 4L4HA 2IWTB 4Q91A 1W3GA 3OJMA 6I1BA 1FN0A 4R6UB 1G82A 4IZXA 3VSZA 4I4YA 3MALA 4DENA 2P23A 3CRIA 1OQLB 1UPSA 1PWAA 3W9TA 1HWOB 1M2TB 2ZQOA 4I4OA 3O4DA 1KNMA 4Q9PA 21BIA 3WMUA 3BADA 1TP0A 4QC4A 1XHBA 4LO2A 3CU1B 1FWVA 3B9UA 3PUBA 3A22A 3AKFA 2F8XC 4GAFA 1JQZA 5F8YA 5BXSA 2NM1A 4USOA 3N7MA 4I4UA 2HWMA 2D20A 3WMVA 3UJ0A 3A07A 4JP0A 4EKXB 4P6AA 1JT4A 4IZEA 2E4MA 5F8SA 3NBEA 3WO4A 1PUMB 5BQUA 31BIA 5D62A 3H6SE 5DZUA 2DRZA 3BAVA 5F8WA 2D7IA 3BAUA 5EG6C 5BXPA 4QO3A 4D0TA 2XOAA 1TTUA 2NP0A 3RTIB 4Z8SB 1E0OA 3R4SA 1ISZA 4LO0A 1SR4C 3FJAA 5BP5A 4KC3A 4I4RA 1IILA 4LO7C 1JT7A 3OBRA 2HWAA 3AKHA 3O49A 1HIBA 3O4CA 4IY9A 5BP5C 4XFTA 4I3NA 3OGFA 4LO1C 1DLLA 4G1RA 1BFCA 3O5WB 2K43A 4KEIA 2R9KB 2FDBM 1MC9A 2D43A 5JMCA 1PUUB 4KEJA 1ISWA 4P0JA 4XFSA 1AVAC 1VCLA 2MLLB 3NJ5A 2LIQA 3TC2A 3FJCA 3F1RA 4XFUA 4QBVA 3VWCA 3H6RB 1V6XA 1ILR1 3IM5A 1AVXB 3P6IA 2AFGA 2NS2A 4X39A 3BB2A 3RMXA 3UD9A 4I4XA 3FJKA 1L2HA 1DQGA 4HJJA 1DQOA 3D7WB 4ZOTA 1TIEA 4OEFA 2X2TA 4XKIA 1S0CA 2UUSA 4A7ZA 1S0BA 4OWJA 2ESUA 1YBIA 4OWKA 2MC2A 4DCKC 2AXMA 1CVSA 4USPA 1FV3A 3V0BB 3CA3A 3AH1A 3WINC 2WRYA 1TOOA 3BRFA 3NBDA 4L4IA 3NBNA 3FJJA 3BA7A 3WO2A 2F2FC 1FWUA 4H9WA 3FJ8A 4I1EA 4J2SA 3OGGA 3RSJA 1NZKA 2X2SA 3IM7A 3FFZA 2Y9FA 3H6QA 1QXMA 3PHZA 3HOMA 3UDAA 4I0YA 4JAWA 4JKXB 4QD2B 3Q7XA 3R4UA 2VUAA 4ENDA 3I29B 3CQAA 4I2SA 3BA4A 3HALA 4EEEB 2J3PA 4Q9GA 1TFMB 3F62B 3VT2A 5E24E 4EFRA 1JLYA 1WD4A 1FMZA 3O4BA 3LLPA 2VLCA 4ZFUB 5DSSB 4IY8A 2I1BA 4WBCA 1M16A 1W3FA 2VSAA 1IRPA 1DJSB 4PC4A 4P0KA 1Z4SA 4D8HA 3FUOA 4D0ZA 1N4KA 4J2YA 1BASA 4LO2C 3AZWA 3EF2A 3BAQA 3JRRA 4DEPA 4LO3A 3T8SA 1J0SA 1K5VA 5EC5A 1JTCA 1F31A 5BVPI 4QKRA 2DS0A 2LIEA 1ONKB 3E8LC 3BRGC 2E4MC 3BAOA 4MZGB 5G00A 5BQUC 3ZC9A 2NVHA 2K4AB 1WD3A 3C9ZA 4IONA 3P53A 1NUNA 1V6WA 3I2AA 3H6RA 1Z2VA 2FFUA 3K1XA 4OWLA 3UD8A 3P6JA 3BAGA 3CRHA 1V6UA 2ZR1B 2Q3NB 3V0AB 4EFQA 7I1BA 3Q7YA 1AXMA 3ILAA 1W3AA 3ZC8A 2D22A 1P63A 4LO0C 4ZLBB 3AKGA 3BTAA 5DVHA 3QR5A 2KI6B 1DZCA 2D7RA 4I4VA 3V79C 1DFCA 1RZOB 3AJ5A 3FJDA 4QALA 1V6VA 4AN6A 3NBCA 3HSMA 3BRDA 3V0BA 3A21A 1ISVA 1GGPB 3AZVA 4GP0A 2ZQNA 2MIBA 2AAIB 5FNXA 1T9FA 4IQPA 1XZZA 5EHAA 1I1BA 1MD6A 1XG6A 2KLLA 4G6MA 4X37A 1HKNA 3IM6A 3Q7WA 3S8KA 4ZGRB 8I1BA 3FUQA 1YTOA 3CA5A 3FJEA 4ZA3B 1A8DA 1IRAX 5BXRA 4CJMA 2RQ9A 3S8JA 3RMYA 3VEQA 4JPZA 2D44A 3MPPG 4EB2B 4QBCA 3PMEA 1I1EA 1CE7B 3CA4A 1JLXA 4A7KA 1G9DA 1HWPB 3RTJB 4EFPA 1S0EA 3FJHA 4HA2A 1DFQA 2YUGA 3N7LA 2KI4A 3ZXGA 5FNWA 4LO7B 4I96A 1JT5A 2KH2A 4ZFYB 1HCEA 1D0HA 1ITBA 4OUJA 5F90A 4A7YA 4IYBA 2KKIA 4HR6C 3WO3A 1HCDA 3AH2A 4F83A 1BLAA 4IHZA 3VT1A 2VU9A 4I1BA 1AF9A 2FGFA 2FFVA 5HPZA 3HMYA 1TWEA 2AQZA 2RSTA 1FMMS 3I2XA 4FGFA 4OEEA 1BFGA 1IT0A 1WBCA 4F34A 9ILBA 5FZYA 1YF8B 2P39A 4ZFWB 3OBTA 1IJTA 4JKQA 3CRGA 4KEKA 2NYYA 1HWNB 5GAQA 3V0AA 4ZKTB 2QN4A 3AH4A 1EV2A 41BIA 5FZUA 1EYLA 3ZXDA 1S0LA 3BA5A 4X3AA 3UD7A 2VXTI 4I4SA 1FGAA 1HWMB 2Z49A 4LO8B 3FJ9A 1IOBA 2QYIB 5DUYA 3AKIA 4LO3C 3O44A 5D63A 1AFCA 4I4QA 3CA6A 1FV2A 4I8MA 1QQKA 4OEGA 2ERMA 4J2KA 2M49A 4YOLA 3OJVA 1JY0A 2GZBA 1SZ6B 1Z0HA 3FJIA 2RG9B 3O4OA 3LTQA 3AJ6A 3O4AA 3WA1A 3FJBA 3FGMA 2Q9XA 2L5XA 4H04A 1JT3A 2HW9A 4OW4A 1BFFA 5D61A 4G6JA 3POKA 3QYDA 1RG8A 4I6IA 2BEAA 3OJ2A 3HBWA 4I37A 1Q04A 1T4QA 1RY7A 2NTDA 1PZZA 4AN7B 5BOWA 1SR4A 2D1ZA 1EPWA 2VXRA 2FO1A 4GOVA 3N7JA 3CA0A 3N7KA 3FJFA 4LO1A 2VSEA 3IAGC 1YYNA 4II0A 1ISXA 2BEBA 1G9CA 1QQLA 1IHKA 4I7IA 4I4PA 4JQ0A 4UY4A 4GP3A 3ZX7A 1R8NA 2Z48A 2BFHA 4J23B 3UJ4A 1WBAA 4TLPA 2K8RA 4Z9WB 1K5UA 4QD2C 5FZZA 4X38A 1ABRB 3PG0A 5I1BA 3CAHA 3VSFA 1Q1UA 1S0FA
