5BRZA

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
275
structure length
275
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5brzA01
2PYEA 2A38A 5L2KE 5EORL 1BLNB 2X89D 1RIHL 4PJGA 1FAIL 4F3FA 2AK4E 1MHCA 1JCKA 4KI5F 3L6FB 1DBMH 3QUZD 4M1CC 2C1PA 4HIEB 4TSCL 4LKXB 5KSBA 2EDQA 2GJ6A 3AMLA 5IVXE 3VFOB 2GEEA 3CC5A 1NAML 4LGRB 5ANME 5BOPA 4WI6A 4M5YL 1XR9A 5JR1H 5DQJA 2PKDA 2XZQH 3KPOB 4G9FA 4HIJB 1FC1A 3STLB 4ZTPH 3RVUC 4X4ZA 5TPWL 4XH2B 4PJ5B 1GC1L 1QFWL 4PRID 5DJ8A 2GAZA 2F5BH 2A0LD 3HE7D 3MGOA 4OF3A 4DFHA 1RURH 1DBAL 4HHAA 1L4IA 4R90H 3NN8B 1I7TB 3UCRA 4XP9L 4G8IB 1EAPA 4BELD 5DRWB 1K2DA 1KIPB 4K3JH 3BP4A 3ARSA 3DVNB 9CGTA 3TFKD 2EE2A 3EYOA 3CLEH 1HQRB 2AV1A 3V7AE 3PWUA 2VLLB 3EBAA 2VDNH 2WW8A 4DKDC 5BS0A 2VIRB 1YDPB 1TZHB 2QSTA 1FFPB 4XPAL 1YEIH 1CFSB 5L88H 3ARED 4UT7L 5D7LD 3TO4A 2CDFA 1FJ1A 5C2BL 4OLYL 3HRPA 2VL5A 4PRDB 5BZWA 5FYKD 2BC4A 3NIGE 4PJDF 4XTRD 5JOFA 1A14H 1OTUD 3KPMB 4UT9H 2Y06L 2WY3A 4WTZG 1E6JH 1Z3GH 3IVKB 2HJLA 1T7ZA 4NQDE 1P2CB 3HMWH 2AABH 5IQ9A 4EUPB 1T7WA 4F7PB 3VXMB 1PGRB 3QWRA 1M6OA 1TJHH 1WBYA 4HKXB 4LPCA 4LSPL 3ZSSA 1KPRA 4G42B 1NPUA 2EDEA 3SCMC 1AKJB 4O4YL 5LQBL 2IWGA 4TULL 5LAXB 1U8HB 1XT5A 3GMRA 4LBEA 4X6CA 5D96C 1REIA 5HGHA 4U6HB 4LLMB 4I1NB 5T3ZD 1GJIA 2FL5B 4P4KB 4MQXD 2WIIA 1A6TA 2BY3A 4XCNA 4MWFA 4X7TB 4PY7A 3C5JA 4YPGA 2Q7NA 3MRJB 2FEEL 4KUCD 4ELKA 4HC1H 5DA0B 3QEQE 2VXVL 1L7IH 4BFBD 4WV1C 5E4EB 5F88B 2Q8AH 5CKGA 3HS0A 3G5VA 3TCLA 2E6QA 3D9AH 3UBXI 5CIPB 4LLWA 4TNVK 4GSDL 3OKDB 3O2VL 4L3AA 2HMID 3VFTB 1WEJH 1I3RA 1M7IA 4M6OH 4LCWD 3V7AG 1FCCA 1T21B 3S36X 3OHXB 5K9QG 1JPFB 2ZJSL 4LQ1A 2H32B 3GJEA 