5BR9A

Crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
217
structure length
217
Chain Sequence
b'HMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Unknown function
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
publication title Crystal structure of an uncharacterized protein with similarity to peptidase YEAZ from Pseudomonas aeruginosa
rcsb
total genus 63
structure length 217
sequence length 217
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5br9A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5br9A02
2FF6A 3VEYA 4BGBA 5E84A 4H5WA 5AQTA 3EL2A 4JHDA 3DWLA 1U2VB 3M3ZA 3HTVA 1MWMA 4M63C 3UKRA 2Q31A 1RFQA 4CZMA 3LDQA 4FWNA 4RWTA 4BRDA 1D4XA 3CHWA 3SLCA 5FPDA 3ENOA 5BPLA 3IUCA 2CGKA 1NMDA 2A41A 5AQSA 1TUYA 4B9QA 3MK6A 4JN4A 3UKUB 2PBDA 3DXKA 3C7NA 4B1UB 1NGHA 4CZIA 1E4FT 3H6EA 4H5VA 5AQPA 3IDHA 2AA4A 2YHYA 3LM9A 2ITMA 3A0IX 5KPZA 1XC3A 2QWOA 2PAVA 3O1WA 2ASPA 1R59O 5AQGA 5JLHA 3CETA 3ULEA 1U2VA 3OHRA 1TUUA 3U8XA 3WQTA 3VERA 5AR0A 5AQHA 5BR9A 4O8KA 3GBTA 1WUAA 5E26A 2Q36A 1HJOA 2P9KB 3ZETB 2GUPA 1NGBA 2NLXA 3CERA 5FPNA 5AZIA 3AAPA 3FZHA 3O80A 3UKUA 4F9OA 1K8KB 3GG4A 3VETA 4EAHD 5CE3A 4KBOA 4BR5A 2P9UB 4ISFA 1V4TA 4O5FA 5AQUA 1ATRA 4XH5A 1S3XA 3VEWA 3WXKA 3H45C 1BWFO 3EZWA 3BF1A 2P9NB 4H03B 3EKUA 2V7ZA 4BC3A 4GY2B 4JD2A 1T44A 4H5TA 1E4GT 5ELZA 3M6GA 4FWMA 2D4WA 1JCEA 3UKRB 4JD2B 3AAQA 3A5MC 3HZ6A 1XUPO 1QZ5A 5JMVA 1BOTO 4MLHA 1GLAG 3MCPA 1H1VA 2YJFA 2KHOA 2GELA 3CI5A 3U9ZA 3IFRA 4IXCA 1NGDA 5KPTA 3B8AX 2OANA 4IZ9A 1NGIA 5EY4A 4BRPA 4H5NA 4DCHA 4EFHA 3ZX3A 5F0XA 1IJJA 1P8ZA 4YDUC 4AM6A 4XH1A 3VENA 3QICA 5AQKA 2UYTA 1BDGA 2IVNA 2QWMA 3JXUA 3MN6A 2IVOA 5TKYA 1BA1A 4HWIA 3H3NO 5AQVA 4CD1A 1ZXOA 3ENHA 4AM7A 4BC4A 1Z6RA 3U4LA 3BUZB 4CZEA 5BPNA 1C0FA 1NGGA 1BU6O 3QFUA 2EWSA 3ZETA 1RGIA 2ZF5O 1ESVA 3O5BA 2YI1A 1QHAA 5AQOA 1DGKN 5AQYA 1ZC6A 4ISGA 3F9MA 3QFPA 4DHYA 1K8KA 1HX1A 4I6MA 1SAZA 1IG8A 2E2NA 1EQYA 4B1XB 4B1WB 4CZGA 5F1XA 3VF2A 4QS8A 3DXKB 1KAYA 4H0TB 4BRGA 4BVPA 3FZMA 4Z94A 3VEVA 3KZBA 3CJ9A 4CZJA 2P9NA 3HM8A 1QQOA 4CJ7A 3L0QA 1NGEA 2HOEA 5AQWA 3ULEB 1QZ6A 1GLJO 4MO5A 3FLCO 3VEXA 4WQ4C 3UB5A 2P9IA 3I33A 3HBTA 4BR0A 5AQLA 3WEEA 2Q0RA 4FWSA 4H0PA 3QBXA 5AZIB 1GLLO 2DPNA 4CBUA 3G25A 2V51B 3LDLA 2F9WA 1U6ZA 2IVPA 3LDPA 4E1JA 2P9LA 3FFKB 1SQKA 4CZLA 3HSCA 3VGKA 3VF6A 3VEZA 2P9LB 2Q2RA 4DB3A 3CQXA 3QB0A 2FSJA 3VEOA 2FXUA 4PKIA 1Y64A 2ASMA 2A5XA 3FZKA 3TPQA 2NZTA 3SJHA 2AP1A 3H1VX 4HTLA 4FL9A 5KQ8A 3R8EA 1ATNA 3I8BA 4J8FA 1NBWA 4K42A 3CQYA 5AQFA 4JNEA 4XEIA 3WQUA 2QWQA 4CZFA 2YJEA 5BRDA 5ADXA 4IJNA 4K41A 1WOQA 4CZHA 2F9TA 2I7NA 1OKJA 4I6MB 1QQMA 3MDQA 3SK3A 3C0BA 1JCGA 2YCHA 3H46O 1QQNA 2D0OA 2GEMA 3WXJA 3ID8A 4M7YA 3D2EB 4EHTA 1NGAA 3KVGA 5AQQA 1KAZA 4IWVA 4GNIA 3GE1A 3IMXA 3L6QA 4BRMA 4EIAA 2E2QA 3D2EA 2E1ZA 1LOTB 2E8AA 5AQJA 1DEJA 3ZEUA 1YXQA 3GL1A 1J6ZA 3MN9A 1DKGD 4BRAA 5AQNA 4FWQA 4BRHA 4FOEA 3O4WA 4JAXA 4BG8A 2P9IB 3ZEUB 2Q1NA 5LJVA 4BG9A 4BRQA 3BF3A 5EVZA 5EXWA 4MLEA 3FR0A 3FZLA 2YHXA 3VGLA 1G99A 4BRCA 4CBXA 5AZJA 1BO5O 2QWRA 1YAGA 4PL8A 1GLFO 3BP8A 5BRHA 2ZGYA 2CH5A 4CI6A 2FF3B 3EO3A 3EN9A 3DJCA 3TU5A 4NB4A 3D2FA 3J8AA 3O08A 4QS9A 4WQ5A 4BRNA 2FLOA 3FZFA 4BC2A 4IJAA 2FSNA 3A5LC 5ADXH 3DAWA 2E88A 2BTFA 2D0PA 4FWRA 4A61A 2P9SA 5AFUA 2ZWHA 2WUSA 4L3QA 4EHUA 1S22A 4BQZA 3VF4A 3MN5A 3VPZA 4RTFD 2QWLA 4K25A 1XQSC 3WEEB 4H0YB 3ATUA 3RSEA 4PKHA 2HF4A 4YDUA 3R9PA 4K43A 3RSEB 3ATVA 3A8YA 3D2FB 1RDWX 1NM1A 4H5RA 2A40A 1T6CA 3L4IA 5AQZA 3LDOA 4FWKA 2E1YA 3QMLA 2VCPA 3VOVA 1BA0A 2ZGZA 4A2AA 2CH6A 1CZAN 2FSKA 1TYQA 1X3MA 2W40A 1NLVA 4BRLA 4CZKA 4WYBA 3CJ1A 4RCHA 2NRHA 2BUPA 3A5NC 1JCFA 1GLDG 4ISEA 3ZX2A 1HKGA 4IO8A 5BREA 4FSVA 4H0XB 2P9PB 4WQ4A 4A62A 1NGJA 3CJ7A 3WXIA 5F2RA 3W3DA 5LJWA 4MO4A 2E20A 5BPMA 5B8HA 1HUXA 2V52B 4WQ5C 3AY9A 2Q0UA 2QWNA 1GLBG 4BRKA 5AQXA 5AQIA 3A5OC 3O8MA 5LY3A 1HKCA 1Z05A 4BVOA 4FO0A 5BRFA 1SZ2A 4BR4A 4BREA 3D7EO 4BR7A 5AQRA 1TYQB 3FGUA 4B1VA 4A2BA 2GWJA 2J4RA 2H3GX 2P9SB 4CD3A 1ZBSA 1T6DA 1NWKA 2QM1A 1HLUA 3HI0A 5KQDA 5AFUH 3CJAA 4M7XA 1MA9B 3SMPA 2D1KA 1YVNA 1GLCG 5KPRA 4Y0WA 3JS6A 5EOYA 1KXPA 3MMVA 2HMPA 3UE5A 3H3OB 3S41A 3WUHA 3VESA 1ATSA 3FE1A 3MN7A 5JLFA 1LCUA 5AZJB 1BG3A 1V4SA 4XH4A 1X9JA 3R6MA 4BR9A 2YHWA 3EKSA 5FPEA 1KAXA 4B1YB 2Q97A 2A42A 3KHYA 4NO7A 3CJBA 2QW9A 1NGFA 5FPMA 1NGCA 3BEXA 4H0OA 2ASOA 3LL3A 3ZX0A 2P9UA 3QBWA 3WT0A 3C7NB 3U9DA 2IIRA 4FPBA 4PKGA 2CGJA 4FWLA 2W41A 1Q18A 4LC9B 2I7PA 5I9EB 4C23A 3WXLA 4BROA 2GWKA 5BN9A 2VYPA 1HPMA 4FWOA 3GDQA 1X3NA 3CIPA 4PL7A 4BQLA 2QWPA 4BRFA 1BUPA 3VGMA 3M1FA 2CGLA 4FPAA 3H1QA 4QS7A 4BR2A 4JHDB 2P9KA 4BGAA 1MWKA 4B1ZA 4BC5A 4CBWA 3GOIA 3LM2A 3O1BA 3DXMA 5AQMA 5EX5A 2A3ZA 2V7YA 3QDKA 3W0LA 3P4IA 2GTDA 4DQ8A 3AARA 5BN8A 3O6WA 3DXMB 4H0VB 3LDNA 2E2OA 5JICA 3CJCA 1HKBA 4FOIA 1MDUB 1GLEG 4FWPA 2VWBA 4BRIA 2HF3A 2A6AA 1YUWA 1C0GA 2QXLA 3SMSA 2P9PA 2E2PA
chains in the Genus database with same CATH superfamily
3QNOA 4BGBA 4Q0BA 3CQ8A 1NK4A 5E84A 2O8FA 5A2QO 3E01A 3DWLA 4ILHA 4F3TA 4M41A 3HTVA 4E1NA 4BRDA 4KHYA 3CHWA 3HSTB 5GAGP 5FPDA 3KK7A 1X9WA 3MWTA 3ENOA 4C1NI 1BCOA 4DF4A 2CGKA 1NMDA 1Q81O 3TSQA 1TUYA 4GKKK 4B9QA 2BE2A 5GADP 3T1AA 2HHWA 2Q3SA 4O5BA 3EY1A 4NXMK 3MCAB 4CHQA 2RF2A 2XO7A 1C1AA 1NK6A 4OPJA 1SL1A 3SQ0A 4BE1A 2ASPA 1RT7A 1C0UA 3S3OA 3HPHA 3U8XA 3WNHA 3O3GA 1J9AA 3VERA 3J7ZO 3CMAN 4OGCA 4KTQA 3DLLL 1CZBA 1QQCA 1WUAA 3ZETB 3SJJA 4YOVA 1IKXA 5FPNA 3F9KA 2KW4A 4LFAK 3HVRA 4LY7A 4CERA 3UKUA 4A57A 4DTXA 4Z4HA 2DFEA 2B6AA 4CEFA 4KBOA 1TL1A 3MXJA 4O5FA 3OW2M 3KWGA 5CY4A 3VQPA 1U4BA 3WXKA 3VEWA 4DFJA 1HYZA 3BF1A 2P9NB 3VQ5A 1LV5A 3N4QA 4JD2A 4JYAK 3I56N 4YFUA 2XY8A 5IT9O 4CK3A 3M6GA 3QIPA 4C8MA 4DFPA 3DLGA 2X74A 2IDOA 3HXMA 1VAZA 3HZ6A 1XUPO 1KLNA 4MLHA 1RCHA 3NGZA 1ZBHA 3S9HA 4R79A 1NJWA 3HP9A 1NGDA 4IXCA 1IG9A 3B8AX 4LF5K 4YY3K 2OANA 4CGGA 4DCHA 4EFHA 5GIPA 4M3UA 1NU0A 1KFDA 4B8AB 4FJKA 2D5RA 4GVMA 2XY7A 1L3VA 3AVBA 4H4OA 2DY4A 2IVOA 5TKYA 3OYGA 1RT5A 4FJLA 4KHWA 3H3NO 3E9PA 5I42A 1NNEA 2VG5A 1ZXOA 2B4JA 3V1OA 3OS0A 3BUZB 4IBNA 3VQEA 1HNIA 4C8OA 1D5AA 1RGIA 2ZF5O 2YI1A 5KRSA 4RW6A 3CCJN 4ISGA 3L2QA 4A5AA 4DHYA 1TKTA 4JI7K 4KB0A 1K8KA 4I6MA 1JLGA 1NKCA 4JKGA 4JI1K 1EQYA 4B1XB 3T1HK 2WBNA 1TL3A 4BVPA 4K8ZA 1JLQA 1W9HA 3RWUA 2LSNA 3MECA 4IFEA 3G6EN 3KK3A 1HRHA 5KTQA 4CHNA 3MAQA 3TTDA 1Z26A 3HM8A 4GV9A 3UIQA 3K57A 5JVGL 5FRNA 1GLJO 1RT4A 3CPEA 3VEXA 4DSJA 2BANA 1VSJA 3SPZA 2Q0RA 5T7BA 3QBXA 5FLXO 4LH4A 4B9MA 1LAVA 4W5RA 3TI0A 1U6ZA 2IVPA 4CIEA 4FJHA 4QCLA 4E1JA 2FBVA 3KJVA 2HVIA 3HSCA 4L8RB 4O4GA 2P9LB 2G8FA 1K6YA 3CQXA 3RR8A 2A5XA 3AVNA 3E1YA 5GAEP 3TPQA 3SJHA 4B9UA 1YITN 4FL9A 4I2QA 3T19A 4CF1A 5DK5A 1ATNA 3I8BA 1S1XA 4J8FA 1NBWA 4K42A 3KK1A 3CQYA 4CEBA 5AQFA 4JNEA 4CJWA 3OS2A 4W5NA 1FK9A 2QWQA 4YOUA 4E7IA 3NFAA 3SI6A 4DFKA 4DR5K 4K41A 1S72N 3AVLA 1IBMK 2F8TA 4FW2A 3NVKA 1QQMA 2Z1HA 2P5OA 4F2RA 3C0BA 2P51A 5TKWA 4FJ8A 2D0OA 3WXJA 1YTAA 4M7YA 4DMNA 4EHTA 2Y1IA 4CJSA 3KD5E 3T69A 4GNIA 1SKSA 1VQ7N 3C65A 3D0PA 1A5VA 3D2EA 1DEJA 3RMCA 4CHZA 1DKGD 5DM7L 3LPTA 2YNGA 4BRAA 3G0ZA 5AQNA 3OJSA 4BRHA 4JAXA 3VQ8A 3ZEUB 1T03A 1I3AA 4LF9K 4CECA 5K14A 3OBWA 3BF3A 5EXWA 1Q7YO 3FR0A 4GMJB 1XC9A 3FZLA 2G8UA 1WSFA 3OYCA 4E0DA 4DV4K 1T05A 1YAGA 3BP8A 4DF8A 4M42A 1WBBA 2ZGYA 1B9DA 4CEDA 3EEQA 3HOTA 4DTJA 2PFUA 2UUCK 3D2FA 4CF0A 3MEEA 4BC2A 2HNYA 5ADXH 3TSPA 5KGWA 2E88A 5CZ1A 4A61A 2HNZA 1N32K 4DQIA 2ZWHA 3LDSA 3SCXA 3CCSN 1YJNN 2VQEK 4FK4A 3PSIA 2G8WA 2IAJA 4NCGA 1CZ9A 3DLBA 3ATUA 1JLCA 1K8AO 1RDDA 3RSEA 4LSNA 4YDUA 2OPPA 2OPQA 3M8PA 2DFHA 5AQZA 3SUPA 3LDOA 2F96A 1JL1A 3TAFA 4Y1CA 1W2BM 4A2AA 3S3MA 2FSKA 1TYQA 1X3MA 3CCUN 5LL6Z 3VMFB 4WYBA 3OY9A 4FJXA 3IAYA 5M1NA 1BI4B 4MQ3A 1JCFA 1GLDG 3HJFA 4IEIA 3LAKA 1HNXK 4KI6A 1NGJA 1ILYA 3W3DA 3TAMA 4JI8K 1KLMA 3TAQA 1U45A 