chains in the Genus database with same CATH topology
4H75A 4P0LA 5BXTA 2GO2A 1G9AA 1BARA 5B2HA 2IHOA 1G9BA 3VT0A 5JLVA 4ISRA 4FVVA 2D23A 3IIRA 1TWMA 1XYFA 1BLDA 4KBBA 2DRYA 2Y9WC 3A23A 4G9NA 1PC8B 1II4A 1FQ9A 2NZ9A 3JUTA 2ET2A 3VUOA 4ZBVB 2DREA 1RMLA 1AVUA 3WINA 3BAHA 3KMVA 2Y9GA 1BFBA 1AVWB 3SNVA 2F2FA 1DZDA 4GAIA 3O3QA 4QKSA 3N0KA 3CA1A 4MZHA 1EVTA 1BA7A 1S0GA 4GOYA 4MZFB 1Q03A 4ISQA 3BX1C 2D24A 2Y9XE 1R8OA 1YXWA 2HZ9A 1ISYA 4JRAA 1DIWA 4G9MA 2WBCA 3HN1A 4J2XA 1S0DA 4L4HA 2IWTB 4Q91A 1W3GA 3OJMA 6I1BA 1FN0A 4R6UB 1G82A 4IZXA 3VSZA 4I4YA 3MALA 4DENA 2P23A 3CRIA 1OQLB 1UPSA 1PWAA 3W9TA 1HWOB 1M2TB 2ZQOA 4I4OA 3O4DA 1KNMA 4Q9PA 21BIA 3WMUA 3BADA 1TP0A 4QC4A 1XHBA 4LO2A 3CU1B 1FWVA 3B9UA 3PUBA 3A22A 3AKFA 2F8XC 4GAFA 1JQZA 5F8YA 5BXSA 2NM1A 4USOA 3N7MA 4I4UA 2HWMA 2D20A 3WMVA 3UJ0A 3A07A 4JP0A 4EKXB 4P6AA 1JT4A 4IZEA 2E4MA 5F8SA 3NBEA 3WO4A 1PUMB 5BQUA 31BIA 5D62A 3H6SE 5DZUA 2DRZA 3BAVA 5F8WA 2D7IA 3BAUA 5EG6C 5BXPA 4QO3A 4D0TA 2XOAA 1TTUA 2NP0A 3RTIB 4Z8SB 1E0OA 3R4SA 1ISZA 4LO0A 1SR4C 3FJAA 5BP5A 4KC3A 4I4RA 1IILA 4LO7C 1JT7A 3OBRA 2HWAA 3AKHA 3O49A 1HIBA 3O4CA 4IY9A 5BP5C 4XFTA 4I3NA 3OGFA 4LO1C 1DLLA 4G1RA 1BFCA 3O5WB 2K43A 4KEIA 2R9KB 2FDBM 1MC9A 2D43A 5JMCA 1PUUB 4KEJA 1ISWA 4P0JA 4XFSA 1AVAC 1VCLA 2MLLB 3NJ5A 2LIQA 3TC2A 3FJCA 3F1RA 4XFUA 4QBVA 3VWCA 3H6RB 1V6XA 1ILR1 3IM5A 1AVXB 3P6IA 2AFGA 2NS2A 4X39A 3BB2A 3RMXA 3UD9A 4I4XA 3FJKA 1L2HA 1DQGA 4HJJA 1DQOA 3D7WB 4ZOTA 1TIEA 4OEFA 2X2TA 4XKIA 1S0CA 2UUSA 4A7ZA 1S0BA 4OWJA 2ESUA 1YBIA 4OWKA 2MC2A 4DCKC 2AXMA 1CVSA 4USPA 1FV3A 3V0BB 3CA3A 3AH1A 3WINC 2WRYA 1TOOA 3BRFA 3NBDA 4L4IA 3NBNA 3FJJA 3BA7A 3WO2A 2F2FC 1FWUA 4H9WA 3FJ8A 4I1EA 4J2SA 3OGGA 3RSJA 1NZKA 2X2SA 3IM7A 3FFZA 2Y9FA 3H6QA 1QXMA 3PHZA 3HOMA 3UDAA 4I0YA 4JAWA 4JKXB 4QD2B 3Q7XA 3R4UA 2VUAA 4ENDA 3I29B 3CQAA 4I2SA 3BA4A 3HALA 4EEEB 2J3PA 4Q9GA 1TFMB 3F62B 3VT2A 5E24E 4EFRA 1JLYA 1WD4A 1FMZA 3O4BA 3LLPA 2VLCA 4ZFUB 5DSSB 4IY8A 2I1BA 4WBCA 1M16A 1W3FA 2VSAA 1IRPA 1DJSB 4PC4A 4P0KA 1Z4SA 4D8HA 3FUOA 4D0ZA 1N4KA 4J2YA 1BASA 4LO2C 3AZWA 3EF2A 3BAQA 3JRRA 4DEPA 4LO3A 3T8SA 1J0SA 1K5VA 5EC5A 1JTCA 1F31A 5BVPI 4QKRA 2DS0A 2LIEA 1ONKB 3E8LC 3BRGC 2E4MC 3BAOA 4MZGB 5G00A 5BQUC 3ZC9A 2NVHA 2K4AB 1WD3A 3C9ZA 4IONA 3P53A 1NUNA 1V6WA 3I2AA 3H6RA 1Z2VA 2FFUA 3K1XA 4OWLA 3UD8A 3P6JA 3BAGA 3CRHA 1V6UA 2ZR1B 2Q3NB 3V0AB 4EFQA 7I1BA 3Q7YA 1AXMA 3ILAA 1W3AA 3ZC8A 2D22A 1P63A 4LO0C 4ZLBB 3AKGA 3BTAA 5DVHA 3QR5A 2KI6B 1DZCA 2D7RA 4I4VA 3V79C 1DFCA 1RZOB 3AJ5A 3FJDA 4QALA 1V6VA 4AN6A 3NBCA 3HSMA 3BRDA 3V0BA 3A21A 1ISVA 1GGPB 3AZVA 4GP0A 2ZQNA 2MIBA 2AAIB 5FNXA 1T9FA 4IQPA 1XZZA 5EHAA 1I1BA 1MD6A 1XG6A 2KLLA 4G6MA 4X37A 1HKNA 3IM6A 3Q7WA 3S8KA 4ZGRB 8I1BA 3FUQA 1YTOA 3CA5A 3FJEA 4ZA3B 1A8DA 1IRAX 5BXRA 4CJMA 2RQ9A 3S8JA 3RMYA 3VEQA 4JPZA 2D44A 3MPPG 4EB2B 4QBCA 3PMEA 1I1EA 1CE7B 3CA4A 1JLXA 4A7KA 1G9DA 