3TN0D 4D2NA 1C5BH 1JWMA 1IGCH 4MCZA 4PP2B 4QXUL 5D2LA 1GGIL 3BMVA 1TVHA 1GAFH 5K59E 3RVTD 3RKDD 5ALBH 3TO4C 3QCVL 4X6EA 2F53B 4AEHL 2GFBA 3QB7C 4PJXB 1LD9B 1P9MA 1Q38A 3U2SB 4OZFG 4MNHB 4BFGA 4PJ9D 1C5DA 4XCEA 4I5BB 1MF2L 1A64A 3T1FB 1LWRA 2C5DC 2CD0A 35C8H 1F11A 3LN5A 4X99B 2CXKA 4C56B 1FGVL 4P3WA 4XXCA 3RNKA 3TYFA 4YHIB 2L7JA 3HAEB 4OGAD 1QPXA 4YNYA 1BVKA 5J1TC 5F6HI 2WBJD 3RWHA 3IT8D 1WLHA 3FZUC 3HUJB 3IXTB 5FGBA 1DQTA 1RUML 1PLGH 4MX7B 5DUML 3WHE1 5EA0H 3P2TA 2ITCA 2EO9A 2XZAH 3C5ZA 3X13B 1EAJA 4XBEH 1OCWL 3V9FA 5I1EH 4JO4H 1MI5A 1RZKH 5EFIB 2ADGB 2YPLE 3FTGB 1LEIA 4UIMB 1NLDL 3DX7A 2Q7YB 4JG0L 3P77B 5I0DA 1G7MB 3LS4L 5EOQL 4KI5C 2DQUH 1U0QA 5HD8D 5ISZB 2NY6B 5L6YL 1H3WM 1BWWA 2OP4L 5KOMC 5JDSA 2HH0L 1V7ML 4R96A 4BZ2L 2VDOH 1I1AC 2A6KB 1II4E 5GSRA 2HFFB 2X1OA 1PAMA 2LVCA 3WIHA 3IDXL 4XP6H 4HWBH 5IB4B 1MIEH 1A6PA 1KPVB 4JO3L 1Z0MA 3FQWB 4HPOL 4ZD3L 3AXLB 2V7HB 4RAUB 5IJKC 2R69L 1AHWA 4LLQA 4JY6A 4QXTB 3GSQB 1FNSL 7FABL 4YC2B 5J12C 1I1FB 1FVEA 3BKML 3UZVB 3C8KA 1T1WB 3NCJH 5ILTL 3BX7C 3VMPA 3FN3A 3W9DB 4QRRE 2YPKA 3MRDA 4HDIB 4N8VG 2Y7QB 3RY4A 3UTZB 1XCTB 3X3GH 1CXFA 2D4DA 3OXSB 3GSWB 3L3KA 4DKFH 3TP4A 2NTFA 3DMMB 1ZE3C 1C1EH 4XXCC 3FT4A 1HHJB 2DQHL 3F7VA 5DJCA 4JO2H 1O7SA 2YD2A 5J1SC 3X11A 4Z8FH 4RISL 1YMHA 4XB8A 3OR6B 3J7HA 3LHPH 5FGBC 3NPZB 2VDKL 3E6FB 1FZJA 2HTLD 3D69B 4OZHB 4HWEH 3T77A 5FM4A 1ZT1B 3S5LA 2MFNA 3MRLA 1UWGL 1AD9A 3FFCB 4L3EB 3C5ZC 3ZTNL 5FB8B 3U4BL 3RL2A 4OAWB 1WFOA 1YEKH 3BESR 2R2HA 1C5CH 4RRPA 5DZNA 1VACB 4S1DC 5JW4R 3L5XL 2A9NH 1MLCB 3UTTE 3VH8G 1CVSC 4OD2A 4YXHL 1T7YA 4K2UH 1YMME 4HIXL 4QGTA 4QRPD 5FOBA 5TQ0H 3V4PL 3PWJA 