5BR9A

Crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
217
structure length
217
Chain Sequence
HMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein with similarity to peptidase YEAZ from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 63
structure length 217
sequence length 217
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5br9A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5br9A02
3S41A 1Y64A 1JCGA 4PKIA 4WQ4C 1XUPO 4CZLA 2QWRA 1JCEA 3GOIA 2ITMA 4H03B 3W0LA 1ZC6A 4ISFA 3SMPA 3FE1A 3IUCA 4ISGA 3GE1A 5AQGA 4CBXA 2E2QA 2QWPA 1YVNA 2E2NA 5LJVA 1YXQA 2FSJA 5TKYA 1WUAA 2J4RA 3F9MA 3GBTA 1KAZA 2P9UA 4XH1A 3GDQA 1H1VA 1X3NA 2ASMA 5AZIA 1J6ZA 3WT0A 3CJAA 2P9KA 3ZEUB 3LDQA 4HWIA 2FF3B 4MO4A 5AZJA 1X3MA 2P9NB 3ULEB 2QWMA 3ATUA 2F9TA 4IZ9A 3WXKA 2QWNA 3J8AA 3VF4A 3C7NA 3JS6A 3DXKA 3ENOA 5BRDA 1WOQA 3BF3A 3WXJA 1P8ZA 3DXKB 2P9LA 2P9SB 1V4TA 3KZBA 3BP8A 2YJFA 2PBDA 5AQPA 2Q31A 4A2BA 3GG4A 1KAXA 2A3ZA 3VEXA 1RDWX 3MDQA 2CGLA 3QBXA 2CH5A 4CD1A 1E4GT 2I7NA 4H0VB 5BREA 5AQRA 5BR9A 4H0TB 3QFUA 3LDLA 3R9PA 2I7PA 3VESA 2OANA 1Q18A 4BR5A 4XH4A 1S3XA 1NM1A 2ZF5O 1LCUA 1QZ6A 4FPAA 3AAPA 3VGLA 2IIRA 4O5FA 5AQQA 2CH6A 2GEMA 2VYPA 3WEEB 5AQFA 5AQSA 1ATNA 4AM7A 4C23A 5KPZA 3H1VX 3U9DA 5JICA 3DXMB 3CJCA 3SLCA 2NRHA 2E20A 5AQYA 4FWPA 2E8AA 2A42A 1SAZA 4K41A 3UKRB 1DKGD 5BN8A 1BA1A 3CQXA 3A8YA 4XH5A 4F9OA 4B1XB 1RGIA 3U9ZA 2GWKA 2YI1A 3SK3A 4FWMA 4RWTA 2HMPA 1GLEG 3VGMA 3FZFA 4MO5A 2NZTA 1ZBSA 3ENHA 4PL8A 4RCHA 3MMVA 4DB3A 3FFKB 2IVOA 3O4WA 3VEVA 1GLDG 1JCFA 1S22A 3M6GA 1NGCA 1OKJA 2E1ZA 4O8KA 1XQSC 1NMDA 1Z6RA 2E2OA 5CE3A 5AQIA 5AQMA 2GTDA 3U4LA 3UB5A 4BRIA 3ATVA 2CGKA 5AQOA 3DAWA 4BRCA 4IJAA 1D4XA 1HKCA 4BR2A 2Q2RA 3UE5A 4CZHA 4BRGA 2QWQA 1U2VA 3LM2A 4H5NA 4BRDA 4BQZA 3LM9A 1K8KB 3EKSA 3C7NB 4BR9A 3L0QA 3IFRA 4CZIA 1BUPA 3UKRA 1TYQB 2Q1NA 1DGKN 4ISEA 3R8EA 1KXPA 3HSCA 4FWSA 4L3QA 4RTFD 5EVZA 1BA0A 3BUZB 3VENA 3D2FA 2WUSA 3VEWA 3UKUA 3ZETA 2E2PA 4BREA 3MK6A 1U2VB 1IG8A 3LDPA 4J8FA 3RSEA 3CJ7A 3HBTA 5KQDA 4CZGA 2YHYA 3MN9A 2P9IA 5AR0A 2E88A 3DWLA 5FPEA 2V51B 3EN9A 5AQZA 4A2AA 4H0YB 5E84A 3UKUB 4H5VA 4JN4A 3HM8A 3ZX0A 4CZFA 4Y0WA 3KVGA 4LC9B 4BRPA 4FOIA 3VF6A 2GELA 3BF1A 4H0OA 4FPBA 1GLJO 1XC3A 2P9IB 3EO3A 1T6CA 4HTLA 3TPQA 5AQNA 5AQUA 3VOVA 2YHWA 1BO5O 4H5TA 4CJ7A 4FWRA 2FSKA 2AA4A 5AQLA 2QXLA 3VF2A 3P4IA 1TUYA 1GLFO 1GLBG 3OHRA 3GL1A 2NLXA 3VEOA 2QWLA 5KPTA 5AQKA 2P9NA 3ULEA 4M63C 1NGAA 1BWFO 1NGFA 2D0OA 3FR0A 3O5BA 1HPMA 2V52B 3QDKA 4EHTA 5ADXA 2AP1A 4H5WA 3L6QA 3WQTA 4K42A 4K25A 4KBOA 3WEEA 1ESVA 4YDUA 3CETA 3CJ1A 3VGKA 4WQ5A 1NGHA 5FPDA 1BU6O 1HKBA 2YCHA 4M7YA 4FWLA 1NBWA 4BVOA 4IXCA 4CZKA 4CZJA 5JLFA 4BR0A 2PAVA 3JXUA 3CERA 5JMVA 2IVNA 3VEYA 4H5RA 3A5LC 5BRHA 2P9LB 3VEZA 4FWOA 4PL7A 5EY4A 4BRAA 3C0BA 3H6EA 4DQ8A 5KQ8A 4BC5A 3SMSA 4GY2B 5AFUH 4BGBA 3A5OC 4A61A 3ZETB 1DEJA 1NWKA 5AQWA 3EL2A 1MDUB 4BG8A 5JLHA 1LOTB 2GUPA 2A40A 5FPNA 4I6MB 4H0XB 4BGAA 4XEIA 3AARA 1BOTO 4B1UB 1IJJA 2Q97A 3O6WA 2CGJA 1GLCG 5AQVA 2P9PB 1BG3A 4WQ5C 3FZHA 1HJOA 1QHAA 3FZLA 3QBWA 4QS9A 1NGBA 2E1YA 4JHDB 3QB0A 1MWMA 3M1FA 3TU5A 3O8MA 5FPMA 4IJNA 4B1WB 4JNEA 1QQMA 4BROA 2P9KB 3ZEUA 3WXIA 5AQXA 5EXWA 2IVPA 4EHUA 2EWSA 3O08A 5AQJA 4BRLA 1NGIA 5AZIB 3SJHA 5B8HA 1NGDA 1Z05A 2GWJA 4FL9A 4JHDA 3FLCO 1R59O 4EIAA 4BRNA 2A5XA 5LJWA 4EFHA 5I9EB 5BRFA 3CI5A 3U8XA 5E26A 3A5MC 4PKHA 3H45C 2FF6A 3LL3A 1YAGA 4FWQA 3ZX2A 4QS8A 3QMLA 4JD2B 4PKGA 5BN9A 4CD3A 3W3DA 4B1VA 1RFQA 2BTFA 5AFUA 1U6ZA 3O80A 2F9WA 4GNIA 4CZMA 3O1WA 5AZJB 1T44A 3D2EB 1TYQA 3EZWA 3H3OB 5BPLA 1GLAG 3G25A 2VWBA 2W40A 2ZWHA 4BRKA 4CZEA 3DJCA 2ZGYA 3MN7A 2P9SA 3EKUA 2UYTA 3ID8A 3VPZA 1X9JA 1K8KA 2Q36A 3CJ9A 1MWKA 3CHWA 4JAXA 3HZ6A 3L4IA 4MLEA 5ELZA 3AY9A 3I33A 4BC2A 2HOEA 5F2RA 4BRFA 4CBUA 4IWVA 4BRQA 3D2FB 2FSNA 4CI6A 1ATSA 3LDOA 3LDNA 1V4SA 3KHYA 1GLLO 4FSVA 4DHYA 5BPMA 3A5NC 4BR4A 1QZ5A 4BRMA 2FXUA 1NGJA 3BEXA 4FWNA 5LY3A 4M7XA 3D2EA 3VETA 4BC3A 3MCPA 2H3GX 3ZX3A 3IDHA 1CZAN 4AM6A 1MA9B 2D4WA 2D0PA 4B1YB 3WXLA 4YDUC 2ASPA 5ADXH 1ZXOA 5BPNA 3FZMA 4FOEA 4BG9A 3H3NO 3QICA 3CJBA 2Q0UA 3CIPA 5AQHA 1NGEA 4MLHA 2D1KA 1KAYA 4B1ZA 2ZGZA 2P9PA 2VCPA 3WQUA 4FWKA 4E1JA 1TUUA 4BVPA 1QQNA 4K43A 4QS7A 4BRHA 2BUPA 3D7EO 3O1BA 1EQYA 4BR7A 1NLVA 5EOYA 5F1XA 2DPNA 2YHXA 3WUHA 4B9QA 2HF3A 2A41A 4BQLA 2W41A 4WQ4A 2QM1A 3VERA 2ASOA 1HUXA 2QW9A 3MN6A 1G99A 2HF4A 3DXMA 4NO7A 2A6AA 1E4FT 2Q0RA 1HX1A 3M3ZA 2P9UB 3QFPA 4CBWA 3FGUA 3RSEB 2QWOA 4DCHA 5AQTA 1BDGA 3CQYA 1ATRA 3I8BA 2YJEA 2KHOA 1QQOA 3H1QA 3H46O 4FO0A 1SQKA 3HTVA 3MN5A 4H0PA 4BC4A 4EAHD 1SZ2A 1C0FA 5EX5A 3AAQA 3HI0A 4NB4A 5F0XA 3B8AX 4IO8A 4Z94A 5KPRA 4WYBA 2FLOA 4A62A 2V7ZA 4I6MA 1HKGA 1T6DA 1HLUA 3R6MA 1NGGA 2V7YA 1C0GA 3FZKA 3IMXA 4JD2A 1YUWA 3A0IX
chains in the Genus database with same CATH superfamily
2BANA 4FJMA 3RRGA 1EETA 3GOIA 2ITMA 4FJ7A 1TKZA 1ZC6A 1RDAA 3FE1A 2O4GA 3ZT4A 1Q82O 3DLKA 3KLEA 2UXBK 5M1PA 1UAXA 4NXNK 3S9HA 2E2NA 1RBRA 3CPEA 4RG8A 4YNQA 4QOZB 1SL0A 2P9UA 4FK0A 1NNEA 5DM6L 1NJXA 3VQ4A 5AZJA 4FYDA 2P9NB 3F5TA 2QWMA 2YNGA 1KCFA 3WXKA 2QWNA 4O0JA 4W5RA 1RNHA 3HPGA 3THYA 4KFBA 1FW6A 4IOXA 1BQMA 3BF3A 4JK9A 3WXJA 4U7BA 3J80O 4DQPA 1O13A 2P9LA 2Z1IA 1NK4A 4WFAL 4DS4A 3KJVA 3GG4A 1YIJN 1RDWX 4B9NA 4FJNA 5CY4A 4NCGA 4FJ8A 1VQMN 2I7NA 3ZSZA 4JV5K 3QFUA 3ZSYA 2I7PA 1IO2A 3AVMA 4XH4A 1QTMA 1CXUA 4CJLA 2A1RA 1RDUA 1LCUA 3OYBA 3NMUA 2BDPA 1S1XA 4FZXC 4F4KA 5AQQA 4AHSA 5CYMA 4JKCA 4K0KK 3WEEB 5AQSA 4IG3A 3SBTA 3VMFB 4FWPA 2E8AA 3UKRB 4JI7K 3VTHA 1DKGD 4CIFA 2FBTA 1RGIA 4C8NA 2Y1JA 3PO5A 3PSIA 2YI1A 3SK3A 1D9DA 3E66A 4JI2K 1QHTA 4JI6K 3G6EN 4DSFA 1ZBSA 3ENHA 2HHSA 3MMVA 1HQEA 3KD1E 3FFKB 1KD1O 2IVOA 3CCLN 1L3VA 2DFFA 1D8YA 3IRXA 4CJTA 1JCFA 3M6GA 4CFBA 1Z26A 4DTJA 5HLFA 3VN5A 2D0BA 3L4QA 5DMRA 3WNEA 1NMDA 1WSGA 4OKKA 4X64K 1Z6RA 1TGOA 2E2OA 5CE3A 1RDCA 3HJFA 3NDKA 3U4LA 3UB5A 3I55N 4JRPA 2YX6A 4CECA 3CCMN 4BRCA 4DR6K 3UE5A 4BRGA 4H5NA 5GAHP 1T05A 4CIGA 3IFRA 1BUPA 2HHUA 2FBYA 1TYQB 3UKRA 4ISEA 3R8EA 4M42A 3KK7A 4FWSA 4L3QA 4RTFD 5EVZA 3S3OA 1BA0A 3O9QA 3E9LA 3VENA 3D2FA 1WSEA 3AVNA 3VEWA 4CVNE 3UKUA 2JWLA 1W7AA 4JI3K 3NHGA 3ZETA 2E2PA 4BREA 1A5WA 1U2VB 4KO0A 1W0HA 3THWB 4W5OA 2IOCA 4PA1A 1SKSA 4J8FA 3SZ2A 3HBTA 4U67L 5C2FA 3V9ZA 3OYHA 3U3GA 4CF1A 3DWLA 3EN9A 1G15A 5AQZA 1RTJA 3JAMO 4YFUA 2KW4A 3E9OA 4H5VA 1TKXA 3V81A 3ZX0A 4O4GA 4N56A 3SUQA 4DTPA 3VF6A 1WLJA 1RT5A 1YI2N 4HTLA 3TPQA 5AQNA 2KFNA 2OCEA 1W2BM 2OZMA 4CEOA 3CD6N 1J9AA 3MEEA 3ZSRA 3CMEN 3ZSWA 4FJLA 2FC0A 5J2MA 3VEOA 3P1GA 3LP1A 3OY9A 4JI1K 4E1MA 3O5BA 4OVLA 1HPMA 4EHTA 3QDKA 5ADXA 4H5WA 4DR7K 3WQTA 2O8BB 4TSXA 4K42A 3HP9A 4KBOA 4M3XA 3WEEA 1ESVA 3CETA 3CJ1A 4FLXA 4WQ5A 5I42A 1TVRA 4E3SA 1NBWA 4CZKA 4IXCA 4CZJA 4M3UA 1IV0A 5J2PA 1XMOK 2IVNA 2QK9A 1R0AA 4EP5A 4BRAA 3KK1A 3H6EA 3QLHA 4DQ8A 5KQ8A 4IOAL 3OYEA 5AFUH 3A5OC 4N41A 4QCLA 3RR7A 5JLHA 3DLEA 4FZZA 4B1UB 5CHIA 3KLFA 1SUQA 4DV3K 4CEQA 4CJ5A 3OYAA 4DF4A 2KZZA 4CW7B 4CJ4A 2OTLN 1QHAA 4K8XA 4RW7A 3ITHA 4JHDB 4CGHA 4Q0BA 1RBUA 1VSHA 4GW6A 4BROA 2XY6A 3P38A 1GOBA 5EXWA 5HRPA 4JEPA 4NYNA 2IVPA 2EWSA 5AQJA 4BRLA 1NGIA 5AZIB 4FJHA 4OPKA 1X9WA 4FL9A 2FBVA 1NKEA 3FLCO 3PSFA 4FW1A 4EIAA 3T1AA 1QVFM 2WBNA 3AVLA 1W9HA 1J53A 3OVNA 1ITGA 5GADP 5C0YA 3HXMA 5C24A 1NK8A 4FM0A 4E7JA 4PUOA 4CGDA 4B3OA 1Q81O 4AHTA 1J5OA 5BN9A 3W3DA 3P39A 1Y97A 1U6ZA 3O80A 5H1SQ 3NH0A 1WBBA 1K8AO 1DLOA 1T44A 3EZWA 4CZEA 2B4JA 3DJCA 4CK3A 4LY7A 4BDYA 2P9SA 3CXCM 4GKJK 4Q5VA 3PX0A 2Q36A 1YF5L 3NBPA 1MWKA 2XO7A 2X6NA 4EZ9A 3AY9A 3VQQA 4BC2A 3D6RA 4BRFA 4CBUA 1KC8O 4IWVA 1A5XA 4O44A 2GV9A 4DLGA 4CFCA 3A5NC 2ZQBA 4FWNA 4J2BA 3EE8A 3OS1A 4IDHA 3L3VA 3JYTA 3E1YA 4AM6A 4DR1K 3KLGA 2F4VK 3T19A 3DI6A 1NJIO 2ASPA 4NCAA 2HHHK 4F3TA 3FZMA 3HOSA 1BQNA 3CJBA 2Q0UA 4DR3K 4DSJA 1LW0A 