1HWPB 3RTJB 4EFPA 1S0EA 3FJHA 4HA2A 1DFQA 2YUGA 3N7LA 2KI4A 3ZXGA 5FNWA 4LO7B 4I96A 1JT5A 2KH2A 4ZFYB 1HCEA 1D0HA 1ITBA 4OUJA 5F90A 4A7YA 4IYBA 2KKIA 4HR6C 3WO3A 1HCDA 3AH2A 4F83A 1BLAA 4IHZA 3VT1A 2VU9A 4I1BA 1AF9A 2FGFA 2FFVA 5HPZA 3HMYA 1TWEA 2AQZA 2RSTA 1FMMS 3I2XA 4FGFA 4OEEA 1BFGA 1IT0A 1WBCA 4F34A 9ILBA 5FZYA 1YF8B 2P39A 4ZFWB 3OBTA 1IJTA 4JKQA 3CRGA 4KEKA 2NYYA 1HWNB 5GAQA 3V0AA 4ZKTB 2QN4A 3AH4A 1EV2A 41BIA 5FZUA 1EYLA 3ZXDA 1S0LA 3BA5A 4X3AA 3UD7A 2VXTI 4I4SA 1FGAA 1HWMB 2Z49A 4LO8B 3FJ9A 1IOBA 2QYIB 5DUYA 3AKIA 4LO3C 3O44A 5D63A 1AFCA 4I4QA 3CA6A 1FV2A 4I8MA 1QQKA 4OEGA 2ERMA 4J2KA 2M49A 4YOLA 3OJVA 1JY0A 2GZBA 1SZ6B 1Z0HA 3FJIA 2RG9B 3O4OA 3LTQA 3AJ6A 3O4AA 3WA1A 3FJBA 3FGMA 2Q9XA 2L5XA 4H04A 1JT3A 2HW9A 4OW4A 1BFFA 5D61A 4G6JA 3POKA 3QYDA 1RG8A 4I6IA 2BEAA 3OJ2A 3HBWA 4I37A 1Q04A 1T4QA 1RY7A 2NTDA 1PZZA 4AN7B 5BOWA 1SR4A 2D1ZA 1EPWA 2VXRA 2FO1A 4GOVA 3N7JA 3CA0A 3N7KA 3FJFA 4LO1A 2VSEA 3IAGC 1YYNA 4II0A 1ISXA 2BEBA 1G9CA 1QQLA 1IHKA 4I7IA 4I4PA 4JQ0A 4UY4A 4GP3A 3ZX7A 1R8NA 2Z48A 2BFHA 4J23B 3UJ4A 1WBAA 4TLPA 2K8RA 4Z9WB 1K5UA 4QD2C 5FZZA 4X38A 1ABRB 3PG0A 5I1BA 3CAHA 3VSFA 1Q1UA 1S0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0L A;  5BXT A;  2GO2 A;  1G9A A;  1BAR A;  5B2H A;  2IHO A;  1G9B A;  3VT0 A;  5JLV A;  4ISR A;  4FVV A;  2D23 A;  3IIR A;  1TWM A;  1XYF A;  1BLD A;  4KBB A;  2DRY A;  2Y9W C;  3A23 A;  4G9N A;  1PC8 B;  1II4 A;  1FQ9 A;  2NZ9 A;  3JUT A;  2ET2 A;  3VUO A;  4ZBV B;  2DRE A;  1RML A;  1AVU A;  3WIN A;  3BAH A;  3KMV A;  2Y9G A;  1BFB A;  1AVW B;  3SNV A;  2F2F A;  1DZD A;  4GAI A;  3O3Q A;  4QKS A;  3N0K A;  3CA1 A;  1EVT A;  1BA7 A;  1S0G A;  4GOY A;  1Q03 A;  4ISQ A;  3BX1 C;  2D24 A;  2Y9X E;  1R8O A;  1YXW A;  2HZ9 A;  1ISY A;  4JRA A;  1DIW A;  4G9M A;  2WBC A;  3HN1 A;  4J2X A;  1S0D A;  4L4H A;  2IWT B;  4Q91 A;  1W3G A;  3OJM A;  6I1B A;  1FN0 A;  4R6U B;  1G82 A;  4IZX A;  3VSZ A;  4I4Y A;  3MAL A;  4DEN A;  2P23 A;  3CRI A;  1OQL B;  1UPS A;  1PWA A;  3W9T A;  1HWO B;  1M2T B;  2ZQO A;  4I4O A;  3O4D A;  1KNM A;  4Q9P A;  21BI A;  3WMU A;  3BAD A;  1TP0 A;  4QC4 A;  1XHB A;  4LO2 A;  3CU1 B;  1FWV A;  3B9U A;  3PUB A;  3A22 A;  3AKF A;  2F8X C;  4GAF A;  1JQZ A;  5F8Y A;  5BXS A;  2NM1 A;  4USO A;  3N7M A;  4I4U A;  2HWM A;  2D20 A;  3WMV A;  3UJ0 A;  3A07 A;  4JP0 A;  4EKX B;  4P6A A;  1JT4 A;  4IZE A;  2E4M A;  5F8S A;  3NBE A;  3WO4 A;  1PUM B;  5BQU A;  31BI A;  5D62 A;  3H6S E;  5DZU A;  2DRZ A;  3BAV A;  5F8W A;  2D7I A;  3BAU A;  5EG6 C;  5BXP A;  4QO3 A;  4D0T A;  2XOA A;  1TTU A;  2NP0 A;  3RTI B;  4Z8S B;  1E0O A;  3R4S A;  1ISZ A;  4LO0 A;  1SR4 C;  3FJA A;  5BP5 A;  4KC3 A;  4I4R A;  1IIL A;  4LO7 C;  1JT7 A;  3OBR A;  2HWA A;  3AKH A;  3O49 A;  1HIB A;  3O4C A;  4IY9 A;  5BP5 C;  4XFT A;  4I3N A;  3OGF A;  4LO1 C;  1DLL A;  4G1R A;  1BFC A;  3O5W B;  2K43 A;  4KEI A;  2R9K B;  2FDB M;  1MC9 A;  2D43 A;  5JMC A;  1PUU B;  4KEJ A;  1ISW A;  4P0J A;  4XFS A;  1AVA C;  1VCL A;  2MLL B;  3NJ5 A;  2LIQ A;  3TC2 A;  3FJC A;  3F1R A;  4XFU A;  4QBV A;  3VWC A;  3H6R B;  1V6X A;  1ILR 1;  3IM5 A;  1AVX B;  3P6I A;  2AFG A;  4X39 A;  3BB2 A;  3RMX A;  3UD9 