4BQ9A 1SBSH 1T0NB 2Z31B 3GNML 3H3BC 3G6JB 5JHLL 1CICD 3MUGA 3IGAA 4P9MH 1AFVH 4PRPA 2W0LA 1LP9E 2VLRD 3L3HA 5T1DL 4LAQL 3NCMA 3CH8A 2AI0L 3MCLH 1AI1L 3SDDD 5A40E 3MRBB 1HSAB 4UINH 4M43H 2PTTB 1FG2A 1IC7H 1NBYB 3FB5B 1KCUL 4Y19A 1IBGH 4MD0B 3WXWL 1QFUH 3ILPA 3QDGE 4TUKL 1F8TH 2XPGA 2I24N 5DVNA 1R3IH 4PP1D 4PRAB 3TF7A 1BFOB 1F6FB 2GITA 1Q9WB 1E4WL 2NY1C 2BSRB 3KPRB 1ZT7A 3FONB 1I7UA 4MXVF 1CE1L 2MPAH 4M9PA 3M07A 1JUFB 3LIZL 5I8OH 3B9DA 2I9LA 1DANU 3MRIB 5DGRA 3RUGF 1JGEA 1HOCB 5DZOA 3K8LA 3DHJA 2FJHA 2APXA 4BK4A 4PJ8D 1KB5B 4DQOH 4B53A 1NCBL 5C70A 5EC2A 2H26A 5HGAA 4EI5A 2XRAH 3EFDH 1CVRA 2MQ3A 3QPQD 1D5IL 3BJLA 1N7ML 4UDTA 5I8EA 2ED8A 1NQBA 4GRMA 4L3CA 1KPUB 3WFHA 4XNQB 2CIKB 4U05A 1QBAA 1T4KB 2VR5A 4Z7UB 3QH3A 3SGDH 2H2SC 5L2JA 1DL7H 3QUZB 4U4BA 2V2WA 5JXED 3LKNB 3QQ4A 3IKCB 4L4TD 5D7IA 4E41D 4U1GC 5GJSH 1KB5L 3P11H 5DD6B 2R23B 1U8OB 3HCVA 1H5BA 4HIHA 2OMNA 5FKPB 1AQKH 1EHXA 4IDJL 2V7NA 1JNHB 1TITA 4OLXH 2BNRE 3A67L 4NWUH 5DURD 3F7QA 5IESH 5D1ZD 1CFBA 3ZKNC 1HWHB 2GJZA 4ZFGH 3HPLB 4ZYKA 4KMTH 3HE7B 1FFRA 5JMOC 2D03L 2APWA 3ULVH 5L0QC 4NO0D 3N1QC 3T08A 5D70H 3FFDA 3RVXC 4OFKA 2Q3AA 1BJMA 2EEAA 3EOAA 3TF7C 4FOMA 5KS9E 4NKOB 2QV2A 1IAKA 3MYZA 4P9HH 5F3HA 3ZO0A 4X7DC 1Q72L 4NNYA 3WUWG 3Q6GH 5IFJB 1HH6B 4FN0A 5JUEH 1MCQA 3VXQB 3AREB 4XWGL 5D7LB 5IBTL 1MFCH 5LWYL 1DN2A 5E2VH 1M1SA 5F7FA 3R06A 2OYPA 4YGVB 2DQJL 3MX0A 3MRQB 3PWNA 2VN7A 2X4QB 3L7FA 4XRCA 4EUPG 1H3UA 3MRHB 4JFEA 2R29H 2VWEC 3TJHA 5CJOL 4N9OB 4QTHA 1ZA6A 1NGQH 4JKPL 4R6UA 4Z7NE 2GCYB 4NOBA 3VXPA 1DLHB 4C56E 5FOJA 1IEBB 3FQRA 3RUGA 1S5HB 4E5XB 4Y16A 4KJQD 4DJMA 5AZ2L 3V4UL 1BMGA 4JZNA 4JO1L 