5BRZA

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5brzA01
4GO6B 2ESVD 4ZAKC 3OKNA 2D7TH 3SKJL 3KXFE 4KK8C 3PIQA 3HFML 1UJ3C 4QHMA 3DHJA 1YEIL 1P4IH 1KNOA 2YOCA 1CFTB 3MLWL 4CMMB 3D2UD 3O8XC 3PHSA 4EDWL 4D2NA 5I8CB 2DI8A 1MFEL 3NGBB 3C08H 3JWDC 4PB9H 1ODAA 1R24A 2ZG3A 3MOBH 5DK2B 3QEUA 3SPVA 3TO4B 3SCMA 4ERSL 5D1ZB 4K7FB 3T3PF 2IFFL 3OJDA 1PX3A 5FGSA 3D5OF 3JUYA 3MLTB 3U0TB 2H32B 1D6VL 2YA1A 2ORBH 3FB5B 3GK8L 3C6SA 4MCZB 3FN0L 1TZIA 4OV5A 3DMMB 4NZUH 3ZYOA 3D0LA 5ISZA 4NCDA 3QYCA 4M02A 3FN9A 4ZO9A 5F9DC 5DFTA 2FGZA 2FX9L 2CRYA 4X9GA 3B83A 3U9UB 4HUVB 5DJ2B 3FO0H 3C6LD 1S7SB 3OKLA 1AKJB 4RGND 3MFFB 1JPTL 1PG7X 4M7LT 4NN7C 2XWJA 4JFEE 2B1HL 4NC1C 2DIJA 4CU7A 1TCRB 4K3GA 3TBWA 1PJ9A 2DKUA 1CXHA 3K0WA 3JXAA 4PLOB 1E6OL 3VD7A 5I1EH 2BNUA 2M1KA 1UACL 1MI5D 2OK0L 5EZIL 3OR6B 4R97B 3S3JA 1IEBB 2X4PA 4BQ8A 3LS4H 5JNYB 3EJJX 1B9ZA 4ZAKD 1YEGH 4LGSB 2X4RA 5DQDL 1OAZH 1DBAH 2IAMB 5SWSA 4KK8D 3SDCB 1BVKA 5SWSE 1FNSH 1HI6B 5E6IA 1XR9A 5K9QG 2YRLA 5DHYB 3MJ7A 4ZPVA 4EN3A 3O8XD 4G8GA 3UMTA 4X9BA 1VFAA 3VW3H 1AO7B 1N0XH 5A16B 2FSEA 4WEUD 3BGAA 1KELL 2ADJB 4CMMA 3WLWC 5H94B 1FZOB 1KB5B 3RU8H 2AEPL 2NX5A 5LCVL 5DK2A 5GISH 1KEML 3MV8D 3TO4A 4KJWC 1QKZH 2NX5E 5D1ZA 4K7FA 5TQ0L 2WK2A 3FHQA 3LQZB 1FNHA 1NCCL 3MLTA 2DQUL 3U0TA 4YDLB 4YGVB 4TVPD 2F58L 3TM6A 3V0WH 3FB5A 4HT1H 4FN0A 1QG3A 1A7NL 4MCZA 2GSIB 4RFNB 3IB4A 1Y0LB 3DMMA 2EXYC 1DQMH 3DVIA 3WFBL 3X12B 5TQ2L 3R8BB 4MD5B 3AMLA 1LGVA 3THML 5JOFB 4G9DB 3BUTA 2APWA 1A02N 3SN6N 2HFEB 3CU7A 5DJ2A 2Q8BL 2FLBT 4NO5A 1QBLH 5B38B 1S7SA 3LRHA 3PWVB 2JJSC 5FOBB 4HWBA 3MFFA 5CIPB 4CL7A 5LKNA 1OAXH 1AC6A 4LSRL 4PGBB 1TCRA 3NABH 4UNUA 4WWKC 1IBGH 4LCCC 1H3XA 2VZUA 3AS1A 4HWBL 1MH5B 4UNTA 1UWGL 1WBZB 3OR6A 1IEBA 5AG8A 5C0JA 4GKZA 5IJVB 5FGBC 5C2BL 2IAMA 4Q9CA 3LDBC 1JGUH 1X7QB 2Y7QB 3SDCA 3TNMA 2P8MA 3D0VB 1HI6A 2YA0A 5D70L 1RMFH 1A6ZB 5DHYA 1TMCA 1Q9OB 1T3FB 1Y6NR 3DVGA 3WLWD 4GMSL 1MJUH 2YKLH 2XRAL 3ESVF 1D5MB 1AO7A 1NGXA 5A16A 4OT1L 4LIQL 4Q9QH 1GH7A 4KJWD 3UTPE 4LSQH 4NHCH 3VGDA 3ARSA 2I07B 4WV1C 1RZIB 1UEMA 3L5XL 2ADJA 1CXEA 5H94A 1FZOA 2F19L 4OBSA 5ERWB 3DX7B 1PAMA 1WZMA 4ZD3L 3S35L 4P23C 1RK0B 4YK4C 2PYEE 1U93A 2EXYD 5T3ZE 3MUHL 3R0MA 1U3ZA 5L2JB 3HI1B 5FKAB 2FYYB 3LQZA 1L6XA 4FZEL 3MC0A 2VXUL 5A2KH 5T3ZL 1EEZB 1EHXA 2GSIA 1Y0LA 1MRDL 3WE6A 3X12A 4MD5A 5AUMB 1RY7B 4NRXB 2AV7B 4RBPH 4WWKD 4QTIH 1X6LA 1F4YL 1CGUA 4YE4H 5F8RC 4LFHD 3MNVB 3OJ2C 4GSDH 3VD4A 4NOBA 3VFMB 4S0TD 3ZKQD 5FOBA 5CIPA 1TZGH 4MA7H 4MS8C 5LWYH 2D0GA 3P0VH 2ZG1A 1MFAH 4DN3L 1IKFH 1R3KB 3HAEH 1MH5A 1CGSL 1Z6JT 1KBGL 2R4SH 1WBZA 1T20B 3NMEA 4X9HA 3A67L 3KS0J 1FIGL 5KG9B 4AQ1B 5LVEA 1DN0B 1QBAA 1V05A 5IJVA 4XP9L 2BZDA 3DUSB 3KGRA 1R0AH 5IHZB 2Y7QA 5ICZA 2ZUWA 1UB6B 1IT9L 1CXIA 3IFLL 4IMKA 3RY4A 4PPTA 1Q9OA 1T3FA 3C5SB 1JWUA 2R1XB 4QWWC 5AAWA 4H0IA 4LEOB 1F11B 4P23D 4JFXB 3H7BB 3QR2A 1L9NA 3VI4F 5KAQG 2I07A 5JW5B 1RZIA 3W0WD 5ENWB 4LSVL 4IRSB 5ERWA 3S96A 3DX7A 1VEOA 3BEWB 4CADB 4HG4J 1YQVH 3RPKA 4ZSOE 3HC4H 1Z9OA 5L2JA 3QHZH 3K8KA 4NSKB 5FKAA 4GXVH 4PJHE 3O6LH 4NBZB 4P59L 1SY6H 4RFOH 3ZTNH 3VRJA 2HKFH 1EEZA 4JFDD 3V5KA 3SGJC 2IQ9L 1P6AB 1A9BB 1FSKB 3QPXH 5I75C 3TN0C 5AUMA 2YEZA 1Y18B 4MS8D 2OR7A 2AV7A 4NRXA 3QB7C 4YDIH 4OZHF 3CK0L 3SOBH 4NO2B 3LHPL 3MACH 1EA9C 3MNVA 4NM8H 2CKBH 3EBAA 3KYKL 1IILE 3VFMA 3AMKA 5L7XH 3VXRD 3L6FB 1MI5E 1XIWB 1S9VA 3IRZA 4PV9B 1TZHB 1S5HA 3WXWL 1TETH 3A0OA 4QXGL 4X7CC 5I1HL 1RUKL 5JORB 4PJCF 1ZHLB 5DFVC 1R3KA 2R2CA 1M6OB 5ADOL 3CXHK 1EEUA 3IJYB 2F8XC 1U2HA 2P4AB 3KDMB 1ZVYA 1T20A 4O9HL 3MR9B 2NLJB 1KN2H 2IBGA 4QWWD 1DN0A 1N7MH 1U2CA 4NP4H 2JIXD 5E8PA 2CSPA 1A7BA 1UB6A 5F7EL 5GRZA 3KR3H 2P5EA 1GXEA 3OV6A 2E6QA 3C5SA 2P5EE 2R1XA 1WZKA 1HZHH 2EKJA 4LP4A 1RUMH 5DR5H 5IK3B 5I8KH 1HYSC 1HHHB 1JVKA 2E7BA 2A38A 2OI9B 2BFVH 3H7BA 2VQ1B 4LARH 4OD1H 4NN5C 5F7DB 5HHQA 4AEIL 1CFVL 5JW5A 5C0EB 5ENWA 5CZVH 1Q8MA 3WIFB 4LK4A 3ZKXB 3BEWA 4G9FD 3C09C 4CADA 5I1KL 5I8OL 5CD3A 3FMGL 4P5TB 3H3BC 4NNYB 5DT1L 3TN0D 4K55A 4MZ3A 4PD4K 4HCRA 4I3RL 3C60A 3OKOB 4HULB 5DMKB 1OAKH 2BVYA 2Y07L 3GI8H 2WQRA 1EBPA 3MV7D 4NC1E 2DQTH 5C07D 4PB0H 3WJJA 1UZ6E 5T1DL 2EDWA 1A9BA 4HCRL 4Q9RL 3O41A 5C6PB 3GMQA 1RAMA 1IAIL 3L3GB 2XICA 4P2RB 1OCWH 4NO2A 3LKOB 3OB0K 1J5OH 2DM7A 2RCSL 5DFVD 1A1NB 3ARDC 4K3JL 5JIHA 3P4MB 5IGXL 3KPSB 3L6FA 4KU1A 4PV9A 1XIWA 1SMOA 3S5LB 1TZHA 1WFOA 1BFVL 2CDGB 2D7NA 2FEEI 3RWGB 3S34L 1S7XB 3VFPA 1QSED 5JORA 1ZHLA 5D1QC 3P40A 1RUAH 4KTDH 3V5DB 1M6OA 4JFFB 5EA0L 3IJYA 4V1DB 4U3HA 3KDMA 3ROOB 2L7JA 3MR9A 4JEGB 2NLJA 4DK6A 4XP1L 3O3BA 2D4DA 1HYSD 2DDQH 4O2CB 3CIQA 2D7TL 5J13C 3NPSB 5E94A 3QQ4B 1P4IL 4EXKA 4HUNB 1CDBA 3ES6B 4MAUH 4RDQF 4PJXE 4P3CH 5IK3A 2Q76B 4KTEH 1JJUA 3C08L 2OTPA 3MRDA 3ILQC 1NUFA 3PG2A 4J3UA 4PB9L 5EUOF 1OWRM 3ARBC 2OI9A 3MOBL 2HTLC 4XXDB 5F9OL 4NQXB 3WBDA 3MRLA 4M1DH 5F7DA 1JYVA 5C0EA 2VO5A 4HW6A 3WIFA 3K2UH 3TPKA 2BNRD 2ORBL 2DN7A 1XF3B 4P5TA 4AY0A 5E08H 1NAKL 4FXLA 4NNYA 2RBLA 5F8QC 4NZUL 3KJ4C 1WICA 1OWWA 5DMKA 3L3KA 12E8H 4J1UB 4NFBA 