3OJUA 4MLHA 4AHUA 1YJWN 3WQUA 4FWKA 1TUUA 3M5RA 1QQNA 2YNFA 3M8QA 5EOYA 4ILGB 3SUOA 1RDBA 2DPNA 3AVJA 3O4QA 1ZYQA 3AA4A 1K73O 1IKWA 1TK0A 4BE0A 4R5PA 3TABA 1VQLN 4OKJA 4NO7A 4DV0K 1E4FT 5CZ1A 4OO1J 2Q0RA 4RW9A 1HNZK 3SQ4A 4CBWA 3MX5A 1TL3A 4KTWA 3FGUA 4ILHA 5AQTA 1BDGA 1ATRA 1FXXA 4LF7K 4CJWA 3ZLJA 2GX9A 4LFAK 1LAVA 2PFUA 4GVEA 2YNHA 4BWJA 3NE6A 3RWUA 2I5JA 3B8AX 3C65A 4WYBA 2FLOA 4I6MA 2XHBA 3LWLA 1HKGA 3NFAA 4B9LA 2IDOA 1LWCA 1UA1A 4KHYA 4JD2A 4CCHA 3MN7A 3LP3A 3O3FA 4WF9L 1IBMK 2QWRA 1JCEA 5DM7L 3CCSN 4H03B 3W0LA 1U49A 4M3RA 1E3MA 4ISFA 4OJRA 4ISGA 4LF8K 3OS2A 4CBXA 2AJQA 3VQ8A 3CFRA 1YVNA 5LJVA 1YXQA 2FSJA 5TKYA 3GBTA 4CHQA 4XH1A 5LMNK 3BZCA 1H1VA 1QSSA 1X3NA 2ASMA 4ZTFA 1J6ZA 3WT0A 3CJAA 4HWIA 2FF3B 2O8BA 4DQIA 5C2DA 4CESA 2OYQA 3VQ6A 4CK1A 3J8AA 3VF4A 3V4IA 1IBLK 3DYAA 3JS6A 4C8OA 3DXKA 4CJKA 3NGZA 4PQUA 4JKGA 3HVRA 3LANA 3PV8A 1I39A 4DV7K 4JKDA 2P9SB 3KZBA 3BP8A 2UUAK 4A2BA 3OYJA 4AH9A 4KRFA 3VEXA 3MDQA 1N8RO 2PYLA 1JLEA 1VAZA 4H0VB 3LPUA 3AGKA 2ATQA 1TK8A 2HHTA 4FLTA 4W5NA 4JS4A 5A2QO 3RRHA 3ENBA 4I9LA 1KTQA 2RF2A 4CF2A 3LDSA 3VESA 1X1PA 3BY5A 4Z4CA 4BDPA 2VWKA 1S3XA 1TAUA 1NM1A 3PX4A 5HROA 4KI6A 4FPAA 1JLQA 3VGLA 2QKKA 2DFEA 2Z1JA 3T69A 3KLIA 1KVAA 3CCVN 1C0MA 3THVA 4AM7A 4CK2A 3DXMB 4LH5A 2NRHA 2NRWA 2A1SA 3VQAA 2O8DB 2A42A 1SAZA 3SI6A 1S9EA 1BGXT 5JS2A 2KKZA 4FVMA 4O5BA 1C0TA 4A5AA 3HP6A 5C42A 3FZFA 3C95A 4OPAA 2RE2A 2NZTA 4PL8A 1M90O 1JL1A 5HRSA 4DB3A 1NKCA 4MDAA 5SZTA 1ASWA 4YOTA 1EKEA 4CEAA 5GINA 1NGCA 1IG9A 1OKJA 4IFEA 1XQSC 5M1OA 3OW2M 5LL6Z 3AVKA 1B92A 3K5NA 1J5EK 4PHTX 3B6PA 2OA8A 5KRSA 3LPTA 3P5JA 4CIEA 3OYNA 4DR5K 1YHQN 2HVHA 3TR8A 5AQOA 3K0SA 4N76A 4Z0UA 3C94A 1HKCA 2Q2RA 3H08A 1BIUA 2QWQA 1U2VA 4BQZA 1EWRA 3EKSA 4HUFA 4KAZA 5M1NA 2JGUA 3C7NB 3EE9A 4KTZA 4CJEA 4DG1A 2KLAA 4CZIA 3DLLL 4KHUA 2Q1NA 1HR0K 1SS6A 4UY8O 4FJ5A 2P1JA 4CE9A 3BUZB 4ID5A 4DFJA 5CZ2A 1WAJA 4FJ9A 1P90A 3ZT1A 3DRRA 3AVBA 3CM6A 1KVCA 5AJ3K 3HO1A 3OYMA 3O3GA 2F96A 1ZBLA 1JXBA 1N32K 5CR4A 2V51B 3V1OA 4H0YB 1VQNN 5E84A 3P31A 3G4SN 3KKRA 4JN4A 3MEDA 3HM8A 2UXCK 1QS4A 2KQ2A 3K5MA 3HSTB 4Y0WA 1FKOA 3KVGA 4LC9B 3AO1A 4BRPA 4MQ3A 3HYFA 3QIPA 3AVHA 4H0OA 4ELVA 1GLJO 2P9IB 3D45A 4J2AA 2O4IA 1HYVA 1RTDA 5J2QA 1BO5O 1RT2A 4CJ7A 3SQ2A 1HNXK 4CHOA 4JRQA 4HHTA 4DSIA 4Z4EA 1RT1A 3SAFA 3GL1A 3HK2A 4KH4A 2DY4A 5AQKA 3HM9A 4DSLA 4C1NI 4M63C 4LSLA 1NGAA 4LF4K 2D0OA 1NGFA 2JWKA 4NLBA 2V52B 3TAEA 2AP1A 1L5UA 3L6QA 3IS9A 4FLVA 4K25A 4E0DA 4C8MA 4YDUA 4CGIA 5FPDA 1HKBA 2YCHA 4FWLA 1TKTA 5I3UA 5C12A 4H5RA 3TTCA 3JSMA 1BIZA 4J2EA 2P9LB 3OYLA 1RT7A 4FWOA 3U6FA 4BE2A 4JKFA 4IG0A 3KIOA 4GY2B 3NCIA 1NWKA 3EL2A 1MDUB 1LOTB 4M41A 4M3ZA 2GUPA 4DWIA 1RILA 3C6HA 4I6MB 4BGAA 2W6LA 3AARA 3IKMA 3NH2A 2G8IA 2B6AA 2HVIA 4FLYA 2P9PB 3RMBA 3TAGA 1BG3A 1UOCA 4DF8A 4A57A 4NLCA 1WNSA 4FLWA 4FW2A 3HT3A 4MDBA 2KZMA 3KTQA 2EHGA 5KGWA 1MWMA 3A2FA 3AVAA 3J7YP 4GV9A 4L8RB 4FK2A 3TAQA 4IJNA 3VQCA 1QQMA 4Y1CA 4CEBA 2NRXA 2O8FB 2P9KB 3ID6A 1CZ9A 5B8HA 3NF6A 4FJGA 3SQ1A 5J2NA 4DV4K 4BRNA 1OH6A 2A5XA 3HVTA 4O55A 4EFHA 1KFDA 4KHQA 5GIPA 3U8XA 4KTQA 4BY9C 4HUEA 4ELUA 2VG5A 3N4PA 4QS8A 2ZD1A 3QMLA 2D5RA 2NRRA 3CM5A 3NVKA 4ELTA 3NH1A 1S9GA 2BGGA 4CD3A 1KFSA 1RFQA 4GNIA 2HBJA 1TYQA 3H3OB 4I2PA 1GLAG 2W40A 5LMUK 4BRKA 4DUYK 4IFVA 3EKUA 4JKEA 1SKWA 2UYTA 3VPZA 1K8KA 4N5SA 4E7HA 1L3SA 4MLEA 3OS0A 2PZSA 1HYZA 5F2RA 3RMCA 3HPOA 4F3OA 2FSNA 4CI6A 1ATSA 4GV6A 3LDNA 4DR2K 4V19S 4LF6K 4FSVA 4NXMK 3CCEN 3VA3A 1XNQK 1Q9YA 1HNWK 3C6AA 3KKSA 1QQCA 1RCHA 3ZYYX 4AHVA 4B8CA 1KLMA 1OH8A 4YDUC 5ADXH 3CCQN 5BPNA 4BG9A 1WSJA 3H3NO 3QICA 4R79A 1REVA 4F2RA 4OKEA 1JLFA 1W97L 3RMAA 4B9VA 2VCPA 4EZ6A 1N34K 1RT4A 2UU9K 4BVPA 3QNNA 2D0CA 4K43A 3ZT2A 4JI0K 4BRHA 2BUPA 2VGMA 3D7EO 1EQYA 3O1BA 1NLVA 2UUCK 2O8CA 5F1XA 1O1WA 4B9QA 3AVFA 1GOAA 4BQLA 1JLBA 3WNGA 1QSYA 4FJXA 1IKXA 1B9FA 5SWMA 4M3WA 1G99A 2HF4A 2O8EB 3PIOL 1HX1A 4HTUA 3RSEB 1JKHA 2QWOA 2HNDA 2QTDA 2E6MA 1IBKK 3QESA 4CHZA 2QA4N 1BHLA 3BDPA 3OA9A 3H46O 2PY5A 3EEQA 1ZBFA 3HTVA 3MN5A 1NOYA 3QO9A 4H0PA 3VQ7A 1WB9A 3LALA 3CPWM 4CEEA 1C0FA 2WOMA 3AAQA 2W42A 1NK5A 4OGCA 5KPRA 3SUPA 2V7ZA 3ZSVA 1WN7A 4DS5A 1T6DA 3R6MA 4DFKA 1C0GA 4FLZA 3A0IX 1Y64A 1JCGA 4PKIA 4E89A 2IGIA 3TTFA 3SMPA 2HHXA 3QETA 4E7LA 2BH1A 2E2QA 2QWPA 1EP4A 2JLEA 4JI4K 4E1NA 1WUAA 2ZE2A 1D9FA 2G8FA 5M1FA 3LP0A 3GDQA 3SQ0A 1Z25A 3J7AP 5AZIA 3TARA 4AQYK 1U4BA 3ZEUB 3LDQA 4MO4A 3AO4A 3M8RA 2OPPA 1TL1A 2F9TA 4IZ9A 2OZSA 4IBNA 3C7NA 3ENOA 2P5GA 5BRDA 3ZSQA 4AILC 1WSIA 4KH6A 1YITN 1HMVA 1VSJA 4CFDA 1VQPN 4CJVA 1V4TA 5HL7L 3VTIA 4MFBA 1BCMA 4FK4A 2Q31A 4IO9L 2HBLA 3QNOA 1KAXA 3OBWA 2A3ZA 3EY1A 2HHVA 2OTJN 3QBXA 4CD1A 1VQ6N 5BREA 3VQEA 2P51A 5AQRA 1ZBIA 2HHWA 3I8DA 3KD5E 5DK5A 3R9PA 4DV2K 2NRTA 4YY3K 2OPSA 3TAFA 2WFBA 2ZF5O 4B8AB 3QEVA 1QZ6A 3OYFA 4DMNA 3AAPA 4O5FA 1XMQK 3CCRN 5GIOA 2X74A 1WSHA 4EP4A 4KHPK 5AQFA 5KPZA 1VQ7N 4IEEA 1NU0A 3QEIA 3SLCA 1RBSA 4DSKA 1BI4B 5AQYA 3WXMB 3OJSA 3L3UA 2GUIA 4DV1K 1BL3A 1YTUA 3A8YA 3K5OA 4F9OA 4M45A 1TK5A 2GWKA 3FFIA 4RWTA 1GLEG 3OYDA 3OYCA 4AHRA 4RCHA 2XRIA 3AVGA 3SBGA 1OVYA 3O4WA 3VEVA 2RN2A 3WNFA 3CFOA 3DMJA 4B3SK 2QKBA 1S72N 3LAKA 4GVMA 2E1ZA 3OYGA 1L3TA 4CGJA 3SAHA 5AQIA 1VSMA 2GTDA 2WONA 1XNRK 5HBMA 2G8VA 4BRIA 3ATVA 2CGKA 1JL2A 3TAPA 1I3AA 4GMJB 4CEZA 3DAWA 1RDDA 4IJAA 3ZT3A 1S6PA 3SV4A 3K59A 2Z1GA 3THWA 4CZHA 4JKGB 3CFPA 3LM2A 4LSNA 3LM9A 2FBXA 1NOZA 3QEXA 4JI8K 1K6YA 4DTSA 4IFYA 3UIQA 1DGKN 1KXPA 3AO5A 1S1UA 5MLCQ 3L2QA 2WUSA 2X6SA 5GAGP 3MEGA 4NCBA 4OX9K 4PWDA 2VQEK 3LDPA 5EU7A 1KLNA 3CJ7A 2NRVA 5KQDA 4CZGA 3MN9A 3AO3A 4IEIA 4OPHA 1C1AA 4A2AA 3UKUB 4CGFA 1EXQA 4FJJA 4DQRA 4FM2A 3T1YK 4CZFA 4DLEA 4FOIA 2GELA 3BF1A 2Y1IA 3DM2A 3DOLA 3P83D 3EO3A 1CZBA 1T3VA 1RT3A 1IKYA 3VOVA 1VSDA 2YHWA 3U3YA 4H5TA 4C8LA 1U47A 1EO1A 4FWRA 2FSKA 2KFZA 4X66K 2ZM6K 2AA4A 3P4IA 1TUYA 1GLFO 1GLBG 4UQGA 5KPTA 2P9NA 5HRNA 3NF8A 1BWFO 3OYIA 3K57A 1HYSA 3O4NA 3VQPA 3PO4A 4BACA 5M1QA 4B3RK 5IWAK 4CF8A 3NVMA 1KVBA 3VQ9A 2VGNA 1LV5A 3VGKA 1C0UA 1JLCA 1LW2A 1BU6O 4M7YA 2WTUA 3J7ZO 1L3UA 3O9UA 5BR8K 4BR0A 2PAVA 3JXUA 4E19A 3CERA 5JMVA 1JJ2M 1C6VA 1FK9A 4W5QA 5BRHA 3A5LC 4RW4A 5K14A 1NJYA 4LFBK 4N47A 4H8KA 5JVHL 4BC5A 4BGBA 4ILJA 4A61A 2NUBA 1DEJA 1OVQA 4JK7A 2YHBA 4X65K 4BG8A 4CERA 4NYFA 5CYQA 4H0XB 2RKIA 4XEIA 1KRPA 1BOTO 1X9SA 2Q97A 4CF0A 2CGJA 1NJWA 4JK8A 4FXDA 1TKDA 2G8WA 1UWBA 4CEDA 1HJOA 1ILYA 1CLQA 4BDZA 3QBWA 4OLAA 1NGBA 2E1YA 4CJPA 4OPJA 2UUBK 3TU5A 5FPMA 4K8ZA 4DTOA 4B1WB 1NG9A 1OH5A 3TSQA 3ZEUA 3WXIA 5AQXA 2X78A 3PX6A 3O08A 2PYJA 3SCXA 3G10A 4FM1A 4B9MA 2XY5A 2GWJA 2BE2A 4DV6K 3R1XA 1VQ5N 3ALYA 4KH5A 3V1RA 2F8TA 5LJWA 5I9EB 5BRFA 3CI5A 3LZIA 4Z4IA 1XHZA 3H45C 1YAGA 3V9UA 3ZX2A 4JD2B 5HRRA 4PKGA 4O8UA 4A5BA 3TWHA 4DU4A 4FJIA 4B1VA 3SV3A 3LP2A 3F73A 3J81O 5AFUA 3KK2A 4CZMA 3O1WA 1BI4A 1XHXA 3D2EB 4FZYA 1SL2A 2ZWHA 2NNWA 1Q7YO 2ZGYA 3CC4N 3ID8A 1VQ9N 1X9JA 3CJ9A 3CHWA 3HL8A 3HZ6A 1HRHA 3KWIA 4FCYA 1A5VA 4BRQA 3D2FB 4YOUA 3LDOA 3QIOA 3KHYA 1GLLO 4YOVA 2WC9A 4BR4A 1QZ5A 1VSEA 4I7FA 4LH4A 2FXUA 5LY3A 5JVGL 4M7XA 3D2EA 4KHWA 3MCPA 4FJKA 3ZX3A 3IDHA 5FRMA 1CZAN 1C1BA 1SL1A 5C10A 2D4WA 4HCBA 4E7KA 1ZXOA 3NGYA 5FDLA 3CIPA 1B9DA 1NGEA 1JLAA 3L8BA 2D1KA 1KAYA 2ZGZA 3D0PA 3V9WA 3S3MA 4QS7A 3HPHA 2HHQA 4DTNA 4CGGA 4WCEL 2HF3A 2IC3A 4KHSA 1NK9A 2W41A 4HCCA 2QM1A 3V9XA 3QEPA 3VERA 1HUXA 3T1HK 2A6AA 1T7PA 1ASUA 2VG6A 3M3ZA 1VHXA 3QFPA 4C8KA 1XWLA 4DCHA 3NF7A 3L2RA 1NJZA 3I8BA 4CJFA 3LZJA 4GV3A 2YJEA 1QQOA 4LF9K 3M8PA 1SQKA 2E6LA 2XY7A 4BC4A 4I9QA 3E01A 4J2DA 1M1KO 3HI0A 4JI5K 1F21A 4IO8A 2O8DA 1U04A 3TSPA 4Z94A 2F7TA 4A62A 1S6QA 4JLHA 1NGGA 4DR4K 2V7YA 2B5JA 3FZKA 3IMXA 3OBYA 1YUWA 3QEWA 4DKWA 4KKOA 5F0XA 3S41A 4WQ4C 2LSNA 3CYMA 1XUPO 1Q86O 4CZLA 3BGRA 1VSLA 2ITGA 5D3GA 2RHKA 3TSUA 5KI6A 1RT6A 