4QRUA 5FYKL 5BO1L 3ZT6A 2J5LB 4EXPX 4IOIA 3ULUD 2WINB 4C4KT 3HUJE 5EZIL 3W0WB 1NC4D 1RULL 4S0TD 4MYWB 1H5BC 4U1LA 3SHSA 4QF1B 1G7LA 3RGVD 2DAVA 3SGEH 5C0BB 3QFJD 3NA9H 4YBQC 3GUTB 1ZA3B 2ZOLB 3MREB 1WCBB 2DQGH 2B0SH 4CN4A 4FNLL 4HXBL 3U0PA 3JV4B 4A2LA 4O9HH 4E42A 1RHHA 4PJ7E 5HPMB 4PJBB 3MLWL 1DP0A 4KVCH 1G7IB 3WJLA 2QHLA 4LCWB 5T3ZL 4TRPL 4D0CB 1UQSA 1UH3A 1IAMA 3O3BB 4QRRD 3LV3B 4P23A 3W5NA 1KJ3H 1EEYA 5K9OB 4Y5VA 4O2CA 2UWEB 3TN0B 3TWCH 3V0VB 5E70A 4HIIB 1HDMA 1LO2H 2G9HB 3D39D 2C1OB 5GGQH 1QVOB 1QLFA 4I77H 1JK8B 4N1CA 3U4EA 2CRZA 4P5MB 3NH7H 1PG7H 4I0PD 2YK1L 3FT3A 4GMTL 3QRFM 4XCFL 5DJ6B 1VFBA 2VDQH 4MAYA 2VXSH 1G6RA 1U8KB 2P5WA 3W11D 3TBVA 1CDCA 3HE6D 5FM5O 4KJYA 2P5EB 3QXTA 5E7BA 4O00A 1C08B 5TGBB 3QG6B 4U1JA 4ZXBD 1L9MA 4JZOA 3O6LL 3WHE0 1P4LB 1YEDB 4Y16C 3PDGA 1XEDA 2G2RA 4R7DA 4PBWD 4AK1A 1OOAA 1NDGA 5KAQF 4RX4D 1ZKAA 3AB0C 3MBEB 5GS2H 3QR2A 3QUMA 3ZE0F 1CK0H 4RAVB 1RZFH 3WKNA 1BD2D 2YD5A 4G9DA 4PJCF 5CEZD 4ZDHA 4ZFFB 5CEXA 2ZCLH 3TPUB 1O7VA 4MAUL 4CVUA 2FJGA 1VCAA 4Y4FA 5I0ZA 4L3EE 1AGFB 5ADPH 4FQ2L 1JF1B 3GMMB 3QIUD 1IE5A 1JFMA 2VSDA 5HVGB 3BN3B 1XGQB 1VPOL 4BSVB 4KZEH 2GTZA 2IAMD 1CLZL 3EYQD 1OF2A 5IR1A 3WJLC 3UTSD 3UTPE 2X41A 2ERJC 4J4PA 2OQJB 5FYLE 3AUVA 3BYTA 4M7JL 4Y5VC 5I71C 4NQCA 5HYIA 4U0RC 5T1LD 3WO4B 1QEWA 2HVKB 1CD0A 3GDBA 3PL6C 5GS1A 1YN7B 2VZ1A 1VFUA 2CLZB 2FX9L 2HN7B 2P24B 3DRTA 4QT5A 1BIIB 3QFDB 2YKLH 2X9WA 3O81A 3T8XB 4IRZL 4LDEB 4NHCH 3HB3C 5MENE 4MAYC 1JBJA 2X70B 3I6KA 2BJMH 1F4YH 3MLZL 3FRUA 4OTXL 2ZSVB 2HLFC 4EQ2A 2XA3A 5EU5A 1WBXB 4DKAA 3OR7B 3MV8D 3CMGA 1CGSL 3V6FA 2IEPA 4JKWA 2YC1A 2EC8A 2XQYK 5D7KE 3SY0A 2DI8A 