3CCQN 2QWNA 1GLBG 3BDPA 5AQXA 5AQIA 4KH6A 3F73A 3OYMA 4Q5VA 1HKCA 4BVOA 4BR4A 1RT2A 3D7EO 3THWB 3HRGA 3T1YK 1U48A 4JKCA 3FGUA 4DUZK 3WNEA 4B1VA 1EP4A 4CJKA 3L2RA 2H3GX 2P9SB 2Z1JA 4A59A 3NVMA 3OJUA 4DUYK 4KB1A 1NWKA 5C0YA 3C95A 4CCHA 3LP0A 3CC2N 2X78A 1BGXT 2E5LK 4IDKA 3QETA 4Y0WA 3MMVA 1VRUA 4Y1DA 1NJZA 3WUHA 3P38A 1ATSA 3FE1A 1KTQA 5JLFA 1V4SA 4JI6K 2YHWA 3EKSA 2D0AA 5FPEA 3PX0A 3ZT3A 3V9WA 4B1YB 2HBMA 2A42A 3L2VA 2DTUA 1NGFA 1C0TA 1RBRA 3QBWA 3U9DA 2IIRA 4FPBA 4CW7B 4PA1A 4PKGA 5CZ2A 2W41A 1Q18A 3CFRA 5I9EB 4X64K 3C6HA 2VYPA 4AHUA 1HPMA 5CYQA 4FWOA 2PYLA 4PL7A 4BQLA 4LFBK 1W0HA 2QWPA 3VGMA 3C6UA 3KWIA 4JHDB 3OYKA 4B1ZA 1VQKN 3QEWA 4Z4FA 2GTDA 4FM0A 4DQ8A 1WAJA 4H0VB 1RDCA 5M1FA 4AHRA 3D45A 4DU3A 1YUWA 4YOWA 4DKWA 3JYTA 4HVJA 4JS4A 3NHGA 3ZLJA 4RW4A 3VQ6A 3HPOA 4H5WA 4FJ9A 3IKMA 4AQYK 5FRMA 1MWMA 4M63C 3UKRA 1RFQA 4FWNA 2HHUA 4RW8A 1D4XA 4RW7A 5JVHL 5J2QA 1VQ8N 4O0JA 1S5JA 1SKWA 5BPLA 2BH1A 2OZMA 3IUCA 1LWFA 5AQSA 3ALYA 1ZBLA 3DXKA 3AA4A 3ASMA 4B1UB 1NGHA 1E4FT 3H6EA 2O8EA 3IDHA 3LM9A 1KQSM 4CGIA 1XC3A 3O1WA 1UOCA 4OKJA 5AQGA 3CETA 3K0SA 1U2VA 3OHRA 4JI4K 3WQTA 4B3SK 3DLEA 5AR0A 5AQHA 3ENBA 3SBTA 4KKOA 2JWKA 3GBTA 5E26A 3V9XA 2Q36A 1HJOA 2P9KB 3IS9A 4ZTJA 1GOBA 4ID5A 3CERA 3AAPA 4KHUA 2EX3A 1BCMA 3GG4A 4RG8A 2UXBK 2HB5A 1WLJA 4ISFA 1TAQA 4GW6A 1ATRA 3VA3A 4CGFA 3PY8A 2NRVA 1RDAA 3EZWA 3EKUA 3AA3A 2V7ZA 1C0MA 3E9OA 4BC3A 4FXDA 4IOAL 4DSLA 4GY2B 1T44A 2UUAK 4O8UA 3AO1A 5DMRA 1E4GT 4FJ7A 1FXXA 4JD2B 3CCVN 3QEXA 2HBKA 4B08A 1QZ5A 5JMVA 4M3WA 3ZSYA 3NCIA 3MCPA 2YJFA 1Z25A 2KHOA 1UA0A 2QTDA 3CI5A 2HHVA 5C42A 5SWMA 1NK9A 4IZ9A 4H5NA 3HK2A 4FJ5A 5IWAK 4XH1A 3K9JA 3VENA 3QICA 5AQKA 3JXUA 4CJQA 3MN6A 4CK2A 4DV5K 3ZSOA 5MLCQ 4JRQA 5AQVA 3ENHA 4AM7A 1Z6RA 4DQRA 3U4LA 5HBMA 1JLFA 3THXA 3DRPA 1C0FA 3ZETA 4BE2A 3E9LA 4B3OA 1QHAA 5AQOA 4JEPA 2W6LA 5AQYA 4CJRA 4KHQA 2QXFA 3O4QA 4CJFA 5F1XA 3VF2A 3DXKB 4W5QA 1VQ9N 4BRGA 4FJJA 4JKGB 4AHTA 3FZMA 1HQEA 1XHXA 4E7HA 3CJ9A 3AGKA 3QO9A 4CZJA 2P9NA 1VHXA 3L0QA 1NGEA 2O8BB 1B92A 1VRTA 5M1PA 3TTCA 2A1SA 3UB5A 3I33A 2ZD1A 4NYNA 5JS2A 4BR0A 3AVHA 3WEEA 4I9LA 3V9ZA 1HYSA 3G25A 3DM2A 1KCFA 2ETJA 2V51B 3LDPA 1LW0A 4HHTA 4H8KA 3THVA 1OH5A 1VSEA 4I9QA 3SZ2A 1FKPA 2WTUA 4MFBA 2NRRA 1KSPA 1KFSA 2Q2RA 4BE0A 1XNQK 3FZKA 4DV0K 4FVUA 3AO4A 2QKKA 3L4QA 5KQ8A 3R8EA 1FW6A 1NMNA 3QEVA 4CJLA 3M8SA 4JLHA 4UQGA 5KI6A 2YJEA 2B5JA 4IJNA 1UWBA 3SQ2A 3WNGA 1VK0A 1R0AA 4I6MB 2RPIA 3MDQA 1RTJA 3SK3A 3ZSVA 3K5MA 4CESA 1JCGA 3H46O 5HL7L 5HLFA 3CYMA 3KD1E 1C1CA 4DV2K 1K9MO 3ID8A 3V4IA 1NGAA 3KVGA 5AQQA 1KAZA 3GE1A 3IMXA 4EIAA 1UAXA 1LOTB 4X66K 4EZ9A 3WXMB 2VWKA 1YXQA 3THYB 2IS3A 3GL1A 3MN9A 1O13A 3KLHA 1BQNA 3CMEN 4BACA 1FKOA 2O4GA 4FWQA 2DFFA 3VQQA 3SBGA 1EXQA 3NH2A 2P1JA 4OGEA 2OPSA 4FVMA 4DLGA 5EVZA 3RMDA 3MXIA 3HP6A 3RMAA 1RT3A 3DLKA 2YHXA 3VGLA 2NRTA 4I7FA 1XMQK 3K9KA 4PL8A 2ATQA 3AVIA 3VA0A 3NGYA 3EO3A 4CFCA 3G4SN 3J8AA 4WQ5A 1NJYA 3AO5A 4FYDA 1JKHA 2VG7A 4FLYA 4E19A 3CFPA 2BTFA 2D0PA 3KIOA 4CEOA 5AFUA 3LZJA 2PY5A 2HBLA 2YHBA 3NBPA 4KV8A 3MN5A 3VPZA 4LF7K 4RTFD 2QWLA 4K25A 1SS6A 3WEEB 1S6QA 2X6SA 1TK8A 1BL3A 4YHHK 3U3GA 1RDBA 4B3RK 2GUIA 1ITGA 4E3SA 1OH6A 3OYDA 3ZSZA 1VQ6N 3RSEB 1RDWX 3DRRA 1T6CA 3J81O 3L4IA 4NYFA 3M8QA 2VGNA 4H4MA 4WFAL 3VOVA 4DWIA 1QSLA 3NE6A 1BA0A 2CH6A 4DV7K 2G8VA 2NRHA 2BUPA 3PX4A 4CGHA 4DR7K 4ISEA 3SAFA 1HNWK 4IO8A 4DR2K 1OH8A 4EZ6A 1D8YA 1N5YA 3OTOK 3BZCA 4CHYA 4JKDA 5F2RA 2WC9A 2E20A 1I94K 1UA1A 4FZYA 3OYLA 1J5OA 1ZBUA 4LF8K 3AY9A 4CJ3A 2BGGA 4BRKA 2VG6A 4M3YA 1RTIA 4GVEA 3VTIA 4DSFA 4FO0A 5BRFA 3V9SA 1X9MA 1EX4A 4FJIA 4BREA 4U67L 5J2MA 1IH7A 5AQRA 4A2BA 1S1UA 2GWJA 3THWA 4KO0A 5LMUK 4JKBA 4KHPK 1U04A 2IGIA 2QM1A 3HI0A 1XMOK 2KZMA 3O9TA 4CJ4A 4HTUA 1ZBFA 3SMPA 4M3TA 1LWCA 2NNWA 1GLCG 1G15A 1IBLK 3CCRN 2ZQBA 1VQON 3JS6A 3VQBA 2HMPA 3S41A 3VQ7A 3MN7A 5HRNA 4NCBA 1LCUA 1S9GA 4KRFA 3LANA 3R6MA 4BR9A 4YOYA 3VQ4A 2GBZA 1KAXA 4BDPA 3ULDA 2Q97A 3KHYA 4GV6A 4DS5A 4JKHA 4H0OA 3LL3A 2YKMA 4OPKA 1HQUA 1N33K 3WT0A 3C7NB 3HO1A 2CGJA 4FJNA 4CJ5A 4LC9B 3HVTA 3DRSA 4JS5A 3SPYA 3E66A 4BROA 4OLAA 1ASVA 3HPGA 3NF9A 2F7TA 3PSFA 1X3NA 3CIPA 1QVGM 3P31A 3OBYA 2A1RA 5KRTA 4FPAA 4M3ZA 4N56A 4BR2A 1MWKA 4CBWA 1QVFM 4B9NA 3GOIA 3OYAA 3J7AP 5AQMA 5EX5A 4JK9A 3W0LA 1JJ2M 3AARA 4E7LA 5BN8A 1X9SA 1SUQA 4CFAA 1T8EA 3LDNA 4R5PA 3CJCA 4KTZA 1M90O 1C0GA 2QXLA 4CE9A 3M8RA 1F21A 4G9ZA 4PUOA 1VSLA 3OVNA 4M45A 2JLEA 3D6RA 2OYQA 5HROA 3I55N 4KH4A 3EL2A 3M3ZA 4IEEA 2Q31A 4RWTA 3WNFA 4DU1A 3OYFA 2O8CB 3SLCA 3V9UA 1YTUA 4J2DA 1RBTA 3L3UA 4Z4EA 3NH1A 2A41A 2HHQA 5CR4A 3UKUB 4CZIA 4DSKA 4H5VA 4FLUA 3ISNC 2YNFA 5AJ3K 2YHYA 3OA9A 5KPZA 4DTSA 2O8FB 4KTWA 5JLHA 1N36K 1TUUA 3BGRA 3RTVA 5BR9A 4AHSA 3I0RA 1NK7A 1SKRA 4FLWA 1NGBA 4JI2K 4OJRA 1Q82O 3LZIA 4NLCA 1VSFA 4F9OA 4EP4A 3U3YA 1TGOA 4B9LA 3IG1A 4EAHD 3NAEA 3AVAA 3PO4A 1QHTA 4BR5A 3SV4A 1V4TA 4IDHA 1S3XA 4IFYA 1BWFO 3VQDA 4CF9A 4HUEA 1BHLA 4F8RA 2YHAA 3HM9A 4K0KK 4E7JA 4H5TA 4ILJA 3P5JA 2D4WA 1JCEA 2QEXN 3UKRB 1TKDA 4CEQA 2KFNA 1BOTO 4OO1J 3U6FA 5C25A 2RN2A 1TKXA 3QNNA 2GELA 1S9EA 4M3XA 2HSTA 2E4LA 4OKKA 2FC0A 2E6LA 4BRPA 3ZX3A 1IJJA 2KFZA 3SQ4A 1P8ZA 1N34K 1L5UA 4AILC 2UYTA 1BDGA 3V6DA 4LFCK 1NKEA 4WF9L 4HWIA 1DTTA 4CD1A 3O4NA 2NRZA 1J5EK 4I2PA 1BU6O 5H1SQ 4LSLA 2EWSA 1DGKN 1ZC6A 3N4PA 5CYMA 3F9MA 3QFPA 4KI4A 1HX1A 3J80O 1SAZA 1IG8A 2E2NA 4GV3A 4B1WB 4F2SA 4H0TB 4KPYA 5J1EA 4X62K 1MU2A 1RT6A 1YVUA 3EE8A 4Z4IA 3DYAA 4CFBA 2KTQA 3RVCA 4CJ7A 4B9SA 4QOZB 3M5RA 2HOEA 5AQWA 1CLQA 3AVJA 1L3SA 4WQ4C 2GV9A 1RBUA 3K58A 2P9IA 4IFVA 1IKWA 5AQLA 3G10A 4HUFA 4DTNA 4H0PA 1IBKK 3ZT0A 1GLLO 1XI1A 3KTQA 4YORA 3LDLA 3AV9A 2F9WA 4CK1A 1HYVA 3VQ9A 5GINA 1NK5A 1T7PA 2YV0X 3FFKB 1RTHA 3AA2A 3L8BA 3TR8A 4CEZA 1SQKA 3NF8A 1HNZK 4CZLA 1EO1A 3SUOA 3ZSWA 3QLHA 1JLEA 3BZKA 2FXUA 4PKIA 1Y64A 3BY5A 2VWJA 2NZTA 3NDKA 1NJXA 3JAMO 3H1VX 2D0BA 4HTLA 2F4VK 4DLEA 1WAFA 1HJRA 4XEIA 3KKRA 3B6PA 3WQUA 4W5OA 5ADXA 4WE1A 1WOQA 4CZHA 4CEEA 2PYJA 2JGUA 1OKJA 1E3MA 3LALA 3NH0A 4DTOA 3IRXA 3NGIA 3QINA 4IO9L 2GEMA 4ILGB 2ZJRL 1S6PA 1QS4A 4IWVA 3L6QA 5GAHP 4C8NA 2Z1IA 1N8RO 5HOOA 2KKZA 5AQJA 2HBJA 4ELVA 4DR6K 3R1XA 3EZ5A 4FOEA 1VQ5N 4BG8A 2UXCK 3C6TA 4FK0A 2Q1NA 4FLTA 1X1PA 3ITHA 5I3UA 5LJVA 3CCEN 4OLBA 4BRQA 3ZT2A 4BRCA 4AHVA 2EHGA 4CBXA 1BO5O 2QWRA 5FROA 5BRHA 4JRPA 5SZTA 1CXQA 3EN9A 2ZJPL 3DJCA 3TU5A 4NB4A 4QS9A 5FDLA 2FLOA 1ASUA 3FZFA 1JLBA 2HHSA 2G8HA 4CF2A 2WOMA 3NF6A 4FM1A 4CJPA 4JKAA 1NK8A 5E41A 1YF5L 2WUSA 2XY5A 1WSEA 1IO2A 5HP1A 4IKFA 1P90A 1S22A 4BQZA 3K5LA 3VF4A 2QA4N 1WSHA 4C8LA 4CHPA 4H0YB 4DR1K 4GKJK 4EP5A 4FCYA 4DTRA 2HF4A 3TABA 4DQPA 3L2UA 3A8YA 3D2FB 1NM1A 4H5RA 3DI6A 3QESA 1YJWN 2E1YA 2VCPA 3CCMN 2ZGZA 4CZKA 1CZAN 3PUFA 1NLVA 1M1KO 3CJ1A 3T3FA 4RCHA 1SV5A 3A5NC 4TSXA 3QERA 1HKGA 3CPWM 1VQPN 3VTHA 4X65K 2OTLN 4FSVA 3CM6A 3C6AA 4A62A 3CJ7A 3TARA 5LJWA 2QI2A 3LP1A 1I39A 3FFIA 1HUXA 2V52B 4KFBA 2Q0UA 2RE2A 1BIZA 3A5OC 3HL8A 1JL2A 3O8MA 5LY3A 1NOZA 3O3FA 3JSMA 1SZ2A 1RBSA 3KKSA 4BR7A 2G8KA 2HMIA 3PV8A 3AVGA 1TYQB 4MDBA 2J4RA 4CFDA 1BI4A 1VSHA 2KQ2A 2WONA 2ZM6K 3ZSXA 1YI2N 3TTFA 4LF6K 3LP2A 4WCEL 4OKEA 1RNHA 5KQDA 3Q7CA 5AFUH 2PZSA 3CJAA 1BISA 4M7XA 1MA9B 4F3OA 2D1KA 3KLEA 3F2KA 2YKNA 5KPRA 5EOYA 1HMVA 1KXPA 4JK8A 4DQQA 1XNRK 3H3OB 2ZJQL 3AVCA 4CIFA 1BG3A 4XH4A 4HCCA 1T3VA 2UU9K 3CJBA 3HOSA 5FPMA 1NGCA 5HRSA 3MX5A 5M1QA 2P9UA 4FM2A 4DFMA 4JKFA 3SAGA 4FWLA 2ITGA 2I7PA 1WB9A 5BN9A 4E1MA 3MEGA 4U7BA 1Q86O 1VQNN 3AO3A 1BUPA 5C10A 5C24A 4Z4GA 4ZTFA 3M1FA 2CGLA 4CF8A 1YT3A 4CJTA 4YOXA 3K5OA 1N6QA 3AVFA 2UXDK 3NF7A 1QE1A 1NKBA 4DSIA 4QS7A 3OYBA 3CG7A 2FBYA 2HHTA 4CJVA 1BIUA 1L3TA 4O44A 3RRHA 4KHSA 4BC5A 2QKBA 3DXMA 3DOLA 2OPRA 4F4KA 2X6NA 3O9RA 2OZSA 3VQAA 2VGMA 3LAMA 4FK2A 1XWLA 3SV3A 2E2OA 2IOCA 1U49A 2GX9A 5JICA 1WBDA 1HKBA 4FOIA 2HNDA 