A;  4I4X A;  3FJK A;  1L2H A;  1DQG A;  4HJJ A;  1DQO A;  3D7W B;  4ZOT A;  1TIE A;  4OEF A;  2X2T A;  4XKI A;  1S0C A;  2UUS A;  4A7Z A;  1S0B A;  4OWJ A;  2ESU A;  1YBI A;  4OWK A;  2MC2 A;  4DCK C;  2AXM A;  1CVS A;  4USP A;  1FV3 A;  3V0B B;  3CA3 A;  3AH1 A;  3WIN C;  2WRY A;  1TOO A;  3BRF A;  3NBD A;  4L4I A;  3NBN A;  3FJJ A;  3BA7 A;  3WO2 A;  2F2F C;  1FWU A;  4H9W A;  3FJ8 A;  4I1E A;  4J2S A;  3OGG A;  3RSJ A;  1NZK A;  2X2S A;  3IM7 A;  3FFZ A;  2Y9F A;  3H6Q A;  1QXM A;  3PHZ A;  3HOM A;  3UDA A;  4I0Y A;  4JAW A;  4JKX B;  4QD2 B;  3Q7X A;  3R4U A;  2VUA A;  4END A;  3I29 B;  3CQA A;  4I2S A;  3BA4 A;  3HAL A;  4EEE B;  2J3P A;  4Q9G A;  1TFM B;  3F62 B;  3VT2 A;  5E24 E;  4EFR A;  1JLY A;  1WD4 A;  1FMZ A;  3O4B A;  3LLP A;  2VLC A;  4ZFU B;  5DSS B;  4IY8 A;  2I1B A;  4WBC A;  1M16 A;  1W3F A;  2VSA A;  1IRP A;  1DJS B;  4PC4 A;  4P0K A;  1Z4S A;  4D8H A;  3FUO A;  4D0Z A;  1N4K A;  4J2Y A;  1BAS A;  4LO2 C;  3AZW A;  3EF2 A;  3BAQ A;  3JRR A;  4DEP A;  4LO3 A;  3T8S A;  1J0S A;  1K5V A;  5EC5 A;  1JTC A;  1F31 A;  5BVP I;  4QKR A;  2DS0 A;  2LIE A;  1ONK B;  3E8L C;  3BRG C;  2E4M C;  3BAO A;  5G00 A;  5BQU C;  3ZC9 A;  2NVH A;  2K4A B;  1WD3 A;  3C9Z A;  4ION A;  3P53 A;  1NUN A;  1V6W A;  3I2A A;  3H6R A;  1Z2V A;  2FFU A;  3K1X A;  4OWL A;  3UD8 A;  3P6J A;  3BAG A;  3CRH A;  1V6U A;  2ZR1 B;  2Q3N B;  3V0A B;  4EFQ A;  7I1B A;  3Q7Y A;  1AXM A;  3ILA A;  1W3A A;  3ZC8 A;  2D22 A;  1P63 A;  4LO0 C;  4ZLB B;  3AKG A;  3BTA A;  5DVH A;  3QR5 A;  2KI6 B;  1DZC A;  2D7R A;  4I4V A;  3V79 C;  1DFC A;  1RZO B;  3AJ5 A;  3FJD A;  4QAL A;  1V6V A;  4AN6 A;  3NBC A;  3HSM A;  3BRD A;  3V0B A;  3A21 A;  1ISV A;  1GGP B;  3AZV A;  4GP0 A;  2ZQN A;  2MIB A;  2AAI B;  5FNX A;  1T9F A;  4IQP A;  1XZZ A;  5EHA A;  1I1B A;  1MD6 A;  1XG6 A;  2KLL A;  4G6M A;  4X37 A;  1HKN A;  3IM6 A;  3Q7W A;  3S8K A;  4ZGR B;  8I1B A;  3FUQ A;  1YTO A;  3CA5 A;  3FJE A;  4ZA3 B;  1A8D A;  1IRA X;  5BXR A;  4CJM A;  2RQ9 A;  3S8J A;  3RMY A;  3VEQ A;  4JPZ A;  2D44 A;  3MPP G;  4EB2 B;  4QBC A;  3PME A;  1I1E A;  1CE7 B;  3CA4 A;  1JLX A;  4A7K A;  1G9D A;  1HWP B;  3RTJ B;  4EFP A;  1S0E A;  3FJH A;  4HA2 A;  1DFQ A;  2YUG A;  3N7L A;  2KI4 A;  3ZXG A;  5FNW A;  4LO7 B;  4I96 A;  1JT5 A;  2KH2 A;  4ZFY B;  1HCE A;  1D0H A;  1ITB A;  4OUJ A;  5F90 A;  4A7Y A;  4IYB A;  2KKI A;  4HR6 C;  3WO3 A;  1HCD A;  3AH2 A;  4F83 A;  1BLA A;  4IHZ A;  3VT1 A;  2VU9 A;  4I1B A;  1AF9 A;  2FGF A;  2FFV A;  5HPZ A;  3HMY A;  1TWE A;  2AQZ A;  2RST A;  1FMM S;  3I2X A;  4FGF A;  4OEE A;  1BFG A;  1IT0 A;  1WBC A;  4F34 A;  9ILB A;  5FZY A;  1YF8 B;  2P39 A;  4ZFW B;  3OBT A;  1IJT A;  4JKQ A;  3CRG A;  4KEK A;  2NYY A;  1HWN B;  5GAQ A;  3V0A A;  4ZKT B;  2QN4 A;  3AH4 A;  1EV2 A;  41BI A;  5FZU A;  1EYL A;  3ZXD A;  1S0L A;  3BA5 A;  4X3A A;  3UD7 A;  2VXT I;  4I4S A;  1FGA A;  1HWM B;  2Z49 A;  4LO8 B;  3FJ9 A;  1IOB A;  2QYI B;  5DUY A;  3AKI A;  4LO3 C;  3O44 A;  5D63 A;  1AFC A;  4I4Q A;  3CA6 A;  1FV2 A;  4I8M A;  1QQK A;  4OEG A;  2ERM A;  4J2K A;  2M49 A;  4YOL A;  3OJV A;  1JY0 A;  2GZB A;  1SZ6 B;  1Z0H A;  3FJI A;  2RG9 B;  