2W0FB 4M7KL 5KVEH 5JO5A 2A6DB 1QBLL 1HYSC 2F54D 4Q9BA 2OL3A 1RVFH 4NDMB 1E4XL 1GPOL 4MD5B 2DQCL 1BQHA 1WAAF 4Y2DD 1S7XB 5FO9A 2CUHA 5D7JD 5IMMB 4MA8H 1CFTB 3QXAB 4Z78B 5LXGH 2P46B 1A7RH 2VAAB 4X4ME 4Z7WE 2R2EB 4YGAB 4NN5B 5C7XL 5F1NB 3I02A 4G5ZH 1OWWA 2IANB 4WI8A 2J8OA 5C92A 1KJ2L 3DO7B 4NIKB 5TE6H 4CU8A 5GRUL 1F90L 2ZKHL 4OKDA 2JELH 1AO7E 4F7TB 1G9ML 4QRPB 5KSVA 2RB8A 1EGJH 1YN6B 4N5ED 1XIWA 4FQPA 2DQDL 4HMDA 4J4PC 4P4RA 4JGMA 2Y6SC 4JN2B 4WCYH 3SGDI 2K9UA 3SQBA 4LSSL 4RGND 1W0YT 1YEGH 2DBJA 2VLRB 5IOPA 1A2YA 1ES0A 3VFSA 3TO2B 1WF5A 3LVEA 5IB1B 4XVUC 1A9EB 4YXKL 1U8PB 3SDDB 5GS1C 3RJQB 5B8CB 1KCGC 4PJFB 1KCKA 3BN9C 1QOKA 3UJJH 4OZIE 1EVUA 2VRAA 3CFKB 5E95B 2XTJD 4L1HA 1GGCH 4ONHB 4RFEA 2RIKA 1S7SB 4NKDB 5IFAL 4KKNA 5E9DE 1A9BA 5KG9A 2B20A 5J7CC 1LO3H 2IALB 3N06B 3MLUL 1AD0B 1S9WA 2IPKB 5EORH 4NQXA 3S37X 1LQVA 1RIHH 1FAIH 2WQ8A 2YN5A 3MXWL 4H1LA 3BHBA 1ONQA 2QLVB 4X6BB 4GW5A 5HHPB 2IPUK 4FTVA 2X2YA 3KLHC 2VQTA 2P8LB 4TSCH 3HC3L 5FK9B 4G8GA 4JRYA 4NHUE 3PHQB 3WFBL 1NAMH 1QTYT 1FVDA 2BVEA 3SPVB 3NFPA 1PYWB 3NACL 4M5YH 4Z7VF 4ORZC 3EJZD 1OAYL 2V17L 1WK0A 5HYJD 4HH8A 4PJ8B 3P73B 3IF1A 4RA0C 4D3CL 5TPWH 2EYTB 1GC1H 1QFWH 4HUUA 1UB6A 4YDVA 4AEIL 1T0MB 3M8OL 5F8RC 5DDHB 1U8NA 1DBAH 2VLKE 2XICA 4JZJB 4P57B 1QO3A 5HDBF 1UCTA 4ZSOB 4YHYC 3CSGA 4ETQA 1TNNA 2I25N 2ZUXA 4J8RA 2BY0A 2ZUQC 1J8HA 4XP9H 1RFDL 1YNLL 5CS7A 1BQLL 2GYSA 5C07A 1JIBA 4KJWD 3P3YA 4KVNL 4Z76B 2ZUUA 4R3SA 3RX5A 2KPNA 3HR5A 3MNZB 4K71C 1XIWC 4M62H 4J3UA 4L4TB 3VWJD 4E41B 2FWOA 4XPAH 2BNQD 4MVBD 3QWQB 1TCRB 1FSKB 4BUHA 4UT6L 3W0WE 4OLYH 1IKFL 4IHOA 4HKZA 1Q9LB 2NYYC 5DURB 2R0ZL 2A73A 3QYCA 