3Q7BA 4DTMA 5CHIA 2VWBA 3K2PA 3G71N 3RMBA 4BRIA 3SQ1A 3PO5A 4B3TK 4IG0A 2O8EB 2FF6A 4J2BA 4DU4A 4V19S 3VEYA 3ZCMA 2WFBA 1J53A 3TAEA 5AQTA 4JHDA 4ELTA 4B9TA 1U2VB 3CXCM 3C94A 3LWLA 1NOYA 4CZMA 3LDQA 1TV6A 1C1BA 4Z0UA 3KK2A 1RT1A 4KH5A 2O8CA 3QIOA 4JI5K 1IKVA 3MK6A 4JN4A 3O9SA 2PBDA 4N47A 3C7NA 3TAGA 4ZHRA 5LMNK 5AQPA 2AA4A 1TKZA 2ITMA 3A0IX 2QWOA 2PAVA 2FBXA 1DTQA 4E89A 1R59O 1QSSA 3O9QA 3ULEA 4IOXA 1HNVA 3ZT1A 4O8KA 4CGDA 3OYNA 4FZZA 3PIPL 3LWMA 3ZYYX 3R3LA 2GUPA 3EE9A 2NLXA 5DM6L 4B3MK 5AZIA 4DS4A 3FZHA 2UUBK 1NG9A 3O80A 3DMJA 1DLOA 1K8KB 3VETA 2P5GA 5EU7A 3ZSQA 5CE3A 3L3VA 1DT9A 2P9UB 5J2NA 4C1NK 5AQUA 2YNIA 4DV1K 4XH5A 2HW3A 3H45C 1Y97A 4H03B 3K5NA 3CD6N 2KLAA 1C6VA 5ELZA 4FWMA 4BY9C 2D0CA 3AAQA 3A5MC 4DSEA 3MWPA 1GOCA 2OTJN 1RTDA 1GLAG 1H1VA 3U9ZA 3IFRA 2O8DA 4E7KA 5KPTA 1WNSA 1NGIA 5EY4A 5F0XA 1KRPA 2W6KA 4YDUC 3I0SA 4AM6A 4JI3K 4HUGA 4CEAA 2IVNA 2QWMA 4WFNL 4AH9A 1J54A 1BA1A 4MDAA 4LH5A 4BC4A 3CF5L 1EWRA 4CZEA 5BPNA 3V81A 1XHZA 1WSJA 1NGGA 3QFUA 4NCAA 1ESVA 3O5BA 3OYEA 1RBVA 1RILA 3O3HA 1KVCA 4PQUA 1YIJN 5HRRA 3V1RA 4CZGA 4QS8A 3LPUA 1KAYA 4O0IA 3LP3A 1QSYA 3KLGA 2NUBA 2IC3A 4Z94A 3VEVA 3MXMA 2G8IA 3KZBA 4CJEA 2XRIA 1NJIO 1QQOA 4CIGA 4FW1A 3THXB 3ULEB 1QZ6A 1QTMA 2YX6A 4OPHA 4MO5A 3FLCO 4KHNA 1OVYA 3PX6A 4RW9A 2XHBA 2RKIA 3HBTA 3OYIA 1YJ9N 3HT3A 4DV3K 4FWSA 1VSKA 3CC7N 4B9VA 5AZIB 2DPNA 4CBUA 3DOKA 4IOCL 4BDYA 5C2FA 1A5XA 1WN7A 4KREA 2P9LA 4NLBA 1VQ4N 3VGKA 3VF6A 3VEZA 4DB3A 3QB0A 2FSJA 3VEOA 2ASMA 2O8BA 3QEIA 3KLFA 4A5BA 2AP1A 3P39A 2JWLA 4FLZA 3RR7A 5C2DA 1Q9YA 1REVA 1CXUA 1OVQA 1Q8IA 2O4IA 3F5TA 4G1QA 1RDUA 1TK0A 4CZFA 5BRDA 2FBTA 5GIOA 2F9TA 2I7NA 1KVBA 1LWEA 2HHXA 2YCHA 2O8DB 2AJQA 1QQNA 1S1VA 2BDPA 1JXBA 3OYJA 4FLXA 1W97L 3TAPA 3D2EB 2VQFK 4UY8O 3TANA 1S1TA 4BRMA 2W42A 2E2QA 2NRWA 3ZT4A 2E1ZA 2E8AA 1W7AA 3ZEUA 4DTUA 1J6ZA 4OVLA 3OYHA 4K8XA 3AA5X 4CVNE 3DLHA 4PY5A 4Z4CA 4FLVA 2OA8A 3O4WA 2P9IB 4C8KA 3CC4N 1ZYQA 3AGRA 4BG9A 4AHCA 3ID6A 4MLEA 2Z1GA 1VSDA 1S1WA 4PWDA 4M3RA 1G99A 3VN5A 5AZJA 1SL0A 3PLAA 1GLFO 3T7ZA 4JV5K 2CH5A 4CI6A 3CCLN 2FF3B 4J2EA 4FJMA 4W5TA 2HVHA 1GOAA 3O08A 4BRNA 1KD1O 1EWQA 3NMUA 4IJAA 4DR4K 1FJGK 2FSNA 1WSIA 3A5LC 2QK9A 3DAWA 3THYA 4FWRA 2P9SA 5C12A 4ICLA 1EKEA 4L3QA 4EHUA 3I8DA 1ASWA 4B8CA 2KZZA 2F8SA 4YNQA 3L2WA 1XQSC 2RHKA 3P83D 3SAHA 4PKHA 1Q9XA 4WFBL 3R9PA 1JXEA 4KAZA 3TSUA 4K43A 3ATVA 4N41A 2A40A 3S3NA 1D9FA 3SUQA 1IV0A 4FWKA 1TAUA 4JKEA 3QMLA 4OX9K 3A2FA 4BRLA 2W40A 5KGXA 1YHQN 1A5WA 1KVAA 2E6MA 3ZX2A 5BREA 4J2AA 1EETA 4H0XB 2P9PB 4WQ4A 2XY6A 3WXIA 3B6OA 1ZBIA 4MO4A 4BWJA 1SL2A 2ZE2A 5BPMA 2YNHA 5B8HA 4WQ5C 4FJGA 3AVMA 1D9DA 1Z05A 4JI0K 3MX2A 3AVKA 2NRXA 1LW2A 4BWMA 1KC8O 2I5JA 3PIOL 1O1WA 3ZSRA 4CD3A 1ZBSA 1T6DA 3AO2A 1K73O 4LD0A 4AF1A 3SYZA 4QAGA 1HLUA 1WSGA 4DTPA 4DG1A 3DLRA 3EYZA 4FZXC 1YVNA 1JLAA 2HHHK 5HRPA 5J2PA 4PHTX 3P1GA 4HCBA 5C15A 1L3UA 3O9UA 3UE5A 1OH7A 3K59A 3VESA 5AZJB 1X9JA 4CGJA 4N76A 1TVRA 4NO7A 3J7YP 3CFOA 4O55A 5M1OA 4DQSA 2QW9A 3HYFA 4YOTA 2OCEA 5BR8K 1TK5A 3H08A 3BEXA 2ASOA 3ZX0A 4DV6K 3SUNA 3CM5A 1VSMA 4ELUA 5D3GA 3TWHA 1HPZA 4C23A 3WXLA 2R7YA 3RRGA 1U47A 2GWKA 1BQMA 3GDQA 4CJUA 4BRFA 1HR0K 5JS1A 3H1QA 4XIUA 4OPAA 5M1KA 1B9FA 4BDZA 4CHOA 2P9KA 4DR3K 4BGAA 4JK7A 1VSIA 1NK0A 4ID1A 3LM2A 2Y1JA 3O1BA 2A3ZA 2V7YA 3QDKA 3QEPA 3P4IA 4N5SA 3OS1A 3KLIA 3O6WA 3DXMB 3SNNA 3V1QA 1MDUB 4NXNK 1GLEG 4FWPA 1IKYA 1VQLN 1LAWA 2HF3A 2A6AA 1VQMN 3MEDA 4IG3A 3SMSA 4LF4K 2P9PA 3VQCA 2E2PA
chains in the Genus database with same CATH topology
2FF6A 4G9ZA 3VEYA 4BGBA 2WFBA 3D6RA 5E84A 3I55N 4H5WA 4KH4A 3EL2A 4JHDA 3DWLA 5AQTA 4ILHA 3IKMA 1U2VB 3CXCM 3M3ZA 3HTVA 4IEEA 1MWMA 4M63C 3UKRA 2Q31A 1RFQA 4CZMA 3LDQA 4FWNA 4RWTA 4BRDA 1D4XA 5JVHL 3CHWA 3SLCA 5GAGP 5FPDA 3KK7A 1VQ8N 3MWTA 3ENOA 5BPLA 2BH1A 4C1NI 3IUCA 2CGKA 4KH5A 1NMDA 2A41A 5AQSA 1Q81O 3TSQA 1TUYA 5CR4A 4B9QA 5GADP 3MK6A 4JN4A 3UKUB 3O9SA 2PBDA 3DXKA 3C7NA 4B1UB 1NGHA 4CZIA 1E4FT 3H6EA 4H5VA 3MCAB 5AQPA 3IDHA 2AA4A 2YHYA 3LM9A 3OA9A 2ITMA 3A0IX 5KPZA 1XC3A 1KQSM 2QWOA 2PAVA 3O1WA 2ASPA 1R59O 5AQGA 5JLHA 3CETA 3O9QA 3ULEA 4IOXA 1U2VA 3OHRA 1TUUA 3U8XA 3WQTA 3VERA 5AR0A 5AQHA 3ENBA 5BR9A 3J7ZO 3CMAN 4O8KA 3SBTA 3DLLL 2JWKA 3GBTA 1WUAA 5E26A 2Q36A 1HJOA 2P9KB 3PIPL 3ZETB 3R3LA 3ZYYX 2GUPA 1NGBA 2NLXA 3EE9A 5DM6L 4YOVA 3CERA 5FPNA 5AZIA 1Q82O 3AAPA 3FZHA 4NLCA 3O80A 3UKUA 4A57A 4F9OA 1K8KB 3GG4A 3VETA 4EAHD 5CE3A 4KBOA 4BR5A 1DT9A 2P9UB 4ISFA 1V4TA 4C1NK 4IDHA 4O5FA 5AQUA 3KWGA 3OW2M 1ATRA 4XH5A 2NRVA 1S3XA 3VEWA 3WXKA 3H45C 1BWFO 3EZWA 3BF1A 2P9NB 4H03B 3EKUA 2V7ZA 3E9OA 4BC3A 4IOAL 3CD6N 2KLAA 3N4QA 4GY2B 1T44A 4JD2A 3I56N 4O8UA 4H5TA 4ILJA 1E4GT 5ELZA 3M6GA 4FWMA 2D4WA 4BY9C 1JCEA 2QEXN 3UKRB 4JD2B 3AAQA 3CCVN 2HBKA 3A5MC 1VAZA 3MWPA 3HZ6A 1XUPO 1QZ5A 5JMVA 1BOTO 4MLHA 4OO1J 2OTJN 1GLAG 3MCPA 1H1VA 2YJFA 2KHOA 2GELA 4R79A 2QTDA 3CI5A 3U9ZA 2HSTA 3IFRA 4IXCA 1NGDA 5KPTA 3B8AX 2OANA 4IZ9A 1NGIA 5EY4A 4BRPA 4H5NA 4DCHA 4EFHA 5GIPA 3ZX3A 5F0XA 1IJJA 1P8ZA 4YDUC 4AM6A 4XH1A 3K9JA 3VENA 3QICA 5AQKA 2UYTA 1BDGA 2IVNA 2QWMA 3JXUA 3MN6A 4WFNL 2IVOA 5TKYA 1BA1A 4MDAA 5MLCQ 4WF9L 4HWIA 3H3NO 5AQVA 3E9PA 4CD1A 1ZXOA 3ENHA 4AM7A 4BC4A 1Z6RA 3CF5L 3U4LA 2NRZA 3BUZB 4CZEA 5BPNA 1C0FA 1NGGA 1BU6O 5H1SQ 3QFUA 2EWSA 3ZETA 1RGIA 2ZF5O 3E9LA 1ESVA 3O5BA 2YI1A 1QHAA 5AQOA 4JEPA 1DGKN 5AQYA 1ZC6A 3CCJN 3N4PA 4ISGA 3F9MA 3QFPA 4A5AA 4DHYA 1K8KA 1HX1A 4I6MA 1SAZA 4JKGA 1IG8A 2E2NA 4GV3A 1YIJN 1EQYA 4B1XB 4B1WB 4CZGA 5F1XA 3VF2A 4QS8A 2WBNA 3DXKB 1VQ9N 1KAYA 4H0TB 4BRGA 4BVPA 4JKGB 3FZMA 4Z94A 3VEVA 4IFEA 3G6EN 3EE8A 3KZBA 3CJ9A 3AGKA 4CZJA 2P9NA 3TTDA 1NJIO 3HM8A 1QQOA 4GV9A 3RVCA 4CJ7A 3L0QA 1NGEA 2HOEA 3M5RA 5AQWA 5JVGL 3ULEB 1QZ6A 1GLJO 2YX6A 4OPHA 4MO5A 3FLCO 3CPEA 1OVYA 4WQ4C 5M1PA 3TTCA 3VEXA 3UB5A 2P9IA 3I33A 3HBTA 4BR0A 5AQLA 3WEEA 1YJ9N 2Q0RA 4FWSA 4H0PA 3CC7N 3QBXA 5AZIB 1GLLO 2DPNA 4CBUA 4YORA 3G25A 4IOCL 2V51B 3LDLA 2F9WA 1U6ZA 2IVPA 3LDPA 5C2FA 5GINA 4E1JA 2P9LA 3FFKB 4NLBA 1SQKA 4CZLA 3HSCA 2NRRA 1VQ4N 3VGKA 1EO1A 3VF6A 3VEZA 2P9LB 2Q2RA 4DB3A 3CQXA 3QB0A 2FSJA 3VEOA 2FXUA 4PKIA 1Y64A 2ASMA 2A5XA 3E1YA 3FZKA 5GAEP 3TPQA 2NZTA 4FVUA 3SJHA 4A5BA 2AP1A 3H1VX 3P39A 4HTLA 3L4QA 4FL9A 1YITN 2JWLA 5KQ8A 3R8EA 5C2DA 1ATNA 3I8BA 4J8FA 1NBWA 4K42A 3F5TA 3CQYA 5AQFA 4JNEA 4XEIA 3WQUA 1RDUA 2QWQA 4YOUA 2YJEA 4CZFA 5BRDA 5ADXA 4IJNA 1S72N 4K41A 5GIOA 1WOQA 4CZHA 2F9TA 2I7NA 1OKJA 3NVKA 4I6MB 1QQMA 3MDQA 3SK3A 3C0BA 1JCGA 2YCHA 3H46O 5HL7L 5TKWA 1QQNA 4IO9L 1K9MO 2D0OA 2GEMA 4ILGB 3WXJA 1W97L 3ID8A 4M7YA 2ZJRL 3D2EB 4EHTA 1NGAA 3KVGA 4UY8O 5AQQA 1KAZA 3T69A 4IWVA 4GNIA 3GE1A 3IMXA 3L6QA 4BRMA 4EIAA 5GAHP 2E2QA 2NRWA 3C65A 5HOOA 1N8RO 1VQ7N 3D2EA 2E1ZA 1LOTB 2E8AA 2KKZA 1DEJA 5AQJA 2HBJA 1YXQA 3WXMB 3ZEUA 3GL1A 1J6ZA 1O13A 1DKGD 3MN9A 5DM7L 3CMEN 4BRAA 3R1XA 5AQNA 4FWQA 4BRHA 4FOEA 3O4WA 4JAXA 4BG8A 1VQ5N 2P9IB 3SBGA 3ZEUB 2Q1NA 3CC4N 5LJVA 3OBWA 3AGRA 4BG9A 3CCEN 4BRQA 3BF3A 5EVZA 3ID6A 5EXWA 1Q7YO 4MLEA 3FR0A 3FZLA 2YHXA 3VGLA 1G99A 4BRCA 4CBXA 5AZJA 1BO5O 2NRTA 3PLAA 2QWRA 3K9KA 1YAGA 4PL8A 1GLFO 3BP8A 5BRHA 2ZGYA 3T7ZA 2CH5A 4CI6A 3CCLN 2FF3B 3EO3A 3EN9A 3HOTA 2PFUA 2ZJPL 3DJCA 3TU5A 3G4SN 4NB4A 3D2FA 3J8AA 3O08A 4QS9A 4WQ5A 4BRNA 1KD1O 2FLOA 3NMUA 3FZFA 4BC2A 4IJAA 2FSNA 3A5LC 5ADXH 3DAWA 3TSPA 2E88A 2BTFA 2D0PA 4FWRA 4A61A 2P9SA 4JKAA 5AFUA 5C12A 2ZWHA 1YF5L 2HBLA 2WUSA 4L3QA 4EHUA 3CCSN 1YJNN 1P90A 1S22A 4BQZA 3VF4A 2QA4N 3MN5A 3VPZA 4RTFD 2QWLA 4K25A 1XQSC 1SS6A 4H0YB 3ATUA 3WEEB 1K8AO 2RHKA 3RSEA 3SAHA 4PKHA 2HF4A 4YDUA 4WFBL 3R9PA 3TSUA 4K43A 1VQ6N 3RSEB 3ATVA 3A8YA 3D2FB 1RDWX 1NM1A 4H5RA 2A40A 1T6CA 3L4IA 5AQZA 3LDOA 2VGNA 4FWKA 4WFAL 1YJWN 4JKEA 2E1YA 3QMLA 2VCPA 3VOVA 1W2BM 3CCMN 1BA0A 2ZGZA 4A2AA 2CH6A 1CZAN 2FSKA 1TYQA 1X3MA 2W40A 1NLVA 4BRLA 