3O4O A;  3LTQ A;  3AJ6 A;  3O4A A;  3WA1 A;  3FJB A;  3FGM A;  2Q9X A;  2L5X A;  4H04 A;  1JT3 A;  2HW9 A;  4OW4 A;  1BFF A;  5D61 A;  4G6J A;  3POK A;  3QYD A;  1RG8 A;  4I6I A;  2BEA A;  3OJ2 A;  3HBW A;  4I37 A;  1Q04 A;  1T4Q A;  1RY7 A;  2NTD A;  1PZZ A;  4AN7 B;  5BOW A;  1SR4 A;  2D1Z A;  1EPW A;  2VXR A;  2FO1 A;  4GOV A;  3N7J A;  3CA0 A;  3N7K A;  3FJF A;  4LO1 A;  2VSE A;  3IAG C;  1YYN A;  4II0 A;  1ISX A;  2BEB A;  1G9C A;  1QQL A;  1IHK A;  4I7I A;  4I4P A;  4JQ0 A;  4GP3 A;  3ZX7 A;  1R8N A;  2Z48 A;  2BFH A;  4J23 B;  3UJ4 A;  1WBA A;  4TLP A;  2K8R A;  4Z9W B;  1K5U A;  4QD2 C;  5FZZ A;  4X38 A;  1ABR B;  3PG0 A;  5I1B A;  3CAH A;  3VSF A;  1Q1U A;  1S0F A; 
#chains in the Genus database with same CATH topology
 4H75 A;  4P0L A;  5BXT A;  2GO2 A;  1G9A A;  1BAR A;  5B2H A;  2IHO A;  1G9B A;  3VT0 A;  5JLV A;  4ISR A;  4FVV A;  2D23 A;  3IIR A;  1TWM A;  1XYF A;  1BLD A;  4KBB A;  2DRY A;  2Y9W C;  3A23 A;  4G9N A;  1PC8 B;  1II4 A;  1FQ9 A;  2NZ9 A;  3JUT A;  2ET2 A;  3VUO A;  4ZBV B;  2DRE A;  1RML A;  1AVU A;  3WIN A;  3BAH A;  3KMV A;  2Y9G A;  1BFB A;  1AVW B;  3SNV A;  2F2F A;  1DZD A;  4GAI A;  3O3Q A;  4QKS A;  3N0K A;  3CA1 A;  4MZH A;  1EVT A;  1BA7 A;  1S0G A;  4GOY A;  4MZF B;  1Q03 A;  4ISQ A;  3BX1 C;  2D24 A;  2Y9X E;  1R8O A;  1YXW A;  2HZ9 A;  1ISY A;  4JRA A;  1DIW A;  4G9M A;  2WBC A;  3HN1 A;  4J2X A;  1S0D A;  4L4H A;  2IWT B;  4Q91 A;  1W3G A;  3OJM A;  6I1B A;  1FN0 A;  4R6U B;  1G82 A;  4IZX A;  3VSZ A;  4I4Y A;  3MAL A;  4DEN A;  2P23 A;  3CRI A;  1OQL B;  1UPS A;  1PWA A;  3W9T A;  1HWO B;  1M2T B;  2ZQO A;  4I4O A;  3O4D A;  1KNM A;  4Q9P A;  21BI A;  3WMU A;  3BAD A;  1TP0 A;  4QC4 A;  1XHB A;  4LO2 A;  3CU1 B;  1FWV A;  3B9U A;  3PUB A;  3A22 A;  3AKF A;  2F8X C;  4GAF A;  1JQZ A;  5F8Y A;  5BXS A;  2NM1 A;  4USO A;  3N7M A;  4I4U A;  2HWM A;  2D20 A;  3WMV A;  3UJ0 A;  3A07 A;  4JP0 A;  4EKX B;  4P6A A;  1JT4 A;  4IZE A;  2E4M A;  5F8S A;  3NBE A;  3WO4 A;  1PUM B;  5BQU A;  31BI A;  5D62 A;  3H6S E;  5DZU A;  2DRZ A;  3BAV A;  5F8W A;  2D7I A;  3BAU A;  5EG6 C;  5BXP A;  4QO3 A;  4D0T A;  2XOA A;  1TTU A;  2NP0 A;  3RTI B;  4Z8S B;  1E0O A;  3R4S A;  1ISZ A;  4LO0 A;  1SR4 C;  3FJA A;  5BP5 A;  4KC3 A;  4I4R A;  1IIL A;  4LO7 C;  1JT7 A;  3OBR A;  2HWA A;  3AKH A;  3O49 A;  1HIB A;  3O4C A;  4IY9 A;  5BP5 C;  4XFT A;  4I3N A;  3OGF A;  4LO1 C;  1DLL A;  4G1R A;  1BFC A;  3O5W B;  2K43 A;  4KEI A;  2R9K B;  2FDB M;  1MC9 A;  2D43 A;  5JMC A;  1PUU B;  4KEJ A;  1ISW A;  4P0J A;  4XFS A;  1AVA C;  1VCL A;  2MLL B;  3NJ5 A;  2LIQ A;  3TC2 A;  3FJC A;  3F1R A;  4XFU A;  4QBV A;  3VWC A;  3H6R B;  1V6X A;  1ILR 1;  3IM5 A;  1AVX B;  3P6I A;  2AFG A;  2NS2 A;  4X39 A;  3BB2 A;  3RMX A;  3UD9 A;  4I4X A;  3FJK A;  1L2H A;  1DQG A;  4HJJ A;  1DQO A;  3D7W B;  4ZOT A;  1TIE A;  4OEF A;  2X2T A;  4XKI A;  1S0C A;  2UUS A;  4A7Z A;  1S0B A;  4OWJ A;  2ESU A;  1YBI A;  4OWK A;  2MC2 A;  4DCK C;  2AXM A;  1CVS A;  4USP A;  1FV3 A;  3V0B B;  3CA3 A;  3AH1 A;  3WIN C;  2WRY A;  1TOO A;  3BRF A;  3NBD A;  4L4I A;  3NBN A;  3FJJ A;  3BA7 A;  3WO2 A;  2F2F C;  1FWU A;  4H9W A;  