3L5HA 5EBLB 2BVPB 3ARDD 3OHXB 3S37H 2XN9D 5K33A 2ZUVA 4O4YH 3VFOA 3WJLC 1NUDA 4LFHG 1TJHH 2HTKC 3QXDB 1FORH 3KLAA 3LKOA 3PDGA 4QEGA 1ORSA 4LLWB 4YBLC 2Z8WC 5DTFB 5CEXB 5D1QD 1A1NA 5IBUG 5IHBA 3QWRD 3SDDB 2VZ1A 5KS9B 3TCXA 1DQQA 5D7IF 1NQBA 4WRLA 1OARH 3S5LA 2R2HB 4O2FB 3LS4L 3EDEA 3VXTA 4W4NA 1CICB 1DBAL 1OAZL 1I9IH 4JFFA 3TGXA 3T3MF 2NXYB 1U8NB 3I75B 3ROOA 2DMKA 2R29H 4P3DB 1WIOA 4U7KA 2ED8A 3DROA 5EFIB 4ELMB 4R7DB 3ILQD 3QUZC 4PY8J 5TDNB 3VW3L 3ARBD 1N0XL 3VH8B 1HSBB 3QQ4A 4YFDB 4GUPB 4N8VB 3CDFA 3PWPD 3ES6A 4CVUA 3KYOB 2J5LC 2UVEA 3RU8L 1TPXC 2D03L 1RUPH 2LU4A 5IEHB 5GISL 3C8DA 4XXDA 1P7QB 4EQ2A 4NQXA 4PJIE 3VFRB 3EKCA 3KYNB 1PG7L 4BZ1H 4F15C 3Q5TA 3O6KH 5CZXC 3AS3A 3V0WL 4MXVE 4HT1L 2BVUA 1VA9A 1XF3A 1FFOB 4JFDE 2EDBA 3FQWA 4IOFC 1DQML 2ICEA 2ATKB 4QRTB 2HTKD 1GGUA 1QFPA 4J1UA 1EHLL 4R4FL 4Z7QF 1BX2B 2BVPA 5DHXB 4Z95L 3U79A 3UX9B 1GOHA 1G7IA 2CRZA 3AM8C 2QV2A 4IOIB 4RMWA 3OHXA 1LQSR 1QBLL 1F8TH 3HUJB 4MMXC 1MCOL 4FRWA 5FXCH 1H8SA 1D5BB 5BOPA 3QXDA 4MDJB 4GKOA 4GLRI 3NABL 4A2MA 1MCCA 5DTFA 5CEXA 1IBGL 3VXPB 1U8HA 3SDDA 5KS9A 2Z8RA 4YHOH 3MRGB 2CUMA 4NOFA 2DD8H 2HG5A 1XF2A 4UT7L 4K8RC 1RHHB 2R2HA 3LN5A 4O2FA 3UO1L 2DB8A 4HWNA 3QUZD 4WI7A 4W6XB 2BSRB 1JGUL 2H3NB 2XT1B 1LNUB 4MWFB 1U8NA 4Z7OE 3I75A 1VFBB 4U4BA 3BT2H 3LD8C 4P3DA 4HPOL 4PTUB 4X6CF 2A74A 1Q94A 4K3HA 2YKLL 3HPJA 4UU9B 2F53A 2WWMC 3K4DA 4Q9QL 3GBMH 1HSBA 4LSQL 2F53E 2MQ3A 2IPTH 3KYOA 3DX6B 1XGYH 5CZXD 4JQVC 1CL7H 4GRWF 3TBTB 4RMUA 5DD6B 3RUGE 5IEHA 5BS0B 5SWZB 3TZVA 1P7QA 1CIUA 3VFRA 3VXOA 4IOFD 2NR6C 4X6DB 1GYAA 3KYNA 5T1KB 4EI5C 1QSFB 4MAYB 2C3VB 3IF1B 3MV7E 5ETUB 2F54D 4HBCL 5DI8B 4O2EB 4OCRL 4TSCH 2CGRH 3DWTA 3MMEB 4HQQH 5HGDB 2CKBB 1FPTH 3LN9A 1KGCE 4Z7UF 2ATKA 4QRTA 1G7HB 4OF5A 1BQHB 2FZ3B 4X6BB 2W59A 5CD5C 4K07A 4I77H 4QTIL 1BX2A 5C0CB 3ZE0F 1NCWH 1B0WA 4IOIA 4XCNB 4GSDL 3VDAA 3HUJA 3HAEA 3HTLX 1VACB 1D5BA 1TZGL 4K8RD 4MA7L 4MDJA 5LWYL 4LAQL 1LP9E 3WKNA 3P0VL 3OAYH 3H42H 1QEWB 1NGWA 3L9RA 4ONHB 4X99B 1MFAL 5E7FA 1IKFL 4AT6B 3MRGA 2R4SL 3TA3C 3HRZB 4DN4H 5T1MA 4ALAL 1OT2A 2BSRA 1UYWH 2P5WA 4YFEA 1MAJA 1R0AL 2A73B 2WWMD 1LNUA 1VFBA 2P5WE 4QRRB 5B8CC 4NT6A 2JF1A 5I73C 4PTUA 2EDKA 3O9WC 3VFGH 1MY5A 3ZL4H 1ZTXL 2PUQT 5GS2H 4MJID 5DSCB 5E5UB 3D85B 4UU9A 4NDMB 3Q3GB 3GUTB 3VGEA 2NR6D 3O4LB 4EI5D 4H20L 4M7LH 4R9HA 3DX6A 4L9DA 1SY6A 2BNRE 5DRZB 3TBTA 2W9DH 4KDWA 5DD6A 3MODH 5SWZA 5BS0A 4E5XA 1YQVL 2J3SA 3HC4L 4X6DA 3IETB 4LSUL 5JW4N 1QSFA 3O6LL 1C1EH 5CD5D 1SY6L 1BOYA 4L4VB 3IRPX 4RFOL 1FAIH 2C3VA 3ZTNL 1T5WA 2X40A 5L6YH 3LVEA 3A6BH 5ETUA 5HYIA 5DI8A 4O2EA 2XTJE 4XRCA 5HGDA 2CKBA 3QPXL 2MCPL 4JVWA 1G7HA 4BH7B 4XCFH 5GGSY 1CS6A 4YDIL 3HA0A 3SOBL 5E2WH 3MACL 5DWUH 3N9GH 2CKBL 1FNGA 5KVFH 2JE8A 4BSJA 4PRHA 1A9EA 4QOKD 3TA3D 5I66B 5L7XL 1VACA 3TO2B 4K7PH 4PRHE 3ULUC 1WK0A 1NC2D 2EIZB 5J0BA 1TETL 4ONHA 3QUXB 4X99A 5CWSB 4AT6A 4XNZC 2WWKO 5I1GH 5JZ7C 3ZDYE 5EU7E 2ZCKL 3HRZA 3O9WD 1KN2L 3UYRH 1XF5B 1N7ML 2Z31B 3NOIA 1KN4H 5D7JA 4NP4L 1UKTA 2WINB 5FYKD 2B0SH 4FFYH 5EU4B 4QRRA 1TVHA 4YHYC 4N0CC 4P57B 3KR3L 2LAGB 5MI0B 5IR1A 3SGKC 1PYWA 3PHQB 1LO5B 4CN4A 4AQOA 5I8KL 5DSCA 2VXQH 3D85A 3VRIA 1OTUC 3CFJB 4YHKH 3V4UH 4S1QL 2BFVL 4LARL 3GUTA 1K8IA 3CDGB 4LSPH 5ITBL 3D9AH 3O4LA 4X0KB 4WEBH 4DFHA 5CZVL 3GIZH 4F58L 3UCRA 1HNFA 1QBBA 5GS0C 5INCB 3BPLB 5DZLA 2HWZL 3RVVC 3BIKB 1JN6A 5DRZA 3T2QA 3O6FB 1FV1B 5TE7H 2ED7A 2CUHA 2WWKT 2ARJB 3W5MA 1OAKL 2GIYA 3SE8L 3JV5A 4L4VA 3UBXG 2NTSP 2DQTL 5C1MB 4PB0L 3VGHA 2E27H 1GSMA 1ZLVH 4TTGA 3FQXB 1B0RB 4DVBB 1NDMB 3H9YA 3DX8B 3QDHA 3ULUD 5DUML 1OCWL 3GGWA 3V4PH 1J5OL 2XOTA 3RGVC 4PJGF 1EH9A 1U3HA 1RZKH 2VSCA 2G2RA 5I66A 3TNNB 2EIZA 1F6LL 1TJIH 4P4KB 5KZCD 3KHQA 4Q0XL 3QUXA 1WV7T 3UTTD 1RUAL 4KTDL 4MJ6B 4XVUC 1Q9WA 4FQXC 1DSFH 4N0CD 3BRDA 4L8CA 2DQGH 5D96B 2KPNA 2A77H 1XF5A 4NRYB 1HHGB 4YHLH 5KVMC 2Z31A 4KZDH 2DDQL 1OTUD 2WINA 3IFNH 1UXSB 1I9JH 5EU4A 2ATPB 3HZMA 3CNKA 4LRIC 3QDJD 4MAUL 4JRXB 3G9AB 2B39A 2YBRB 4J8RA 4NM4H 3RVVD 5GS0D 3M8OH 4YXKH 1GHFH 4IM8A 3CFJA 5E2VH 3EOAB 3LN4A 2P47B 1R3LB 1KPVB 3CDGA 4KV5F 1Z9SA 4M1DL 4X0KA 1WFTA 3QIWC 3K2UL 5INCA 4ENEC 3BIKA 4Y16C 1KIRB 3O6FA 1BGXH 1FV1A 4NC0B 4QXWA 5E08L 1IRAY 1ACZA 4L8BB 4JO4L 3JWDH 12E8L 1HSAB 3FOLB 3U36A 3RGVD 5IROC 3C5ZB 2VDLH 4OIBA 5DD0H 2AS5M 1BJMA 1B0RA 1ZLWH 4O4YL 3QHTC 3DX8A 2VUYA 2FATH 5T3XH 2D7MA 4Z77B 1TJHL 1FORL 1JGDB 4WHCA 3WUWG 4LKCA 1FCGA 4W81A 5MEQB 1A7OH 4G8IA 1OD9A 3NIDF 4XCCH 1WLHA 4XVUD 3BD3A 4FQXD 5SX4H 5EC2B 4F9PA 4PJ7B 1G1CA 4TVPH 4WI2A 1G6VK 4JHZA 2V2TA 1U8JB 4P0DA 1WSST 2VZVA 4GRLB 4MJ6A 5F1NB 1I9IL 1BF8A 1Z0NA 4RAHA 4GKNB 2DQFB 5ESAB 2BSTB 2OR8A 2CRMA 2R29L 4HFUL 3ZLQC 5IHUL 3U7AA 1E4KC 4X4MA 1HHGA 4G7VH 3QXTA 1VHPA 4NQEB 1CGYA 1UXSA 1MJ8H 4BFGA 3JTSB 3DOSA 4CU8A 5AYQA 4JRXA 2YBRA 3QIWD 4ZUTA 5FHBL 4ENED 1U42A 3GMPA 3LIZH 4FXKB 1D9KB 4Y16D 5BVPH 1ZT4B 3EOAA 1RUPL 1IEAB 1R3LA 1KPVA 5JIPA 3UTSB 3SY0B 1I1RA 3P73B 3WO4C 2AJXH 1AJ7L 2LVEA 4BZ1L 4Y5YB 4LSTL 3O6KL 5IQ9B 4KXZH 1MRFH 4CVWA 1NSNH 4M3JA 4TUKH 2WBJC 