4LD0A 1IH7A 3IUCA 3KLHA 3SPYA 3GE1A 5AQGA 3IG1A 3V9SA 2IAJA 4ICLA 3MWPA 4Y1DA 3HOTA 1U45A 2DTUA 2J4RA 3F9MA 3I56N 1KAZA 4QAGA 3AGRA 3MECA 2P9KA 3K58A 3O9RA 5FROA 3LWMA 1VSKA 1X3MA 2VWJA 3AA3A 3ULEB 4JYAK 3ATUA 3B6OA 3G0ZA 2G8HA 3ULDA 2O8CB 4BWMA 3DOKA 1WOQA 3F9KA 1I94K 4OLBA 3ISNC 3TANA 3VQDA 1P8ZA 3TTDA 4E7IA 1YTAA 3DXKB 1NMNA 2IS3A 4JKHA 1VQKN 1LWEA 3O9SA 1WAFA 2R7YA 2YJFA 2PBDA 5AQPA 3NAEA 1WSFA 2CGLA 2CH5A 1E4GT 5BR9A 4H0TB 5KRTA 3LDLA 2YKNA 2QXFA 2OANA 1Q18A 4BR5A 1RTHA 1VK0A 3I0SA 1QVGM 3L2WA 4DTXA 1GOCA 2IIRA 2D0AA 3KWGA 4WFNL 3SUNA 2CH6A 2GEMA 4KV8A 2VYPA 1ATNA 4C23A 3VQ5A 3H1VX 3MCAB 3U9DA 2QI2A 3LAMA 5JICA 2ETJA 1FJGK 2KTQA 2O8EA 4KI4A 3CJCA 4FLUA 2E20A 4DTUA 4Z4FA 4Z4HA 4YOXA 4DTMA 4K41A 5BN8A 1BA1A 3CQXA 1VQON 4XH5A 4Z4GA 3NGIA 4B1XB 4DU3A 4CHPA 3T7ZA 3U9ZA 1HPZA 4FWMA 4O0IA 2HMPA 3VGMA 4LFCK 2RPIA 4YHHK 3I0RA 1EX4A 4MO5A 3G71N 3ZT0A 3E9PA 4DTRA 3MWTA 3CMAN 1GLDG 1YT3A 2HSTA 1VRUA 1S22A 3TAMA 3OTOK 3IAYA 1VQ8N 2ZJQL 1YVUA 3Q7CA 4O8KA 1HNIA 1KSPA 3NF9A 5AQMA 2O8FA 2HMIA 3DLGA 2E4LA 2W6KA 4KB1A 2OPQA 3ZSXA 2YV0X 3AV9A 1HNVA 1D4XA 4BR2A 4CJRA 1U48A 2OPRA 1S1VA 4BRDA 1K8KB 4ZHRA 4X62K 3M8SA 4DFMA 4HVJA 4BR9A 4CF9A 2HW3A 4JKAA 4B9SA 3CC7N 3L0QA 4F2SA 1NKBA 1QSLA 3RVCA 3HSCA 3DLRA 4DFPA 3QERA 3K2PA 2HNZA 3THXB 4ZTJA 4OGEA 3MK6A 3N4QA 1NK7A 1IG8A 4PY5A 3RSEA 3K9KA 3ZSOA 3HRGA 2YHYA 2HBKA 2P9IA 5AR0A 2E88A 5FPEA 1OH7A 4AF1A 2P5OA 4DU1A 1RTIA 3DRPA 1ZBHA 1J54A 5JS1A 4DQSA 3SAGA 4FPBA 3SPZA 1D5AA 1XC3A 1UA0A 1T6CA 5AQUA 1CXQA 5KTQA 3MAQA 4KREA 3PLAA 3WNHA 4AHCA 4DUZK 5AQLA 4ID1A 2QXLA 3VF2A 5T7BA 1JXEA 3OHRA 2NLXA 1QE1A 2QWLA 3ULEA 3DLBA 3FR0A 4DSEA 4M3YA 2E5LK 1LWFA 1TV6A 1NK0A 3R3LA 1RBTA 1VSIA 1NGHA 4BVOA 4WFBL 4CJ3A 5JLFA 3DLHA 4LF5K 1IKVA 4KPYA 2VQFK 1TAQA 3VQBA 3F2KA 4B08A 3RMDA 3VEYA 3MXIA 2HB5A 2DFHA 3VEZA 3MX2A 2XY8A 4PL7A 5EY4A 3C0BA 2G8KA 3Q7BA 3SMSA 1Q9XA 3ZETB 3OYKA 1VQ4N 1S1WA 5AQWA 3AVCA 1HQUA 1N6QA 2A40A 5FPNA 1ASVA 1ZBUA 3PIPL 1IJJA 3O6WA 1GLCG 3C6TA 2UXDK 5AQVA 4C1NK 3SJJA 1VRTA 4WQ5C 5J1EA 3L2UA 3FZHA 1YJNN 2EX3A 4H4MA 4M3TA 2ZJRL 3RTVA 3FZLA 4QS9A 3EZ5A 1RBVA 3QB0A 3THXA 3M1FA 3O8MA 1DT9A 4B3MK 1YJ9N 3MXJA 4FVUA 4JNEA 3CG7A 3CQ8A 3O9TA 1HJRA 4YOYA 1WBDA 4IOCL 1SKRA 1EWQA 1LAWA 4EHUA 4RW8A 3SJHA 2YKMA 2QEXN 1NGDA 1Z05A 5C15A 4JHDA 1R59O 5FRNA 4CFAA 4CJUA 3TI0A 2G8UA 1XI1A 5E26A 3A5MC 4PKHA 2FF6A 3LL3A 4FWQA 3S3NA 1KQSM 3THYB 4JKBA 5KGXA 1NK6A 2BTFA 1N5YA 4A59A 1BCOA 1N36K 3EYZA 2F9WA 4I2QA 5AZJB 2NRZA 3AA2A 5BPLA 4YORA 3G25A 1X9MA 2VWBA 1BISA 4CJSA 4B9TA 4GKKK 2ZJPL 1T03A 4JAXA 5ELZA 3L4IA 4KB0A 3I33A 2HOEA 3CF5L 4WE1A 1N33K 3CCUN 1VSFA 1V4SA 5BPMA 4DHYA 2HBMA 1DTTA 3K9JA 3C6UA 2VG7A 4CHNA 4BRMA 3QINA 3AA5X 2YNIA 1NGJA 3BEXA 3K5LA 4IKFA 3VETA 4BC3A 3PY8A 5E41A 2H3GX 4H4OA 3KK3A 1MA9B 1DTQA 2D0PA 4B1YB 3WXLA 3T3FA 4FOEA 4B9UA 5AQHA 4F8RA 4W5TA 2Z1HA 2HNYA 5C25A 4B1ZA 1S1TA 3AVIA 2P9PA 4E1JA 4HUGA 4CEFA 3ASMA 4DV5K 4BE1A 4G1QA 2F8SA 4G9ZA 5HP1A 3VA0A 4BR7A 1JLGA 4XIUA 2YHXA 3SYZA 3WUHA 2A41A 1XC9A 4IDKA 4WQ4A 3L2VA 2GBZA 2ASOA 2QW9A 3PUFA 3MN6A 3DXMA 3V1QA 3SNNA 2P9UB 1SV5A 2YHAA 1T8EA 1Q8IA 3CQYA 4CJQA 5FLXO 5TKWA 1S5JA 2KHOA 3H1QA 1MU2A 4DQQA 4FO0A 3V6DA 5M1KA 2Q3SA 3CCJN 3ZCMA 4EAHD 4JS5A 1SZ2A 5EX5A 3AO2A 4NB4A 4KHNA 4B3TK 1C1CA 4CHYA 3O3HA 4RW6A 5IT9O 1K9MO 3RR8A 5HOOA 4YOWA 3MXMA 1HLUA 5GAEP 3BZKA 1FKPA 3DRSA 3CC2N
chains in the Genus database with same CATH topology
3S41A 1Y64A 1JCGA 4PKIA 4WQ4C 1XUPO 1Q86O 4WF9L 4CZLA 2QWRA 1JCEA 3GOIA 2ITMA 5DM7L 3CCSN 4H03B 3W0LA 3TTFA 1ZC6A 2RHKA 3TSUA 4ISFA 3SMPA 3FE1A 3IUCA 2BH1A 4ISGA 3GE1A 5AQGA 4CBXA 1Q82O 2E2QA 2QWPA 5M1PA 1YVNA 2E2NA 3MWPA 3HOTA 5LJVA 1YXQA 2FSJA 3CPEA 5TKYA 1WUAA 2J4RA 3F9MA 3GBTA 3I56N 1KAZA 2P9UA 4XH1A 5M1FA 3GDQA 1H1VA 1X3NA 2ASMA 5AZIA 1J6ZA 3WT0A 3AGRA 5DM6L 3CJAA 2P9KA 3ZEUB 3LDQA 4HWIA 2FF3B 3O9RA 4MO4A 5AZJA 1X3MA 5C2DA 2P9NB 3ULEB 3F5TA 2QWMA 3ATUA 2F9TA 4IZ9A 3WXKA 2QWNA 3J8AA 3VF4A 3C7NA 3JS6A 3DXKA 3ENOA 5BRDA 1WOQA 4JKGA 4IOXA 3BF3A 4JK9A 4KH6A 3WXJA 4U7BA 1YITN 1P8ZA 3TTDA 4JKDA 3DXKB 1O13A 1VQPN 2P9LA 2P9SB 1V4TA 3KZBA 4JKHA 3BP8A 3O9SA 5HL7L 3VTIA 4WFAL 1VQKN 2YJFA 2PBDA 5AQPA 2Q31A 4A2BA 4IO9L 2HBLA 3GG4A 1KAXA 3OBWA 2A3ZA 3VEXA 1RDWX 1YIJN 3MDQA 2CGLA 1N8RO 2OTJN 3QBXA 2CH5A 1VQMN 4CD1A 1VQ6N 1E4GT 1VAZA 2I7NA 4H0VB 5AQRA 5BREA 3AGKA 4H0TB 5BR9A 3ENBA 3QFUA 3LDLA 3R9PA 2NRTA 2I7PA 3VESA 2OANA 1Q18A 4BR5A 4XH4A 1S3XA 2WFBA 1NM1A 1RDUA 1LCUA 2ZF5O 1QVGM 3NMUA 1QZ6A 4FPAA 3AAPA 3VGLA 2IIRA 3KWGA 4O5FA 5AQQA 4WFNL 3T69A 2CH6A 4JKCA 2GEMA 5GIOA 3CCRN 2VYPA 3CCVN 3WEEB 5AQFA 5AQSA 1ATNA 4AM7A 4C23A 5KPZA 3H1VX 1VQ7N 4IEEA 3MCAB 3U9DA 2QI2A 3SBTA 5JICA 3VMFB 3DXMB 3CJCA 3SLCA 2NRHA 2E20A 2NRWA 5AQYA 3WXMB 4FWPA 4YOXA 2E8AA 2A42A 1SAZA 4K41A 3UKRB 1DKGD 3VTHA 1BA1A 3CQXA 5BN8A 3A8YA 4XH5A 1VQON 4F9OA 4B1XB 1RGIA 3T7ZA 2KKZA 3U9ZA 2GWKA 2YI1A 3SK3A 4FWMA 4A5AA 3E66A 4RWTA 2HMPA 1GLEG 3VGMA 3FZFA 4OPAA 4MO5A 3G6EN 2RE2A 2NZTA 1ZBSA 3ENHA 4PL8A 3G71N 1M90O 4RCHA 3MMVA 4DB3A 3FFKB 3E9PA 2IVOA 1KD1O 4MDAA 3CCLN 3SBGA 1OVYA 3O4WA 3VEVA 3MWTA 3CMAN 1GLDG 4YOTA 2HSTA 1JCFA 1S22A 3M6GA 1NGCA 5GINA 1VQ8N 2ZJQL 1S72N 1OKJA 3L4QA 2E1ZA 3Q7CA 1XQSC 4IFEA 4O8KA 5M1OA 5KQDA 3OW2M 1NMDA 4PHTX 3SAHA 1Z6RA 2E2OA 5CE3A 5AQIA 5AQMA 2GTDA 1YHQN 3U4LA 3UB5A 3I55N 4BRIA 3ATVA 2CGKA 5AQOA 2YX6A 3DAWA 3CCMN 4BRCA 4IJAA 1D4XA 1HKCA 4BR2A 2Q2RA 3UE5A 4CZHA 4BRGA 4JKGB 2QWQA 1U2VA 3LM2A 4H5NA 4BRDA 4BQZA 3LM9A 5GAHP 1K8KB 3EKSA 5M1NA 3C7NB 3EE9A 4BR9A 4JKAA 3CC7N 3L0QA 2KLAA 3IFRA 4CZIA 1BUPA 3DLLL 3UKRA 1TYQB 2Q1NA 1SS6A 1DGKN 4ISEA 3R8EA 3RVCA 1KXPA 4UY8O 3HSCA 3KK7A 4FWSA 4L3QA 4RTFD 5EVZA 1BA0A 3BUZB 3E9LA 3O9QA 3VENA 3D2FA 5MLCQ 2WUSA 5GAGP 3VEWA 3UKUA 2JWLA 3ZETA 2E2PA 4BREA 3MK6A 3N4QA 1U2VB 1P90A 1IG8A 3LDPA 4J8FA 3RSEA 3K9KA 3CJ7A 3HBTA 2NRVA 3HRGA 4CZGA 2YHYA 4U67L 2HBKA 3MN9A 4IEIA 4OPHA 5C2FA 2P9IA 5AR0A 2E88A 3DWLA 5CR4A 5FPEA 4AF1A 2V51B 3EN9A 5AQZA 4A2AA 4H0YB 1VQNN 5E84A 3UKUB 3P31A 3G4SN 3E9OA 4H5VA 4JN4A 3HM8A 3ZX0A 4CZFA 4Y0WA 3KVGA 4LC9B 4BRPA 4FOIA 3VF6A 2GELA 3BF1A 3SAGA 4H0OA 4FPBA 1YI2N 1GLJO 1XC3A 2P9IB 3EO3A 1T6CA 4HTLA 3TPQA 1T3VA 5AQNA 5AQUA 1W2BM 3VOVA 3PLAA 2YHWA 1BO5O 4H5TA 1EO1A 4CJ7A 4FWRA 3CD6N 3CMEN 2FSKA 2AA4A 5AQLA 2QXLA 3VF2A 3P4IA 3SAFA 1TUYA 1GLFO 1GLBG 3OHRA 3GL1A 2NLXA 3VEOA 2QWLA 4KH4A 5KPTA 5AQKA 2P9NA 3ULEA 4M63C 4C1NI 1NGAA 1BWFO 1NGFA 2D0OA 3FR0A 2JWKA 3O5BA 4NLBA 1HPMA 2V52B 3QDKA 4EHTA 5ADXA 2AP1A 5M1QA 4H5WA 3L6QA 3WQTA 4K42A 3NVMA 4K25A 4KBOA 3WEEA 1ESVA 2VGNA 4YDUA 3CETA 3CJ1A 3R3LA 3VGKA 4WQ5A 1NGHA 5FPDA 1BU6O 1HKBA 2YCHA 4M7YA 4FWLA 1NBWA 4BVOA 4IXCA 4CZKA 4CZJA 5JLFA 3O9UA 4WFBL 3J7ZO 4BR0A 2PAVA 3JXUA 3CERA 5JMVA 1JJ2M 2IVNA 3F2KA 3VEYA 5C12A 4H5RA 3A5LC 3TTCA 5BRHA 2P9LB 3VEZA 3MX2A 4FWOA 4PL7A 5EY4A 4BRAA 3C0BA 4JKFA 3H6EA 4DQ8A 5KQ8A 3Q7BA 3SMSA 4GY2B 4BC5A 5AFUH 5JVHL 4IOAL 4BGBA 4ILJA 3A5OC 4A61A 3ZETB 1DEJA 1VQ4N 4JK7A 1NWKA 5AQWA 3EL2A 1MDUB 4BG8A 5JLHA 1LOTB 2GUPA 2A40A 5FPNA 3C6HA 4I6MB 4H0XB 4BGAA 4XEIA 3PIPL 3AARA 1BOTO 3IKMA 4B1UB 5CHIA 1IJJA 2Q97A 3O6WA 2CGJA 1GLCG 4JK8A 5AQVA 4C1NK 2P9PB 1BG3A 4WQ5C 1YJNN 3FZHA 2ZJRL 1HJOA 1ILYA 4A57A 2OTLN 1QHAA 3FZLA 3QBWA 4QS9A 4NLCA 1NGBA 2E1YA 4JHDB 4MDBA 3QB0A 1MWMA 4GV9A 3M1FA 3TU5A 3O8MA 1DT9A 5FPMA 1YJ9N 4IJNA 4B1WB 4FVUA 4JNEA 3O9TA 1QQMA 3TSQA 4BROA 2NRXA 4YOYA 2P9KB 3ZEUA 3ID6A 3WXIA 3P38A 5AQXA 4IOCL 5EXWA 4JEPA 2IVPA 4EHUA 2EWSA 3O08A 5AQJA 4BRLA 1NGIA 5AZIB 3SJHA 5B8HA 2QEXN 1NGDA 1Z05A 2GWJA 5C15A 4FL9A 4JHDA 1VQ5N 3FLCO 3R1XA 1R59O 4EIAA 1QVFM 4KH5A 2WBNA 4BRNA 2A5XA 5LJWA 4EFHA 5I9EB 5BRFA 3CI5A 5GIPA 3U8XA 5E26A 3A5MC 4PKHA 4BY9C 3H45C 2FF6A 3LL3A 1YAGA 5GADP 4FWQA 3N4PA 5C0YA 3ZX2A 4QS8A 3QMLA 1KQSM 2NRRA 4JKBA 3NVKA 4JD2B 