3FJ8 A;  4I1E A;  4J2S A;  3OGG A;  3RSJ A;  1NZK A;  2X2S A;  3IM7 A;  3FFZ A;  2Y9F A;  3H6Q A;  1QXM A;  3PHZ A;  3HOM A;  3UDA A;  4I0Y A;  4JAW A;  4JKX B;  4QD2 B;  3Q7X A;  3R4U A;  2VUA A;  4END A;  3I29 B;  3CQA A;  4I2S A;  3BA4 A;  3HAL A;  4EEE B;  2J3P A;  4Q9G A;  1TFM B;  3F62 B;  3VT2 A;  5E24 E;  4EFR A;  1JLY A;  1WD4 A;  1FMZ A;  3O4B A;  3LLP A;  2VLC A;  4ZFU B;  5DSS B;  4IY8 A;  2I1B A;  4WBC A;  1M16 A;  1W3F A;  2VSA A;  1IRP A;  1DJS B;  4PC4 A;  4P0K A;  1Z4S A;  4D8H A;  3FUO A;  4D0Z A;  1N4K A;  4J2Y A;  1BAS A;  4LO2 C;  3AZW A;  3EF2 A;  3BAQ A;  3JRR A;  4DEP A;  4LO3 A;  3T8S A;  1J0S A;  1K5V A;  5EC5 A;  1JTC A;  1F31 A;  5BVP I;  4QKR A;  2DS0 A;  2LIE A;  1ONK B;  3E8L C;  3BRG C;  2E4M C;  3BAO A;  4MZG B;  5G00 A;  5BQU C;  3ZC9 A;  2NVH A;  2K4A B;  1WD3 A;  3C9Z A;  4ION A;  3P53 A;  1NUN A;  1V6W A;  3I2A A;  3H6R A;  1Z2V A;  2FFU A;  3K1X A;  4OWL A;  3UD8 A;  3P6J A;  3BAG A;  3CRH A;  1V6U A;  2ZR1 B;  2Q3N B;  3V0A B;  4EFQ A;  7I1B A;  3Q7Y A;  1AXM A;  3ILA A;  1W3A A;  3ZC8 A;  2D22 A;  1P63 A;  4LO0 C;  4ZLB B;  3AKG A;  3BTA A;  5DVH A;  3QR5 A;  2KI6 B;  1DZC A;  2D7R A;  4I4V A;  3V79 C;  1DFC A;  1RZO B;  3AJ5 A;  3FJD A;  4QAL A;  1V6V A;  4AN6 A;  3NBC A;  3HSM A;  3BRD A;  3V0B A;  3A21 A;  1ISV A;  1GGP B;  3AZV A;  4GP0 A;  2ZQN A;  2MIB A;  2AAI B;  5FNX A;  1T9F A;  4IQP A;  1XZZ A;  5EHA A;  1I1B A;  1MD6 A;  1XG6 A;  2KLL A;  4G6M A;  4X37 A;  1HKN A;  3IM6 A;  3Q7W A;  3S8K A;  4ZGR B;  8I1B A;  3FUQ A;  1YTO A;  3CA5 A;  3FJE A;  4ZA3 B;  1A8D A;  1IRA X;  5BXR A;  4CJM A;  2RQ9 A;  3S8J A;  3RMY A;  3VEQ A;  4JPZ A;  2D44 A;  3MPP G;  4EB2 B;  4QBC A;  3PME A;  1I1E A;  1CE7 B;  3CA4 A;  1JLX A;  4A7K A;  1G9D A;  1HWP B;  3RTJ B;  4EFP A;  1S0E A;  3FJH A;  4HA2 A;  1DFQ A;  2YUG A;  3N7L A;  2KI4 A;  3ZXG A;  5FNW A;  4LO7 B;  4I96 A;  1JT5 A;  2KH2 A;  4ZFY B;  1HCE A;  1D0H A;  1ITB A;  4OUJ A;  5F90 A;  4A7Y A;  4IYB A;  2KKI A;  4HR6 C;  3WO3 A;  1HCD A;  3AH2 A;  4F83 A;  1BLA A;  4IHZ A;  3VT1 A;  2VU9 A;  4I1B A;  1AF9 A;  2FGF A;  2FFV A;  5HPZ A;  3HMY A;  1TWE A;  2AQZ A;  2RST A;  1FMM S;  3I2X A;  4FGF A;  4OEE A;  1BFG A;  1IT0 A;  1WBC A;  4F34 A;  9ILB A;  5FZY A;  1YF8 B;  2P39 A;  4ZFW B;  3OBT A;  1IJT A;  4JKQ A;  3CRG A;  4KEK A;  2NYY A;  1HWN B;  5GAQ A;  3V0A A;  4ZKT B;  2QN4 A;  3AH4 A;  1EV2 A;  41BI A;  5FZU A;  1EYL A;  3ZXD A;  1S0L A;  3BA5 A;  4X3A A;  3UD7 A;  2VXT I;  4I4S A;  1FGA A;  1HWM B;  2Z49 A;  4LO8 B;  3FJ9 A;  1IOB A;  2QYI B;  5DUY A;  3AKI A;  4LO3 C;  3O44 A;  5D63 A;  1AFC A;  4I4Q A;  3CA6 A;  1FV2 A;  4I8M A;  1QQK A;  4OEG A;  2ERM A;  4J2K A;  2M49 A;  4YOL A;  3OJV A;  1JY0 A;  2GZB A;  1SZ6 B;  1Z0H A;  3FJI A;  2RG9 B;  3O4O A;  3LTQ A;  3AJ6 A;  3O4A A;  3WA1 A;  3FJB A;  3FGM A;  2Q9X A;  2L5X A;  4H04 A;  1JT3 A;  2HW9 A;  4OW4 A;  1BFF A;  5D61 A;  4G6J A;  3POK A;  3QYD A;  1RG8 A;  4I6I A;  2BEA A;  3OJ2 A;  3HBW A;  4I37 A;  1Q04 A;  1T4Q A;  1RY7 A;  2NTD A;  1PZZ A;  4AN7 B;  5BOW A;  1SR4 A;  2D1Z A;  1EPW A;  2VXR A;  2FO1 A;  4GOV A;  3N7J A;  3CA0 A;  3N7K A;  3FJF A;  4LO1 A;  2VSE A;  3IAG C;  1YYN A;  4II0 A;  1ISX A;  2BEB A;  1G9C A;  1QQL A;  1IHK A;  4I7I A;  4I4P A;  4JQ0 A;  4UY4 A;  4GP3 A;  3ZX7 A;  1R8N A;  2Z48 A;  2BFH A;  4J23 B;  3UJ4 A;  1WBA A;  4TLP A;  2K8R A;  4Z9W B;  1K5U A;  4QD2 C;  5FZZ A;  4X38 A;  1ABR B;  3PG0 A;  5I1B A;  3CAH A;  3VSF A;  1Q1U A;  1S0F A; 