4JVUA 4ODWB 5D8JH 4L8BA 4PRBB 3FO9B 3RWCB 1YMMB 1WUNT 1NMBL 3WKMH 3ALXA 3FOLA 2CDFA 4UBDC 1WWBX 4LDLB 4JDZB 2I9LB 1G9MH 1OTTC 4N90E 5D7LA 3V0AC 5L9DH 5CZKA 1F8TL 4D9LH 2OM5A 3MRKB 2QQQA 5D7LE 4Z77A 3BFOA 4QOKE 1JGDA 5MEQA 2D4FA 2WNGA 3EYOA 4HXBL 1VFUA 3PNWB 3GRWH 3LEYH 4NUJB 5EC2A 4YHOL 4RMTA 3DBXB 4PJ7A 4FQHB 2GTWB 4NRZB 3BPNC 1JTPA 1U8JA 4WHTA 4R8WH 3KYMB 4L4TB 1BZ7B 1HQ4B 4GKNA 2DQFA 5ESAA 2W0FB 2CH8A 4DGVH 3BT2L 3CZJA 5F70A 2C3GA 2J88H 5DJYB 2M8XA 4M7JH 1AHWC 2EDTA 2ZCHH 1RJZA 2Y5EA 1BMGA 3JTSA 4PRDA 3ROLB 4YNYA 1DEEB 1BQLH 2X41A 3CLFL 4I0CC 1NH6A 1B4RA 2DYPD 1GVIA 2J8UA 1S7VB 1W0WA 2FBJH 1ZSDB 1PLGL 5GGSA 3O2WH 2J8UE 2EICA 1CL7L 5JXAH 1KFAH 8FABA 1T66C 3W5NA 3SO3C 3F65A 2WBJD 1U6AH 3SY0A 3W9DB 3WN5C 1TLKA 2H26B 4OD3L 4TNVF 2XPGB 4HF5H 3G04B 3OG6B 3WXVH 5D5MF 4UBDD 1O0VA 3NZ8B 3OAUH 5IQ9A 2BHZA 4JM2F 4E41B 1OTTD 5HHVH 4TSCL 2CGRL 3UTOA 4Y0GA 3AUVA 1FPTL 4JY6B 4ODWA 4MQSB 4OZGF 4PRBA 3EIFA 3FO9A 5CJBA 1WITA 2X44D 3C8HA 3WFCH 2GCYB 4JO3H 1NCWL 1G7MB 2OL3L 4JDZA 2I9LA 3HG1A 4JQXC 3BOVA 5DURD 3GHBL 3MRKA 3HG1E 4D0CB 2Z93B 3R06B 5C0RL 1XGTA 4YO0B 1EHAA 2ZNXA 5CSZB 1F02I 4PY7A 3H42L 3IGAB 1X5LA 3QDMB 4OKDA 4D9RD 3PNWA 1DLHB 4NUJA 2Y1VA 3DBXA 3FT4B 1OP5H 4FQHA 2X9WA 1K2DB 2GTWA 5D9SB 4NRZA 3S4SA 2ZSVB 4DN4L 1XCTB 1T03H 1CWVA 4Y4KB 4ACPA 4L4TA 1BZ7A 1CGXA 2FJGB 2DM2A 2VWEC 4NQUA 1HQ4A 1YJDC 4OFPA 2W0FA 3SE4C 3VMOA 3QDJE 3I02B 5CSGA 2E5EA 1FNLA 1T66D 2V5RA 1DEEA 3TT3H 5HYQB 4UQ3A 2N7BA 1B4JH 1UB5B 2UY7A 1S7VA 1OD7A 2XIDA 5A2JH 4M7LL 1ZSDA 3FQTB 4MNGE 5I30H 4N0FB 1A7PH 4XX1E 2ESVB 2O5XL 5DS8B 2W9DL 4R0LB 3SKUD 1DDHB 3TF7A 4M5YH 3MLUH 2AV1B 3P9WB 3GJFB 4UNVA 3A6OA 2H26A 2XPGA 1WAAF 4IRJC 5I16B 2EC8A 1C1EL 4OIIH 4NBXB 3WSQH 3D2UB 5GGQH 4KJQC 1FAIL 4RSVA 5CHNB 5L6YL 3A6BL 3BPOB 1LEKB 4E41A 4DWHA 5IUSA 2Y23A 1U92B 5I74C 1NC4D 5C8JB 4JY6A 3CU1A 4YUEL 5IFJB 2EC9T 1T7YA 4XCFL 2IH1B 25C8H 5E2WL 1LK3H 1G7MA 5DWUL 2QBWA 3BN9C 5KVFL 3F7RA 4GBXA 5GRXG 1PQZA 1IGJB 1T7ZA 3R06A 4K7PL 4YO0A 1UH4A 3IGAA 5J9PB 1WCBB 4ETYA 3C6LB 3VG9B 4OTXH 1HKLH 5I1GL 4RGNB 1IKNA 1K2DA 1RULH 3PHOB 5CJXC 5D9SA 4HMEA 5IFHH 3UYRL 1XCTA 5J11C 4Y4KA 2G9HB 4NHUB 4RMRA 4HLJA 1KN4L 4HJGB 2FJGA 2VITB 4QTHB 2EH8L 2B0SL 1EIBA 1T1ZB 4FNLL 4OLEA 1V7NH 2ZOKA 2Q86B 1IZJA 3I02A 4ZAKB 3IXAB 2NY7H 5HHOD 2VXQL 2CO6B 4YHKL 1E4WH 1UJ3B 5HYQA 3PQYE 1DL7H 2VYRE 4LSPL 1UB5A 3D9AL 1OW0A 4IRJD 4F7TB 3TH2T 5IM7A 3GIZL 3FQTA 3O8XB 5FCUH 1J8KA 1XGRB 1CLYH 4KJQD 4N0FA 5DS8A 5SV3A 2XZAL 1T21A 1GCFA 4R0LA 3F62A 1DDHA 2CIKB 2W0KA 1YY8B 4NGHH 2AV1A 4ZTPL 5TE7L 4PBXA 3B2VL 4QRQB 1A2YB 3QT2A 3HRPA 5FYJU 5J89A 4GG6B 3MRNB 4ZS6C 1BJ8A 5BW7A 5C92A 5CHNA 5GS1B 5I1DB 5SWQB 3BN9D 2RHEA 2E27L 1U92A 5HGBB 3F7PC 3MV8B 2YZ8A 5C8JA 1NAML 3UROR 2K9UA 4RAVB 5IFJA 4LHUB 3NA9H 3T2OA 3MBEC 3V4PL 3PP3H 1CDUA 1LD9B 2DLFH 4KUCF 5JIIA 1L8JA 1RZKL 3MA9H 1DVFB 1IGJA 2X05A 2PKDA 5B22A 4NN7B 1I3GH 1TJIL 2EEBA 1L7TL 5FA4B 5J9PA 5FB8B 1WCBA 5EO1B 1A3QA 1Q0XL 1DSFL 3C6LA 5B3NA 1Z0MA 3BDXA 5AD0B 2DQGL 2VRAA 2P42B 3PHOA 1CFSB 4HX1A 2HT3C 4LPVA 2A77L 4QF1B 4YHLL 3LQAH 4P5MB 4NHUA 3VCLB 2AEWA 3SKNB 1IVLA 2VITA 4PRAA 4G8FB 3MV11 3IXTB 3G6AB 3SBWC 5HDBE 1X5XA 4XVTH 4M7ZC 5D2NC 1EPFA 1L7IH 1F3JB 2J6EH 3NFPA 2UY6A 2HT2C 4NM4L 5CGTA 1UADC 3M8OL 3IXAA 3OKDB 4YXKL 3VFNB 1D3CA 1ONQB 2FGWL 2VDOH 1IMHC 5E2VL 1FZJA 4D3CL 1UJ3A 4HWZB 1UVQB 1QYGH 4F7TA 1MHCB 2HJFB 1MJJB 2EDXA 4U1NB 4ZS6D 4AENA 1I9EA 4I2XE 5MEND 1QO3B 4QXTB 2CIKA 3QHFH 1BGXL 1OP3K 5I76B 4QRSB 2N56A 1A2YA 3FRUB 4QRQA 3OTTA 1OTSC 1TQCC 3OKEB 2UZIH 2HMIC 2APXA 4FP8H 3RZCB 4GG6A 3MRNA 3CVHH 5EO0B 5F1SA 5GZOC 3MBED 4YXHL 4Q97A 5GS1A 5I1DA 1FGVH 5SWQA 5T3XE 5GGTL 5GRYA 2VDLL 4KUZH 5JHDD 2K7PA 3MV8A 5B21A 2CRIA 3UC0H 4RAVA 4WW1B 2FATL 4LHUA 2IADB 5T3XL 1T1XA 4UAOB 2E7HA 3QRGL 1S9YB 2DM4A 3SE3A 1VB9A 3QFJD 2W65B 1A7OL 4ODHH 1LD9A 4XCCL 1LO0L 4F57H 2EC9U 5E0QA 1AFVH 1DVFA 1WBYB 5C9JB 3MYZA 1FQ9C 2BNQA 1FIEA 3FQNB 4F7PB 1PY4A 2HT3D 3TFKA 1BF2A 2BNQE 2VR5A 3HNVH 5FA4A 5C0DB 5FB8A 5IJKC 4LCCB 1X5FA 4Y1AE 3CXDH 5EO1A 1C7SA 1QR1B 4N0UE 1AIFB 5AD0A 2ARWA 4LNRB 2YD9A 5IBUB 1CFSA 3AS0A 1M7DB 2HT2D 4G7VL 4QF1A 3L3IB 4P5MA 3SKNA 2BY1A 4TPRL 1FFPA 3DXAB 3BZ4B 3LDBB 4NO0D 3SE9H 3IXTA 3G6AA 3OR7A 3UPCA 1BD2B 2XV6B 1F3JA 1IEHA 4XC1L 4PJEB 3D1MC 3RX8A 1K8DB 2DRUA 3OKDA 5BVPL 3VFNA 1ONQA 2FL5B 4ZQKB 1OPGH 3I6LE 4BELD 3FQUB 2JTDA 1OTSD 1T0MA 2HMID 1S78C 4ZO8A 2AJXL 1MHCA 2HJFA 4U1NA 5GZOD 2R39A 2E7CA 4OQTH 1QO3A 4P23B 4QXTA 2NY4B 1T0NB 4MJ5B 1MRFL 2VE6B 2R0WH 1NSNL 4QRSA 4TUKL 5I76A 4MVBA 3TH4T 4P2QA 5D8JL 3OKEA 5HJ3B 3RZCA 3W0WB 4OQ1A 3MRBB 5EO0A 4V3EB 4P2QE 5GGRB 3WKML 5I71C 1IQWH 2NQCA 4F9LA 4WW2A 4BSVB 1XMWA 4PJCE 3U2SB 3MSPA 3UZVB 1G9ML 5CKGA 4R96B 1BWMA 3MLSH 4D9LL 4Z7NE 5HHNB 2NXZC 3GRWA 4ODXB 3DNKA 1S9YA 2W65A 2D0HA 5L0QC 2GY5A 3EO1B 5D2LB 4I4WB 3V52H 4E42B 4JHBA 5IW6B 3GRWL 1WBYA 4GAJH 4BZYA 5M95B 5C9JA 5T33L 2R8SH 3P9LA 5FUZH 5K9KA 1NGPH 3NZHH 1YPZA 2HKHH 5C0DA 4NCC2 4LCCA 4R8WL 4YDVA 5IW3A 3T77B 1W8NA 4D8PB 1YPZE 1YC7A 1VEMA 