1Q81O 4PKGA 5BN9A 4O8UA 4A5BA 3W3DA 4CD3A 3P39A 4B1VA 1RFQA 2BTFA 4A59A 5AFUA 1U6ZA 3O80A 2F9WA 4GNIA 5H1SQ 4CZMA 2HBJA 3O1WA 5AZJB 1K8AO 2NRZA 1T44A 3D2EB 1TYQA 3EZWA 3H3OB 4YORA 5BPLA 1GLAG 3G25A 2VWBA 2W40A 2ZWHA 4BRKA 4CZEA 2NNWA 3DJCA 1Q7YO 2ZGYA 3MN7A 2P9SA 3EKUA 4JKEA 3CXCM 2UYTA 3CC4N 3ID8A 3VPZA 1VQ9N 2ZJPL 1X9JA 1K8KA 2Q36A 1YF5L 1MWKA 3CHWA 3CJ9A 3HZ6A 3L4IA 3KWIA 4JAXA 3AY9A 4MLEA 3I33A 5ELZA 4BC2A 3D6RA 2HOEA 5F2RA 3CF5L 4BRFA 4CBUA 1KC8O 4IWVA 4BRQA 3D2FB 3CCUN 2FSNA 4CI6A 1ATSA 4YOUA 4GV6A 3LDOA 3LDNA 1V4SA 3KHYA 1GLLO 4FSVA 4DHYA 5BPMA 4YOVA 2HBMA 2WC9A 3K9JA 3A5NC 4BR4A 1QZ5A 4BRMA 2FXUA 1NGJA 3BEXA 3CCEN 4FWNA 5LY3A 4M7XA 5JVGL 3D2EA 3EE8A 3VETA 4BC3A 4IDHA 3MCPA 3C6AA 3ZYYX 3E1YA 2H3GX 3ZX3A 3IDHA 1CZAN 4AM6A 1MA9B 5C10A 2D4WA 2D0PA 4B1YB 3WXLA 1NJIO 4YDUC 2ASPA 5ADXH 3CCQN 1ZXOA 5BPNA 3FZMA 4FOEA 3HOSA 4BG9A 3H3NO 3QICA 3CJBA 2Q0UA 4R79A 3CIPA 5AQHA 1NGEA 4MLHA 2D1KA 1W97L 1KAYA 4B1ZA 2ZGZA 2P9PA 2VCPA 3WQUA 4FWKA 4E1JA 1YJWN 1TUUA 4BVPA 3M5RA 4G9ZA 1QQNA 4K43A 4QS7A 4BRHA 2BUPA 2VGMA 3D7EO 1EQYA 3O1BA 1NLVA 4BR7A 5EOYA 5F1XA 4ILGB 2DPNA 2YHXA 3WUHA 4B9QA 4WCEL 2HF3A 2A41A 4BQLA 1K73O 2W41A 4WQ4A 2QM1A 3VERA 2ASOA 1VQLN 1HUXA 2QW9A 3MN6A 1G99A 2HF4A 3DXMA 4NO7A 2A6AA 1E4FT 3PIOL 4OO1J 2Q0RA 1HX1A 3M3ZA 2P9UB 3QFPA 4CBWA 3MX5A 3FGUA 3RSEB 2QWOA 4ILHA 5AQTA 4DCHA 2QTDA 1BDGA 3CQYA 1ATRA 3I8BA 5TKWA 4GV3A 2QA4N 2YJEA 2KHOA 1QQOA 3OA9A 3H1QA 3H46O 2GX9A 4FO0A 1SQKA 5M1KA 3HTVA 3MN5A 2PFUA 3CCJN 4H0PA 4BC4A 4EAHD 3CPWM 1SZ2A 1C0FA 4GVEA 5EX5A 3AAQA 1M1KO 3HI0A 4NB4A 5F0XA 3B8AX 3C65A 4IO8A 3TSPA 4Z94A 5KPRA 4WYBA 2FLOA 1K9MO 2F7TA 4A62A 2V7ZA 5HOOA 4I6MA 4YOWA 1HKGA 1T6DA 1HLUA 3R6MA 1NGGA 5GAEP 2V7YA 1C0GA 3FZKA 3IMXA 4JD2A 3OBYA 1YUWA 3CC2N 4DKWA 3A0IX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S41 A;  1Y64 A;  1JCG A;  4PKI A;  4WQ4 C;  1XUP O;  4CZL A;  2QWR A;  1JCE A;  3GOI A;  2ITM A;  4H03 B;  3W0L A;  1ZC6 A;  4ISF A;  3SMP A;  3FE1 A;  3IUC A;  4ISG A;  3GE1 A;  5AQG A;  4CBX A;  2E2Q A;  2QWP A;  1YVN A;  2E2N A;  5LJV A;  1YXQ A;  2FSJ A;  5TKY A;  1WUA A;  2J4R A;  3F9M A;  3GBT A;  1KAZ A;  2P9U A;  4XH1 A;  3GDQ A;  1H1V A;  1X3N A;  2ASM A;  5AZI A;  1J6Z A;  3WT0 A;  3CJA A;  2P9K A;  3ZEU B;  3LDQ A;  4HWI A;  2FF3 B;  4MO4 A;  5AZJ A;  1X3M A;  2P9N B;  3ULE B;  2QWM A;  3ATU A;  2F9T A;  4IZ9 A;  3WXK A;  2QWN A;  3J8A A;  3VF4 A;  3C7N A;  3JS6 A;  3DXK A;  3ENO A;  5BRD A;  1WOQ A;  3BF3 A;  3WXJ A;  1P8Z A;  3DXK B;  2P9L A;  2P9S B;  1V4T A;  3KZB A;  3BP8 A;  2YJF A;  2PBD A;  5AQP A;  2Q31 A;  4A2B A;  3GG4 A;  1KAX A;  2A3Z A;  3VEX A;  1RDW X;  3MDQ A;  2CGL A;  3QBX A;  2CH5 A;  4CD1 A;  1E4G T;  2I7N A;  4H0V B;  5BRE A;  5AQR A;  5BR9 A;  4H0T B;  3QFU A;  3LDL A;  3R9P A;  2I7P A;  3VES A;  2OAN A;  1Q18 A;  4BR5 A;  4XH4 A;  1S3X A;  1NM1 A;  2ZF5 O;  1LCU A;  1QZ6 A;  4FPA A;  3AAP A;  3VGL A;  2IIR A;  4O5F A;  5AQQ A;  2CH6 A;  2GEM A;  2VYP A;  3WEE B;  5AQF A;  5AQS A;  1ATN A;  4AM7 A;  4C23 A;  5KPZ A;  3H1V X;  3U9D A;  5JIC A;  3DXM B;  3CJC A;  3SLC A;  2NRH A;  2E20 A;  5AQY A;  4FWP A;  2E8A A;  2A42 A;  1SAZ A;  4K41 A;  3UKR B;  1DKG D;  5BN8 A;  1BA1 A;  3CQX A;  3A8Y A;  4XH5 A;  4F9O A;  4B1X B;  1RGI A;  3U9Z A;  2GWK A;  2YI1 A;  3SK3 A;  4FWM A;  4RWT A;  2HMP A;  1GLE G;  3VGM A;  3FZF A;  4MO5 A;  2NZT A;  1ZBS A;  3ENH A;  4PL8 A;  4RCH A;  3MMV A;  4DB3 A;  3FFK B;  2IVO A;  3O4W A;  3VEV A;  1GLD G;  1JCF A;  1S22 A;  3M6G A;  1NGC A;  1OKJ A;  2E1Z A;  4O8K A;  1XQS C;  1NMD A;  1Z6R A;  2E2O A;  5CE3 A;  5AQI A;  5AQM A;  2GTD A;  3U4L A;  3UB5 A;  4BRI A;  3ATV A;  2CGK A;  5AQO A;  3DAW A;  4BRC A;  4IJA A;  1D4X A;  1HKC A;  4BR2 A;  2Q2R A;  3UE5 A;  4CZH A;  4BRG A;  2QWQ A;  1U2V A;  3LM2 A;  4H5N A;  4BRD A;  4BQZ A;  3LM9 A;  1K8K B;  3EKS A;  3C7N B;  4BR9 A;  3L0Q A;  3IFR A;  4CZI A;  1BUP A;  3UKR A;  1TYQ B;  2Q1N A;  1DGK N;  4ISE A;  3R8E A;  1KXP A;  3HSC A;  4FWS A;  4L3Q A;  4RTF D;  5EVZ A;  1BA0 A;  3BUZ B;  3VEN A;  3D2F A;  2WUS A;  3VEW A;  3UKU A;  3ZET A;  2E2P A;  4BRE A;  3MK6 A;  1U2V B;  1IG8 A;  3LDP A;  4J8F A;  3RSE A;  3CJ7 A;  3HBT A;  5KQD A;  4CZG A;  2YHY A;  3MN9 A;  2P9I A;  5AR0 A;  2E88 A;  3DWL A;  5FPE A;  2V51 B;  3EN9 A;  5AQZ A;  4A2A A;  4H0Y B;  5E84 A;  3UKU B;  4H5V A;  4JN4 A;  3HM8 A;  3ZX0 A;  4CZF A;  4Y0W A;  3KVG A;  4LC9 B;  4BRP A;  4FOI A;  3VF6 A;  2GEL A;  3BF1 A;  4H0O A;  4FPB A;  1GLJ O;  1XC3 A;  2P9I B;  3EO3 A;  1T6C A;  4HTL A;  3TPQ A;  5AQN A;  5AQU A;  3VOV A;  2YHW A;  1BO5 O;  4H5T A;  4CJ7 A;  4FWR A;  2FSK A;  2AA4 A;  5AQL A;  2QXL A;  3VF2 A;  3P4I A;  1TUY A;  1GLF O;  1GLB G;  3OHR A;  3GL1 A;  2NLX A;  3VEO A;  2QWL A;  5KPT A;  5AQK A;  2P9N A;  3ULE A;  4M63 C;  1NGA A;  1BWF O;  1NGF A;  2D0O A;  3FR0 A;  3O5B A;  1HPM A;  2V52 B;  3QDK A;  4EHT A;  5ADX A;  2AP1 A;  4H5W A;  3L6Q A;  3WQT A;  4K42 A;  4K25 A;  4KBO A;  3WEE A;  1ESV A;  4YDU A;  3CET A;  3CJ1 A;  3VGK A;  4WQ5 A;  1NGH A;  5FPD A;  1BU6 O;  1HKB A;  2YCH A;  4M7Y A;  4FWL A;  1NBW A;  4BVO A;  4IXC A;  4CZK A;  4CZJ A;  5JLF A;  4BR0 A;  2PAV A;  3JXU A;  3CER A;  5JMV A;  2IVN A;  3VEY A;  4H5R A;  3A5L C;  5BRH A;  2P9L B;  3VEZ A;  4FWO A;  4PL7 A;  5EY4 A;  4BRA A;  3C0B A;  3H6E A;  4DQ8 A;  5KQ8 A;  4BC5 A;  3SMS A;  4GY2 B;  5AFU H;  4BGB A;  3A5O C;  4A61 A;  3ZET B;  1DEJ A;  1NWK A;  5AQW A;  3EL2 A;  1MDU B;  4BG8 A;  5JLH A;  1LOT B;  2GUP A;  2A40 A;  5FPN A;  4I6M B;  4H0X B;  4BGA A;  4XEI A;  3AAR A;  1BOT O;  4B1U B;  1IJJ A;  2Q97 A;  3O6W A;  2CGJ A;  1GLC G;  5AQV A;  2P9P B;  1BG3 A;  4WQ5 C;  3FZH A;  1HJO A;  1QHA A;  3FZL A;  3QBW A;  4QS9 A;  1NGB A;  2E1Y A;  4JHD B;  3QB0 A;  1MWM A;  3M1F A;  3TU5 A;  3O8M A;  5FPM A;  4IJN A;  4B1W B;  4JNE A;  1QQM A;  4BRO A;  2P9K B;  3ZEU A;  3WXI A;  5AQX A;  5EXW A;  2IVP A;  4EHU A;  2EWS A;  3O08 A;  5AQJ A;  4BRL A;  1NGI A;  5AZI B;  3SJH A;  5B8H A;  1NGD A;  1Z05 A;  2GWJ A;  4FL9 A;  4JHD A;  3FLC O;  1R59 O;  4EIA A;  4BRN A;  2A5X A;  5LJW A;  4EFH A;  5I9E B;  5BRF A;  3CI5 A;  3U8X A;  5E26 A;  3A5M C;  4PKH A;  3H45 C;  2FF6 A;  3LL3 A;  1YAG A;  4FWQ A;  3ZX2 A;  4QS8 A;  3QML A;  4JD2 B;  4PKG A;  5BN9 A;  4CD3 A;  3W3D A;  4B1V A;  1RFQ A;  2BTF A;  5AFU A;  1U6Z A;  3O80 A;  2F9W A;  4GNI A;  4CZM A;  3O1W A;  5AZJ B;  1T44 A;  3D2E B;  1TYQ A;  3EZW A;  3H3O B;  5BPL A;  1GLA G;  3G25 A;  2VWB A;  2W40 A;  2ZWH A;  4BRK A;  4CZE A;  3DJC A;  2ZGY A;  3MN7 A;  2P9S A;  3EKU A;  2UYT A;  3ID8 A;  3VPZ A;  1X9J A;  1K8K A;  2Q36 A;  3CJ9 A;  1MWK A;  3CHW A;  4JAX A;  3HZ6 A;  3L4I A;  4MLE A;  5ELZ A;  3AY9 A;  3I33 A;  4BC2 A;  2HOE A;  5F2R A;  4BRF A;  4CBU A;  4IWV A;  4BRQ A;  3D2F B;  2FSN A;  4CI6 A;  1ATS A;  3LDO A;  3LDN A;  1V4S A;  3KHY A;  1GLL O;  4FSV A;  4DHY A;  5BPM A;  3A5N C;  4BR4 A;  1QZ5 A;  4BRM A;  2FXU A;  1NGJ A;  3BEX A;  4FWN A;  5LY3 A;  4M7X A;  3D2E A;  3VET A;  4BC3 A;  3MCP A;  2H3G X;  3ZX3 A;  3IDH A;  1CZA N;  4AM6 A;  1MA9 B;  2D4W A;  2D0P A;  4B1Y B;  3WXL A;  4YDU C;  2ASP A;  5ADX H;  1ZXO A;  5BPN A;  3FZM A;  4FOE A;  4BG9 A;  3H3N O;  3QIC A;  3CJB A;  2Q0U A;  3CIP A;  5AQH A;  1NGE A;  4MLH A;  2D1K A;  1KAY A;  4B1Z A;  2ZGZ A;  2P9P A;  2VCP A;  3WQU A;  4FWK A;  4E1J A;  1TUU A;  4BVP A;  1QQN A;  4K43 A;  4QS7 A;  4BRH A;  2BUP A;  3D7E O;  3O1B A;  1EQY A;  4BR7 A;  1NLV A;  5EOY A;  5F1X A;  2DPN A;  2YHX A;  3WUH A;  4B9Q A;  2HF3 A;  2A41 A;  4BQL A;  2W41 A;  4WQ4 A;  2QM1 A;  3VER A;  2ASO A;  1HUX A;  2QW9 A;  3MN6 A;  1G99 A;  2HF4 A;  3DXM A;  4NO7 A;  2A6A A;  1E4F T;  2Q0R A;  1HX1 A;  3M3Z A;  2P9U B;  3QFP A;  4CBW A;  3FGU A;  3RSE B;  2QWO A;  4DCH A;  5AQT A;  1BDG A;  3CQY A;  1ATR A;  3I8B A;  2YJE A;  2KHO A;  1QQO A;  3H1Q A;  3H46 O;  4FO0 A;  1SQK A;  3HTV A;  3MN5 A;  4H0P A;  4BC4 A;  4EAH D;  1SZ2 A;  1C0F A;  5EX5 A;  3AAQ A;  3HI0 A;  4NB4 A;  5F0X A;  3B8A X;  4IO8 A;  4Z94 A;  5KPR A;  4WYB A;  2FLO A;  4A62 A;  2V7Z A;  4I6M A;  1HKG A;  1T6D A;  1HLU A;  3R6M A;  1NGG A;  2V7Y A;  1C0G A;  3FZK A;  3IMX A;  4JD2 A;  1YUW A;  3A0I X; 