4CZKA 3VMFB 3CCUN 4WYBA 3CJ1A 1YHQN 1M1KO 5M1NA 4RCHA 2NRHA 2BUPA 3A5NC 1JCFA 1GLDG 4ISEA 4IEIA 3ZX2A 3SAFA 1HKGA 4IO8A 3CPWM 1VQPN 3VTHA 5BREA 2OTLN 4FSVA 4H0XB 3C6AA 2P9PB 4JKDA 4WQ4A 4A62A 1NGJA 3CJ7A 3WXIA 5F2RA 3W3DA 1ILYA 5LJWA 2WC9A 4MO4A 2E20A 2QI2A 5BPMA 5B8HA 1HUXA 2V52B 4WQ5C 3AY9A 2Q0UA 2QWNA 1GLBG 2RE2A 3CCQN 4BRKA 5AQXA 5AQIA 3A5OC 4KH6A 3O8MA 4GVEA 3VTIA 5LY3A 1HKCA 1Z05A 4BVOA 4FO0A 5BRFA 3MX2A 1SZ2A 2NRXA 4BR4A 4BREA 3D7EO 4BR7A 4U67L 3HRGA 4JKCA 5AQRA 1TYQB 1KC8O 3FGUA 4B1VA 4A2BA 3PIOL 2GWJA 4MDBA 2J4RA 2H3GX 2P9SB 4CD3A 4A59A 3NVMA 1ZBSA 1T6DA 4JKBA 1YI2N 1NWKA 3TTFA 1K73O 4AF1A 5C0YA 2QM1A 4WCEL 1HLUA 3HI0A 5KQDA 3Q7CA 5AFUH 3O9TA 3CJAA 4M7XA 1MA9B 3SMPA 3CC2N 2D1KA 1YVNA 3F2KA 2NNWA 1GLCG 5KPRA 4Y0WA 3CCRN 1VQON 3JS6A 5EOYA 4PHTX 1KXPA 3MMVA 4JK8A 5C15A 2HMPA 3O9UA 3UE5A 3H3OB 3S41A 2ZJQL 3WUHA 3P38A 1ATSA 3FE1A 3MN7A 3VESA 5JLFA 1LCUA 5AZJB 1BG3A 1V4SA 4XH4A 1T3VA 1X9JA 3R6MA 4BR9A 2YHWA 3EKSA 5FPEA 4YOYA 1KAXA 4B1YB 2Q97A 2HBMA 2A42A 3KHYA 4NO7A 3CJBA 5M1OA 4GV6A 2QW9A 1NGFA 4YOTA 3HOSA 5FPMA 1NGCA 4JKHA 3BEXA 4H0OA 2ASOA 3LL3A 3MX5A 5M1QA 3ZX0A 2P9UA 4JKFA 3QBWA 3WT0A 3C7NB 3U9DA 2IIRA 4FPBA 3SAGA 4PKGA 2CGJA 4FWLA 2W41A 1Q18A 4LC9B 2I7PA 5I9EB 4C23A 3E66A 3WXLA 4BROA 2GWKA 5BN9A 3C6HA 2VYPA 2F7TA 1HPMA 4FWOA 4U7BA 3GDQA 1X3NA 3CIPA 1QVGM 4PL7A 4BQLA 1Q86O 1VQNN 2QWPA 4BRFA 1BUPA 3P31A 3OBYA 5C10A 3VGMA 3M1FA 2CGLA 4YOXA 4FPAA 3H1QA 4OPAA 5M1KA 4QS7A 4BR2A 3KWIA 4JHDB 2P9KA 4BGAA 4JK7A 1MWKA 4B1ZA 4BC5A 4CBWA 1QVFM 3GOIA 1VQKN 3LM2A 3O1BA 3DXMA 5AQMA 5EX5A 2A3ZA 2V7YA 3QDKA 4JK9A 3O9RA 3P4IA 2GTDA 3W0LA 2VGMA 1JJ2M 4DQ8A 3AARA 5BN8A 3O6WA 3DXMB 4H0VB 3LDNA 2E2OA 2GX9A 3CJCA 5JICA 5M1FA 1HKBA 4FOIA 1MDUB 3Q7BA 1GLEG 4FWPA 2VWBA 5CHIA 3G71N 1M90O 1VQLN 4BRIA 2HF3A 2A6AA 1VQMN 1YUWA 1C0GA 2QXLA 3SMSA 4DKWA 4YOWA 2P9PA 2E2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FF6 A;  3VEY A;  4BGB A;  5E84 A;  4H5W A;  5AQT A;  3EL2 A;  4JHD A;  3DWL A;  1U2V B;  3M3Z A;  3HTV A;  1MWM A;  4M63 C;  3UKR A;  2Q31 A;  1RFQ A;  4CZM A;  3LDQ A;  4FWN A;  4RWT A;  4BRD A;  1D4X A;  3CHW A;  3SLC A;  5FPD A;  3ENO A;  5BPL A;  3IUC A;  2CGK A;  1NMD A;  2A41 A;  5AQS A;  1TUY A;  4B9Q A;  3MK6 A;  4JN4 A;  3UKU B;  2PBD A;  3DXK A;  3C7N A;  4B1U B;  1NGH A;  4CZI A;  1E4F T;  3H6E A;  4H5V A;  5AQP A;  3IDH A;  2AA4 A;  2YHY A;  3LM9 A;  2ITM A;  3A0I X;  5KPZ A;  1XC3 A;  2QWO A;  2PAV A;  3O1W A;  2ASP A;  1R59 O;  5AQG A;  5JLH A;  3CET A;  3ULE A;  1U2V A;  3OHR A;  1TUU A;  3U8X A;  3WQT A;  3VER A;  5AR0 A;  5AQH A;  5BR9 A;  4O8K A;  3GBT A;  1WUA A;  5E26 A;  2Q36 A;  1HJO A;  2P9K B;  3ZET B;  2GUP A;  1NGB A;  2NLX A;  3CER A;  5FPN A;  5AZI A;  3AAP A;  3FZH A;  3O80 A;  3UKU A;  4F9O A;  1K8K B;  3GG4 A;  3VET A;  4EAH D;  5CE3 A;  4KBO A;  4BR5 A;  2P9U B;  4ISF A;  1V4T A;  4O5F A;  5AQU A;  1ATR A;  4XH5 A;  1S3X A;  3VEW A;  3WXK A;  3H45 C;  1BWF O;  3EZW A;  3BF1 A;  2P9N B;  4H03 B;  3EKU A;  2V7Z A;  4BC3 A;  4GY2 B;  4JD2 A;  1T44 A;  4H5T A;  1E4G T;  5ELZ A;  3M6G A;  4FWM A;  2D4W A;  1JCE A;  3UKR B;  4JD2 B;  3AAQ A;  3A5M C;  3HZ6 A;  1XUP O;  1QZ5 A;  5JMV A;  1BOT O;  4MLH A;  1GLA G;  3MCP A;  1H1V A;  2YJF A;  2KHO A;  2GEL A;  3CI5 A;  3U9Z A;  3IFR A;  4IXC A;  1NGD A;  5KPT A;  3B8A X;  2OAN A;  4IZ9 A;  1NGI A;  5EY4 A;  4BRP A;  4H5N A;  4DCH A;  4EFH A;  3ZX3 A;  5F0X A;  1IJJ A;  1P8Z A;  4YDU C;  4AM6 A;  4XH1 A;  3VEN A;  3QIC A;  5AQK A;  2UYT A;  1BDG A;  2IVN A;  2QWM A;  3JXU A;  3MN6 A;  2IVO A;  5TKY A;  1BA1 A;  4HWI A;  3H3N O;  5AQV A;  4CD1 A;  1ZXO A;  3ENH A;  4AM7 A;  4BC4 A;  1Z6R A;  3U4L A;  3BUZ B;  4CZE A;  5BPN A;  1C0F A;  1NGG A;  1BU6 O;  3QFU A;  2EWS A;  3ZET A;  1RGI A;  2ZF5 O;  1ESV A;  3O5B A;  2YI1 A;  1QHA A;  5AQO A;  1DGK N;  5AQY A;  1ZC6 A;  4ISG A;  3F9M A;  3QFP A;  4DHY A;  1K8K A;  1HX1 A;  4I6M A;  1SAZ A;  1IG8 A;  2E2N A;  1EQY A;  4B1X B;  4B1W B;  4CZG A;  5F1X A;  3VF2 A;  4QS8 A;  3DXK B;  1KAY A;  4H0T B;  4BRG A;  4BVP A;  3FZM A;  4Z94 A;  3VEV A;  3KZB A;  3CJ9 A;  4CZJ A;  2P9N A;  3HM8 A;  1QQO A;  4CJ7 A;  3L0Q A;  1NGE A;  2HOE A;  5AQW A;  3ULE B;  1QZ6 A;  1GLJ O;  4MO5 A;  3FLC O;  3VEX A;  4WQ4 C;  3UB5 A;  2P9I A;  3I33 A;  3HBT A;  4BR0 A;  5AQL A;  3WEE A;  2Q0R A;  4FWS A;  4H0P A;  3QBX A;  5AZI B;  1GLL O;  2DPN A;  4CBU A;  3G25 A;  2V51 B;  3LDL A;  2F9W A;  1U6Z A;  2IVP A;  3LDP A;  4E1J A;  2P9L A;  3FFK B;  1SQK A;  4CZL A;  3HSC A;  3VGK A;  3VF6 A;  3VEZ A;  2P9L B;  2Q2R A;  4DB3 A;  3CQX A;  3QB0 A;  2FSJ A;  3VEO A;  2FXU A;  4PKI A;  1Y64 A;  2ASM A;  2A5X A;  3FZK A;  3TPQ A;  2NZT A;  3SJH A;  2AP1 A;  3H1V X;  4HTL A;  4FL9 A;  5KQ8 A;  3R8E A;  1ATN A;  3I8B A;  4J8F A;  1NBW A;  4K42 A;  3CQY A;  5AQF A;  4JNE A;  4XEI A;  3WQU A;  2QWQ A;  4CZF A;  2YJE A;  5BRD A;  5ADX A;  4IJN A;  4K41 A;  1WOQ A;  4CZH A;  2F9T A;  2I7N A;  1OKJ A;  4I6M B;  1QQM A;  3MDQ A;  3SK3 A;  3C0B A;  1JCG A;  2YCH A;  3H46 O;  1QQN A;  2D0O A;  2GEM A;  3WXJ A;  3ID8 A;  4M7Y A;  3D2E B;  4EHT A;  1NGA A;  3KVG A;  5AQQ A;  1KAZ A;  4IWV A;  4GNI A;  3GE1 A;  3IMX A;  3L6Q A;  4BRM A;  4EIA A;  2E2Q A;  3D2E A;  2E1Z A;  1LOT B;  2E8A A;  5AQJ A;  1DEJ A;  3ZEU A;  1YXQ A;  3GL1 A;  1J6Z A;  3MN9 A;  1DKG D;  4BRA A;  5AQN A;  4FWQ A;  4BRH A;  4FOE A;  3O4W A;  4JAX A;  4BG8 A;  2P9I B;  3ZEU B;  2Q1N A;  5LJV A;  4BG9 A;  4BRQ A;  3BF3 A;  5EVZ A;  5EXW A;  4MLE A;  3FR0 A;  3FZL A;  2YHX A;  3VGL A;  1G99 A;  4BRC A;  4CBX A;  5AZJ A;  1BO5 O;  2QWR A;  1YAG A;  4PL8 A;  1GLF O;  3BP8 A;  5BRH A;  2ZGY A;  2CH5 A;  4CI6 A;  2FF3 B;  3EO3 A;  3EN9 A;  3DJC A;  3TU5 A;  4NB4 A;  3D2F A;  3J8A A;  3O08 A;  4QS9 A;  4WQ5 A;  4BRN A;  2FLO A;  3FZF A;  4BC2 A;  4IJA A;  2FSN A;  3A5L C;  5ADX H;  3DAW A;  2E88 A;  2BTF A;  2D0P A;  4FWR A;  4A61 A;  2P9S A;  5AFU A;  2ZWH A;  2WUS A;  4L3Q A;  4EHU A;  1S22 A;  4BQZ A;  3VF4 A;  3MN5 A;  3VPZ A;  4RTF D;  2QWL A;  4K25 A;  1XQS C;  3WEE B;  4H0Y B;  3ATU A;  3RSE A;  4PKH A;  2HF4 A;  4YDU A;  3R9P A;  4K43 A;  3RSE B;  3ATV A;  3A8Y A;  3D2F B;  1RDW X;  1NM1 A;  4H5R A;  2A40 A;  1T6C A;  3L4I A;  5AQZ A;  3LDO A;  4FWK A;  2E1Y A;  3QML A;  2VCP A;  3VOV A;  1BA0 A;  2ZGZ A;  4A2A A;  2CH6 A;  1CZA N;  2FSK A;  1TYQ A;  1X3M A;  2W40 A;  1NLV A;  4BRL A;  4CZK A;  4WYB A;  3CJ1 A;  4RCH A;  2NRH A;  2BUP A;  3A5N C;  1JCF A;  1GLD G;  4ISE A;  3ZX2 A;  1HKG A;  4IO8 A;  5BRE A;  4FSV A;  4H0X B;  2P9P B;  4WQ4 A;  4A62 A;  1NGJ A;  3CJ7 A;  3WXI A;  5F2R A;  3W3D A;  5LJW A;  4MO4 A;  2E20 A;  5BPM A;  5B8H A;  1HUX A;  2V52 B;  4WQ5 C;  3AY9 A;  2Q0U A;  2QWN A;  1GLB G;  4BRK A;  5AQX A;  5AQI A;  3A5O C;  3O8M A;  5LY3 A;  1HKC A;  1Z05 A;  4BVO A;  4FO0 A;  5BRF A;  1SZ2 A;  4BR4 A;  4BRE A;  3D7E O;  4BR7 A;  5AQR A;  1TYQ B;  3FGU A;  4B1V A;  4A2B A;  2GWJ A;  2J4R A;  2H3G X;  2P9S B;  4CD3 A;  1ZBS A;  1T6D A;  1NWK A;  2QM1 A;  1HLU A;  3HI0 A;  5KQD A;  5AFU H;  3CJA A;  4M7X A;  1MA9 B;  3SMP A;  2D1K A;  1YVN A;  1GLC G;  5KPR A;  4Y0W A;  3JS6 A;  5EOY A;  1KXP A;  3MMV A;  2HMP A;  3UE5 A;  3H3O B;  3S41 A;  3WUH A;  3VES A;  1ATS A;  3FE1 A;  3MN7 A;  5JLF A;  1LCU A;  5AZJ B;  1BG3 A;  1V4S A;  4XH4 A;  1X9J A;  3R6M A;  4BR9 A;  2YHW A;  3EKS A;  5FPE A;  1KAX A;  4B1Y B;  2Q97 A;  2A42 A;  3KHY A;  4NO7 A;  3CJB A;  2QW9 A;  1NGF A;  5FPM A;  1NGC A;  3BEX A;  4H0O A;  2ASO A;  3LL3 A;  3ZX0 A;  2P9U A;  3QBW A;  3WT0 A;  3C7N B;  3U9D A;  2IIR A;  4FPB A;  4PKG A;  2CGJ A;  4FWL A;  2W41 A;  1Q18 A;  4LC9 B;  2I7P A;  5I9E B;  4C23 A;  3WXL A;  4BRO A;  2GWK A;  5BN9 A;  2VYP A;  1HPM A;  4FWO A;  3GDQ A;  1X3N A;  3CIP A;  4PL7 A;  4BQL A;  2QWP A;  4BRF A;  1BUP A;  3VGM A;  3M1F A;  2CGL A;  4FPA A;  3H1Q A;  4QS7 A;  4BR2 A;  4JHD B;  2P9K A;  4BGA A;  1MWK A;  4B1Z A;  4BC5 A;  4CBW A;  3GOI A;  3LM2 A;  3O1B A;  3DXM A;  5AQM A;  5EX5 A;  2A3Z A;  2V7Y A;  3QDK A;  3W0L A;  3P4I A;  2GTD A;  4DQ8 A;  3AAR A;  5BN8 A;  3O6W A;  3DXM B;  4H0V B;  3LDN A;  2E2O A;  5JIC A;  3CJC A;  1HKB A;  4FOI A;  1MDU B;  1GLE G;  4FWP A;  2VWB A;  4BRI A;  2HF3 A;  2A6A A;  1YUW A;  1C0G A;  2QXL A;  3SMS A;  2P9P A;  2E2P A; 