1QR1A 5J6GA 1EFXD 3RJQB 1AIFA 4HKXB 1JV5B 2VDML 5KANG 4LNRA 4DGVL 3P77B 3VXRB 3EDFA 4LPXA 2VZ3A 5EZLA 4M7JL 1WC7B 5GRJH 2F9BT 1K6QH 1LQVA 1ZT7B 4KVNH 5E99L 4U3CA 2ZCHL 3DSFH 3RNKA 3DXAA 3BZ4A 4OM0H 3ULVH 2X9XA 1KPRB 5E5RB 4XXCC 1BQLL 1DQJB 4QCIB 4G5ZH 3B2UC 3BDYH 3I3DA 1BD2A 4K8RH 1SMAA 1S78D 1MCWW 1R5VA 4P46C 4PRNB 1JF6A 2FBJL 1LEGA 1K8DA 5BRZB 3O2WL 4J7RA 5JXAL 1LO2H 3KPNB 1KFAL 2E9WA 3MUZ1 3EOBB 3RWEA 4CW1B 3F7VB 1U6AL 4XNXH 4EIZC 2F74A 1YN6B 4HEPG 4QO1A 2HRLA 1IM3B 4R2GB 4HF5L 5C0BD 3V0VB 2BXZA 3WXVL 1NMAH 2HYMA 2W60B 3ZDXE 4TUJB 3OAUL 3ARGC 3MGTB 4HFWB 1T0NA 4MJ5A 2VE6A 5DHVB 5HHVL 5ESQB 1N5AB 5HJ3A 2NXZD 3ZSSA 3MRBA 4YPJA 4ZOEA 4JM4H 2IAND 3VXSD 4BSVA 4JO3L 2LFGA 4G9FB 4POUB 5E8OB 1CI5A 3U2SA 3BWUC 4R96A 1JP5A 4LQFL 2XWBB 5HSFA 5I75B 3TN0B 2CXGA 4L3CA 4Y8AA 5HHNA 4ODXA 2VC2H 1T22B 4TSBL 4RX4D 5CEYB 5C07B 3EO1A 4JY5H 5D2LA 1ADQH 1RU9L 2JJTC 2PNDA 4E42A 3QCTH 3QEQD 3D6GA 4LLMB 4MNHB 2VJXA 3H0TA 1NGZB 3BX7C 1T03L 3CFCH 1ED3B 3JWOC 4QT5B 3RKPA 1U91B 1KTKE 4RDQG 4D8PA 4EJ1C 5ADPH 5LJYH 3RDTA 3U0PA 2QJDA 3B2UD 3P77A 2VLRB 3QIUC 1OGTB 4P46D 2I5YH 3MNWA 2XYCA 5MEOA 1WC7A 3AXLA 1JYNA 3QQ9C 1ZT7A 1QSEB 5CKAA 4DQOH 2EDHA 1KPRA 2V9TA 4RMSA 3TT3L 1CD9B 4PIRF 4QCIA 5EUKB 1B4JL 2MSPA 1RZGB 3O3UN 3V5HA 5E1AA 4CMHC 1XGQB 5BRZA 1A7PL 2X4QB 5EBMB 3ARGD 3KPNA 2R56H 3KPLB 3L95A 5ALBL 5MENE 5DDHB 3QUMH 3EOBA 4M5YL 3MLUL 3F7VA 4NN5B 3BISA 4TQEH 3ARTA 3V0VA 1YN6A 2XZCH 2ZUYA 1IM3A 5ACZB 4OIIL 5F6HJ 4JZJA 5GGQL 5JMRA 1FFNB 4I0PC 3C09B 5CILL 3QH3B 3MGTA 4HFWA 5CBAB 3CH1B 1U8OB 1U0QA 3E6FB 4Y19A 1N5AA 5JHDE 4Z7WB 5ICXA 1NCNA 5JQ6L 4Y19E 5D7IE 1JRHH 3RTQB 4XWGL 4L8DA 25C8L 3UJJH 1LK3L 4G9FA 3M1BB 3CFEB 3E8UL 2JCCB 3QFJE 5DLML 2IH3A 3RZWA 2XWBA 3BUYB 5HYJE 2HFTA 4ODSH 4EUPG 1LHZA 1T22A 5CAYB 4B5EA 3IDYC 2C3XA 1EZVY 4YJZL 4P9MH 3ARDB 5HHMB 1J1OH 1DEDA 2XN9B 2J2ZA 3MQIA 4OTXL 1HKLL 3QIUD 4LLMA 4MNHA 1AGDB 2X4SA 5IFHL 1NGZA 1K9TA 4BKLB 3VDCA 3QQ9D 1ED3A 5I9QB 4QT5A 4YLQT 5D1QB 2MKWA 1RPQA 4NKOB 3IDJB 2LVCA 4PJ5D 1RHFA 4H5SA 3FFCA 2VLRA 3PDOB 3BP5B 1HOCB 3FFCE 4N9GB 1QSEA 3TBSB 2NY7L 2XKNA 5J13B 5ILTL 1E4WL 1VKXB 1DL7L 4JN1H 5EUKA 1I1AC 3NH7H 3REVB 1RZ7L 1X5ZA 2KH2B 5HBBA 3BZEB 1OVZA 5A43C 4QRPD 4I0PD 2GAZB 2PW2B 2X4QA 3HNSH 5C08D 1MCPH 3QRFM 5EBMA 4S1SH 3KPLA 5DDHA 3ARBB 3TYGH 1ITBB 4NGHL 4I9WE 2F5BH 4W4OA 4HAFA 5ACZA 3PWPB 4M93B 1SJHB 4QXUL 4WHDA 2IMMA 3LKNB 1FFNA 1IFHH 3QH3A 5DJZB 1YNKH 4OAWB 1MELA 3CH1A 3ZE1E 1U8OA 3E6FA 1AY1L 1OAUH 4Z7WA 4PJHF 2LU7A 3KJ4B 1MIMH 1NFIA 4Z7WE 3RTQA 4JAMB 5T5FH 3M1BA 3CFEA 5EOTB 2JCCA 5HTSA 2CDEB 2DLFL 3LQMA 4L9LB 5IV2A 3UBXB 4BM7A 3BUYA 4S2SB 3MA9L 3CSBA 5IB5B 5C09D 1QRND 1I3GL 4AM0B 1OF2B 3E3QC 4YBLB 1QSZA 3GMMB 2VLKA 5FYJH 3ARDA 1ZWIB 3FAXA 5HHMA 2XN9A 3X3FL 1U8KB 2VLKE 2H1PH 4PYHA 1AGDA 2FB4H 2H2SC 4G6FD 5AG9A 2R0KH 4BKLA 3VMNA 2J6EA 4JZNB 3LQAL 5JOPD 4HS6B 3VI3F 4GQ9H 3IDJA 1MHHB 2B2XH 3QWRA 3TVMC 2X1OA 4XVTL 1I1AD 1PZ5A 2JELH 1L7IL 2J6EL 1HOCA 4N9GA 2HN7B 4PJBA 2ZPKH 4UZGA 1HWHB 2B7DT 2Z35B 4XPHH 1PKOA 3WO3B 4PJBE 3S97C 5A2FA 5F6IC 1CXFA 2VDOL 5KJRL 1Z5LA 3NIFE 4HGKC 3U4EB 3QDGB 1JHLH 2FECI 3FZUC 5K9JH 1VGKB 3VG0H 1QYGL 3NN8B 1TTGA 3PV7A 3BZEA 4LDEB 2GAZA 2W38A 5C0BE 4DEPC 3CVHA 3VMPA 1SVZA 4Z7VB 4HMCA 1UWXK 3ARBA 4LLQB 4WTXA 3QHFL 4JRYB 1BIHA 1X3DA 3ZT5A 2GK0B 2UZIL 1M7IB 4FP8L 1AC0A 1MFNA 1SJHA 4YHNB 3CVHL 3LKNA 2GSGA 1ND0B 4U0QB 5DJZA 2IANE 4OAWA 2Z9TA 5FM4A 3QULB 4F7MB 1C12A 3SGEH 1IC7H 3UC0L 2UWEA 2E7LC 2X09A 2PF6A 2UWEE 2A6JB 3VFSA 2OTUB 1JFMA 1B6DA 4ODHL 1ERNA 2F54B 1AR2A 4M6MH 1YQ2A 4L9LA 4F57L 3UBXA 1CVRA 3IFOA 4YR6A 4F37F 4S2SA 4WFGD 1AFVL 4FOMA 3VWKA 3WJLA 1HN1A 2H2SD 4QGTA 3QEQE 4AM0A 1HILB 4G7YH 1OF2A 2XTLA 2APTA 3S88H 2XXMB 3GMMA 3CDCA 4FQIH 2DWDB 2R1YB 3CXDL 1ZWIA 3WUWB 4GAFB 3TVMD 1U8KA 1X5HA 3OBAA 4H8WH 1CE1H 5GJTL 3PJSA 1LWRA 2EO1A 3OXRB 4DKFH 1N6VA 4EBQH 1IQDB 5EU3B 4I18A 2XI9A 5J1TC 4HS6A 2DTMH 4MZ2A 1ACYH 3IAQA 1PY9A 1MHHA 3RVXC 3SE9L 1AP2B 1REIA 2COQA 1I8LC 2UUDK 3FZUD 4PRID 3PP4H 2ZUTA 3IJSA 1UXWA 3WEXB 5EU6D 2Q6WB 5JLZB 4NQVB 1QQDB 1CGTA 4QHKJ 5KVGH 5ID0B 3DRQB 4V3DB 5I8EB 3GJFK 3PGDB 5C6TL 4OQTA 4BK4A 2IALA 3U4EA 3QDGA 1PGRB 5CMAB 1VGKA 2Z8VC 1JGEB 4HIXH 4ONGH 3RIFF 4UTAH 2EYSB 2OYPA 2X5PA 1IGCH 4Y4FC 4JM2C 4OQTL 1EJOH 4LLQA 5GRVL 2CR6A 4JRYA 4Z76B 2R0WL 2DLHA 4PD4J 3CDYA 4JRYE 3NIGE 3QG6B 2GK0A 2VNCA 4R4BA 1M7IA 4YHNA 2X7LB 1ZS8B 2OXGA 1G9NH 4NJAH 5LGHH 4F7EA 1IQWL 4M6AA 1SHMA 1ND0A 1FYTD 4ZFFB 4W68A 1KJMB 3TJHA 3MLSL 4PGCA 1MWAB 1P4LA 2BJMH 5IVXE 2DQCH 4JREC 4P2OC 4LVNC 1BJ1J 3T4AB 2A6JA 2OTUA 4QHNB 4LVOC 2G75A 4G8EB 3C9NB 3V52L 3RFZC 1KTLB 1NLDH 1ZA3A 4GAJL 4WFFD 1WTGT 4K71C 4JLRB 3TWCH 1HILA 2R8SL 3OB0H 1NGPL 3KJ6H 4I3SH 2IQAB 4XP4H 1BJ1H 1EUTA 2DWDA 1HXYB 5D6DC 4WU7A 4OLYH 3RVXD 4KHTH 4BQCA 3WUWA 2YPKB 3W39A 1MAML 4PJ5E 3REWB 4L8SC 5BZDB 2FIKB 3OXRA 3ULVE 1NC2B 1KXQE 1JNLH 3UTQB 5IF0B 1IQDA 1JI2A 4OF8A 5GRJL 4F3FB 4NNPH 1WIPA 4KVNL 2DJSA 3DSFL 5C71A 1QLFB 4OM0L 3F8UB 3ULVL 4KKAC 1AP2A 2C4XA 5B8CB 5IVNA 4G5ZL 1F13A 3BDYL 