#chains in the Genus database with same CATH topology
 2BAN A;  4FJM A;  3RRG A;  1EET A;  3GOI A;  2ITM A;  4FJ7 A;  1TKZ A;  1ZC6 A;  1RDA A;  3FE1 A;  2O4G A;  3ZT4 A;  1Q82 O;  3DLK A;  3KLE A;  2UXB K;  5M1P A;  1UAX A;  4NXN K;  3S9H A;  2E2N A;  1RBR A;  3CPE A;  4RG8 A;  4YNQ A;  4QOZ B;  1SL0 A;  2P9U A;  4FK0 A;  1NNE A;  5DM6 L;  1NJX A;  3VQ4 A;  5AZJ A;  4FYD A;  2P9N B;  3F5T A;  2QWM A;  2YNG A;  1KCF A;  3WXK A;  2QWN A;  4O0J A;  4W5R A;  1RNH A;  3HPG A;  3THY A;  4KFB A;  1FW6 A;  4IOX A;  1BQM A;  3BF3 A;  4JK9 A;  3WXJ A;  4U7B A;  3J80 O;  4DQP A;  1O13 A;  2P9L A;  2Z1I A;  1NK4 A;  4WFA L;  4DS4 A;  3KJV A;  3GG4 A;  1YIJ N;  1RDW X;  4B9N A;  4FJN A;  5CY4 A;  4NCG A;  4FJ8 A;  1VQM N;  2I7N A;  3ZSZ A;  4JV5 K;  3QFU A;  3ZSY A;  2I7P A;  1IO2 A;  3AVM A;  4XH4 A;  1QTM A;  1CXU A;  4CJL A;  2A1R A;  1RDU A;  1LCU A;  3OYB A;  3NMU A;  2BDP A;  1S1X A;  4FZX C;  4F4K A;  5AQQ A;  4AHS A;  5CYM A;  4JKC A;  4K0K K;  3WEE B;  5AQS A;  4IG3 A;  3SBT A;  3VMF B;  4FWP A;  2E8A A;  3UKR B;  4JI7 K;  3VTH A;  1DKG D;  4CIF A;  2FBT A;  1RGI A;  4C8N A;  2Y1J A;  3PO5 A;  3PSI A;  2YI1 A;  3SK3 A;  1D9D A;  3E66 A;  4JI2 K;  1QHT A;  4JI6 K;  3G6E N;  4DSF A;  1ZBS A;  3ENH A;  2HHS A;  3MMV A;  1HQE A;  3KD1 E;  3FFK B;  1KD1 O;  2IVO A;  3CCL N;  1L3V A;  2DFF A;  1D8Y A;  3IRX A;  4CJT A;  1JCF A;  3M6G A;  4CFB A;  1Z26 A;  4DTJ A;  5HLF A;  3VN5 A;  2D0B A;  3L4Q A;  5DMR A;  3WNE A;  1NMD A;  1WSG A;  4OKK A;  4X64 K;  1Z6R A;  1TGO A;  2E2O A;  5CE3 A;  1RDC A;  3HJF A;  3NDK A;  3U4L A;  3UB5 A;  3I55 N;  4JRP A;  2YX6 A;  4CEC A;  3CCM N;  4BRC A;  4DR6 K;  3UE5 A;  4BRG A;  4H5N A;  5GAH P;  1T05 A;  4CIG A;  3IFR A;  1BUP A;  2HHU A;  2FBY A;  1TYQ B;  3UKR A;  4ISE A;  3R8E A;  4M42 A;  3KK7 A;  4FWS A;  4L3Q A;  4RTF D;  5EVZ A;  3S3O A;  1BA0 A;  3O9Q A;  3E9L A;  3VEN A;  3D2F A;  1WSE A;  3AVN A;  3VEW A;  4CVN E;  3UKU A;  2JWL A;  1W7A A;  4JI3 K;  3NHG A;  3ZET A;  2E2P A;  4BRE A;  1A5W A;  1U2V B;  4KO0 A;  1W0H A;  3THW B;  4W5O A;  2IOC A;  4PA1 A;  1SKS A;  4J8F A;  3SZ2 A;  3HBT A;  4U67 L;  5C2F A;  3V9Z A;  3OYH A;  3U3G A;  4CF1 A;  3DWL A;  3EN9 A;  1G15 A;  5AQZ A;  1RTJ A;  3JAM O;  4YFU A;  2KW4 A;  3E9O A;  4H5V A;  1TKX A;  3V81 A;  3ZX0 A;  4O4G A;  4N56 A;  3SUQ A;  4DTP A;  3VF6 A;  1WLJ A;  1RT5 A;  1YI2 N;  4HTL A;  3TPQ A;  5AQN A;  2KFN A;  2OCE A;  1W2B M;  2OZM A;  4CEO A;  3CD6 N;  1J9A A;  3MEE A;  3ZSR A;  3CME N;  3ZSW A;  4FJL A;  2FC0 A;  5J2M A;  3VEO A;  3P1G A;  3LP1 A;  3OY9 A;  4JI1 K;  4E1M A;  3O5B A;  4OVL A;  1HPM A;  4EHT A;  3QDK A;  5ADX A;  4H5W A;  4DR7 K;  3WQT A;  2O8B B;  4TSX A;  4K42 A;  3HP9 A;  4KBO A;  4M3X A;  3WEE A;  1ESV A;  3CET A;  3CJ1 A;  4FLX A;  4WQ5 A;  5I42 A;  1TVR A;  4E3S A;  1NBW A;  4CZK A;  4IXC A;  4CZJ A;  4M3U A;  1IV0 A;  5J2P A;  1XMO K;  2IVN A;  2QK9 A;  1R0A A;  4EP5 A;  4BRA A;  3KK1 A;  3H6E A;  3QLH A;  4DQ8 A;  5KQ8 A;  4IOA L;  3OYE A;  5AFU H;  3A5O C;  4N41 A;  4QCL A;  3RR7 A;  5JLH A;  3DLE A;  4FZZ A;  4B1U B;  5CHI A;  3KLF A;  1SUQ A;  4DV3 K;  4CEQ A;  4CJ5 A;  3OYA A;  4DF4 A;  2KZZ A;  4CW7 B;  4CJ4 A;  2OTL N;  1QHA A;  4K8X A;  4RW7 A;  3ITH A;  4JHD B;  4CGH A;  4Q0B A;  1RBU A;  1VSH A;  4GW6 A;  4BRO A;  2XY6 A;  3P38 A;  1GOB A;  5EXW A;  5HRP A;  4JEP A;  4NYN A;  2IVP A;  2EWS A;  5AQJ A;  4BRL A;  1NGI A;  5AZI B;  4FJH A;  4OPK A;  1X9W A;  4FL9 A;  2FBV A;  1NKE A;  3FLC O;  3PSF A;  4FW1 A;  4EIA A;  3T1A A;  1QVF M;  2WBN A;  3AVL A;  1W9H A;  1J53 A;  3OVN A;  1ITG A;  5GAD P;  5C0Y A;  3HXM A;  5C24 A;  1NK8 A;  4FM0 A;  4E7J A;  4PUO A;  4CGD A;  4B3O A;  1Q81 O;  4AHT A;  1J5O A;  5BN9 A;  3W3D A;  3P39 A;  1Y97 A;  1U6Z A;  3O80 A;  5H1S Q;  3NH0 A;  1WBB A;  1K8A O;  1DLO A;  1T44 A;  3EZW A;  4CZE A;  2B4J A;  3DJC A;  4CK3 A;  4LY7 A;  4BDY A;  2P9S A;  3CXC M;  4GKJ K;  4Q5V A;  3PX0 A;  2Q36 A;  1YF5 L;  3NBP A;  1MWK A;  2XO7 A;  2X6N A;  4EZ9 A;  3AY9 A;  3VQQ A;  4BC2 A;  3D6R A;  4BRF A;  4CBU A;  1KC8 O;  4IWV A;  1A5X A;  4O44 A;  2GV9 A;  4DLG A;  4CFC A;  3A5N C;  2ZQB A;  4FWN A;  4J2B A;  3EE8 A;  3OS1 A;  4IDH A;  3L3V A;  3JYT A;  3E1Y A;  4AM6 A;  4DR1 K;  3KLG A;  2F4V K;  3T19 A;  3DI6 A;  1NJI O;  2ASP A;  4NCA A;  2HHH K;  4F3T A;  3FZM A;  3HOS A;  1BQN A;  3CJB A;  2Q0U A;  4DR3 K;  4DSJ A;  1LW0 A;  3OJU A;  4MLH A;  4AHU A;  1YJW N;  3WQU A;  4FWK A;  1TUU A;  3M5R A;  1QQN A;  2YNF A;  3M8Q A;  5EOY A;  4ILG B;  3SUO A;  1RDB A;  2DPN A;  3AVJ A;  3O4Q A;  1ZYQ A;  3AA4 A;  1K73 O;  1IKW A;  1TK0 A;  4BE0 A;  4R5P A;  3TAB A;  1VQL N;  4OKJ A;  4NO7 A;  4DV0 K;  1E4F T;  5CZ1 A;  4OO1 J;  2Q0R A;  4RW9 A;  1HNZ K;  3SQ4 A;  4CBW A;  3MX5 A;  1TL3 A;  4KTW A;  3FGU A;  4ILH A;  5AQT A;  1BDG A;  1ATR A;  1FXX A;  4LF7 K;  4CJW A;  3ZLJ A;  2GX9 A;  4LFA K;  1LAV A;  2PFU A;  4GVE A;  2YNH A;  4BWJ A;  3NE6 A;  3RWU A;  2I5J A;  3B8A X;  3C65 A;  4WYB A;  2FLO A;  4I6M A;  2XHB A;  3LWL A;  1HKG A;  3NFA A;  4B9L A;  2IDO A;  1LWC A;  1UA1 A;  4KHY A;  4JD2 A;  4CCH A;  3MN7 A;  3LP3 A;  3O3F A;  4WF9 L;  1IBM K;  2QWR A;  1JCE A;  5DM7 L;  3CCS N;  4H03 B;  3W0L A;  1U49 A;  4M3R A;  1E3M A;  4ISF A;  4OJR A;  4ISG A;  4LF8 K;  3OS2 A;  4CBX A;  2AJQ A;  3VQ8 A;  3CFR A;  1YVN A;  5LJV A;  1YXQ A;  2FSJ A;  5TKY A;  3GBT A;  4CHQ A;  4XH1 A;  5LMN K;  3BZC A;  1H1V A;  1QSS A;  1X3N A;  2ASM A;  4ZTF A;  1J6Z A;  3WT0 A;  3CJA A;  4HWI A;  2FF3 B;  2O8B A;  4DQI A;  5C2D A;  4CES A;  2OYQ A;  3VQ6 A;  4CK1 A;  3J8A A;  3VF4 A;  3V4I A;  1IBL K;  3DYA A;  3JS6 A;  4C8O A;  3DXK A;  4CJK A;  3NGZ A;  4PQU A;  4JKG A;  3HVR A;  3LAN A;  3PV8 A;  1I39 A;  4DV7 K;  4JKD A;  2P9S B;  3KZB A;  3BP8 A;  2UUA K;  4A2B A;  3OYJ A;  4AH9 A;  4KRF A;  3VEX A;  3MDQ A;  1N8R O;  2PYL A;  1JLE A;  1VAZ A;  4H0V B;  3LPU A;  3AGK A;  2ATQ A;  1TK8 A;  2HHT A;  4FLT A;  4W5N A;  4JS4 A;  5A2Q O;  3RRH A;  3ENB A;  4I9L A;  1KTQ A;  2RF2 A;  4CF2 A;  3LDS A;  3VES A;  1X1P A;  3BY5 A;  4Z4C A;  4BDP A;  2VWK A;  1S3X A;  1TAU A;  1NM1 A;  3PX4 A;  5HRO A;  4KI6 A;  4FPA A;  1JLQ A;  3VGL A;  2QKK A;  2DFE A;  2Z1J A;  3T69 A;  3KLI A;  1KVA A;  3CCV N;  1C0M A;  3THV A;  4AM7 A;  4CK2 A;  3DXM B;  4LH5 A;  2NRH A;  2NRW A;  2A1S A;  3VQA A;  2O8D B;  2A42 A;  1SAZ A;  3SI6 A;  1S9E A;  1BGX T;  5JS2 A;  2KKZ A;  4FVM A;  4O5B A;  1C0T A;  4A5A A;  3HP6 A;  5C42 A;  3FZF A;  3C95 A;  4OPA A;  2RE2 A;  2NZT A;  4PL8 A;  1M90 O;  1JL1 A;  5HRS A;  4DB3 A;  1NKC A;  4MDA A;  5SZT A;  1ASW A;  4YOT A;  1EKE A;  4CEA A;  5GIN A;  1NGC A;  1IG9 A;  1OKJ A;  4IFE A;  1XQS C;  5M1O A;  3OW2 M;  5LL6 Z;  3AVK A;  1B92 A;  3K5N A;  1J5E K;  4PHT X;  3B6P A;  2OA8 A;  5KRS A;  3LPT A;  3P5J A;  4CIE A;  3OYN A;  4DR5 K;  1YHQ N;  2HVH A;  3TR8 A;  5AQO A;  3K0S A;  4N76 A;  4Z0U A;  3C94 A;  1HKC A;  2Q2R A;  3H08 A;  1BIU A;  2QWQ A;  1U2V A;  4BQZ A;  1EWR A;  3EKS A;  4HUF A;  4KAZ A;  5M1N A;  2JGU A;  3C7N B;  3EE9 A;  4KTZ A;  4CJE A;  4DG1 A;  