#chains in the Genus database with same CATH homology
 4H75 A;  4P0L A;  5BXT A;  2GO2 A;  1G9A A;  1BAR A;  5B2H A;  2IHO A;  1G9B A;  3VT0 A;  5JLV A;  4ISR A;  4FVV A;  2D23 A;  3IIR A;  1TWM A;  1XYF A;  1BLD A;  4KBB A;  2DRY A;  2Y9W C;  3A23 A;  4G9N A;  1PC8 B;  1II4 A;  1FQ9 A;  2NZ9 A;  3JUT A;  2ET2 A;  3VUO A;  4ZBV B;  2DRE A;  1RML A;  1AVU A;  3WIN A;  3BAH A;  3KMV A;  2Y9G A;  1BFB A;  1AVW B;  3SNV A;  2F2F A;  1DZD A;  4GAI A;  3O3Q A;  4QKS A;  3N0K A;  3CA1 A;  4MZH A;  1EVT A;  1BA7 A;  1S0G A;  4GOY A;  4MZF B;  1Q03 A;  4ISQ A;  3BX1 C;  2D24 A;  2Y9X E;  1R8O A;  1YXW A;  2HZ9 A;  1ISY A;  4JRA A;  1DIW A;  4G9M A;  2WBC A;  3HN1 A;  4J2X A;  1S0D A;  4L4H A;  2IWT B;  4Q91 A;  1W3G A;  3OJM A;  6I1B A;  1FN0 A;  4R6U B;  1G82 A;  4IZX A;  3VSZ A;  4I4Y A;  3MAL A;  4DEN A;  2P23 A;  3CRI A;  1OQL B;  1UPS A;  1PWA A;  3W9T A;  1HWO B;  1M2T B;  2ZQO A;  4I4O A;  3O4D A;  1KNM A;  4Q9P A;  21BI A;  3WMU A;  3BAD A;  1TP0 A;  4QC4 A;  1XHB A;  4LO2 A;  3CU1 B;  1FWV A;  3B9U A;  3PUB A;  3A22 A;  3AKF A;  2F8X C;  4GAF A;  1JQZ A;  5F8Y A;  5BXS A;  2NM1 A;  4USO A;  3N7M A;  4I4U A;  2HWM A;  2D20 A;  3WMV A;  3UJ0 A;  3A07 A;  4JP0 A;  4EKX B;  4P6A A;  1JT4 A;  4IZE A;  2E4M A;  5F8S A;  3NBE A;  3WO4 A;  1PUM B;  5BQU A;  31BI A;  5D62 A;  3H6S E;  5DZU A;  2DRZ A;  3BAV A;  5F8W A;  2D7I A;  3BAU A;  5EG6 C;  5BXP A;  4QO3 A;  4D0T A;  2XOA A;  1TTU A;  2NP0 A;  3RTI B;  4Z8S B;  1E0O A;  3R4S A;  1ISZ A;  4LO0 A;  1SR4 C;  3FJA A;  5BP5 A;  4KC3 A;  4I4R A;  1IIL A;  4LO7 C;  1JT7 A;  3OBR A;  2HWA A;  3AKH A;  3O49 A;  1HIB A;  3O4C A;  4IY9 A;  5BP5 C;  4XFT A;  4I3N A;  3OGF A;  4LO1 C;  1DLL A;  4G1R A;  1BFC A;  3O5W B;  2K43 A;  4KEI A;  2R9K B;  2FDB M;  1MC9 A;  2D43 A;  5JMC A;  1PUU B;  4KEJ A;  1ISW A;  4P0J A;  4XFS A;  1AVA C;  1VCL A;  2MLL B;  3NJ5 A;  2LIQ A;  3TC2 A;  3FJC A;  3F1R A;  4XFU A;  4QBV A;  3VWC A;  3H6R B;  1V6X A;  1ILR 1;  3IM5 A;  1AVX B;  3P6I A;  2AFG A;  2NS2 A;  4X39 A;  3BB2 A;  3RMX A;  3UD9 A;  4I4X A;  3FJK A;  1L2H A;  1DQG A;  4HJJ A;  1DQO A;  3D7W B;  4ZOT A;  1TIE A;  4OEF A;  2X2T A;  4XKI A;  1S0C A;  2UUS A;  4A7Z A;  1S0B A;  4OWJ A;  2ESU A;  1YBI A;  4OWK A;  2MC2 A;  4DCK C;  2AXM A;  1CVS A;  4USP A;  1FV3 A;  3V0B B;  3CA3 A;  3AH1 A;  3WIN C;  2WRY A;  1TOO A;  3BRF A;  3NBD A;  4L4I A;  3NBN A;  3FJJ A;  3BA7 A;  3WO2 A;  2F2F C;  1FWU A;  4H9W A;  3FJ8 A;  4I1E A;  4J2S A;  3OGG A;  3RSJ A;  1NZK A;  2X2S A;  3IM7 A;  3FFZ A;  2Y9F A;  3H6Q A;  1QXM A;  3PHZ A;  3HOM A;  3UDA A;  4I0Y A;  4JAW A;  4JKX B;  4QD2 B;  3Q7X A;  3R4U A;  2VUA A;  4END A;  3I29 B;  3CQA A;  4I2S A;  3BA4 A;  3HAL A;  4EEE B;  2J3P A;  4Q9G A;  1TFM B;  3F62 B;  3VT2 A;  5E24 E;  4EFR A;  1JLY A;  1WD4 A;  1FMZ A;  3O4B A;  3LLP A;  