4J23A 4PV8A 4ORGA 1G7JA 2NY7L 5CP3H 5D1ZB 1N8ZB 1F5WA 2QSCL 1SQ2N 2Y06H 1D7FA 3B3IB 5DRXA 1IGYA 4NPYB 1NCUA 2FBJL 5DJXB 1YUHB 4CDHA 4NO0B 1UEMA 4DN3L 3SGEI 2FIKA 4LLDA 4LSPH 3VXTA 2IADA 4PJBE 2QQQA 5GGRB 5DC4B 5T5FL 4O4YH 4N9GA 5LQBH 2Z35A 3RWEA 4TULH 1PKOA 1CR9L 5JOPD 1A7NL 5GXBB 1GZPA 1WWCA 3B6SA 2Z92B 2UWEE 2H45A 5SWSA 3ZHKA 5F1SA 1Y6MR 4G8FB 1EEZA 3RZCD 3ESVF 3TBYB 2NW3A 4Z7QF 1I9JL 4MDJB 3SGJA 5K9KB 3OJ2C 3I50L 4JHAL 4OT1L 4A6YB 4GS7C 1TTUA 4I9WE 2Z91B 4K7PX 2ZUVA 5EO9A 2VXVH 2VE6A 1G7HA 4D0BB 4WNQB 2N7AA 3BP6A 4GRLA 4PRHD 1CCZA 2H2PC 1H3PL 1IGIL 4GSDH 4LHQB 2D4FA 1R5IB 3O2VH 4PGDA 4OBRA 1FZMB 1HEZA 1B88A 4S1SL 1MFDL 4I3GA 1IARB 5DRNB 3MRRB 3QNZA 2XWBA 1H8NA 4PTTB 3F5WB 2CMRL 4GRWE 4OM0L 4K7PY 1Y0LB 2ZJSH 1MWAA 4BFIB 3BIAX 4EVNA 5FCSH 2D7QA 2HT2C 1A3QA 1WWAX 1SJVA 1MHHA 4A6YL 2EKSB 3O41B 1T20A 2AKRA 2XN9D 4P5TA 3O4OC 2OK0L 1MJ7L 4QXUH 1NC4B 3P30L 1GGIH 3P9MB 1EK3A 4QOKA 5D5ME 1ZT4A 5HI3D 3QCVH 4AEHH 4L8SA 4X6FB 1ZS8A 2R4RL 3RGVB 2I60L 2ILLA 2YR3A 4X6DF 1CDJA 5CIPH 3QFJB 3O3AA 3QQ3A 5SV4A 1MF2H 1QYGL 15C8L 1MREL 2Q87A 1MVUB 1EO7A 1RJLB 1T2XA 8CGTA 5DO2D 4DCQB 3H9ZA 1ITBB 3H9HA 3QIBD 1RY7B 1FGVH 2H32H 3ARRA 4M6ML 3ULUL 1MRCL 4GKZB 1JPST 5JW5B 4NBYB 5T1MB 1DEEB 5GQBA 4UTAL 1UZ8B 3GMLB 3WNLA 4NT6A 1LEGA 5JPMB 5TDPB 3PNWA 5I74B 1WC7A 1RUMH 4MS8D 4XCYB 1NKRA 3KXFE 3DYPA 1CGVA 4X5XB 5T1KD 5DUMH 3TBSA 3INUL 3GKZA 3EDJA 1XGTA 3SKNA 4X8XA 3BQUA 4G6AC 4NUGL 2WLYA 2H3NA 4NC2B 2XWJB 4I0PB 4R4FL 1OCWH 1Y6NR 1FAKT 4M7ZB 1S78D 1NLDH 4P99A 2ARWA 4JG0H 3I75A 3LS4H 5EOQH 2X1PA 1CQKA 5L6YH 1HHHA 4ZXBB 4MB5A 1QRKA 4N0YL 1BZ7A 4UI2A 2OP4H 5CP3A 3SDXB 5HHQB 3FCTB 