2KLA A;  4CZI A;  3DLL L;  4KHU A;  2Q1N A;  1HR0 K;  1SS6 A;  4UY8 O;  4FJ5 A;  2P1J A;  4CE9 A;  3BUZ B;  4ID5 A;  4DFJ A;  5CZ2 A;  1WAJ A;  4FJ9 A;  1P90 A;  3ZT1 A;  3DRR A;  3AVB A;  3CM6 A;  1KVC A;  5AJ3 K;  3HO1 A;  3OYM A;  3O3G A;  2F96 A;  1ZBL A;  1JXB A;  1N32 K;  5CR4 A;  2V51 B;  3V1O A;  4H0Y B;  1VQN N;  5E84 A;  3P31 A;  3G4S N;  3KKR A;  4JN4 A;  3MED A;  3HM8 A;  2UXC K;  1QS4 A;  2KQ2 A;  3K5M A;  3HST B;  4Y0W A;  1FKO A;  3KVG A;  4LC9 B;  3AO1 A;  4BRP A;  4MQ3 A;  3HYF A;  3QIP A;  3AVH A;  4H0O A;  4ELV A;  1GLJ O;  2P9I B;  3D45 A;  4J2A A;  2O4I A;  1HYV A;  1RTD A;  5J2Q A;  1BO5 O;  1RT2 A;  4CJ7 A;  3SQ2 A;  1HNX K;  4CHO A;  4JRQ A;  4HHT A;  4DSI A;  4Z4E A;  1RT1 A;  3SAF A;  3GL1 A;  3HK2 A;  4KH4 A;  2DY4 A;  5AQK A;  3HM9 A;  4DSL A;  4C1N I;  4M63 C;  4LSL A;  1NGA A;  4LF4 K;  2D0O A;  1NGF A;  2JWK A;  4NLB A;  2V52 B;  3TAE A;  2AP1 A;  1L5U A;  3L6Q A;  3IS9 A;  4FLV A;  4K25 A;  4E0D A;  4C8M A;  4YDU A;  4CGI A;  5FPD A;  1HKB A;  2YCH A;  4FWL A;  1TKT A;  5I3U A;  5C12 A;  4H5R A;  3TTC A;  3JSM A;  1BIZ A;  4J2E A;  2P9L B;  3OYL A;  1RT7 A;  4FWO A;  3U6F A;  4BE2 A;  4JKF A;  4IG0 A;  3KIO A;  4GY2 B;  3NCI A;  1NWK A;  3EL2 A;  1MDU B;  1LOT B;  4M41 A;  4M3Z A;  2GUP A;  4DWI A;  1RIL A;  3C6H A;  4I6M B;  4BGA A;  2W6L A;  3AAR A;  3IKM A;  3NH2 A;  2G8I A;  2B6A A;  2HVI A;  4FLY A;  2P9P B;  3RMB A;  3TAG A;  1BG3 A;  1UOC A;  4DF8 A;  4A57 A;  4NLC A;  1WNS A;  4FLW A;  4FW2 A;  3HT3 A;  4MDB A;  2KZM A;  3KTQ A;  2EHG A;  5KGW A;  1MWM A;  3A2F A;  3AVA A;  3J7Y P;  4GV9 A;  4L8R B;  4FK2 A;  3TAQ A;  4IJN A;  3VQC A;  1QQM A;  4Y1C A;  4CEB A;  2NRX A;  2O8F B;  2P9K B;  3ID6 A;  1CZ9 A;  5B8H A;  3NF6 A;  4FJG A;  3SQ1 A;  5J2N A;  4DV4 K;  4BRN A;  1OH6 A;  2A5X A;  3HVT A;  4O55 A;  4EFH A;  1KFD A;  4KHQ A;  5GIP A;  3U8X A;  4KTQ A;  4BY9 C;  4HUE A;  4ELU A;  2VG5 A;  3N4P A;  4QS8 A;  2ZD1 A;  3QML A;  2D5R A;  2NRR A;  3CM5 A;  3NVK A;  4ELT A;  3NH1 A;  1S9G A;  2BGG A;  4CD3 A;  1KFS A;  1RFQ A;  4GNI A;  2HBJ A;  1TYQ A;  3H3O B;  4I2P A;  1GLA G;  2W40 A;  5LMU K;  4BRK A;  4DUY K;  4IFV A;  3EKU A;  4JKE A;  1SKW A;  2UYT A;  3VPZ A;  1K8K A;  4N5S A;  4E7H A;  1L3S A;  4MLE A;  3OS0 A;  2PZS A;  1HYZ A;  5F2R A;  3RMC A;  3HPO A;  4F3O A;  2FSN A;  4CI6 A;  1ATS A;  4GV6 A;  3LDN A;  4DR2 K;  4V19 S;  4LF6 K;  4FSV A;  4NXM K;  3CCE N;  3VA3 A;  1XNQ K;  1Q9Y A;  1HNW K;  3C6A A;  3KKS A;  1QQC A;  1RCH A;  3ZYY X;  4AHV A;  4B8C A;  1KLM A;  1OH8 A;  4YDU C;  5ADX H;  3CCQ N;  5BPN A;  4BG9 A;  1WSJ A;  3H3N O;  3QIC A;  4R79 A;  1REV A;  4F2R A;  4OKE A;  1JLF A;  1W97 L;  3RMA A;  4B9V A;  2VCP A;  4EZ6 A;  1N34 K;  1RT4 A;  2UU9 K;  4BVP A;  3QNN A;  2D0C A;  4K43 A;  3ZT2 A;  4JI0 K;  4BRH A;  2BUP A;  2VGM A;  3D7E O;  1EQY A;  3O1B A;  1NLV A;  2UUC K;  2O8C A;  5F1X A;  1O1W A;  4B9Q A;  3AVF A;  1GOA A;  4BQL A;  1JLB A;  3WNG A;  1QSY A;  4FJX A;  1IKX A;  1B9F A;  5SWM A;  4M3W A;  1G99 A;  2HF4 A;  2O8E B;  3PIO L;  1HX1 A;  4HTU A;  3RSE B;  1JKH A;  2QWO A;  2HND A;  2QTD A;  2E6M A;  1IBK K;  3QES A;  4CHZ A;  2QA4 N;  1BHL A;  3BDP A;  3OA9 A;  3H46 O;  2PY5 A;  3EEQ A;  1ZBF A;  3HTV A;  3MN5 A;  1NOY A;  3QO9 A;  4H0P A;  3VQ7 A;  1WB9 A;  3LAL A;  3CPW M;  4CEE A;  1C0F A;  2WOM A;  3AAQ A;  2W42 A;  1NK5 A;  4OGC A;  5KPR A;  3SUP A;  2V7Z A;  3ZSV A;  1WN7 A;  4DS5 A;  1T6D A;  3R6M A;  4DFK A;  1C0G A;  4FLZ A;  3A0I X;  1Y64 A;  1JCG A;  4PKI A;  4E89 A;  2IGI A;  3TTF A;  3SMP A;  2HHX A;  3QET A;  4E7L A;  2BH1 A;  2E2Q A;  2QWP A;  1EP4 A;  2JLE A;  4JI4 K;  4E1N A;  1WUA A;  2ZE2 A;  1D9F A;  2G8F A;  5M1F A;  3LP0 A;  3GDQ A;  3SQ0 A;  1Z25 A;  3J7A P;  5AZI A;  3TAR A;  4AQY K;  1U4B A;  3ZEU B;  3LDQ A;  4MO4 A;  3AO4 A;  3M8R A;  2OPP A;  1TL1 A;  2F9T A;  4IZ9 A;  2OZS A;  4IBN A;  3C7N A;  3ENO A;  2P5G A;  5BRD A;  3ZSQ A;  4AIL C;  1WSI A;  4KH6 A;  1YIT N;  1HMV A;  1VSJ A;  4CFD A;  1VQP N;  4CJV A;  1V4T A;  5HL7 L;  3VTI A;  4MFB A;  1BCM A;  4FK4 A;  2Q31 A;  4IO9 L;  2HBL A;  3QNO A;  1KAX A;  3OBW A;  2A3Z A;  3EY1 A;  2HHV A;  2OTJ N;  3QBX A;  4CD1 A;  1VQ6 N;  5BRE A;  3VQE A;  2P51 A;  5AQR A;  1ZBI A;  2HHW A;  3I8D A;  3KD5 E;  5DK5 A;  3R9P A;  4DV2 K;  2NRT A;  4YY3 K;  2OPS A;  3TAF A;  2WFB A;  2ZF5 O;  4B8A B;  3QEV A;  1QZ6 A;  3OYF A;  4DMN A;  3AAP A;  4O5F A;  1XMQ K;  3CCR N;  5GIO A;  2X74 A;  1WSH A;  4EP4 A;  4KHP K;  5AQF A;  5KPZ A;  1VQ7 N;  4IEE A;  1NU0 A;  3QEI A;  3SLC A;  1RBS A;  4DSK A;  1BI4 B;  5AQY A;  3WXM B;  3OJS A;  3L3U A;  2GUI A;  4DV1 K;  1BL3 A;  1YTU A;  3A8Y A;  3K5O A;  4F9O A;  4M45 A;  1TK5 A;  2GWK A;  3FFI A;  4RWT A;  1GLE G;  3OYD A;  3OYC A;  4AHR A;  4RCH A;  2XRI A;  3AVG A;  3SBG A;  1OVY A;  3O4W A;  3VEV A;  2RN2 A;  3WNF A;  3CFO A;  3DMJ A;  4B3S K;  2QKB A;  1S72 N;  3LAK A;  4GVM A;  2E1Z A;  3OYG A;  1L3T A;  4CGJ A;  3SAH A;  5AQI A;  1VSM A;  2GTD A;  2WON A;  1XNR K;  5HBM A;  2G8V A;  4BRI A;  3ATV A;  2CGK A;  1JL2 A;  3TAP A;  1I3A A;  4GMJ B;  4CEZ A;  3DAW A;  1RDD A;  4IJA A;  3ZT3 A;  1S6P A;  3SV4 A;  3K59 A;  2Z1G A;  3THW A;  4CZH A;  4JKG B;  3CFP A;  3LM2 A;  4LSN A;  3LM9 A;  2FBX A;  1NOZ A;  3QEX A;  4JI8 K;  1K6Y A;  4DTS A;  4IFY A;  3UIQ A;  1DGK N;  1KXP A;  3AO5 A;  1S1U A;  5MLC Q;  3L2Q A;  2WUS A;  2X6S A;  5GAG P;  3MEG A;  4NCB A;  4OX9 K;  4PWD A;  2VQE K;  3LDP A;  5EU7 A;  1KLN A;  3CJ7 A;  2NRV A;  5KQD A;  4CZG A;  3MN9 A;  3AO3 A;  4IEI A;  4OPH A;  1C1A A;  4A2A A;  3UKU B;  4CGF A;  1EXQ A;  4FJJ A;  4DQR A;  4FM2 A;  3T1Y K;  4CZF A;  4DLE A;  4FOI A;  2GEL A;  3BF1 A;  2Y1I A;  3DM2 A;  3DOL A;  3P83 D;  3EO3 A;  1CZB A;  1T3V A;  1RT3 A;  1IKY A;  3VOV A;  1VSD A;  2YHW A;  3U3Y A;  4H5T A;  4C8L A;  1U47 A;  1EO1 A;  4FWR A;  2FSK A;  2KFZ A;  4X66 K;  2ZM6 K;  2AA4 A;  3P4I A;  1TUY A;  1GLF O;  1GLB G;  4UQG A;  5KPT A;  2P9N A;  5HRN A;  3NF8 A;  1BWF O;  3OYI A;  3K57 A;  1HYS A;  3O4N A;  3VQP A;  3PO4 A;  4BAC A;  5M1Q A;  4B3R K;  5IWA K;  4CF8 A;  3NVM A;  1KVB A;  3VQ9 A;  2VGN A;  1LV5 A;  3VGK A;  1C0U A;  1JLC A;  1LW2 A;  1BU6 O;  4M7Y A;  2WTU A;  3J7Z O;  1L3U A;  3O9U A;  5BR8 K;  4BR0 A;  2PAV A;  3JXU A;  4E19 A;  3CER A;  5JMV A;  1JJ2 M;  1C6V A;  1FK9 A;  4W5Q A;  5BRH A;  3A5L C;  4RW4 A;  5K14 A;  1NJY A;  4LFB K;  4N47 A;  4H8K A;  5JVH L;  4BC5 A;  4BGB A;  4ILJ A;  4A61 A;  2NUB A;  1DEJ A;  1OVQ A;  4JK7 A;  2YHB A;  4X65 K;  4BG8 A;  4CER A;  4NYF A;  5CYQ A;  4H0X B;  2RKI A;  4XEI A;  1KRP A;  1BOT O;  1X9S A;  2Q97 A;  4CF0 A;  2CGJ A;  1NJW A;  4JK8 A;  4FXD A;  1TKD A;  2G8W A;  1UWB A;  4CED A;  1HJO A;  1ILY A;  1CLQ A;  4BDZ A;  3QBW A;  4OLA A;  1NGB A;  2E1Y A;  4CJP A;  4OPJ A;  2UUB K;  3TU5 A;  5FPM A;  4K8Z A;  4DTO A;  4B1W B;  1NG9 A;  1OH5 A;  3TSQ A;  3ZEU A;  3WXI A;  5AQX A;  2X78 A;  3PX6 A;  3O08 A;  2PYJ A;  3SCX A;  3G10 A;  4FM1 A;  4B9M A;  2XY5 A;  2GWJ A;  2BE2 A;  4DV6 K;  3R1X A;  1VQ5 N;  3ALY A;  4KH5 A;  3V1R A;  2F8T A;  5LJW A;  5I9E B;  5BRF A;  3CI5 A;  3LZI A;  4Z4I A;  1XHZ A;  3H45 C;  1YAG A;  3V9U A;  3ZX2 A;  4JD2 B;  5HRR A;  4PKG A;  4O8U A;  4A5B A;  3TWH A;  4DU4 A;  4FJI A;  4B1V A;  3SV3 A;  3LP2 A;  3F73 A;  3J81 O;  5AFU A;  3KK2 A;  4CZM A;  3O1W A;  1BI4 A;  1XHX A;  3D2E B;  4FZY A;  1SL2 A;  2ZWH A;  2NNW A;  1Q7Y O;  2ZGY A;  3CC4 N;  3ID8 A;  1VQ9 N;  1X9J A;  3CJ9 A;  3CHW A;  3HL8 A;  3HZ6 A;  1HRH A;  3KWI A;  4FCY A;  1A5V A;  4BRQ A;  3D2F B;  4YOU A;  3LDO A;  3QIO A;  3KHY A;  1GLL O;  4YOV A;  2WC9 A;  4BR4 A;  