2VLC A;  4ZFU B;  5DSS B;  4IY8 A;  2I1B A;  4WBC A;  1M16 A;  1W3F A;  2VSA A;  1IRP A;  1DJS B;  4PC4 A;  4P0K A;  1Z4S A;  4D8H A;  3FUO A;  4D0Z A;  1N4K A;  4J2Y A;  1BAS A;  4LO2 C;  3AZW A;  3EF2 A;  3BAQ A;  3JRR A;  4DEP A;  4LO3 A;  3T8S A;  1J0S A;  1K5V A;  5EC5 A;  1JTC A;  1F31 A;  5BVP I;  4QKR A;  2DS0 A;  2LIE A;  1ONK B;  3E8L C;  3BRG C;  2E4M C;  3BAO A;  4MZG B;  5G00 A;  5BQU C;  3ZC9 A;  2NVH A;  2K4A B;  1WD3 A;  3C9Z A;  4ION A;  3P53 A;  1NUN A;  1V6W A;  3I2A A;  3H6R A;  1Z2V A;  2FFU A;  3K1X A;  4OWL A;  3UD8 A;  3P6J A;  3BAG A;  3CRH A;  1V6U A;  2ZR1 B;  2Q3N B;  3V0A B;  4EFQ A;  7I1B A;  3Q7Y A;  1AXM A;  3ILA A;  1W3A A;  3ZC8 A;  2D22 A;  1P63 A;  4LO0 C;  4ZLB B;  3AKG A;  3BTA A;  5DVH A;  3QR5 A;  2KI6 B;  1DZC A;  2D7R A;  4I4V A;  3V79 C;  1DFC A;  1RZO B;  3AJ5 A;  3FJD A;  4QAL A;  1V6V A;  4AN6 A;  3NBC A;  3HSM A;  3BRD A;  3V0B A;  3A21 A;  1ISV A;  1GGP B;  3AZV A;  4GP0 A;  2ZQN A;  2MIB A;  2AAI B;  5FNX A;  1T9F A;  4IQP A;  1XZZ A;  5EHA A;  1I1B A;  1MD6 A;  1XG6 A;  2KLL A;  4G6M A;  4X37 A;  1HKN A;  3IM6 A;  3Q7W A;  3S8K A;  4ZGR B;  8I1B A;  3FUQ A;  1YTO A;  3CA5 A;  3FJE A;  4ZA3 B;  1A8D A;  1IRA X;  5BXR A;  4CJM A;  2RQ9 A;  3S8J A;  3RMY A;  3VEQ A;  4JPZ A;  2D44 A;  3MPP G;  4EB2 B;  4QBC A;  3PME A;  1I1E A;  1CE7 B;  3CA4 A;  1JLX A;  4A7K A;  1G9D A;  1HWP B;  3RTJ B;  4EFP A;  1S0E A;  3FJH A;  4HA2 A;  1DFQ A;  2YUG A;  3N7L A;  2KI4 A;  3ZXG A;  5FNW A;  4LO7 B;  4I96 A;  1JT5 A;  2KH2 A;  4ZFY B;  1HCE A;  1D0H A;  1ITB A;  4OUJ A;  5F90 A;  4A7Y A;  4IYB A;  2KKI A;  4HR6 C;  3WO3 A;  1HCD A;  3AH2 A;  4F83 A;  1BLA A;  4IHZ A;  3VT1 A;  2VU9 A;  4I1B A;  1AF9 A;  2FGF A;  2FFV A;  5HPZ A;  3HMY A;  1TWE A;  2AQZ A;  2RST A;  1FMM S;  3I2X A;  4FGF A;  4OEE A;  1BFG A;  1IT0 A;  1WBC A;  4F34 A;  9ILB A;  5FZY A;  1YF8 B;  2P39 A;  4ZFW B;  3OBT A;  1IJT A;  4JKQ A;  3CRG A;  4KEK A;  2NYY A;  1HWN B;  5GAQ A;  3V0A A;  4ZKT B;  2QN4 A;  3AH4 A;  1EV2 A;  41BI A;  5FZU A;  1EYL A;  3ZXD A;  1S0L A;  3BA5 A;  4X3A A;  3UD7 A;  2VXT I;  4I4S A;  1FGA A;  1HWM B;  2Z49 A;  4LO8 B;  3FJ9 A;  1IOB A;  2QYI B;  5DUY A;  3AKI A;  4LO3 C;  3O44 A;  5D63 A;  1AFC A;  4I4Q A;  3CA6 A;  1FV2 A;  4I8M A;  1QQK A;  4OEG A;  2ERM A;  4J2K A;  2M49 A;  4YOL A;  3OJV A;  1JY0 A;  2GZB A;  1SZ6 B;  1Z0H A;  3FJI A;  2RG9 B;  3O4O A;  3LTQ A;  3AJ6 A;  3O4A A;  3WA1 A;  3FJB A;  3FGM A;  2Q9X A;  2L5X A;  4H04 A;  1JT3 A;  2HW9 A;  4OW4 A;  1BFF A;  5D61 A;  4G6J A;  3POK A;  3QYD A;  1RG8 A;  4I6I A;  2BEA A;  3OJ2 A;  3HBW A;  4I37 A;  1Q04 A;  1T4Q A;  1RY7 A;  2NTD A;  1PZZ A;  4AN7 B;  5BOW A;  1SR4 A;  2D1Z A;  1EPW A;  2VXR A;  2FO1 A;  4GOV A;  3N7J A;  3CA0 A;  3N7K A;  3FJF A;  4LO1 A;  2VSE A;  3IAG C;  1YYN A;  4II0 A;  1ISX A;  2BEB A;  1G9C A;  1QQL A;  1IHK A;  4I7I A;  4I4P A;  4JQ0 A;  4UY4 A;  4GP3 A;  3ZX7 A;  1R8N A;  2Z48 A;  2BFH A;  4J23 B;  3UJ4 A;  1WBA A;  4TLP A;  2K8R A;  4Z9W B;  1K5U A;  4QD2 C;  5FZZ A;  4X38 A;  1ABR B;  3PG0 A;  5I1B A;  3CAH A;  3VSF A;  1Q1U A;  1S0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...