1ZAGA 1U8PA 5I73B 3WFEH 3WEXA 2Q6WA 1UGNA 5JLZA 2VAAB 1KCUH 4NQVA 1QQDA 4Y4FD 4JM2D 4LMQI 4BFBD 2EDFA 4QRPE 2LTQC 3BRFA 3L3DB 3PGDA 5C08E 1LO2L 1CDYA 5MHSD 5LGJB 4DUVA 5CMAA 3RA7H 4XNXL 3ARFC 1J11A 3QUYC 1EAJA 1OGAE 2EYSA 2NYYC 3DLQR 1YEEL 1NMAL 2LQRA 5TE6H 3HE7C 3EYFA 5IMKB 4WNQB 4PJIF 4Z76A 4LEXH 2VLJA 3QG6A 2VLJE 2X7LA 1ZS8A 3HMXL 5EPMA 4P2OD 3IDNB 5I0ZA 3ETBF 4MXVF 1FG2A 4XHJC 1H8NA 4ZFFA 1D5IH 3MV01 1FZMB 1MHEA 3QA3B 2Q7YB 5GPRA 1ADQA 4FFEX 1CG9B 3K80A 3ULSB 3MCG1 5KSAC 3LKRB 1TFHA 5KSBE 1BIIA 3AY4C 2VC2L 2DI9A 5C09E 5HDOA 3T4AA 1JHKH 3JVGA 4F37K 1NEZG 3BESR 4QHNA 4NWTH 5T1LA 2BOCB 4JY5L 1ADQL 4G8EA 4C54A 43C9B 2Y9RT 3QCTL 4UT9L 4WO4B 5DF0A 2C1PB 2C4FT 5HPMA 3VXME 2F15A 2PO6A 3S7GA 5HYSA 3CFCL 4U1KB 1NJ9B 5ADPL 4KKAD 5KS9F 3REWA 1CN4A 3U9PH 5DYOB 5BZDA 2FIKA 1TENA 4K94L 5H37G 1I9RH 5FEBA 4YBHA 2QR0B 5IF0A 1FBIH 1ZLUK 4H1LG 4UV4H 3U7WH 3SGEI 3UTTB 4Z7OF 1OAYL 1LO3H 4OZFG 4YHYB 5B8CA 5BQ7B 4JFYB 3QUMA 2XG5A 3ARFD 3V9FA 3QUYD 2ZZUT 5JO5B 3MLYH 5EOQH 5BCAA 2VAAA 3OGCB 2YD4A 1WEJH 4G6KH 3HE7D 4YDKH 5ACLA 4DZBB 3QUML 5DJDB 5LGJA 3GSWA 4JRWA 5IG7B 1JFQH 3CSGA 4TQEL 2I60H 2J4WH 1FG9C 3WIHA 3U0WH 2XZCL 2W07A 4P9HH 3G6JB 4Y5XC 1W2KT 3I2CH 1BFOB 4XHJD 5F89A 3LV3A 3NIDE 4Z0BH 4JPVH 4WNQA 4JFQB 3R8QA 3DURB 2O61B 1T2QH 2G5BA 5KSAD 3IAGC 3K74B 3UTZA 5IP4A 1MFCL 1JRHL 2NY1C 4DW2L 3O3DB 4XGZB 3AB0C 5E4IA 2X70B 3BWAB 3E2HA 1R5IB 4AIZB 2EH7L 4APQC 3QWQB 1CG9A 3ULSA 4N68A 1YEDA 4Z5RA 4ODSL 4Q6IC 3EDJA 4FQ1H 7FABH 1X5IA 2X6MA 1H9VA 4HK0B 4X4YB 2BOCA 2RB8A 3HZYB 3MZGB 4XBEH 1P9MC 1J1OL 4KQ4L 5TH2B 3QNXA 4WO4A 2QLVB 3TBYB 5KOMC 1FCCA 1TVBB 4JGJA 5I17A 3BDBA 1G7PA 1RSFA 3QNYA 5E9DD 1NJ9A 1NLBL 4ZG1A 4RA0C 4XPBH 4FQXB 5KOVC 5DJ0B 3JV6B 4XB7A 1O5DT 1S7RA 4HUUB 1OL0A 5DYOA 5KTEH 3NCJH 2W9LA 2EIEA 2WUCH 4PRIE 2QR0A 1T6WA 2CJUH 4HGWB 4KK9C 3BQUC 2RIKA 1SQ2N 3BIAX 4UDTB 5JPMB 3QIBC 4YC2C 1FFRA 4JFYA 3P9MA 1VERA 3NH7L 3P2TA 5ID1B 3SGKA 1A1MB 1N6QH 2BSSB 5JO5A 4ZTOH 5ACMA 3OGCA 3T2PA 3B9KC 3EUUA 3HNSL 3QSKB 4LPUA 1YYLH 4S1SL 4DZBA 4QHLB 2YSSA 3TYGL 5DJDA 3W11C 5IG7A 3F7QA 2F5BL 2NY1D 1MQKH 3G6JA 1BBDH 3QIWB 1FL3B 4F80A 4U7SA 3BD4A 1IFHL 4KUCD 5F9JA 1MCQA 1U95A 1YNKL 3DURA 4APQD 1QOKA 5FV1L 5GHWH 2IMNA 1Y6KR 4NZTH 1MIML 3O3DA 2Q87A 1X4YA 4OBRA 2X70A 5T5FL 3GSNH 1EBAA 4UV7L 3UPRB 4LPTA 5BMFH 3BWAA 4PJFA 1VDGA 1R5IA 4OF0A 1T7XA 5CGMA 1H15B 4PJFE 1FNAA 3D39D 2FHFA 3FO1B 3VXNB 1J05B 4WFFE 3BW9A 3O6MH 5FYJE 3DGGB 4HK0A 3WS3B 4X4YA 2JJVA 2GHWB 2XFXB 3HZYA 5IBTH 4ZXBA 1B2WH 2VTFA 4U1MB 5FYJL 2R4RH 1S8DB 3GSUB 5TH2A 1X9QA 2AK4B 4LU5H 1M71B 3FCTA 1P1ZB 3MBXH 2H1PL 1TVBA 2FB4L 3OAZH 1RZJH 2R0KL 4KK9D 4MA3A 3BQUD 4UB0H 3RY6C 3LPFA 3T1FB 2A9MH 1IL1B 2C4FU 4FQXA 3QIBD 4PGEB 5DJ0A 3JV6A 3ZDYF 4QY8B 1LE9B 5K9OB 2JELL 2EYRB 1N59B 4L5FH 5FHAL 4HGWA 2ZPKL 5CJOH 3KNBB 3NCFB 4MX7B 3B9KD 1I85A 4L3EA 4XPHL 4CKVX 4OFYD 4BZ2H 5JPMA 3G5YB 1DE4B 4V2BA 4L3EE 3W11D 1CDCA 2BY3A 5K9JL 2HJKB 3FFDB 4OZGE 5MHSE 1QFWI 3D25B 1A1MA 2BSSA 2VLME 2D7OA 5H35A 1OLZA 1BM3H 2VDNH 5E6ZA 1JCKA 1A6UH 4K3DH 1NANI 3CX2A 3GB7B 1CCZA 2VABB 5IB1B 4CJ0A 5HVFB 4KRPC 4TULH 5D7SH 3UJIH 4PRPD 1QVOB 3SCMC 3VXUB 2HVJB 2DYPB 4FTVD 4HUKB 4X9IA 3WO4B 2J7LA 2H32H 1KLGA 5LXGH 5INDB 1FL3A 5DUPH 5IW1B 4HDIB 3S35X 1QPPA 5TGBB 3MLZH 1HCFX 2VXSH 5CEZD 4X5XB 5FIEA 5E8DL 3MROB 4JHWL 4R3SB 3PWNB 1IC7L 2WBJB 3PV6A 2R69H 1J9CT 3F12B 1ZVSA 4NQCA 5GS3A 3BP7B 4KVCH 4NQCE 1NFDB 4NO3B 1MCJA 3AREA 2V2XB 5I0DA 4M6ML 4L4JA 4EKXA 3FO1A 1J05A 3ZHLA 5I18L 5GRUL 3VD5A 1FVCA 2YPLD 1WTLA 3BXNB 4G7YL 3WS3A 4MB5A 4U1MA 4EXPX 1C5DB 3RBGA 5KANI 2AK4A 4H8WL 1M71A 1P1ZA 1AXSB 1F2XK 4DKFL 3BPNB 3DHMA 4EBQL 3KXFD 4NC2B 1FRGH 2MHAB 4S1RH 2DTML 3T1FA 1ACYL 4WFED 1IL1A 3AAZB 3UZEA 3NCCB 4QY8A 3QZWG 5E6IC 2EYRA 1CFNB 1N59A 3PP4L 4NZDA 3O0RH 4EN3C 5E00B 2FO1A 1AHWB 2BVOA 3KNBA 4ZOAA 1FC1A 5DQ9B 3CFDB 5KVGL 2I27N 3G5YA 1DE4A 4KRPD 4WWID 3BYYA 3SCMD 3FFDA 3MRFB 1KB5H 3D25A 4U6YB 4HIXL 4OI9A 4ONGL 2RJMA 1GC1L 1CE6B 4WUUE 1JZ3A 3V6FB 3NGBC 1IGCL 3GB7A 5E5MA 1MY7A 4LLYB 2VABA 1EJOL 3QXAB 5EIVA 1OHQA 2OZ4H 3TO4C 3SO3B 5J06A 3ZYIA 3VXUA 4HKBA 1PKQA 3WN5B 5ISZD 3WD5L 4GRWH 2N7AA 5INDA 1PKQE 4NJAL 1G9NL 5IW1A 4HDIA 3UYPA 3D3VA 2AKRB 5TGBA 5L88H 2BXYA 2NMSA 4YHPB 4OSUH 4WJ5B 1EEYA 3OGOE 3D3VE 4JKWA 5FOJA 5HI5C 1J8HB 2BCKA 4WU5B 4HG4K 3DMMC 3PWNA 5J1SC 2WBJA 4Q7DA 3F12A 2BJML 3L1OH 4OZHB 4U6XB 2DQCL 3MOAH 4ZNEE 1NCDH 1I3VA 2AABL 4H26A 3BP7A 5F7UA 1NFDA 4HKJB 4H0HB 3QJHB 5DEGB 2V2XA 4XVSH 1IJ9A 1F58H 1NLDL 3MREB 2XKUA 1NDGB 4KWUA 1FZKB 1JHTB 3TWCL 1P5UA 3BXNA 1DR9A 4GS7B 5DJXB 3ARPA 3BZFA 3FO2A 2IBZY 3ZT6A 4XP4L 4DOHB 5SWSD 2EEDA 4OLYL 3UAJC 5AZEH 1C5DA 5E9DE 1BBJB 5IMLA 4S10A 1HXMB 5E6ID 4Q9BA 5E4EC 4EN3D 2KZWA 1JNLL 4G8GD 4M6OH 2BVQB 4NNPL 2IAMC 4R4NC 4UOJA 3AAZA 5CINH 1UWEH 1PZUB 3V6ZB 2XKSA 1CFNA 2GYSA 5E00A 1D5XB 1AHWA 3WFEL 2GJ6A 1KCUL 5DQ9A 3CFDA 5FGCE 2NX5D 1EVUA 2AP2A 2NTFB 2GJ6E 3TO4D 3MRFA 3RA7L 4U6YA 4PYGA 2ICWB 1CE6A 3BEVB 3V6FA 3I9GH 3KPOB 5TE6L 3UZQA 4LLYA 3GSXA 5HHOB 5HI5D 2Y5TB 