#chains in the Genus database with same CATH topology
 3QNO A;  4BGB A;  4Q0B A;  3CQ8 A;  1NK4 A;  5E84 A;  2O8F A;  5A2Q O;  3E01 A;  3DWL A;  4ILH A;  4F3T A;  4M41 A;  3HTV A;  4E1N A;  4BRD A;  4KHY A;  3CHW A;  3HST B;  5GAG P;  5FPD A;  3KK7 A;  1X9W A;  3MWT A;  3ENO A;  4C1N I;  1BCO A;  4DF4 A;  2CGK A;  1NMD A;  1Q81 O;  3TSQ A;  1TUY A;  4GKK K;  4B9Q A;  2BE2 A;  5GAD P;  3T1A A;  2HHW A;  2Q3S A;  4O5B A;  3EY1 A;  4NXM K;  3MCA B;  4CHQ A;  2RF2 A;  2XO7 A;  1C1A A;  1NK6 A;  4OPJ A;  1SL1 A;  3SQ0 A;  4BE1 A;  2ASP A;  1RT7 A;  1C0U A;  3S3O A;  3HPH A;  3U8X A;  3WNH A;  3O3G A;  1J9A A;  3VER A;  3J7Z O;  3CMA N;  4OGC A;  4KTQ A;  3DLL L;  1CZB A;  1QQC A;  1WUA A;  3ZET B;  3SJJ A;  4YOV A;  1IKX A;  5FPN A;  3F9K A;  2KW4 A;  4LFA K;  3HVR A;  4LY7 A;  4CER A;  3UKU A;  4A57 A;  4DTX A;  4Z4H A;  2DFE A;  2B6A A;  4CEF A;  4KBO A;  1TL1 A;  3MXJ A;  4O5F A;  3OW2 M;  3KWG A;  5CY4 A;  3VQP A;  1U4B A;  3WXK A;  3VEW A;  4DFJ A;  1HYZ A;  3BF1 A;  2P9N B;  3VQ5 A;  1LV5 A;  3N4Q A;  4JD2 A;  4JYA K;  3I56 N;  4YFU A;  2XY8 A;  5IT9 O;  4CK3 A;  3M6G A;  3QIP A;  4C8M A;  4DFP A;  3DLG A;  2X74 A;  2IDO A;  3HXM A;  1VAZ A;  3HZ6 A;  1XUP O;  1KLN A;  4MLH A;  1RCH A;  3NGZ A;  1ZBH A;  3S9H A;  4R79 A;  1NJW A;  3HP9 A;  1NGD A;  4IXC A;  1IG9 A;  3B8A X;  4LF5 K;  4YY3 K;  2OAN A;  4CGG A;  4DCH A;  4EFH A;  5GIP A;  4M3U A;  1NU0 A;  1KFD A;  4B8A B;  4FJK A;  2D5R A;  4GVM A;  2XY7 A;  1L3V A;  3AVB A;  4H4O A;  2DY4 A;  2IVO A;  5TKY A;  3OYG A;  1RT5 A;  4FJL A;  4KHW A;  3H3N O;  3E9P A;  5I42 A;  1NNE A;  2VG5 A;  1ZXO A;  2B4J A;  3V1O A;  3OS0 A;  3BUZ B;  4IBN A;  3VQE A;  1HNI A;  4C8O A;  1D5A A;  1RGI A;  2ZF5 O;  2YI1 A;  5KRS A;  4RW6 A;  3CCJ N;  4ISG A;  3L2Q A;  4A5A A;  4DHY A;  1TKT A;  4JI7 K;  4KB0 A;  1K8K A;  4I6M A;  1JLG A;  1NKC A;  4JKG A;  4JI1 K;  1EQY A;  4B1X B;  3T1H K;  2WBN A;  1TL3 A;  4BVP A;  4K8Z A;  1JLQ A;  1W9H A;  3RWU A;  2LSN A;  3MEC A;  4IFE A;  3G6E N;  3KK3 A;  1HRH A;  5KTQ A;  4CHN A;  3MAQ A;  3TTD A;  1Z26 A;  3HM8 A;  4GV9 A;  3UIQ A;  3K57 A;  5JVG L;  5FRN A;  1GLJ O;  1RT4 A;  3CPE A;  3VEX A;  4DSJ A;  2BAN A;  1VSJ A;  3SPZ A;  2Q0R A;  5T7B A;  3QBX A;  5FLX O;  4LH4 A;  4B9M A;  1LAV A;  4W5R A;  3TI0 A;  1U6Z A;  2IVP A;  4CIE A;  4FJH A;  4QCL A;  4E1J A;  2FBV A;  3KJV A;  2HVI A;  3HSC A;  4L8R B;  4O4G A;  2P9L B;  2G8F A;  1K6Y A;  3CQX A;  3RR8 A;  2A5X A;  3AVN A;  3E1Y A;  5GAE P;  3TPQ A;  3SJH A;  4B9U A;  1YIT N;  4FL9 A;  4I2Q A;  3T19 A;  4CF1 A;  5DK5 A;  1ATN A;  3I8B A;  1S1X A;  4J8F A;  1NBW A;  4K42 A;  3KK1 A;  3CQY A;  4CEB A;  5AQF A;  4JNE A;  4CJW A;  3OS2 A;  4W5N A;  1FK9 A;  2QWQ A;  4YOU A;  4E7I A;  3NFA A;  3SI6 A;  4DFK A;  4DR5 K;  4K41 A;  1S72 N;  3AVL A;  1IBM K;  2F8T A;  4FW2 A;  3NVK A;  1QQM A;  2Z1H A;  2P5O A;  4F2R A;  3C0B A;  2P51 A;  5TKW A;  4FJ8 A;  2D0O A;  3WXJ A;  1YTA A;  4M7Y A;  4DMN A;  4EHT A;  2Y1I A;  4CJS A;  3KD5 E;  3T69 A;  4GNI A;  1SKS A;  1VQ7 N;  3C65 A;  3D0P A;  1A5V A;  3D2E A;  1DEJ A;  3RMC A;  4CHZ A;  1DKG D;  5DM7 L;  3LPT A;  2YNG A;  4BRA A;  3G0Z A;  5AQN A;  3OJS A;  4BRH A;  4JAX A;  3VQ8 A;  3ZEU B;  1T03 A;  1I3A A;  4LF9 K;  4CEC A;  5K14 A;  3OBW A;  3BF3 A;  5EXW A;  1Q7Y O;  3FR0 A;  4GMJ B;  1XC9 A;  3FZL A;  2G8U A;  1WSF A;  3OYC A;  4E0D A;  4DV4 K;  1T05 A;  1YAG A;  3BP8 A;  4DF8 A;  4M42 A;  1WBB A;  2ZGY A;  1B9D A;  4CED A;  3EEQ A;  3HOT A;  4DTJ A;  2PFU A;  2UUC K;  3D2F A;  4CF0 A;  3MEE A;  4BC2 A;  2HNY A;  5ADX H;  3TSP A;  5KGW A;  2E88 A;  5CZ1 A;  4A61 A;  2HNZ A;  1N32 K;  4DQI A;  2ZWH A;  3LDS A;  3SCX A;  3CCS N;  1YJN N;  2VQE K;  4FK4 A;  3PSI A;  2G8W A;  2IAJ A;  4NCG A;  1CZ9 A;  3DLB A;  3ATU A;  1JLC A;  1K8A O;  1RDD A;  3RSE A;  4LSN A;  4YDU A;  2OPP A;  2OPQ A;  3M8P A;  2DFH A;  5AQZ A;  3SUP A;  3LDO A;  2F96 A;  1JL1 A;  3TAF A;  4Y1C A;  1W2B M;  4A2A A;  3S3M A;  2FSK A;  1TYQ A;  1X3M A;  3CCU N;  5LL6 Z;  3VMF B;  4WYB A;  3OY9 A;  4FJX A;  3IAY A;  5M1N A;  1BI4 B;  4MQ3 A;  1JCF A;  1GLD G;  3HJF A;  4IEI A;  3LAK A;  1HNX K;  4KI6 A;  1NGJ A;  1ILY A;  3W3D A;  3TAM A;  4JI8 K;  1KLM A;  3TAQ A;  1U45 A;  3CCQ N;  2QWN A;  1GLB G;  3BDP A;  5AQX A;  5AQI A;  4KH6 A;  3F73 A;  3OYM A;  4Q5V A;  1HKC A;  4BVO A;  4BR4 A;  1RT2 A;  3D7E O;  3THW B;  3HRG A;  3T1Y K;  1U48 A;  4JKC A;  3FGU A;  4DUZ K;  3WNE A;  4B1V A;  1EP4 A;  4CJK A;  3L2R A;  2H3G X;  2P9S B;  2Z1J A;  4A59 A;  3NVM A;  3OJU A;  4DUY K;  4KB1 A;  1NWK A;  5C0Y A;  3C95 A;  4CCH A;  3LP0 A;  3CC2 N;  2X78 A;  1BGX T;  2E5L K;  4IDK A;  3QET A;  4Y0W A;  3MMV A;  1VRU A;  4Y1D A;  1NJZ A;  3WUH A;  3P38 A;  1ATS A;  3FE1 A;  1KTQ A;  5JLF A;  1V4S A;  4JI6 K;  2YHW A;  3EKS A;  2D0A A;  5FPE A;  3PX0 A;  3ZT3 A;  3V9W A;  4B1Y B;  2HBM A;  2A42 A;  3L2V A;  2DTU A;  1NGF A;  1C0T A;  1RBR A;  3QBW A;  3U9D A;  2IIR A;  4FPB A;  4CW7 B;  4PA1 A;  4PKG A;  5CZ2 A;  2W41 A;  1Q18 A;  3CFR A;  5I9E B;  4X64 K;  3C6H A;  2VYP A;  4AHU A;  1HPM A;  5CYQ A;  4FWO A;  2PYL A;  4PL7 A;  4BQL A;  4LFB K;  1W0H A;  2QWP A;  3VGM A;  3C6U A;  3KWI A;  4JHD B;  3OYK A;  4B1Z A;  1VQK N;  3QEW A;  4Z4F A;  2GTD A;  4FM0 A;  4DQ8 A;  1WAJ A;  4H0V B;  1RDC A;  5M1F A;  4AHR A;  3D45 A;  4DU3 A;  1YUW A;  4YOW A;  4DKW A;  3JYT A;  4HVJ A;  4JS4 A;  3NHG A;  3ZLJ A;  4RW4 A;  3VQ6 A;  3HPO A;  4H5W A;  4FJ9 A;  3IKM A;  4AQY K;  5FRM A;  1MWM A;  4M63 C;  3UKR A;  1RFQ A;  4FWN A;  2HHU A;  4RW8 A;  1D4X A;  4RW7 A;  5JVH L;  5J2Q A;  1VQ8 N;  4O0J A;  1S5J A;  1SKW A;  5BPL A;  2BH1 A;  2OZM A;  3IUC A;  1LWF A;  5AQS A;  3ALY A;  1ZBL A;  3DXK A;  3AA4 A;  3ASM A;  4B1U B;  1NGH A;  1E4F T;  3H6E A;  2O8E A;  3IDH A;  3LM9 A;  1KQS M;  4CGI A;  1XC3 A;  3O1W A;  1UOC A;  4OKJ A;  5AQG A;  3CET A;  3K0S A;  1U2V A;  3OHR A;  4JI4 K;  3WQT A;  4B3S K;  3DLE A;  5AR0 A;  5AQH A;  3ENB A;  3SBT A;  4KKO A;  2JWK A;  3GBT A;  5E26 A;  3V9X A;  2Q36 A;  1HJO A;  2P9K B;  3IS9 A;  4ZTJ A;  1GOB A;  4ID5 A;  3CER A;  3AAP A;  4KHU A;  2EX3 A;  1BCM A;  3GG4 A;  4RG8 A;  2UXB K;  2HB5 A;  1WLJ A;  4ISF A;  1TAQ A;  4GW6 A;  1ATR A;  3VA3 A;  4CGF A;  3PY8 A;  2NRV A;  1RDA A;  3EZW A;  3EKU A;  3AA3 A;  2V7Z A;  1C0M A;  3E9O A;  4BC3 A;  4FXD A;  4IOA L;  4DSL A;  4GY2 B;  1T44 A;  2UUA K;  4O8U A;  3AO1 A;  5DMR A;  1E4G T;  4FJ7 A;  1FXX A;  4JD2 B;  3CCV N;  3QEX A;  2HBK A;  4B08 A;  1QZ5 A;  5JMV A;  4M3W A;  3ZSY A;  3NCI A;  3MCP A;  2YJF A;  1Z25 A;  2KHO A;  1UA0 A;  2QTD A;  3CI5 A;  2HHV A;  5C42 A;  5SWM A;  1NK9 A;  4IZ9 A;  4H5N A;  3HK2 A;  4FJ5 A;  5IWA K;  4XH1 A;  3K9J A;  3VEN A;  3QIC A;  5AQK A;  3JXU A;  4CJQ A;  3MN6 A;  4CK2 A;  4DV5 K;  3ZSO A;  5MLC Q;  4JRQ A;  5AQV A;  3ENH A;  4AM7 A;  1Z6R A;  4DQR A;  3U4L A;  5HBM A;  1JLF A;  3THX A;  3DRP A;  1C0F A;  3ZET A;  4BE2 A;  3E9L A;  4B3O A;  1QHA A;  5AQO A;  4JEP A;  2W6L A;  5AQY A;  4CJR A;  4KHQ A;  2QXF A;  3O4Q A;  