1QZ5 A;  1VSE A;  4I7F A;  4LH4 A;  2FXU A;  5LY3 A;  5JVG L;  4M7X A;  3D2E A;  4KHW A;  3MCP A;  4FJK A;  3ZX3 A;  3IDH A;  5FRM A;  1CZA N;  1C1B A;  1SL1 A;  5C10 A;  2D4W A;  4HCB A;  4E7K A;  1ZXO A;  3NGY A;  5FDL A;  3CIP A;  1B9D A;  1NGE A;  1JLA A;  3L8B A;  2D1K A;  1KAY A;  2ZGZ A;  3D0P A;  3V9W A;  3S3M A;  4QS7 A;  3HPH A;  2HHQ A;  4DTN A;  4CGG A;  4WCE L;  2HF3 A;  2IC3 A;  4KHS A;  1NK9 A;  2W41 A;  4HCC A;  2QM1 A;  3V9X A;  3QEP A;  3VER A;  1HUX A;  3T1H K;  2A6A A;  1T7P A;  1ASU A;  2VG6 A;  3M3Z A;  1VHX A;  3QFP A;  4C8K A;  1XWL A;  4DCH A;  3NF7 A;  3L2R A;  1NJZ A;  3I8B A;  4CJF A;  3LZJ A;  4GV3 A;  2YJE A;  1QQO A;  4LF9 K;  3M8P A;  1SQK A;  2E6L A;  2XY7 A;  4BC4 A;  4I9Q A;  3E01 A;  4J2D A;  1M1K O;  3HI0 A;  4JI5 K;  1F21 A;  4IO8 A;  2O8D A;  1U04 A;  3TSP A;  4Z94 A;  2F7T A;  4A62 A;  1S6Q A;  4JLH A;  1NGG A;  4DR4 K;  2V7Y A;  2B5J A;  3FZK A;  3IMX A;  3OBY A;  1YUW A;  3QEW A;  4DKW A;  4KKO A;  5F0X A;  3S41 A;  4WQ4 C;  2LSN A;  3CYM A;  1XUP O;  1Q86 O;  4CZL A;  3BGR A;  1VSL A;  2ITG A;  5D3G A;  2RHK A;  3TSU A;  5KI6 A;  1RT6 A;  4LD0 A;  1IH7 A;  3IUC A;  3KLH A;  3SPY A;  3GE1 A;  5AQG A;  3IG1 A;  3V9S A;  2IAJ A;  4ICL A;  3MWP A;  4Y1D A;  3HOT A;  1U45 A;  2DTU A;  2J4R A;  3F9M A;  3I56 N;  1KAZ A;  4QAG A;  3AGR A;  3MEC A;  2P9K A;  3K58 A;  3O9R A;  5FRO A;  3LWM A;  1VSK A;  1X3M A;  2VWJ A;  3AA3 A;  3ULE B;  4JYA K;  3ATU A;  3B6O A;  3G0Z A;  2G8H A;  3ULD A;  2O8C B;  4BWM A;  3DOK A;  1WOQ A;  3F9K A;  1I94 K;  4OLB A;  3ISN C;  3TAN A;  3VQD A;  1P8Z A;  3TTD A;  4E7I A;  1YTA A;  3DXK B;  1NMN A;  2IS3 A;  4JKH A;  1VQK N;  1LWE A;  3O9S A;  1WAF A;  2R7Y A;  2YJF A;  2PBD A;  5AQP A;  3NAE A;  1WSF A;  2CGL A;  2CH5 A;  1E4G T;  5BR9 A;  4H0T B;  5KRT A;  3LDL A;  2YKN A;  2QXF A;  2OAN A;  1Q18 A;  4BR5 A;  1RTH A;  1VK0 A;  3I0S A;  1QVG M;  3L2W A;  4DTX A;  1GOC A;  2IIR A;  2D0A A;  3KWG A;  4WFN L;  3SUN A;  2CH6 A;  2GEM A;  4KV8 A;  2VYP A;  1ATN A;  4C23 A;  3VQ5 A;  3H1V X;  3MCA B;  3U9D A;  2QI2 A;  3LAM A;  5JIC A;  2ETJ A;  1FJG K;  2KTQ A;  2O8E A;  4KI4 A;  3CJC A;  4FLU A;  2E20 A;  4DTU A;  4Z4F A;  4Z4H A;  4YOX A;  4DTM A;  4K41 A;  5BN8 A;  1BA1 A;  3CQX A;  1VQO N;  4XH5 A;  4Z4G A;  3NGI A;  4B1X B;  4DU3 A;  4CHP A;  3T7Z A;  3U9Z A;  1HPZ A;  4FWM A;  4O0I A;  2HMP A;  3VGM A;  4LFC K;  2RPI A;  4YHH K;  3I0R A;  1EX4 A;  4MO5 A;  3G71 N;  3ZT0 A;  3E9P A;  4DTR A;  3MWT A;  3CMA N;  1GLD G;  1YT3 A;  2HST A;  1VRU A;  1S22 A;  3TAM A;  3OTO K;  3IAY A;  1VQ8 N;  2ZJQ L;  1YVU A;  3Q7C A;  4O8K A;  1HNI A;  1KSP A;  3NF9 A;  5AQM A;  2O8F A;  2HMI A;  3DLG A;  2E4L A;  2W6K A;  4KB1 A;  2OPQ A;  3ZSX A;  2YV0 X;  3AV9 A;  1HNV A;  1D4X A;  4BR2 A;  4CJR A;  1U48 A;  2OPR A;  1S1V A;  4BRD A;  1K8K B;  4ZHR A;  4X62 K;  3M8S A;  4DFM A;  4HVJ A;  4BR9 A;  4CF9 A;  2HW3 A;  4JKA A;  4B9S A;  3CC7 N;  3L0Q A;  4F2S A;  1NKB A;  1QSL A;  3RVC A;  3HSC A;  3DLR A;  4DFP A;  3QER A;  3K2P A;  2HNZ A;  3THX B;  4ZTJ A;  4OGE A;  3MK6 A;  3N4Q A;  1NK7 A;  1IG8 A;  4PY5 A;  3RSE A;  3K9K A;  3ZSO A;  3HRG A;  2YHY A;  2HBK A;  2P9I A;  5AR0 A;  2E88 A;  5FPE A;  1OH7 A;  4AF1 A;  2P5O A;  4DU1 A;  1RTI A;  3DRP A;  1ZBH A;  1J54 A;  5JS1 A;  4DQS A;  3SAG A;  4FPB A;  3SPZ A;  1D5A A;  1XC3 A;  1UA0 A;  1T6C A;  5AQU A;  1CXQ A;  5KTQ A;  3MAQ A;  4KRE A;  3PLA A;  3WNH A;  4AHC A;  4DUZ K;  5AQL A;  4ID1 A;  2QXL A;  3VF2 A;  5T7B A;  1JXE A;  3OHR A;  2NLX A;  1QE1 A;  2QWL A;  3ULE A;  3DLB A;  3FR0 A;  4DSE A;  4M3Y A;  2E5L K;  1LWF A;  1TV6 A;  1NK0 A;  3R3L A;  1RBT A;  1VSI A;  1NGH A;  4BVO A;  4WFB L;  4CJ3 A;  5JLF A;  3DLH A;  4LF5 K;  1IKV A;  4KPY A;  2VQF K;  1TAQ A;  3VQB A;  3F2K A;  4B08 A;  3RMD A;  3VEY A;  3MXI A;  2HB5 A;  2DFH A;  3VEZ A;  3MX2 A;  2XY8 A;  4PL7 A;  5EY4 A;  3C0B A;  2G8K A;  3Q7B A;  3SMS A;  1Q9X A;  3ZET B;  3OYK A;  1VQ4 N;  1S1W A;  5AQW A;  3AVC A;  1HQU A;  1N6Q A;  2A40 A;  5FPN A;  1ASV A;  1ZBU A;  3PIP L;  1IJJ A;  3O6W A;  1GLC G;  3C6T A;  2UXD K;  5AQV A;  4C1N K;  3SJJ A;  1VRT A;  4WQ5 C;  5J1E A;  3L2U A;  3FZH A;  1YJN N;  2EX3 A;  4H4M A;  4M3T A;  2ZJR L;  3RTV A;  3FZL A;  4QS9 A;  3EZ5 A;  1RBV A;  3QB0 A;  3THX A;  3M1F A;  3O8M A;  1DT9 A;  4B3M K;  1YJ9 N;  3MXJ A;  4FVU A;  4JNE A;  3CG7 A;  3CQ8 A;  3O9T A;  1HJR A;  4YOY A;  1WBD A;  4IOC L;  1SKR A;  1EWQ A;  1LAW A;  4EHU A;  4RW8 A;  3SJH A;  2YKM A;  2QEX N;  1NGD A;  1Z05 A;  5C15 A;  4JHD A;  1R59 O;  5FRN A;  4CFA A;  4CJU A;  3TI0 A;  2G8U A;  1XI1 A;  5E26 A;  3A5M C;  4PKH A;  2FF6 A;  3LL3 A;  4FWQ A;  3S3N A;  1KQS M;  3THY B;  4JKB A;  5KGX A;  1NK6 A;  2BTF A;  1N5Y A;  4A59 A;  1BCO A;  1N36 K;  3EYZ A;  2F9W A;  4I2Q A;  5AZJ B;  2NRZ A;  3AA2 A;  5BPL A;  4YOR A;  3G25 A;  1X9M A;  2VWB A;  1BIS A;  4CJS A;  4B9T A;  4GKK K;  2ZJP L;  1T03 A;  4JAX A;  5ELZ A;  3L4I A;  4KB0 A;  3I33 A;  2HOE A;  3CF5 L;  4WE1 A;  1N33 K;  3CCU N;  1VSF A;  1V4S A;  5BPM A;  4DHY A;  2HBM A;  1DTT A;  3K9J A;  3C6U A;  2VG7 A;  4CHN A;  4BRM A;  3QIN A;  3AA5 X;  2YNI A;  1NGJ A;  3BEX A;  3K5L A;  4IKF A;  3VET A;  4BC3 A;  3PY8 A;  5E41 A;  2H3G X;  4H4O A;  3KK3 A;  1MA9 B;  1DTQ A;  2D0P A;  4B1Y B;  3WXL A;  3T3F A;  4FOE A;  4B9U A;  5AQH A;  4F8R A;  4W5T A;  2Z1H A;  2HNY A;  5C25 A;  4B1Z A;  1S1T A;  3AVI A;  2P9P A;  4E1J A;  4HUG A;  4CEF A;  3ASM A;  4DV5 K;  4BE1 A;  4G1Q A;  2F8S A;  4G9Z A;  5HP1 A;  3VA0 A;  4BR7 A;  1JLG A;  4XIU A;  2YHX A;  3SYZ A;  3WUH A;  2A41 A;  1XC9 A;  4IDK A;  4WQ4 A;  3L2V A;  2GBZ A;  2ASO A;  2QW9 A;  3PUF A;  3MN6 A;  3DXM A;  3V1Q A;  3SNN A;  2P9U B;  1SV5 A;  2YHA A;  1T8E A;  1Q8I A;  3CQY A;  4CJQ A;  5FLX O;  5TKW A;  1S5J A;  2KHO A;  3H1Q A;  1MU2 A;  4DQQ A;  4FO0 A;  3V6D A;  5M1K A;  2Q3S A;  3CCJ N;  3ZCM A;  4EAH D;  4JS5 A;  1SZ2 A;  5EX5 A;  3AO2 A;  4NB4 A;  4KHN A;  4B3T K;  1C1C A;  4CHY A;  3O3H A;  4RW6 A;  5IT9 O;  1K9M O;  3RR8 A;  5HOO A;  4YOW A;  3MXM A;  1HLU A;  5GAE P;  3BZK A;  1FKP A;  3DRS A;  3CC2 N; 
#chains in the Genus database with same CATH homology
 3S41 A;  1Y64 A;  1JCG A;  4PKI A;  4WQ4 C;  1XUP O;  1Q86 O;  4WF9 L;  4CZL A;  2QWR A;  1JCE A;  3GOI A;  2ITM A;  5DM7 L;  3CCS N;  4H03 B;  3W0L A;  3TTF A;  1ZC6 A;  2RHK A;  3TSU A;  4ISF A;  3SMP A;  3FE1 A;  3IUC A;  2BH1 A;  4ISG A;  3GE1 A;  5AQG A;  4CBX A;  1Q82 O;  2E2Q A;  2QWP A;  5M1P A;  1YVN A;  2E2N A;  3MWP A;  3HOT A;  5LJV A;  1YXQ A;  2FSJ A;  3CPE A;  5TKY A;  1WUA A;  2J4R A;  3F9M A;  3GBT A;  3I56 N;  1KAZ A;  2P9U A;  4XH1 A;  5M1F A;  3GDQ A;  1H1V A;  1X3N A;  2ASM A;  5AZI A;  1J6Z A;  3WT0 A;  3AGR A;  5DM6 L;  3CJA A;  2P9K A;  3ZEU B;  3LDQ A;  4HWI A;  2FF3 B;  3O9R A;  4MO4 A;  5AZJ A;  1X3M A;  5C2D A;  2P9N B;  3ULE B;  3F5T A;  2QWM A;  3ATU A;  2F9T A;  4IZ9 A;  3WXK A;  2QWN A;  3J8A A;  3VF4 A;  3C7N A;  3JS6 A;  3DXK A;  3ENO A;  5BRD A;  1WOQ A;  4JKG A;  4IOX A;  3BF3 A;  4JK9 A;  4KH6 A;  3WXJ A;  4U7B A;  1YIT N;  1P8Z A;  3TTD A;  4JKD A;  3DXK B;  1O13 A;  1VQP N;  2P9L A;  2P9S B;  1V4T A;  3KZB A;  4JKH A;  3BP8 A;  3O9S A;  5HL7 L;  3VTI A;  4WFA L;  1VQK N;  2YJF A;  2PBD A;  5AQP A;  2Q31 A;  4A2B A;  4IO9 L;  2HBL A;  3GG4 A;  1KAX A;  3OBW A;  2A3Z A;  3VEX A;  1RDW X;  1YIJ N;  3MDQ A;  2CGL A;  1N8R O;  2OTJ N;  3QBX A;  2CH5 A;  1VQM N;  4CD1 A;  1VQ6 N;  1E4G T;  1VAZ A;  2I7N A;  4H0V B;  5AQR A;  5BRE A;  3AGK A;  4H0T B;  5BR9 A;  3ENB A;  3QFU A;  3LDL A;  3R9P A;  2NRT A;  2I7P A;  3VES A;  2OAN A;  1Q18 A;  4BR5 A;  