3RWDB 2HH0H 1V7MH 4BZ2H 1QSFE 3OJDA 5BRZD 3IDXH 4R9HA 1NEZB 4WFGD 1HHKA 4JO3H 2V6HA 4ZD3H 5E8PA 4LEXH 1X5HA 2R69H 1BD2B 3ARUA 3QG7L 4PR5A 2OSLA 3RDTD 3SBWA 1S8DA 5F7EL 3ARFD 1BP3B 4GKSA 1FNSH 4JFFA 1KIQB 3X17A 7FABH 1WIOA 3FT2B 3IU3B 4UB0L 5CCKL 3BKMH 1MUJA 5ILTH 4JLRB 3QIUB 2EIBA 2IANE 5EIIA 1Z9SA 3FB7A 1FL6A 1KN2L 1EFXD 5IF0A 1NCTA 4Z95L 1S9YB 4OQTA 2QBWA 4NZUL 2IAMB 4IIQB 3BFOA 3S3PA 1T89A 3QJFA 4QEGA 4PJIB 1OAKL 3LOWA 2DQHH 1UM5L 1VB9A 3UTSB 1M71A 3RAJL 5EO0B 2AW2A 5F6IC 4XMPL 4NYLB 4RISH 1U2HA 5CEZL 3G9AB 1KNOA 3MA7B 5C0GA 4ZAKA 4HK0B 2BERA 2A77L 4MB3A 2VXUL 2VDKH 1AIFA 5JW4N 3HLAA 2VLJE 4X6DA 3QDHA 5T1LB 4XNYL 1SYSA 3AU1A 1A7OH 3Q0HA 1AGCB 1QLRA 1G0DA 3F12B 2FECL 1UWGH 3BD3A 4JPKL 5AG9A 5TE7L 2YUVA 3QDAA 3LSOA 3ZTNH 3U4BH 2XACC 3OAYK 3WS6A 1ZLSL 1WWBX 4OZGF 3QIWD 4NQEE 3PQYE 3WJJC 3L5XH 2VABA 2I9TB 5C09E 5DVMA 3VFGL 2F8VA 3CPLA 3TBWB 3LPWA 4YXHH 1MELA 4OGXL 4HIXH 3DHMA 1TQCC 3MV8B 4XP5L 2GSIB 1JF6A 3B5HA 3V4PH 4JFHE 2R0KL 4WFHE 2I07B 3OKEA 3QWOA 3DV6A 4LCIL 3GNMH 2F54B 3DUSA 1CXLA 4MXWL 5JHLH 1NLBL 2BFVL 3AGVA 3GJFH 4Y2DB 4TVPE 1GHFL 1UXSA 5T1DH 2AJUL 4LAQH 5E5MA 2AI0H 3UPRB 5F7DB 1AI1H 4JREC 2DWEA 5C0CE 2V5MA 4YR6A 3ZMRA 1MCHA 4WJ5A 4LSUL 4RMQA 5DK0B 4EZMA 1A6WL 1H0DA 1YC8A 2Z93B 1KCUH 43CAB 2LU7A 3GBNL 2WAHA 4LVHB 3WXWH 1G6VK 3BP7B 3FQTB 2X40A 3C09B 1QFWI 4M1CD 4AENA 1ROWA 4TUKH 1VADA 1EERB 1HXYB 3ZE1F 1Z6JT 2HKFL 1U3HB 4MXQA 3SDAB 1E4WH 1T89C 5I66B 2AERT 1Z0NA 4TTDD 1KULA 1CE1H 1VFMA 2J8UA 4M61B 3DXAA 1QHOA 3RVUD 4HCRL 1U92A 4OCRL 4ZAKC 3MLVH 4F7CA 4RGNB 2X4NA 5I16B 4G7YL 4HJ0C 4WHTA 3MFFA 3MGTA 4NSKA 2WK2A 3IDIB 2HT4C 3JBG7 3RWCB 5I1IL 