4CJF A;  5F1X A;  3VF2 A;  3DXK B;  4W5Q A;  1VQ9 N;  4BRG A;  4FJJ A;  4JKG B;  4AHT A;  3FZM A;  1HQE A;  1XHX A;  4E7H A;  3CJ9 A;  3AGK A;  3QO9 A;  4CZJ A;  2P9N A;  1VHX A;  3L0Q A;  1NGE A;  2O8B B;  1B92 A;  1VRT A;  5M1P A;  3TTC A;  2A1S A;  3UB5 A;  3I33 A;  2ZD1 A;  4NYN A;  5JS2 A;  4BR0 A;  3AVH A;  3WEE A;  4I9L A;  3V9Z A;  1HYS A;  3G25 A;  3DM2 A;  1KCF A;  2ETJ A;  2V51 B;  3LDP A;  1LW0 A;  4HHT A;  4H8K A;  3THV A;  1OH5 A;  1VSE A;  4I9Q A;  3SZ2 A;  1FKP A;  2WTU A;  4MFB A;  2NRR A;  1KSP A;  1KFS A;  2Q2R A;  4BE0 A;  1XNQ K;  3FZK A;  4DV0 K;  4FVU A;  3AO4 A;  2QKK A;  3L4Q A;  5KQ8 A;  3R8E A;  1FW6 A;  1NMN A;  3QEV A;  4CJL A;  3M8S A;  4JLH A;  4UQG A;  5KI6 A;  2YJE A;  2B5J A;  4IJN A;  1UWB A;  3SQ2 A;  3WNG A;  1VK0 A;  1R0A A;  4I6M B;  2RPI A;  3MDQ A;  1RTJ A;  3SK3 A;  3ZSV A;  3K5M A;  4CES A;  1JCG A;  3H46 O;  5HL7 L;  5HLF A;  3CYM A;  3KD1 E;  1C1C A;  4DV2 K;  1K9M O;  3ID8 A;  3V4I A;  1NGA A;  3KVG A;  5AQQ A;  1KAZ A;  3GE1 A;  3IMX A;  4EIA A;  1UAX A;  1LOT B;  4X66 K;  4EZ9 A;  3WXM B;  2VWK A;  1YXQ A;  3THY B;  2IS3 A;  3GL1 A;  3MN9 A;  1O13 A;  3KLH A;  1BQN A;  3CME N;  4BAC A;  1FKO A;  2O4G A;  4FWQ A;  2DFF A;  3VQQ A;  3SBG A;  1EXQ A;  3NH2 A;  2P1J A;  4OGE A;  2OPS A;  4FVM A;  4DLG A;  5EVZ A;  3RMD A;  3MXI A;  3HP6 A;  3RMA A;  1RT3 A;  3DLK A;  2YHX A;  3VGL A;  2NRT A;  4I7F A;  1XMQ K;  3K9K A;  4PL8 A;  2ATQ A;  3AVI A;  3VA0 A;  3NGY A;  3EO3 A;  4CFC A;  3G4S N;  3J8A A;  4WQ5 A;  1NJY A;  3AO5 A;  4FYD A;  1JKH A;  2VG7 A;  4FLY A;  4E19 A;  3CFP A;  2BTF A;  2D0P A;  3KIO A;  4CEO A;  5AFU A;  3LZJ A;  2PY5 A;  2HBL A;  2YHB A;  3NBP A;  4KV8 A;  3MN5 A;  3VPZ A;  4LF7 K;  4RTF D;  2QWL A;  4K25 A;  1SS6 A;  3WEE B;  1S6Q A;  2X6S A;  1TK8 A;  1BL3 A;  4YHH K;  3U3G A;  1RDB A;  4B3R K;  2GUI A;  1ITG A;  4E3S A;  1OH6 A;  3OYD A;  3ZSZ A;  1VQ6 N;  3RSE B;  1RDW X;  3DRR A;  1T6C A;  3J81 O;  3L4I A;  4NYF A;  3M8Q A;  2VGN A;  4H4M A;  4WFA L;  3VOV A;  4DWI A;  1QSL A;  3NE6 A;  1BA0 A;  2CH6 A;  4DV7 K;  2G8V A;  2NRH A;  2BUP A;  3PX4 A;  4CGH A;  4DR7 K;  4ISE A;  3SAF A;  1HNW K;  4IO8 A;  4DR2 K;  1OH8 A;  4EZ6 A;  1D8Y A;  1N5Y A;  3OTO K;  3BZC A;  4CHY A;  4JKD A;  5F2R A;  2WC9 A;  2E20 A;  1I94 K;  1UA1 A;  4FZY A;  3OYL A;  1J5O A;  1ZBU A;  4LF8 K;  3AY9 A;  4CJ3 A;  2BGG A;  4BRK A;  2VG6 A;  4M3Y A;  1RTI A;  4GVE A;  3VTI A;  4DSF A;  4FO0 A;  5BRF A;  3V9S A;  1X9M A;  1EX4 A;  4FJI A;  4BRE A;  4U67 L;  5J2M A;  1IH7 A;  5AQR A;  4A2B A;  1S1U A;  2GWJ A;  3THW A;  4KO0 A;  5LMU K;  4JKB A;  4KHP K;  1U04 A;  2IGI A;  2QM1 A;  3HI0 A;  1XMO K;  2KZM A;  3O9T A;  4CJ4 A;  4HTU A;  1ZBF A;  3SMP A;  4M3T A;  1LWC A;  2NNW A;  1GLC G;  1G15 A;  1IBL K;  3CCR N;  2ZQB A;  1VQO N;  3JS6 A;  3VQB A;  2HMP A;  3S41 A;  3VQ7 A;  3MN7 A;  5HRN A;  4NCB A;  1LCU A;  1S9G A;  4KRF A;  3LAN A;  3R6M A;  4BR9 A;  4YOY A;  3VQ4 A;  2GBZ A;  1KAX A;  4BDP A;  3ULD A;  2Q97 A;  3KHY A;  4GV6 A;  4DS5 A;  4JKH A;  4H0O A;  3LL3 A;  2YKM A;  4OPK A;  1HQU A;  1N33 K;  3WT0 A;  3C7N B;  3HO1 A;  2CGJ A;  4FJN A;  4CJ5 A;  4LC9 B;  3HVT A;  3DRS A;  4JS5 A;  3SPY A;  3E66 A;  4BRO A;  4OLA A;  1ASV A;  3HPG A;  3NF9 A;  2F7T A;  3PSF A;  1X3N A;  3CIP A;  1QVG M;  3P31 A;  3OBY A;  2A1R A;  5KRT A;  4FPA A;  4M3Z A;  4N56 A;  4BR2 A;  1MWK A;  4CBW A;  1QVF M;  4B9N A;  3GOI A;  3OYA A;  3J7A P;  5AQM A;  5EX5 A;  4JK9 A;  3W0L A;  1JJ2 M;  3AAR A;  4E7L A;  5BN8 A;  1X9S A;  1SUQ A;  4CFA A;  1T8E A;  3LDN A;  4R5P A;  3CJC A;  4KTZ A;  1M90 O;  1C0G A;  2QXL A;  4CE9 A;  3M8R A;  1F21 A;  4G9Z A;  4PUO A;  1VSL A;  3OVN A;  4M45 A;  2JLE A;  3D6R A;  2OYQ A;  5HRO A;  3I55 N;  4KH4 A;  3EL2 A;  3M3Z A;  4IEE A;  2Q31 A;  4RWT A;  3WNF A;  4DU1 A;  3OYF A;  2O8C B;  3SLC A;  3V9U A;  1YTU A;  4J2D A;  1RBT A;  3L3U A;  4Z4E A;  3NH1 A;  2A41 A;  2HHQ A;  5CR4 A;  3UKU B;  4CZI A;  4DSK A;  4H5V A;  4FLU A;  3ISN C;  2YNF A;  5AJ3 K;  2YHY A;  3OA9 A;  5KPZ A;  4DTS A;  2O8F B;  4KTW A;  5JLH A;  1N36 K;  1TUU A;  3BGR A;  3RTV A;  5BR9 A;  4AHS A;  3I0R A;  1NK7 A;  1SKR A;  4FLW A;  1NGB A;  4JI2 K;  4OJR A;  1Q82 O;  3LZI A;  4NLC A;  1VSF A;  4F9O A;  4EP4 A;  3U3Y A;  1TGO A;  4B9L A;  3IG1 A;  4EAH D;  3NAE A;  3AVA A;  3PO4 A;  1QHT A;  4BR5 A;  3SV4 A;  1V4T A;  4IDH A;  1S3X A;  4IFY A;  1BWF O;  3VQD A;  4CF9 A;  4HUE A;  1BHL A;  4F8R A;  2YHA A;  3HM9 A;  4K0K K;  4E7J A;  4H5T A;  4ILJ A;  3P5J A;  2D4W A;  1JCE A;  2QEX N;  3UKR B;  1TKD A;  4CEQ A;  2KFN A;  1BOT O;  4OO1 J;  3U6F A;  5C25 A;  2RN2 A;  1TKX A;  3QNN A;  2GEL A;  1S9E A;  4M3X A;  2HST A;  2E4L A;  4OKK A;  2FC0 A;  2E6L A;  4BRP A;  3ZX3 A;  1IJJ A;  2KFZ A;  3SQ4 A;  1P8Z A;  1N34 K;  1L5U A;  4AIL C;  2UYT A;  1BDG A;  3V6D A;  4LFC K;  1NKE A;  4WF9 L;  4HWI A;  1DTT A;  4CD1 A;  3O4N A;  2NRZ A;  1J5E K;  4I2P A;  1BU6 O;  5H1S Q;  4LSL A;  2EWS A;  1DGK N;  1ZC6 A;  3N4P A;  5CYM A;  3F9M A;  3QFP A;  4KI4 A;  1HX1 A;  3J80 O;  1SAZ A;  1IG8 A;  2E2N A;  4GV3 A;  4B1W B;  4F2S A;  4H0T B;  4KPY A;  5J1E A;  4X62 K;  1MU2 A;  1RT6 A;  1YVU A;  3EE8 A;  4Z4I A;  3DYA A;  4CFB A;  2KTQ A;  3RVC A;  4CJ7 A;  4B9S A;  4QOZ B;  3M5R A;  2HOE A;  5AQW A;  1CLQ A;  3AVJ A;  1L3S A;  4WQ4 C;  2GV9 A;  1RBU A;  3K58 A;  2P9I A;  4IFV A;  1IKW A;  5AQL A;  3G10 A;  4HUF A;  4DTN A;  4H0P A;  1IBK K;  3ZT0 A;  1GLL O;  1XI1 A;  3KTQ A;  4YOR A;  3LDL A;  3AV9 A;  2F9W A;  4CK1 A;  1HYV A;  3VQ9 A;  5GIN A;  1NK5 A;  1T7P A;  2YV0 X;  3FFK B;  1RTH A;  3AA2 A;  3L8B A;  3TR8 A;  4CEZ A;  1SQK A;  3NF8 A;  1HNZ K;  4CZL A;  1EO1 A;  3SUO A;  3ZSW A;  3QLH A;  1JLE A;  3BZK A;  2FXU A;  4PKI A;  1Y64 A;  3BY5 A;  2VWJ A;  2NZT A;  3NDK A;  1NJX A;  3JAM O;  3H1V X;  2D0B A;  4HTL A;  2F4V K;  4DLE A;  1WAF A;  1HJR A;  4XEI A;  3KKR A;  3B6P A;  3WQU A;  4W5O A;  5ADX A;  4WE1 A;  1WOQ A;  4CZH A;  4CEE A;  2PYJ A;  2JGU A;  1OKJ A;  1E3M A;  3LAL A;  3NH0 A;  4DTO A;  3IRX A;  3NGI A;  3QIN A;  4IO9 L;  2GEM A;  4ILG B;  2ZJR L;  1S6P A;  1QS4 A;  4IWV A;  3L6Q A;  5GAH P;  4C8N A;  2Z1I A;  1N8R O;  5HOO A;  2KKZ A;  5AQJ A;  2HBJ A;  4ELV A;  4DR6 K;  3R1X A;  3EZ5 A;  4FOE A;  1VQ5 N;  4BG8 A;  2UXC K;  3C6T A;  4FK0 A;  2Q1N A;  4FLT A;  1X1P A;  3ITH A;  5I3U A;  5LJV A;  3CCE N;  4OLB A;  4BRQ A;  3ZT2 A;  4BRC A;  4AHV A;  2EHG A;  4CBX A;  1BO5 O;  2QWR A;  5FRO A;  5BRH A;  4JRP A;  5SZT A;  1CXQ A;  3EN9 A;  2ZJP L;  3DJC A;  3TU5 A;  4NB4 A;  4QS9 A;  5FDL A;  2FLO A;  1ASU A;  3FZF A;  1JLB A;  2HHS A;  2G8H A;  4CF2 A;  2WOM A;  3NF6 A;  4FM1 A;  4CJP A;  4JKA A;  1NK8 A;  5E41 A;  1YF5 L;  2WUS A;  2XY5 A;  1WSE A;  1IO2 A;  5HP1 A;  4IKF A;  1P90 A;  1S22 A;  4BQZ A;  3K5L A;  3VF4 A;  2QA4 N;  1WSH A;  4C8L A;  4CHP A;  4H0Y B;  4DR1 K;  4GKJ K;  4EP5 A;  4FCY A;  4DTR A;  2HF4 A;  3TAB A;  4DQP A;  3L2U A;  3A8Y A;  3D2F B;  1NM1 A;  4H5R A;  3DI6 A;  3QES A;  1YJW N;  2E1Y A;  2VCP A;  3CCM N;  2ZGZ A;  4CZK A;  1CZA N;  3PUF A;  1NLV A;  1M1K O;  3CJ1 A;  3T3F A;  4RCH A;  1SV5 A;  3A5N C;  4TSX A;  3QER A;  1HKG A;  3CPW M;  1VQP N;  3VTH A;  4X65 K;  2OTL N;  4FSV A;  3CM6 A;  3C6A A;  4A62 A;  3CJ7 A;  3TAR A;  5LJW A;  2QI2 A;  3LP1 A;  1I39 A;  3FFI A;  1HUX A;  2V52 B;  4KFB A;  2Q0U A;  2RE2 A;  1BIZ A;  3A5O C;  3HL8 A;  1JL2 A;  3O8M A;  5LY3 A;  1NOZ A;  3O3F A;  3JSM A;  1SZ2 A;  1RBS A;  3KKS A;  4BR7 A;  2G8K A;  2HMI A;  3PV8 A;  3AVG A;  1TYQ B;  4MDB A;  2J4R A;  4CFD A;  1BI4 A;  1VSH A;  2KQ2 A;  2WON A;  2ZM6 K;  3ZSX A;  1YI2 N;  3TTF A;  4LF6 