4XH4 A;  1S3X A;  2WFB A;  1NM1 A;  1RDU A;  1LCU A;  2ZF5 O;  1QVG M;  3NMU A;  1QZ6 A;  4FPA A;  3AAP A;  3VGL A;  2IIR A;  3KWG A;  4O5F A;  5AQQ A;  4WFN L;  3T69 A;  2CH6 A;  4JKC A;  2GEM A;  5GIO A;  3CCR N;  2VYP A;  3CCV N;  3WEE B;  5AQF A;  5AQS A;  1ATN A;  4AM7 A;  4C23 A;  5KPZ A;  3H1V X;  1VQ7 N;  4IEE A;  3MCA B;  3U9D A;  2QI2 A;  3SBT A;  5JIC A;  3VMF B;  3DXM B;  3CJC A;  3SLC A;  2NRH A;  2E20 A;  2NRW A;  5AQY A;  3WXM B;  4FWP A;  4YOX A;  2E8A A;  2A42 A;  1SAZ A;  4K41 A;  3UKR B;  1DKG D;  3VTH A;  1BA1 A;  3CQX A;  5BN8 A;  3A8Y A;  4XH5 A;  1VQO N;  4F9O A;  4B1X B;  1RGI A;  3T7Z A;  2KKZ A;  3U9Z A;  2GWK A;  2YI1 A;  3SK3 A;  4FWM A;  4A5A A;  3E66 A;  4RWT A;  2HMP A;  1GLE G;  3VGM A;  3FZF A;  4OPA A;  4MO5 A;  3G6E N;  2RE2 A;  2NZT A;  1ZBS A;  3ENH A;  4PL8 A;  3G71 N;  1M90 O;  4RCH A;  3MMV A;  4DB3 A;  3FFK B;  3E9P A;  2IVO A;  1KD1 O;  4MDA A;  3CCL N;  3SBG A;  1OVY A;  3O4W A;  3VEV A;  3MWT A;  3CMA N;  1GLD G;  4YOT A;  2HST A;  1JCF A;  1S22 A;  3M6G A;  1NGC A;  5GIN A;  1VQ8 N;  2ZJQ L;  1S72 N;  1OKJ A;  3L4Q A;  2E1Z A;  3Q7C A;  1XQS C;  4IFE A;  4O8K A;  5M1O A;  5KQD A;  3OW2 M;  1NMD A;  4PHT X;  3SAH A;  1Z6R A;  2E2O A;  5CE3 A;  5AQI A;  5AQM A;  2GTD A;  1YHQ N;  3U4L A;  3UB5 A;  3I55 N;  4BRI A;  3ATV A;  2CGK A;  5AQO A;  2YX6 A;  3DAW A;  3CCM N;  4BRC A;  4IJA A;  1D4X A;  1HKC A;  4BR2 A;  2Q2R A;  3UE5 A;  4CZH A;  4BRG A;  4JKG B;  2QWQ A;  1U2V A;  3LM2 A;  4H5N A;  4BRD A;  4BQZ A;  3LM9 A;  5GAH P;  1K8K B;  3EKS A;  5M1N A;  3C7N B;  3EE9 A;  4BR9 A;  4JKA A;  3CC7 N;  3L0Q A;  2KLA A;  3IFR A;  4CZI A;  1BUP A;  3DLL L;  3UKR A;  1TYQ B;  2Q1N A;  1SS6 A;  1DGK N;  4ISE A;  3R8E A;  3RVC A;  1KXP A;  4UY8 O;  3HSC A;  3KK7 A;  4FWS A;  4L3Q A;  4RTF D;  5EVZ A;  1BA0 A;  3BUZ B;  3E9L A;  3O9Q A;  3VEN A;  3D2F A;  5MLC Q;  2WUS A;  5GAG P;  3VEW A;  3UKU A;  2JWL A;  3ZET A;  2E2P A;  4BRE A;  3MK6 A;  3N4Q A;  1U2V B;  1P90 A;  1IG8 A;  3LDP A;  4J8F A;  3RSE A;  3K9K A;  3CJ7 A;  3HBT A;  2NRV A;  3HRG A;  4CZG A;  2YHY A;  4U67 L;  2HBK A;  3MN9 A;  4IEI A;  4OPH A;  5C2F A;  2P9I A;  5AR0 A;  2E88 A;  3DWL A;  5CR4 A;  5FPE A;  4AF1 A;  2V51 B;  3EN9 A;  5AQZ A;  4A2A A;  4H0Y B;  1VQN N;  5E84 A;  3UKU B;  3P31 A;  3G4S N;  3E9O A;  4H5V A;  4JN4 A;  3HM8 A;  3ZX0 A;  4CZF A;  4Y0W A;  3KVG A;  4LC9 B;  4BRP A;  4FOI A;  3VF6 A;  2GEL A;  3BF1 A;  3SAG A;  4H0O A;  4FPB A;  1YI2 N;  1GLJ O;  1XC3 A;  2P9I B;  3EO3 A;  1T6C A;  4HTL A;  3TPQ A;  1T3V A;  5AQN A;  5AQU A;  1W2B M;  3VOV A;  3PLA A;  2YHW A;  1BO5 O;  4H5T A;  1EO1 A;  4CJ7 A;  4FWR A;  3CD6 N;  3CME N;  2FSK A;  2AA4 A;  5AQL A;  2QXL A;  3VF2 A;  3P4I A;  3SAF A;  1TUY A;  1GLF O;  1GLB G;  3OHR A;  3GL1 A;  2NLX A;  3VEO A;  2QWL A;  4KH4 A;  5KPT A;  5AQK A;  2P9N A;  3ULE A;  4M63 C;  4C1N I;  1NGA A;  1BWF O;  1NGF A;  2D0O A;  3FR0 A;  2JWK A;  3O5B A;  4NLB A;  1HPM A;  2V52 B;  3QDK A;  4EHT A;  5ADX A;  2AP1 A;  5M1Q A;  4H5W A;  3L6Q A;  3WQT A;  4K42 A;  3NVM A;  4K25 A;  4KBO A;  3WEE A;  1ESV A;  2VGN A;  4YDU A;  3CET A;  3CJ1 A;  3R3L A;  3VGK A;  4WQ5 A;  1NGH A;  5FPD A;  1BU6 O;  1HKB A;  2YCH A;  4M7Y A;  4FWL A;  1NBW A;  4BVO A;  4IXC A;  4CZK A;  4CZJ A;  5JLF A;  3O9U A;  4WFB L;  3J7Z O;  4BR0 A;  2PAV A;  3JXU A;  3CER A;  5JMV A;  1JJ2 M;  2IVN A;  3F2K A;  3VEY A;  5C12 A;  4H5R A;  3A5L C;  3TTC A;  5BRH A;  2P9L B;  3VEZ A;  3MX2 A;  4FWO A;  4PL7 A;  5EY4 A;  4BRA A;  3C0B A;  4JKF A;  3H6E A;  4DQ8 A;  5KQ8 A;  3Q7B A;  3SMS A;  4GY2 B;  4BC5 A;  5AFU H;  5JVH L;  4IOA L;  4BGB A;  4ILJ A;  3A5O C;  4A61 A;  3ZET B;  1DEJ A;  1VQ4 N;  4JK7 A;  1NWK A;  5AQW A;  3EL2 A;  1MDU B;  4BG8 A;  5JLH A;  1LOT B;  2GUP A;  2A40 A;  5FPN A;  3C6H A;  4I6M B;  4H0X B;  4BGA A;  4XEI A;  3PIP L;  3AAR A;  1BOT O;  3IKM A;  4B1U B;  5CHI A;  1IJJ A;  2Q97 A;  3O6W A;  2CGJ A;  1GLC G;  4JK8 A;  5AQV A;  4C1N K;  2P9P B;  1BG3 A;  4WQ5 C;  1YJN N;  3FZH A;  2ZJR L;  1HJO A;  1ILY A;  4A57 A;  2OTL N;  1QHA A;  3FZL A;  3QBW A;  4QS9 A;  4NLC A;  1NGB A;  2E1Y A;  4JHD B;  4MDB A;  3QB0 A;  1MWM A;  4GV9 A;  3M1F A;  3TU5 A;  3O8M A;  1DT9 A;  5FPM A;  1YJ9 N;  4IJN A;  4B1W B;  4FVU A;  4JNE A;  3O9T A;  1QQM A;  3TSQ A;  4BRO A;  2NRX A;  4YOY A;  2P9K B;  3ZEU A;  3ID6 A;  3WXI A;  3P38 A;  5AQX A;  4IOC L;  5EXW A;  4JEP A;  2IVP A;  4EHU A;  2EWS A;  3O08 A;  5AQJ A;  4BRL A;  1NGI A;  5AZI B;  3SJH A;  5B8H A;  2QEX N;  1NGD A;  1Z05 A;  2GWJ A;  5C15 A;  4FL9 A;  4JHD A;  1VQ5 N;  3FLC O;  3R1X A;  1R59 O;  4EIA A;  1QVF M;  4KH5 A;  2WBN A;  4BRN A;  2A5X A;  5LJW A;  4EFH A;  5I9E B;  5BRF A;  3CI5 A;  5GIP A;  3U8X A;  5E26 A;  3A5M C;  4PKH A;  4BY9 C;  3H45 C;  2FF6 A;  3LL3 A;  1YAG A;  5GAD P;  4FWQ A;  3N4P A;  5C0Y A;  3ZX2 A;  4QS8 A;  3QML A;  1KQS M;  2NRR A;  4JKB A;  3NVK A;  4JD2 B;  1Q81 O;  4PKG A;  5BN9 A;  4O8U A;  4A5B A;  3W3D A;  4CD3 A;  3P39 A;  4B1V A;  1RFQ A;  2BTF A;  4A59 A;  5AFU A;  1U6Z A;  3O80 A;  2F9W A;  4GNI A;  5H1S Q;  4CZM A;  2HBJ A;  3O1W A;  5AZJ B;  1K8A O;  2NRZ A;  1T44 A;  3D2E B;  1TYQ A;  3EZW A;  3H3O B;  4YOR A;  5BPL A;  1GLA G;  3G25 A;  2VWB A;  2W40 A;  2ZWH A;  4BRK A;  4CZE A;  2NNW A;  3DJC A;  1Q7Y O;  2ZGY A;  3MN7 A;  2P9S A;  3EKU A;  4JKE A;  3CXC M;  2UYT A;  3CC4 N;  3ID8 A;  3VPZ A;  1VQ9 N;  2ZJP L;  1X9J A;  1K8K A;  2Q36 A;  1YF5 L;  1MWK A;  3CHW A;  3CJ9 A;  3HZ6 A;  3L4I A;  3KWI A;  4JAX A;  3AY9 A;  4MLE A;  3I33 A;  5ELZ A;  4BC2 A;  3D6R A;  2HOE A;  5F2R A;  3CF5 L;  4BRF A;  4CBU A;  1KC8 O;  4IWV A;  4BRQ A;  3D2F B;  3CCU N;  2FSN A;  4CI6 A;  1ATS A;  4YOU A;  4GV6 A;  3LDO A;  3LDN A;  1V4S A;  3KHY A;  1GLL O;  4FSV A;  4DHY A;  5BPM A;  4YOV A;  2HBM A;  2WC9 A;  3K9J A;  3A5N C;  4BR4 A;  1QZ5 A;  4BRM A;  2FXU A;  1NGJ A;  3BEX A;  3CCE N;  4FWN A;  5LY3 A;  4M7X A;  5JVG L;  3D2E A;  3EE8 A;  3VET A;  4BC3 A;  4IDH A;  3MCP A;  3C6A A;  3ZYY X;  3E1Y A;  2H3G X;  3ZX3 A;  3IDH A;  1CZA N;  4AM6 A;  1MA9 B;  5C10 A;  2D4W A;  2D0P A;  4B1Y B;  3WXL A;  1NJI O;  4YDU C;  2ASP A;  5ADX H;  3CCQ N;  1ZXO A;  5BPN A;  3FZM A;  4FOE A;  3HOS A;  4BG9 A;  3H3N O;  3QIC A;  3CJB A;  2Q0U A;  4R79 A;  3CIP A;  5AQH A;  1NGE A;  4MLH A;  2D1K A;  1W97 L;  1KAY A;  4B1Z A;  2ZGZ A;  2P9P A;  2VCP A;  3WQU A;  4FWK A;  4E1J A;  1YJW N;  1TUU A;  4BVP A;  3M5R A;  4G9Z A;  1QQN A;  4K43 A;  4QS7 A;  4BRH A;  2BUP A;  2VGM A;  3D7E O;  1EQY A;  3O1B A;  1NLV A;  4BR7 A;  5EOY A;  5F1X A;  4ILG B;  2DPN A;  2YHX A;  3WUH A;  4B9Q A;  4WCE L;  2HF3 A;  2A41 A;  4BQL A;  1K73 O;  2W41 A;  4WQ4 A;  2QM1 A;  3VER A;  2ASO A;  1VQL N;  1HUX A;  2QW9 A;  3MN6 A;  1G99 A;  2HF4 A;  3DXM A;  4NO7 A;  2A6A A;  1E4F T;  3PIO L;  4OO1 J;  2Q0R A;  1HX1 A;  3M3Z A;  2P9U B;  3QFP A;  4CBW A;  3MX5 A;  3FGU A;  3RSE B;  2QWO A;  4ILH A;  5AQT A;  4DCH A;  2QTD A;  1BDG A;  3CQY A;  1ATR A;  3I8B A;  5TKW A;  4GV3 A;  2QA4 N;  2YJE A;  2KHO A;  1QQO A;  3OA9 A;  3H1Q A;  3H46 O;  2GX9 A;  4FO0 A;  1SQK A;  5M1K A;  3HTV A;  3MN5 A;  2PFU A;  3CCJ N;  4H0P A;  4BC4 A;  4EAH D;  3CPW M;  1SZ2 A;  1C0F A;  4GVE A;  5EX5 A;  3AAQ A;  1M1K O;  3HI0 A;  4NB4 A;  5F0X A;  3B8A X;  3C65 A;  4IO8 A;  3TSP A;  4Z94 A;  5KPR A;  4WYB A;  2FLO A;  1K9M O;  2F7T A;  4A62 A;  2V7Z A;  5HOO A;  4I6M A;  4YOW A;  1HKG A;  1T6D A;  1HLU A;  3R6M A;  1NGG A;  5GAE P;  2V7Y A;  1C0G A;  3FZK A;  3IMX A;  4JD2 A;  3OBY A;  1YUW A;  3CC2 N;  4DKW A;  3A0I X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...