1CQYA 1L0XA 3DMMD 3WN5A 1T0PB 3WYRA 4HEME 3ZTJH 4IRJB 4YEEA 2AKRA 5AZ2H 5FUOL 1JI1A 2UZYB 3MRMA 4WJ5A 4YHPA 2GUOB 1J8HA 1CYGA 4WU5A 5I19H 4GH7B 2E8ZA 5I74B 2QQLH 4ZOBA 5CCKH 5GSVB 3L5IA 4OZHA 4U6XA 2QHLA 2I9TB 1FNEB 1KB9J 3KPQB 1JHKL 3IS0X 1O7SA 5FUCC 1U8QB 4NWTL 4HH9B 3UAJD 4HGMA 4NWUH 4DKEL 2FBOJ 5C0AA 4XPGH 1FZKA 3UDWC 3SDXA 5C0AE 1A0QH 4EOWH 1W72L 5DJXA 3SDXE 3ECBB 2IAMD 4R4ND 4ISVB 1JNJA 3SJVB 1BBJA 4WTWA 1HXMA 5IKCB 1JIBA 3U9PL 4XWOC 4PJ7F 4NN6B 1I9RL 1FBIL 4PJDA 3C8KB 4TUOA 3DETC 2BVQA 2ERJC 1IC1A 1AO7D 4UV4L 3U7WL 1ZT1B 4PJDE 2CIIB 3LH2L 2C7UB 2SEBB 3V6ZA 3MJ8A 2PW1B 3UP1A 2PCPB 4IMKC 3BJLA 3JWOH 2IWGA 1D5XA 3MLYL 5EOQL 1GGIH 4G6KL 4U1SB 5EUOB 4HUXB 2NTFA 1K5NA 2X4NA 1A14H 5T3ZD 4BFIB 1BOGA 4POZC 3TCLB 1JPST 3MV9B 2GKIA 1JFQL 3ZYZA 2I60L 3U0WL 1ZHKA 2ICWA 2IF7A 4HJJH 4P9HL 2J8UF 4X6FA 4OZIA 3O3AB 1YMHB 3O2DH 4R26H 1T5XB 3LKSB 4JPVL 3PL6A 5CEZE 4OZIE 2Y5TA 4MNQB 3GSNB 2ZG2A 1ZMYA 1T2QL 3Q6GH 4B41A 3FHAA 2QKIB 2O26U 3RHWF 4JDVB 3QO1A 3T1WA 3T0EB 2GUOA 4AMKH 1A4KB 4HMDA 1A6VH 4JFHE 5I1JH 1N4XH 3HI5H 4KGJA 5HYEA 3OJVC 1FNEA 3DYOA 3KPQA 3MBEB 4FQ1L 4TRPH 1J1PH 2FLRT 5ESVB 2A1WH 4XBEL 4RRPG 3HI6H 1UKSA 1NCBL 2FX8H 2VLLB 4XWOD 1FJ1B 3B9EA 1HKFA 2NY5H 3DETD 4EUPB 4ISVA 5F97E 2X1PA 4XPBL 1P2CA 3NAAH 4ZUVA 3SJVA 4WFEE 2HJLA 1YEKH 2DF3A 4I5BB 5IKCA 1TTUA 4OLXH 5BXFA 5KTEL 3NCJL 5FM8A 2WUCL 3EOTH 2WW8A 2CK2A 1IM9B 4OUUB 3C8KA 1G7LA 2R0LH 4RMVA 3H3PH 4JB9H 2HFFA 2ZJSH 3T09A 4NKIL 2IFGA 2C7UA 2SEBA 3KAAA 4POZD 2BP3A 4M7ZB 4XMKH 5D2NB 2PCPA 4M5ZH 1N6QL 1YY9C 5C70A 4ETQB 4ZTOL 1INEH 5EUOA 4HUXA 1YYLL 2OP4H 4NO0B 5TDOB 1JGLH 4CRPA 4FZ8H 1F6AB 3TCLA 1FFQA 3MV9A 4PG9A 4U6VH 3WFHB 4KC3B 4J6RH 1QFUH 5ISZE 4DKAA 1MQKL 1W8OA 1BBDL 1DBKH 2NW3A 3O3AA 2DOCA 3WDHA 1T5XA 4XNUH 5TF0A 4JQIH 4MNQA 3GSNA 5FYLH 1M7XA 2P7TB 2YZ1A 4OZFH 5GHWL 1C16B 2B4CH 4MNQE 1TQCB 2QKIA 3C60C 4NZTL 1EXUB 4JDVA 2YS4A 3T0EA 4LCWA 3GSNL 1A4KA 1XT5A 5BMFL 3WJJC 4B50A 2AXHA 2GFBB 4LCWE 1FSKC 1VGEH 4NNXA 2KQNA 2J12B 3D18B 2Z0BA 5A40E 1I8IB 4ZS7H 3EFFB 1GGBL 3Q6FA 4GFTB 2IGFH 5ESVA 5IBTL 2BK8A 1B2WL 5GXBB 4LU5L 3HE6B 2VLLA 1FJ1A 1AD0A 3MBXL 1II4E 1XIWC 1KENH 2MQCA 1RZJL 3RVTC 5FO8B 4LGPB 1C7TA 4UB0L 3EYUH 4G8GE 1F4WH 2A9ML 4LQ1A 3W9EB 4I5BA 1DANT 3GHEH 2P5ED 2DL2A 1CFTA 2I25N 3GSRB 3OKKB 5I8CA 1YY9D 4X6CB 4XZUB 1IM9A 4OUUA 5BZWB 4LRNH 1AGEB 3V8OA 3IS1X 2BY2A 3GMRB 5HI4C 4BZ2L 3SQOL 3GMNB 1ZEAH 3JV0A 4X7TB 2P46B 5D2NA 1BQUA 1XEDA 1DFBH 3P11H 2MKLC 4XNQB 5BO1H 2AJVL 1BM3L 5DMIH 1A6UL 2H32A 4GRWB 4OJFH 3GBLA 4NO0A 2OI9C 4LVEA 5FO9B 4TULL 4BUGA 5D7SL 3EYSH 5JXEA 3WFHA 1MVUB 3GIVB 3UJTH 1D5ZB 3C60D 2V5YA 5LXGL 3MRPB 1VCAA 2QSTA 5DUPL 3U9UA 1S3KH 5DZNA 4HUVA 5DA4A 1MCKA 3FOMB 4ZFGH 2YMXH 5TFSH 4A6YH 2P7TA 1AKJA 4Z7UB 3HC3H 1C16A 3RHWK 15C8H 2R69L 5C0IB 4RISH 1UEYA 4X7EC 5I71B 4IJ3B 3L5WB 3MRIB 2GFBA 3HN3A 1EHNA 5HGAB 2VL4A 2JKXA 2B5IB 2FO4B 1DZBA 3V7AE 3D18A 1XIWD 5AYUH 1I8IA 3RY5A 5JNYA 4HWEH 2I26N 3RVTD 3EFFA 3H9SB 3VXSB 3FB8B 1H0DB 5L0QB 3K81A 1BWWA 2O5ZH 4UUJB 5KW9H 1K3ZA 3HE6A 1CU4H 4WVRA 5FDWB 4LIQE 2DLTA 2VDPH 2ZKHH 3RRQA 4HJ0C 1KCKA 4GW1B 4LKXB 1FRGL 3MZTA 2VKWA 3BKYH 5HI4D 4U0RB 1AO7E 3W9EA 3TPUB 3VXQB 4TOYL 2FEDC 5J3HC 1DLFH 1KEGL 3GSRA 3OKKA 1T1WB 4X6CA 1KB5A 4BYHA 4ZYKB 5BZWA 1AGEA 3OMZA 2OLDA 3GMNA 4OGYH 2H8PB 5HDBF 1Q9LB 4I1NB 2A6KB 2OZ4A 4XMPH 1WT5A 3P3YA 1KB5L 4XNQA 3ZZ1A 2QSVA 4N1HB 3ARWA 4YGVA 4WIQA 1JWMB 3HMWH 5AWNH 1J86A 3ARZA 2DQEH 2VH5H 3FN3A 3ALWA 5FO9A 1P4BL 1JZ6A 2F5AL 1MVUA 3GIVA 1D5ZA 5JOFA 4G9DA 5F3BB 4G6AC 2HFEA 3MRPA 1KSRA 2ZUQB 5EIIB 5L88L 3ARGB 4OSUL 4YX2H 5FUCE 5B38A 3PWVA 3EYVB 4PGBA 3L1OL 1JPFB 3MOAL 1IGIL 4GG6F 1NCDL 3VFUB 4HIHB 1KCLA 4NQTA 1JZ5A 3L5WA 1G84A 4XVSL 5HGAA 3BKMH 1F58L 3PWJB 2FO4A 1I7UB 3BAEH 1HQRB 4YHIB 2WSKA 4M43H 4HJ0D 1QA9B 1BVZA 3H9SA 3R1GL 3FB8A 3B9VA 1X7QA 3H9SE 3D0VA 1GZPB 5AZEL 1HINH 1MEXH 4UUJA 3SDDC 3LZFH 2FEDD 5J3HD 1A6ZA 5FDWA 4MJ2A 5DO2C 1U3YA 4PUBH 2DQJH 4LKXA 1D5MA 4M6OL 5GJSH 1JE6A 5CINL 2ITDB 1UWEL 1KIPB 1G1YA 2XNAB 4B7IA 1T1WA 5ELIA 4NYLB 4JDTH 4BFEA 5CGYC 4ZYKA 2RAMA 1DANU 5IFAH 1RK0A 3BH8B 2H8PA 4ZNCD 4M8QB 4RA3A 1CZ8H 2A6KA 3HI1A 2FYYA 4G6AD 4CMHB 1JWMA 1ETZB 2XXCB 3I9GL 2GJZB 3MOQA 3V6OA 4PJ8B 4OGAC 3TZVC 5DJ8B 1H3UA 3V6OE 3O4OB 1I7TB 2YD7A 3K8LA 1RJLB 5EIIA 4I0PB 5AZ2L 4L29B 4ZFOB 4OLWH 1ZLVK 5I19L 1OP3H 4KPHH 3EYVA 2QQLL 5CCKL 1JPFA 2CLRB 3V7MA 3VFUA 4HIHA 3DO7B 2BHYA 1FYHB 3WCYA 4WW2F 4IDJH 1VEPA 4PJGB 3VI3E 2QHRL 4NKMB 1KIQB 5I1CH 4NWUL 3PWJA 3SDDD 4Z7NF 1R3HB 2ZWLT 4PGDB 4XNYH 1QNZH 2R2BB 1J88A 4XPGL 5JR1L 1HQRA 1YECH 5DO2D 5KG9A 1A0QL 1OM3H 4EOWL 1EO8L 3T65B 3IDYB 3DUSA 5IHZA 3QI9B 1I1FB 2GT9B 1HE7A 2R1WB 3V4VL 3VFTB 1S7WB 2QADB 2E9JA 1NEZB 2E7MA 3DUUB 3RWJB 1B88A 1QRNB 4ZMAT 5CGYD 4LEOA 1F11A 1AR1C 3WDIA 4JFXA 4GLRH 5HVHC 1YPZF 3A6CH 4N8CH 2F53D 5ICYB 3QFDB 4QGYA 2XNAA 3H9HB 4QLRA 1KC5H 4MDIB 4OLZH 4NYLA 4IRSA 5JW4M 5IVOA 2BOBB 1PG7W 1FNFA 1GGIL 1AGBB 2CLVB 1ZV5A 1A14L 4OGAD 3TZVD 4M8QA 3WNOA 1P7QD 3ZMRA 3O2DA 4NSKA 2DWEB 1I1AB 4CVZB 5KVEH 