K;  3LP2 A;  4WCE L;  4OKE A;  1RNH A;  5KQD A;  3Q7C A;  5AFU H;  2PZS A;  3CJA A;  1BIS A;  4M7X A;  1MA9 B;  4F3O A;  2D1K A;  3KLE A;  3F2K A;  2YKN A;  5KPR A;  5EOY A;  1HMV A;  1KXP A;  4JK8 A;  4DQQ A;  1XNR K;  3H3O B;  2ZJQ L;  3AVC A;  4CIF A;  1BG3 A;  4XH4 A;  4HCC A;  1T3V A;  2UU9 K;  3CJB A;  3HOS A;  5FPM A;  1NGC A;  5HRS A;  3MX5 A;  5M1Q A;  2P9U A;  4FM2 A;  4DFM A;  4JKF A;  3SAG A;  4FWL A;  2ITG A;  2I7P A;  1WB9 A;  5BN9 A;  4E1M A;  3MEG A;  4U7B A;  1Q86 O;  1VQN N;  3AO3 A;  1BUP A;  5C10 A;  5C24 A;  4Z4G A;  4ZTF A;  3M1F A;  2CGL A;  4CF8 A;  1YT3 A;  4CJT A;  4YOX A;  3K5O A;  1N6Q A;  3AVF A;  2UXD K;  3NF7 A;  1QE1 A;  1NKB A;  4DSI A;  4QS7 A;  3OYB A;  3CG7 A;  2FBY A;  2HHT A;  4CJV A;  1BIU A;  1L3T A;  4O44 A;  3RRH A;  4KHS A;  4BC5 A;  2QKB A;  3DXM A;  3DOL A;  2OPR A;  4F4K A;  2X6N A;  3O9R A;  2OZS A;  3VQA A;  2VGM A;  3LAM A;  4FK2 A;  1XWL A;  3SV3 A;  2E2O A;  2IOC A;  1U49 A;  2GX9 A;  5JIC A;  1WBD A;  1HKB A;  4FOI A;  2HND A;  3Q7B A;  4DTM A;  5CHI A;  2VWB A;  3K2P A;  3G71 N;  3RMB A;  4BRI A;  3SQ1 A;  3PO5 A;  4B3T K;  4IG0 A;  2O8E B;  2FF6 A;  4J2B A;  4DU4 A;  4V19 S;  3VEY A;  3ZCM A;  2WFB A;  1J53 A;  3TAE A;  5AQT A;  4JHD A;  4ELT A;  4B9T A;  1U2V B;  3CXC M;  3C94 A;  3LWL A;  1NOY A;  4CZM A;  3LDQ A;  1TV6 A;  1C1B A;  4Z0U A;  3KK2 A;  1RT1 A;  4KH5 A;  2O8C A;  3QIO A;  4JI5 K;  1IKV A;  3MK6 A;  4JN4 A;  3O9S A;  2PBD A;  4N47 A;  3C7N A;  3TAG A;  4ZHR A;  5LMN K;  5AQP A;  2AA4 A;  1TKZ A;  2ITM A;  3A0I X;  2QWO A;  2PAV A;  2FBX A;  1DTQ A;  4E89 A;  1R59 O;  1QSS A;  3O9Q A;  3ULE A;  4IOX A;  1HNV A;  3ZT1 A;  4O8K A;  4CGD A;  3OYN A;  4FZZ A;  3PIP L;  3LWM A;  3ZYY X;  3R3L A;  2GUP A;  3EE9 A;  2NLX A;  5DM6 L;  4B3M K;  5AZI A;  4DS4 A;  3FZH A;  2UUB K;  1NG9 A;  3O80 A;  3DMJ A;  1DLO A;  1K8K B;  3VET A;  2P5G A;  5EU7 A;  3ZSQ A;  5CE3 A;  3L3V A;  1DT9 A;  2P9U B;  5J2N A;  4C1N K;  5AQU A;  2YNI A;  4DV1 K;  4XH5 A;  2HW3 A;  3H45 C;  1Y97 A;  4H03 B;  3K5N A;  3CD6 N;  2KLA A;  1C6V A;  5ELZ A;  4FWM A;  4BY9 C;  2D0C A;  3AAQ A;  3A5M C;  4DSE A;  3MWP A;  1GOC A;  2OTJ N;  1RTD A;  1GLA G;  1H1V A;  3U9Z A;  3IFR A;  2O8D A;  4E7K A;  5KPT A;  1WNS A;  1NGI A;  5EY4 A;  5F0X A;  1KRP A;  2W6K A;  4YDU C;  3I0S A;  4AM6 A;  4JI3 K;  4HUG A;  4CEA A;  2IVN A;  2QWM A;  4WFN L;  4AH9 A;  1J54 A;  1BA1 A;  4MDA A;  4LH5 A;  4BC4 A;  3CF5 L;  1EWR A;  4CZE A;  5BPN A;  3V81 A;  1XHZ A;  1WSJ A;  1NGG A;  3QFU A;  4NCA A;  1ESV A;  3O5B A;  3OYE A;  1RBV A;  1RIL A;  3O3H A;  1KVC A;  4PQU A;  1YIJ N;  5HRR A;  3V1R A;  4CZG A;  4QS8 A;  3LPU A;  1KAY A;  4O0I A;  3LP3 A;  1QSY A;  3KLG A;  2NUB A;  2IC3 A;  4Z94 A;  3VEV A;  3MXM A;  2G8I A;  3KZB A;  4CJE A;  2XRI A;  1NJI O;  1QQO A;  4CIG A;  4FW1 A;  3THX B;  3ULE B;  1QZ6 A;  1QTM A;  2YX6 A;  4OPH A;  4MO5 A;  3FLC O;  4KHN A;  1OVY A;  3PX6 A;  4RW9 A;  2XHB A;  2RKI A;  3HBT A;  3OYI A;  1YJ9 N;  3HT3 A;  4DV3 K;  4FWS A;  1VSK A;  3CC7 N;  4B9V A;  5AZI B;  2DPN A;  4CBU A;  3DOK A;  4IOC L;  4BDY A;  5C2F A;  1A5X A;  1WN7 A;  4KRE A;  2P9L A;  4NLB A;  1VQ4 N;  3VGK A;  3VF6 A;  3VEZ A;  4DB3 A;  3QB0 A;  2FSJ A;  3VEO A;  2ASM A;  2O8B A;  3QEI A;  3KLF A;  4A5B A;  2AP1 A;  3P39 A;  2JWL A;  4FLZ A;  3RR7 A;  5C2D A;  1Q9Y A;  1REV A;  1CXU A;  1OVQ A;  1Q8I A;  2O4I A;  3F5T A;  4G1Q A;  1RDU A;  1TK0 A;  4CZF A;  5BRD A;  2FBT A;  5GIO A;  2F9T A;  2I7N A;  1KVB A;  1LWE A;  2HHX A;  2YCH A;  2O8D B;  2AJQ A;  1QQN A;  1S1V A;  2BDP A;  1JXB A;  3OYJ A;  4FLX A;  1W97 L;  3TAP A;  3D2E B;  2VQF K;  4UY8 O;  3TAN A;  1S1T A;  4BRM A;  2W42 A;  2E2Q A;  2NRW A;  3ZT4 A;  2E1Z A;  2E8A A;  1W7A A;  3ZEU A;  4DTU A;  1J6Z A;  4OVL A;  3OYH A;  4K8X A;  3AA5 X;  4CVN E;  3DLH A;  4PY5 A;  4Z4C A;  4FLV A;  2OA8 A;  3O4W A;  2P9I B;  4C8K A;  3CC4 N;  1ZYQ A;  3AGR A;  4BG9 A;  4AHC A;  3ID6 A;  4MLE A;  2Z1G A;  1VSD A;  1S1W A;  4PWD A;  4M3R A;  1G99 A;  3VN5 A;  5AZJ A;  1SL0 A;  3PLA A;  1GLF O;  3T7Z A;  4JV5 K;  2CH5 A;  4CI6 A;  3CCL N;  2FF3 B;  4J2E A;  4FJM A;  4W5T A;  2HVH A;  1GOA A;  3O08 A;  4BRN A;  1KD1 O;  1EWQ A;  3NMU A;  4IJA A;  4DR4 K;  1FJG K;  2FSN A;  1WSI A;  3A5L C;  2QK9 A;  3DAW A;  3THY A;  4FWR A;  2P9S A;  5C12 A;  4ICL A;  1EKE A;  4L3Q A;  4EHU A;  3I8D A;  1ASW A;  4B8C A;  2KZZ A;  2F8S A;  4YNQ A;  3L2W A;  1XQS C;  2RHK A;  3P83 D;  3SAH A;  4PKH A;  1Q9X A;  4WFB L;  3R9P A;  1JXE A;  4KAZ A;  3TSU A;  4K43 A;  3ATV A;  4N41 A;  2A40 A;  3S3N A;  1D9F A;  3SUQ A;  1IV0 A;  4FWK A;  1TAU A;  4JKE A;  3QML A;  4OX9 K;  3A2F A;  4BRL A;  2W40 A;  5KGX A;  1YHQ N;  1A5W A;  1KVA A;  2E6M A;  3ZX2 A;  5BRE A;  4J2A A;  1EET A;  4H0X B;  2P9P B;  4WQ4 A;  2XY6 A;  3WXI A;  3B6O A;  1ZBI A;  4MO4 A;  4BWJ A;  1SL2 A;  2ZE2 A;  5BPM A;  2YNH A;  5B8H A;  4WQ5 C;  4FJG A;  3AVM A;  1D9D A;  1Z05 A;  4JI0 K;  3MX2 A;  3AVK A;  2NRX A;  1LW2 A;  4BWM A;  1KC8 O;  2I5J A;  3PIO L;  1O1W A;  3ZSR A;  4CD3 A;  1ZBS A;  1T6D A;  3AO2 A;  1K73 O;  4LD0 A;  4AF1 A;  3SYZ A;  4QAG A;  1HLU A;  1WSG A;  4DTP A;  4DG1 A;  3DLR A;  3EYZ A;  4FZX C;  1YVN A;  1JLA A;  2HHH K;  5HRP A;  5J2P A;  4PHT X;  3P1G A;  4HCB A;  5C15 A;  1L3U A;  3O9U A;  3UE5 A;  1OH7 A;  3K59 A;  3VES A;  5AZJ B;  1X9J A;  4CGJ A;  4N76 A;  1TVR A;  4NO7 A;  3J7Y P;  3CFO A;  4O55 A;  5M1O A;  4DQS A;  2QW9 A;  3HYF A;  4YOT A;  2OCE A;  5BR8 K;  1TK5 A;  3H08 A;  3BEX A;  2ASO A;  3ZX0 A;  4DV6 K;  3SUN A;  3CM5 A;  1VSM A;  4ELU A;  5D3G A;  3TWH A;  1HPZ A;  4C23 A;  3WXL A;  2R7Y A;  3RRG A;  1U47 A;  2GWK A;  1BQM A;  3GDQ A;  4CJU A;  4BRF A;  1HR0 K;  5JS1 A;  3H1Q A;  4XIU A;  4OPA A;  5M1K A;  1B9F A;  4BDZ A;  4CHO A;  2P9K A;  4DR3 K;  4BGA A;  4JK7 A;  1VSI A;  1NK0 A;  4ID1 A;  3LM2 A;  2Y1J A;  3O1B A;  2A3Z A;  2V7Y A;  3QDK A;  3QEP A;  3P4I A;  4N5S A;  3OS1 A;  3KLI A;  3O6W A;  3DXM B;  3SNN A;  3V1Q A;  1MDU B;  4NXN K;  1GLE G;  4FWP A;  1IKY A;  1VQL N;  1LAW A;  2HF3 A;  2A6A A;  1VQM N;  3MED A;  4IG3 A;  3SMS A;  4LF4 K;  2P9P A;  3VQC A;  2E2P A; 
#chains in the Genus database with same CATH homology
 2FF6 A;  4G9Z A;  3VEY A;  4BGB A;  2WFB A;  3D6R A;  5E84 A;  3I55 N;  4H5W A;  4KH4 A;  3EL2 A;  4JHD A;  3DWL A;  5AQT A;  4ILH A;  3IKM A;  1U2V B;  3CXC M;  3M3Z A;  3HTV A;  4IEE A;  1MWM A;  4M63 C;  3UKR A;  2Q31 A;  1RFQ A;  4CZM A;  3LDQ A;  4FWN A;  4RWT A;  4BRD A;  1D4X A;  5JVH L;  3CHW A;  3SLC A;  5GAG P;  5FPD A;  3KK7 A;  1VQ8 N;  3MWT A;  3ENO A;  5BPL A;  2BH1 A;  4C1N I;  3IUC A;  2CGK A;  4KH5 A;  1NMD A;  2A41 A;  5AQS A;  1Q81 O;  3TSQ A;  1TUY A;  5CR4 A;  4B9Q A;  5GAD P;  3MK6 A;  4JN4 A;  3UKU B;  3O9S A;  2PBD A;  3DXK A;  3C7N A;  4B1U B;  1NGH A;  4CZI A;  1E4F T;  3H6E A;  4H5V A;  3MCA B;  5AQP A;  3IDH A;  2AA4 A;  2YHY A;  3LM9 A;  3OA9 A;  2ITM A;  3A0I X;  5KPZ A;  1XC3 A;  1KQS M;  2QWO A;  2PAV A;  3O1W A;  2ASP A;  1R59 O;  5AQG A;  5JLH A;  3CET A;  3O9Q A;  3ULE A;  4IOX A;  1U2V A;  3OHR A;  1TUU A;  3U8X A;  3WQT A;  3VER A;  5AR0 A;  5AQH A;  3ENB A;  5BR9 A;  3J7Z O;  3CMA N;  4O8K A;  3SBT A;  3DLL L;  2JWK A;  3GBT A;  1WUA A;  5E26 A;  2Q36 A;  1HJO A;  2P9K B;  3PIP L;  3ZET B;  3R3L A;  3ZYY X;  2GUP A;  1NGB A;  2NLX A;  3EE9 A;  5DM6 L;  4YOV A;  3CER A;  5FPN A;  5AZI A;  1Q82 O;  3AAP A;  3FZH A;  4NLC A;  3O80 A;  3UKU A;  4A57 A;  4F9O A;  1K8K B;  3GG4 A;  3VET A;  4EAH D;  5CE3 A;  4KBO A;  4BR5 A;  1DT9 A;  2P9U B;  4ISF A;  1V4T A;  4C1N K;  4IDH A;  4O5F A;  5AQU A;  3KWG A;  3OW2 M;  1ATR A;  4XH5 A;  2NRV A;  1S3X A;  3VEW A;  3WXK A;  3H45 C;  1BWF O;  3EZW A;  3BF1 A;  2P9N B;  4H03 B;  3EKU A;  2V7Z A;  3E9O A;  4BC3 A;  4IOA L;  3CD6 N;  2KLA A;  3N4Q A;  4GY2 B;  1T44 A;  4JD2 A;  3I56 N;  4O8U A;  4H5T A;  4ILJ A;  1E4G T;  5ELZ A;  3M6G A;  4FWM A;  2D4W A;  4BY9 C;  1JCE A;  2QEX N;  3UKR B;  4JD2 B;  3AAQ A;  3CCV N;  2HBK A;  3A5M C;  1VAZ A;  3MWP A;  3HZ6 A;  1XUP O;  1QZ5 A;  5JMV A;  1BOT O;  4MLH A;  4OO1 J;  2OTJ N;  1GLA G;  3MCP A;  1H1V A;  2YJF A;  2KHO A;  2GEL A;  4R79 A;  2QTD A;  3CI5 A;  3U9Z A;  2HST A;  3IFR A;  4IXC A;  1NGD A;  5KPT A;  3B8A X;  2OAN A;  4IZ9 A;  1NGI A;  5EY4 A;  4BRP A;  4H5N A;  4DCH A;  4EFH A;  5GIP A;  3ZX3 A;  5F0X A;  1IJJ A;  1P8Z A;  4YDU C;  4AM6 A;  4XH1 A;  3K9J A;  3VEN A;  3QIC A;  5AQK A;  2UYT A;  1BDG A;  2IVN A;  2QWM A;  3JXU A;  3MN6 A;  4WFN L;  2IVO A;  5TKY A;  1BA1 A;  4MDA A;  5MLC Q;  4WF9 L;  4HWI A;  3H3N O;  5AQV A;  3E9P A;  4CD1 A;  1ZXO A;  3ENH A;  4AM7 A;  4BC4 A;  1Z6R A;  3CF5 L;  3U4L A;  2NRZ A;  3BUZ B;  4CZE A;  5BPN A;  1C0F A;  1NGG A;  1BU6 O;  5H1S Q;  3QFU A;  2EWS A;  3ZET A;  1RGI A;  2ZF5 O;  3E9L A;  1ESV A;  3O5B A;  2YI1 A;  1QHA A;  5AQO A;  4JEP A;  1DGK N;  5AQY A;  1ZC6 A;  3CCJ N;  3N4P A;  4ISG A;  3F9M A;  3QFP A;  4A5A A;  4DHY A;  1K8K A;  1HX1 A;  4I6M A;  1SAZ A;  4JKG A;  1IG8 A;  2E2N A;  4GV3 A;  1YIJ N;  1EQY A;  4B1X B;  4B1W B;  4CZG A;  5F1X A;  3VF2 A;  4QS8 A;  2WBN A;  3DXK B;  1VQ9 N;  1KAY A;  4H0T B;  4BRG A;  4BVP A;  4JKG B;  3FZM A;  4Z94 A;  3VEV A;  4IFE A;  3G6E N;  3EE8 A;  3KZB A;  3CJ9 A;  3AGK A;  4CZJ A;  2P9N A;  3TTD A;  1NJI O;  3HM8 A;  1QQO A;  4GV9 A;  3RVC A;  4CJ7 A;  3L0Q A;  1NGE A;  2HOE A;  3M5R A;  5AQW A;  5JVG L;  3ULE B;  1QZ6 A;  1GLJ O;  2YX6 A;  4OPH A;  4MO5 A;  3FLC O;  3CPE A;  1OVY A;  4WQ4 C;  5M1P A;  3TTC A;  3VEX A;  3UB5 A;  2P9I A;  3I33 A;  3HBT A;  4BR0 A;  5AQL A;  3WEE A;  1YJ9 N;  2Q0R A;  4FWS A;  4H0P A;  3CC7 N;  3QBX A;  5AZI B;  1GLL O;  2DPN A;  4CBU A;  4YOR A;  3G25 A;  4IOC L;  2V51 B;  3LDL A;  2F9W A;  1U6Z A;  2IVP A;  3LDP A;  5C2F A;  5GIN A;  4E1J A;  2P9L A;  3FFK B;  4NLB A;  1SQK A;  4CZL A;  3HSC A;  2NRR A;  1VQ4 N;  3VGK A;  1EO1 A;  3VF6 A;  3VEZ A;  2P9L B;  2Q2R A;  4DB3 A;  3CQX A;  3QB0 A;  2FSJ A;  3VEO A;  2FXU A;  4PKI A;  1Y64 A;  2ASM A;  2A5X A;  3E1Y A;  3FZK A;  5GAE P;  3TPQ A;  2NZT A;  4FVU A;  3SJH A;  4A5B A;  2AP1 A;  3H1V X;  3P39 A;  4HTL A;  3L4Q A;  4FL9 A;  1YIT N;  2JWL A;  5KQ8 A;  3R8E A;  5C2D A;  1ATN A;  3I8B A;  4J8F A;  1NBW A;  4K42 A;  3F5T A;  3CQY A;  5AQF A;  4JNE A;  4XEI A;  3WQU A;  1RDU A;  2QWQ A;  4YOU A;  2YJE A;  4CZF A;  5BRD A;  5ADX A;  4IJN A;  1S72 N;  4K41 A;  5GIO A;  1WOQ A;  4CZH A;  2F9T A;  2I7N A;  1OKJ A;  3NVK A;  4I6M B;  1QQM A;  3MDQ A;  3SK3 A;  3C0B A;  1JCG A;  2YCH A;  3H46 O;  5HL7 L;  5TKW A;  1QQN A;  4IO9 L;  1K9M O;  2D0O A;  2GEM A;  4ILG B;  3WXJ A;  1W97 L;  3ID8 A;  4M7Y A;  2ZJR L;  3D2E B;  4EHT A;  1NGA A;  3KVG A;  4UY8 O;  5AQQ A;  1KAZ A;  3T69 A;  4IWV A;  4GNI A;  3GE1 A;  3IMX A;  3L6Q A;  4BRM A;  4EIA A;  5GAH P;  2E2Q A;  2NRW A;  3C65 A;  5HOO A;  1N8R O;  1VQ7 N;  3D2E A;  2E1Z A;  1LOT B;  2E8A A;  2KKZ A;  1DEJ A;  5AQJ A;  2HBJ A;  1YXQ A;  3WXM B;  3ZEU A;  3GL1 A;  1J6Z A;  1O13 A;  1DKG D;  3MN9 A;  5DM7 L;  3CME N;  4BRA A;  3R1X A;  5AQN A;  4FWQ A;  4BRH A;  4FOE A;  3O4W A;  4JAX A;  4BG8 A;  1VQ5 N;  2P9I B;  3SBG A;  3ZEU B;  2Q1N A;  3CC4 N;  5LJV A;  3OBW A;  3AGR A;  4BG9 A;  3CCE N;  4BRQ A;  3BF3 A;  5EVZ A;  3ID6 A;  5EXW A;  1Q7Y O;  4MLE A;  3FR0 A;  3FZL A;  2YHX A;  3VGL A;  1G99 A;  4BRC A;  4CBX A;  5AZJ A;  1BO5 O;  2NRT A;  3PLA A;  2QWR A;  3K9K A;  1YAG A;  4PL8 A;  1GLF O;  3BP8 A;  5BRH A;  2ZGY A;  3T7Z A;  2CH5 A;  4CI6 A;  3CCL N;  2FF3 B;  3EO3 A;  3EN9 A;  3HOT A;  2PFU A;  2ZJP L;  3DJC A;  3TU5 A;  3G4S N;  4NB4 A;  3D2F A;  3J8A A;  3O08 A;  4QS9 A;  4WQ5 A;  4BRN A;  1KD1 O;  2FLO A;  3NMU A;  3FZF A;  4BC2 A;  4IJA A;  2FSN A;  3A5L C;  5ADX H;  3DAW A;  3TSP A;  2E88 A;  2BTF A;  2D0P A;  4FWR A;  4A61 A;  2P9S A;  4JKA A;  5AFU A;  5C12 A;  2ZWH A;  1YF5 L;  2HBL A;  2WUS A;  4L3Q A;  4EHU A;  3CCS N;  1YJN N;  1P90 A;  1S22 A;  4BQZ A;  3VF4 A;  2QA4 N;  3MN5 A;  3VPZ A;  4RTF D;  2QWL A;  4K25 A;  1XQS C;  1SS6 A;  4H0Y B;  3ATU A;  3WEE B;  1K8A O;  2RHK A;  3RSE A;  3SAH A;  4PKH A;  2HF4 A;  4YDU A;  4WFB L;  3R9P A;  3TSU A;  4K43 A;  1VQ6 N;  3RSE B;  3ATV A;  3A8Y A;  3D2F B;  1RDW X;  1NM1 A;  4H5R A;  2A40 A;  1T6C A;  3L4I A;  5AQZ A;  3LDO A;  2VGN A;  4FWK A;  4WFA L;  1YJW N;  4JKE A;  2E1Y A;  3QML A;  2VCP A;  3VOV A;  1W2B M;  3CCM N;  1BA0 A;  2ZGZ A;  4A2A A;  2CH6 A;  1CZA N;  2FSK A;  1TYQ A;  1X3M A;  2W40 A;  1NLV A;  4BRL A;  4CZK A;  3VMF B;  3CCU N;  4WYB A;  3CJ1 A;  1YHQ N;  1M1K O;  5M1N A;  4RCH A;  2NRH A;  2BUP A;  3A5N C;  1JCF A;  1GLD G;  4ISE A;  4IEI A;  3ZX2 A;  3SAF A;  1HKG A;  4IO8 A;  3CPW M;  1VQP N;  3VTH A;  5BRE A;  2OTL N;  4FSV A;  4H0X B;  3C6A A;  2P9P B;  4JKD A;  4WQ4 A;  4A62 A;  1NGJ A;  3CJ7 A;  3WXI A;  5F2R A;  3W3D A;  1ILY A;  5LJW A;  2WC9 A;  4MO4 A;  2E20 A;  2QI2 A;  5BPM A;  5B8H A;  1HUX A;  2V52 B;  4WQ5 C;  3AY9 A;  2Q0U A;  2QWN A;  1GLB G;  2RE2 A;  3CCQ N;  4BRK A;  5AQX A;  5AQI A;  3A5O C;  4KH6 A;  3O8M A;  4GVE A;  3VTI A;  5LY3 A;  1HKC A;  1Z05 A;  4BVO A;  4FO0 A;  5BRF A;  3MX2 A;  1SZ2 A;  2NRX A;  4BR4 A;  4BRE A;  3D7E O;  4BR7 A;  4U67 L;  3HRG A;  4JKC A;  5AQR A;  1TYQ B;  1KC8 O;  3FGU A;  4B1V A;  4A2B A;  3PIO L;  2GWJ A;  4MDB A;  2J4R A;  2H3G X;  2P9S B;  4CD3 A;  4A59 A;  3NVM A;  1ZBS A;  1T6D A;  4JKB A;  1YI2 N;  1NWK A;  3TTF A;  1K73 O;  4AF1 A;  5C0Y A;  2QM1 A;  4WCE L;  1HLU A;  3HI0 A;  5KQD A;  3Q7C A;  5AFU H;  3O9T A;  3CJA A;  4M7X A;  1MA9 B;  3SMP A;  3CC2 N;  2D1K A;  1YVN A;  3F2K A;  2NNW A;  1GLC G;  5KPR A;  4Y0W A;  3CCR N;  1VQO N;  3JS6 A;  5EOY A;  4PHT X;  1KXP A;  3MMV A;  4JK8 A;  5C15 A;  2HMP A;  3O9U A;  3UE5 A;  3H3O B;  3S41 A;  2ZJQ L;  3WUH A;  3P38 A;  1ATS A;  3FE1 A;  3MN7 A;  3VES A;  5JLF A;  1LCU A;  5AZJ B;  1BG3 A;  1V4S A;  4XH4 A;  1T3V A;  1X9J A;  3R6M A;  4BR9 A;  2YHW A;  3EKS A;  5FPE A;  4YOY A;  1KAX A;  4B1Y B;  2Q97 A;  2HBM A;  2A42 A;  3KHY A;  4NO7 A;  3CJB A;  5M1O A;  4GV6 A;  2QW9 A;  1NGF A;  4YOT A;  3HOS A;  5FPM A;  1NGC A;  4JKH A;  3BEX A;  4H0O A;  2ASO A;  3LL3 A;  3MX5 A;  5M1Q A;  3ZX0 A;  2P9U A;  4JKF A;  3QBW A;  3WT0 A;  3C7N B;  3U9D A;  2IIR A;  4FPB A;  3SAG A;  4PKG A;  2CGJ A;  4FWL A;  2W41 A;  1Q18 A;  4LC9 B;  2I7P A;  5I9E B;  4C23 A;  3E66 A;  3WXL A;  4BRO A;  2GWK A;  5BN9 A;  3C6H A;  2VYP A;  2F7T A;  1HPM A;  4FWO A;  4U7B A;  3GDQ A;  1X3N A;  3CIP A;  1QVG M;  4PL7 A;  4BQL A;  1Q86 O;  1VQN N;  2QWP A;  4BRF A;  1BUP A;  3P31 A;  3OBY A;  5C10 A;  3VGM A;  3M1F A;  2CGL A;  4YOX A;  4FPA A;  3H1Q A;  4OPA A;  5M1K A;  4QS7 A;  4BR2 A;  3KWI A;  4JHD B;  2P9K A;  4BGA A;  4JK7 A;  1MWK A;  4B1Z A;  4BC5 A;  4CBW A;  1QVF M;  3GOI A;  1VQK N;  3LM2 A;  3O1B A;  3DXM A;  5AQM A;  5EX5 A;  2A3Z A;  2V7Y A;  3QDK A;  4JK9 A;  3O9R A;  3P4I A;  2GTD A;  3W0L A;  2VGM A;  1JJ2 M;  4DQ8 A;  3AAR A;  5BN8 A;  3O6W A;  3DXM B;  4H0V B;  3LDN A;  2E2O A;  2GX9 A;  3CJC A;  5JIC A;  5M1F A;  1HKB A;  4FOI A;  1MDU B;  3Q7B A;  1GLE G;  4FWP A;  2VWB A;  5CHI A;  3G71 N;  1M90 O;  1VQL N;  4BRI A;  2HF3 A;  2A6A A;  1VQM N;  1YUW A;  1C0G A;  2QXL A;  3SMS A;  4DKW A;  4YOW A;  2P9P A;  2E2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...