4YFLF 3OJMB 4OZFB 4HJJL 1ETZA 5GZNC 5SV4A 5J6HB 2A6IB 1U58B 2GJZA 4MXQA 1KGCD 2YUXA 2OJZH 4PJ8A 4R26L 3S9DB 3GKZA 5DJ8A 3EZ8A 2UV3A 1Y18A 3KVQA 5IEKB 3GSQB 5BVJB 3ZDXF 2C3WA 1RJLA 3RKDC 1R5WB 2XTJC 1E4XH 3WNMA 1UC6A 4IEFB 3VWJB 4MQTB 4L29A 4ZFOA 4KGLA 4AMKL 1QD0A 3F7YB 3FT2B 1A6VL 4OCXH 5I1JL 5F71A 1N4XL 3HI5L 4NQDB 2X9YA 4S11A 3RPIB 2CLRA 5E7BA 1U8MB 3DO7A 4ZFOL 1NFKA 4OLUH 3S37X 1A3RH 4NKMA 1KIQA 4ONFH 3S6CA 2A1WL 4LP5A 3HI6L 4ODBD 1RVFH 4PGDA 3BMWA 2R2BA 1QLEH 1RK1B 3T65A 4CNIB 1JMXA 1AR1D 2NY5L 1KLUB 3QI9A 4U31A 2P5WD 4WHYH 2GT9A 3VFTA 1S7WA 5D2LF 4LCUB 5EU7C 4Z0XB 4FHBD 1YEKL 4C57C 1WZLA 3DUUA 3RWJA 1M1SA 4OLXL 4LHJB 2GY7B 4OB5H 3EOTL 1HHHA 2R0LL 2GW5A 1Q1JH 4Q58C 3CH8A 5D7JC 5FFLA 3H3PL 4JB9L 3TV3H 3WHE1 2VQ1A 1CGWA 1UH2A 2W1NA 2ZJSL 5ICYA 3ARRA 4RWYH 2NZ9C 4XMKL 3RAJH 4MDIA 4M5ZL 4P49A 2BOBA 5GZND 1INEL 2CLVA 4X8JB 5BS0D 5SWZD 2OP4L 1JGLL 4FZ8L 4UQ2B 1MFDH 2X42A 4A6YB 2DWEA 3OKOA 4CVZA 4U6VL 4DCQB 3VFVB 4J6RL 1QSFD 4OZFA 1QFUL 5EU6B 5FYLE 2XTJD 4OM1H 3RKDD 5J6HA 4DEPB 3WLBB 3IJHB 2A6IA 5IB3B 4KTYA 4QRUB 3FO0L 4XNUL 1H3PH 5FYLL 1B90A 4F33B 3L3GA 4WGWB 2B4CL 2R15A 1HHIB 4P2RA 5FGRA 1R5WA 4P2RE 3VWJA 1XFPA 3DX9B 3VD3A 3F7YA 3L5JA 2HLFC 3FT2A 4UINH 5I1EL 3P4MA 1A7QH 4FQCH 4LBEB 4PRHD 1VGEL 3KPSA 3RWHB 1V3MA 4LASH 4NQDA 3KPSE 2CDGA 3NA4A 4AIOA 3RWGA 4K9EH 1S7XA 4ZS7L 3NCYS 1CDGA 1YEGL 1A22B 1QACA 3V5DA 3PABB 1FYTB 4V1DA 3HHRB 3EZJB 3S5LG 4JFFE 1FNSL 1U3HC 4V1DE 5I2IB 1KENL 1RK1A 4CNIA 3W2DH 4WI3A 4O2CA 1KLUA 5D7JD 3EYUL 3VGBA 4G3YH 4LCUA 2Q7NA 4QRRD 3O2VH 2NZ9D 3GHEL 3KLDA 2XA8H 4ODVH 4C56B 3MO1B 2WUBH 3TC9A 5DMYA 1N3NB 2Q76A 3G6DH 4LRNL 2Z31C 1ZGLM 3D85D 1QKZL 1ZEAL 5IMMB 3C87A 1MQ8A 2VMFA 3O4LD 1DFBL 3P11L 5MI0C 1MREH 5BO1L 3UEZA 3TJEH 1ZVHA 5L8KB 3AFLA 3QQNA 1N2RB 4QHKI 4OJFL 3M17B 2DQIH 2DAVA 4P48A 4UQ2A 1YEIH 4A6YA 4DCQA 3VFVA 3CSYB 3MCKB 5D5MB 4L4VD 1I1CA 5EBLA 35C8H 5BV7H 1S3KL 3IJHA 4Y4FB 4JM2B 4ZFGL 5IB3A 2YMXL 4M48H 3ZKMC 2HLFD 4A6YL 3O6FC 4LCYB 3D69B 5E8EB 3MYJB 5L2KB 4ERSH 4F33A 1U3JA 4M6NH 3HC3L 1A3LH 2IFFH 1OAXL 2PTTB 5D6CB 4LLWA 4RISL 4LPYA 3DX9A 4Y2DB 3ZE1F 3FN0H 4WY7H 1ZA6B 1CTNA 1U3HD 3RWHA 5KS9E 1P84J 4Z7WF 2E7LA 5AYUL 4HWEL 3DVNB 5DEFB 4JREB 2XQBH 4LVNB 2EDJA 3STBA 2HT4C 4NKQB 2CLZB 1CICA 3PABA 1KULA 4HS3B 4O51B 1F5WA 2FR4B 2EECA 3TP4A 2O5ZL 2VERN 5KW9L 3LEXB 1RMFL 1JPSH 4F9PC 4X4XB 1CU4L 4UIKH 1OP5K 5I2IA 2VDPL 1MJUL 5EFIA 4ELMA 4R7DA 5TDNA 2Z31D 4XVJH 5DD1H 3VH8A 4ELME 4NZRH 4FXGB 4GUPA 4LLVB 4NHCL 4N8VA 4YAQB 4YH6A 5D96C 4C56A 5EZIH 1E4XI 3I84A 3NFNB 2OQJB 5I1LB 2FEEL 4X80H 3WHE0 3NCYP 3VE0B 4AEFA 4OGYL 4KQ3H 2X1XR 3QDAA 5IMMA 1H5BC 4JKKA 4XMPL 3MTRA 3DGCR 1O7VA 3FJTA 2ZOLB 1N2RA 3HMWL 4PJBF 5AWNL 1FFOA 3M17A 3NIFF 3ZKMD 2DQEL 3O6FD 2VH5L 2EDYA 1KCSH 5FECB 1CR9H 4XAWH 4PLNC 4M9OA 1KELH 3CSYA 3ARFB 3MCKA 4WFHE 3QUYB 1KT2B 3BVNB 4YE4L 5D1XC 1S9XB 4PG2A 4LCYA 4YX2L 3D69A 5E8EA 5L2KA 3P4OB 3U46B 1I7ZB 3HUJE 3GM8A 1DQTA 4NFCA 2PTTA 1G7QB 4KMTH 1G9EA 3P4LA 1FAKT 2HT4D 4Y2DA 3VXPA 3HAEG 1ZA6A 2DM3A 3BKML 4PREB 1NMCC 1S9WB 3WFBH 2KKQA 4U1JB 1RHHA 4XTRC 3BAEL 4GKSB 3THMH 2UWEF 2DLGA 4M43L 5DEFA 2RQ8A 1YDPB 4ZUWB 4HS3A 2H3NA 1JNHB 4MWFA 5BJTB 2UYLB 2FR4A 2FJFB 4TYUA 1MEXL 3TH3T 3LZFL 3MRRB 4K7PX 2DQDH 3WMSA 4M62H 3TT1H 4M3KB 5DMJB 5IWLA 4LSRH 4PUBL 4TTDC 5GJSL 5JDJA 3NCBB 5D6DA 3SO5A 1QFHA 3SEPA 4LLVA 4YAQA 4LLDB 4QKXB 3ELAT 3NFNA 3R4DA 5I1LA 2RGSA 1E6JH 5IFAL 2QSCH 3B3IB 3VE0A 4OF7A 5E56A 4AK1A 5TDPB 5BS0E 5SWZE 2APFA 5IVZB 3U30B 1N8ZB 5D70H 3QHZL 4GXVL 5T1KA 1JWSB 1V8HA 2IPKB 4X6DE 4H88H 4FMFA 4MAYA 2HKFL 1T83A 2XRAH 1QSFE 3IF1A 1CXKA 3QPQC 5D1XD 4D94A 3MMEA 3T0XA 1CGVA 5CJ8A 3OF6A 4LLUB 3BN3B 5FECA 5HDLA 5JW4R 3DI3B 3GSVB 1BQHA 1B3JA 2FZ3A 4X6BA 3ARFA 5IB2B 2D3VA 1KT2A 4Y5XB 3BVNA 5C0CA 4N90D 2OBGA 4NM8L 4GQPH 4XCNA 4C55A 1S9XA 3N1GC 4ZD3H 1UWXH 5C0CE 3P4OA 4OLWL 5D7LD 3U46A 5DMGC 3MRQB 1I7ZA 4OFVA 3MJ9H 3NIGF 4KPHL 1VSCA 2HLAB 3PXJA 2EE3A 4PJ9B 4X7FC 4XTRD 2ZUSA 4BQ9A 3AB0B 1QEWA 3BGFC 5DVLA 1X44A 3OSKA 1UZ8B 1MOEA 3RWFB 2X1QA 5I1CL 3TBVB 1MRDH 4POYA 5IVXF 4U1JA 4GKSA 1YECL 3AY4A 3L3OB 4Q6IB 3GM0A 1OM3L 4RNRB 3QXWA 4HC1H 5F96H 4TTDD 3JTTB 2A73A 1JNHA 5BJTA 4J4PA 5JMOC 4WCYH 3MRRA 1AQDB 4QRRE 2APVA 4M1GH 3MUGB 32C2B 4XH2B 1KJVB 4GRMB 3QBTB 1HZHL 2CO7B 2ZSWB 5F1OB 3T8XB 1RUML 5DR5L 3QQ3B 3SGDI 4HZAA 3A6CL 4NDMA 4N8CL 3Q3GA 4JFOB 4NJ9H 5T5NF 3RX5A 4OD1L 2M26A 1KBGH 1KPUB 2E3VA 4LLDA 3D87B 3PF2A 4YXLH 3ULVF 1KC5L 5CFHA 4OLZL 3O4LE 1EJ6A 4XP9H 3QPQD 5E70A 2VDQH 3OXSB 3B3IA 2ENYA 2HH0H 4BK5A 2LAAA 2X89A 3QIBB 4YC2B 5IVZA 2UUDH 3IETA 1N8ZA 1FLTX 3IFLH 5KVEL 1TJGH 3VGGA 2BSED 3GI8L 1T7VA 1BEYH 4L4VE 3GJFH 4LLUA 5DMGD 5JIKA 1A6AB 5CP3H 4N5EA 3BPCB 4XP5H 4BH7A 3U1SH 4RMQA 3QEHB 2PTUA 3HB3C 1R3JB 1YN7B 2AEIT 4KKBC 3HG1D 5MERB 3MRQA 4OCXL 3FB7B 4PRPB 4ZDHB 2HLAA 5MEPB 3K4AA 3TO2A 2OS7A 4PJ9A 4FTVB 5JUEH 1X5GA 2C26A 3FT3B 4ELKB 4OLUL 5CWSA 1UZ8A 2FH6A 2MJWA 1A3RL 3OX8B 4ZPTB 3RWFA 4ONFL 1NCAH 3TBVA 4GBXC 5ANMB 5KSBF 5DXWA 1QLEL 4K7PY 3L3OA 4KKLC 4Q6IA 4RNRA 1P6FA 3CK0H 3LHPH 4ORGB 3JTTA 4LGRB 2YN5A 1UFUA 4L4TD 4D9QD 5GS2D 5DVOA 4P57A 1EO7A 3QWOB 3MUGA 5JHLH 32C2A 3PHQA 4XH2A 1KJVA 1LO5A 4OB5L 4NBYB 4P3CL 5EOCJ 2ZSWA 2YPLB 3Q1SH 4KTEL 4Y4KC 1Q1JL 1TNMA 4FA8A 1A8JH 3TV3L 4JFOA 1HHKB 4LNVA 4M4RA 1YNTB 3BI9X 3RAJL 5JDSB 3IT8D 2H41A 4NFDA 3S8WA 1J87A 3OXSA 3KXFB 5EOCH 4U1GC 3OG4B 5BV7B 1I3UA 4QHMB 2ARJA 1MFDL 3RL2B 1M4KA 3CLEH 1OW0C 3HB3D 4OM1L 1C8PA 5GRVK 4KKBD 3KPRB 3S37L 4E41D 3FQXA 1R24B 4DVBA 1NDMA 3QEUB 1A6AA 4KRPB 5HGHB 4AEIH 1CFVH 5JW3H 1YNLH 2JB5H 3OJDB 1YN7A 5BW7C 3C6SB 3J8F7 4FG6C 5MERA 4UINL 5CS7A 1A7QL 3FB7A 4OV5B 4FQCL 4GBXD 3TNNA 5MEPA 2P45B 4FTVA 4KKLD 1RZKC 1OARL 4P4KA 4LASL 3FT3A 3EHBC 4K9EL 3IKCB 1CFBA 5DFWH 4Q9RH 3OKLB 5ANMA 4JFEB 4MXWH 1FL5B 4NRYA 5D93B 1QLRB 3W2DL 4Y4KD 2Q3ZA 4ORGA 5EO9B 1GZQB 4X4ME 1LMKA 1JZ8A 1VENA 1JZ4A 2ATPA 4G3YL 3KHOA 2GQHA 4K3JH 4LAJH 3VG9C 3O2VL 1F3RB 3Q5YA 4ODVL 3QWOA 2BRRH 2X4PB 1MCFA 4JRXE 3G6DL 2OX5A 3PQYD 4UIMB 3CMGA 5SWSB 2HFGH 1HHKA 1YNTA 1HYRC 5E6IB 1XR9B 1L6ZA 1MREL 1CD1B 4XPFH 4EN3B 3TJEL 1JK8B 2OCFD 3T0AA 3KXFA 1ZLUH 1KIRA 3BRGC 1VFAB 2DQIL 1BZQK 2FSEB 1KCVH 3MXVH 2VISB 3RL2A 4ZODA 1G0YR 2VB5A 1HSAA 35C8L 5BV7L 4AZ8A 1WFNA 3C5ZA 4PV8B 2NX5B 3KPRA 4FG6D 4M48L 1MJ7H 5CJQH 4M7KH 5F9OH 5HGHA 3KPRE 4M6NL 1A3LL 3CD4A 3EHBD 1F97A 4CBPA 4Y2OA 1S5IH 3G6JF 5GS1C 2DLEA 1T89A 4G6MH 5E95B 2DICA 1KCRH 2P48B 4WY7L 1NAKH 1NL0H 2DD8L 2EEAA 2P44B 4YZFF 4PJ7E 2WBKA 3CSPA 2XQBL 4O00A 4KI5F 3EFDH 3SE3C 4GRLA 2DIAA 3WNNA 5F1NA 3S36H 5F7NC 1CLCA 4J3VA 3IKCA 4X8XA 4NO5B 3LMJH 4PJFF 2BSTA 4JFEA 1DVFC 1JPSL 4UIKL 1FL5A 1ORQB 1XR8B 2YWYA 1QLRA 2BERA 3TFKC 3P0YH 4NQEA 4Y88A 5EO9A 1GZQA 4XVJL 2IPUK 5DD1L 3K7UA 4KHXH 4NQEE 3GBML 4NZRL 2AK1H 2YK1H 2IPTL 3WIIH 5E4EB 4JGMA 3MXWH 5C0JB 4FXKA 1D9KA 4GKZB 1XGYL 2CR3A 4WGVB 1ZT4A 2VR9A 1IEAA 4UIMA 4X80L 5E2JA 5IQ7H 4JKLA 1DJSA 4KQ3L 3TNMB 2P8MB 3UTSA 3P73A 1U8IB 5L8LB 1CD1A 3QP3A 3UTSE 4DTGH 4Y5YA 1TMCB 3BSZH 3DVGB 1JK8A 4GT7A 3EAKA 4H25B 3GMLB 2V6HA 1NGXB 2Y36H 3EOYG 4HQQL 4RIRB 5C0FB 2NNAB 2XG4A 1KCSL 2VISA 3RWCA 3RVUC 1CR9L 3DECA 4XAWL 1YMMA 2NY3C 4FQQB 4DAGH 4R7NB 5T3XD 3NTCH 1YMME 1TIUA 4I77L 1EERB 2D03H 4PV8A 2PYEB 1RIVH 1F90H 1CD8A 2OMNA 1U93B 3DIFB 2DJUA 2N1KA 4MVBC 1G9MC 4WI4A 2ILLA 1CIDA 2EDEA 4LHUD 5D71H 3RZCC 4UTBH 1DQDH 1PG7H 3CCHB 3DV6B 4KMTL 4F9LC 4WW2C 4PS4H 1DTUA 5F9WC 2E6JA 1L0QA 3BP4B 1DVFD 5SX5H 3WE6B 1NKRA 4CJ1A 2BNQD 4HLZG 1DQLH 2GI7A 4UAOC 1YA5A 3QUKB 3TFKD 1EHLH 4Y1AD 4R4FH 2EDDA 3KYMA 3SDAC 4Z95H 1UYWL 4XB8A 3B43A 4L4TE 4D9QE 1U36A 5FYKU 3S4SG 4PBWD 1MCOH 1WZ1H 2DQDL 4M62L 3TT1L 5DJYA 4HS8H 3VFGL 1ORQA 3ZL4L 1XR8A 3CX5J 2XWTB 3ROLA 4E9LA 1XCQB 1SM3H 4IIQB 5DEZA 1WCQA 2B8OT 4DGIH 1AXIB 4UT7H 3NVQA 3UO1H 5J12B 1B0GB 3I6LD 1E6JL 2ERJB 4H0GA 2QSCL 1ZGLP 3MODL 5DJCB 5ICZB 1WISA 4XX1G 3W9DA 3RVUD 1U8IA 2X2YA 2NY3D 4HPOH 3G04A 3MA7B 4W70A 4H88L 4H25A 1JWUB 3GMLA 3NZ8A 4YEFA 1GOFA 5HVGB 4RIRA 5C0FA 2NNAA 1IAII 4U6TA 1HWGB 4E41E 3FAWA 4MVBD 5C7XH 2XQYK 4P2QD 4FQQA 3MJ9A 4M4PA 3RZCD 2GCYA 1QZ1A 4R7NA 4U2ZA 5DHVH 3S96B 1Q0YH 2N4IA 3N9GL 2PYEA 4ZSOB 2NY4C 3C2AH 3DIFA 3MJ9L 4PJHB 4D0CA 2Z93A 4DJMA 4XT1C 3CCHA 4CAGA 3DV6A 5CSZA 1EAPB 5IOPB 3VRJB 3SDAD 3QDMA 4HBCH 4HC1A 1IAIM 4OCRH 3V5KB 1DLHA 4KRMB 3VGAB 3QDME 3PWLB 4GXUN 3BP4A 3FT4A 5GGRY 2ZSVA 2YEZB 3QUKA 5I15H 3RWIB 4HC1L 5F96L 4MQXC 3N0PB 1NFDF 4NKDB 4FFYL 4WCYL 1E0OB 5BOZG 3TIDB 1MI5B 2E8YA 4KJPC 4PLKC 1JZ2A 4M1GL 3UDWA 1ZOXA 1S9VB 4LAQH 2XWTA 1S5HB 1H3WM 5LG1A 1XCQA 3DXAD 1RV6X 4IIQA 5CSBA 3KPPB 4RCAA 3V4UL 2CK0H 4NJ9L 2ZP0T 5F1KC 3RDTC 1BD2D 4JPIB 4WEBL 4YXLL 1EDQA 1B0GA 2DI7A 1CK0H 2ESVA 3NBNA 2VDQL 4ALAH 2HH0L 2ESVE 5DJCA 4TNVK 5E8PB 3GJFA 5JTWA 2YD5A 2P5EB 4U3XA 5CP3A 3HLAB 5I16A 3MA7A 1TJGL 4J23A 3D2UA 1ZTXH 3KS0H 1IGFH 1BEYL 4BH8B 1LEKA 5JPNB 2NY4D 3VU2A 3U4BH 4XP5L 2ZCLH 5HHQB 4H20H 4LSSH 2IH1A 3U1SL 4R2GC 4Y5VC 4JZJC 5EN2B 4BUHA 4ZSOA 3GJEB 5CD3B 4PJHA 3IYLW 4LSUH 3C60B 5JUEL 1EAPA 5IOPA 1NUGA 1A6TB 1WQVT 3SHSA 1NGQH 4MQXD 2DMBA 4FS0A 1NCAL 1T04B 3WS6A 3PWLA 2KUTA 4KJPD 4PLKD 3O41B 2MCPH 3L3JB 3GMQB 4RGNE 3RWIA 1J0IA 2G9HA 1VFOA 4HJGA 4KZDL 3RNQB 4QTHA 3IFNL 4NKDA 3AU1B 4KDTA 4RQQB 1I9JL 5EB9A 1T1ZA 4EDXB 4NHUE 3TIDA 1MI5A 2Q86A 3RDTD 5JHLL 1P69B 3SDXF 4JVPA 4OF6A 4ZAKA 3VFPB 3Q1SL 1GHFL 3JWNC 5HXMA 3KPPA 4MLSA 4LHQB 3FB6B 4JPIA 2ZCKH 4JKMA 3O8XA 3EYQC 1XGRA 1ZE3C 3IU4H 5BRZD 5EOCL 3O3BB 4PJDF 1MNUH 1YY8A 1A5FH 2ARJQ 3U82B 5E94B 1OLLA 3CLEL 4PJXB 3SKOB 3HLAA 3JWDL 2AAVA 4R2GD 3ZYJA 4GG6E 2YXMA 5M94B 1UM6H 3OPZH 4BH8A 5JPNA 3MRDB 4HHAB 5DD0L 5CLTA 5FM5M 5LAXB 2YC1B 4S1QH 5D7KD 5HGBA 1KYOK 1WGOA 3HS0B 4Y19D 5ITBH 3MV8E 3MRLB 1INDH 4W4OC 3ARUA 5EBWB 5JW3L 1YNLL 2LE9A 2JB5L 4WTZG 4F58H 5EN2A 3OWEA 2HWZH 4C59B 3LSOB 4CGTA 4OZIF 3GJEA 4TVPE 4IBLT 4LHUG 4KKNA 5HYJD 4OCSH 2VZTA 4TVPL 2M2DA 3L3KB 3RTQC 3SE8H 1SJXA 4WWKB 3IDUA 1A6TA 1RIHH 2R9HC 1HDMB 1TNNA 1CLOH 1T04A 5EWIH 1ITCA 3L3JA 4PJAB 3VFOB 4MXWL 2UZXB 2KBGA 5DUMH 3VCLA 3O81A 3KLAB 1ORSB 1OSPH 3RNQA 1MJ8L 3AU1A 4G8FA 3CUPB