3MA9L 4XNUL 4NO3B 1NCBH 5IM7B 5FECA 1R24A 4ZO8A 2B8OT 2XTJB 1ZAGA 2X42A 1D5IH 1B2WL 1N7MH 4G43A 4DK3A 3NA4A 2VDLL 4P2CG 4Y4KC 5DXWA 1U8QB 5I1LB 1DQLL 1U8IB 2H6PA 1INQB 3ARQA 2HFEB 1JWUB 3SEPA 5H2BB 2ICWA 2IJ0C 3I3EA 2EICA 4HF5L 4XBGB 3SJVD 1MOEA 4X9BA 4GG6B 1LK2A 3D18B 4RQQA 2O5YL 1KB5H 3QXDA 4YDKL 1QLEL 3O6FA 1LDPL 5I76B 3MBXL 3U30B 5A2KH 2ATKA 2F5AH 2X4PA 4IDJH 4DEPB 5HYJB 3BZDA 3BAEL 3MJ9A 4OZGA 5IB5B 5CD3A 3A67H 3Q5YA 2CH8A 5EZOH 4YIQA 2UYLB 2PYED 1QSEB 5EPMA 3VFNB 2YN3A 2D03H 1JZ4A 2FEEI 3LRGA 4Z7OE 1X4YA 4XXDA 4IS6A 3V5HA 4LEOB 3KPPB 3OKMB 2RJMA 2GJ6D 3U9UA 3L7EA 2OMBA 3KDMA 3OGCA 5CSBA 1MCCA 4LPYA 5DHVA 4ZQKA 4HULB 3P0VL 2C7UB 4L4VA 3VWJB 1T5WB 4G9FD 3CFJB 1Q72H 5J4MA 4KQ3L 4GUPB 1N5AA 4AYFA 5GRVK 3GSNB 4Y4HA 4H5SA 3BJ91 1XF5A 4XWGH 4NP4L 1N0LA 3ARXA 1T1YA 5IBTH 2FO4B 3MV9A 5LWYH 5IK3B 1BJ8A 3CVHA 2DQJH 3CDFA 4PPTA 4GFTB 3BMWA 3O9WC 1TZIA 2VR9A 5EUKB 1NFKA 3CXHJ 4OV5B 4WU7B 5FGSA 2XOTA 1I7ZB 4QHMB 3UO1L 5GGUA 5CJOH 4KV5E 5E8OB 4YJZL 4NO5B 4JKPH 3X12A 4PJAE 3MRNA 1RIVL 3OGOE 4RGOL 1LHZA 3GSNL 5L8JB 1DVFA 2BRRL 1SBBA 5M95B 1PZ5B 3ZYZA 5AZ2H 3V4UH 3IFOB 3TO4D 4JO1H 4QWWD 5FYKH 5BO1H 2F9BT 5KW9L 3ZDZE 5HJ3A 1HNFA 4XB7A 4MHHI 3THML 4F2MA 3VD4A 4TNWK 3M1BA 3GRWH 5EZIH 3WV0A 1RULH 4YDJA 3RZCB 3DROB 5DEGB 5HHOE 1IGJB 2V2TB 4P2RB 2VQUA 2K3TA 2FEDC 1JYNA 4DZBA 3QWRD 5D1QA 2AJXL 5GRWA 3EYSL 5DEZA 5JPNB 3IFPB 1RUKL 4PJHB 1MCNA 4UNTA 4ODWB 4HXBH 1NUFA 5IB3A 3KS0J 4JFDA 4PRHB 3ROOB 4FQIL 3FZUD 2VLMD 1I7RB 2XYCA 3MLWH 1SEQH 5AYUL 3ZHLA 5CLTA 5EC1A 1T5XA 5T3ZH 4TRPH 4JAMA 1X5XA 5I17A 5ECJE 5FV2A 1FHGA 2PYFB 5IHZA 5EG6C 2QEJA 1MHEB 2XN9B 4QHUA 4OD3L 2O5XL 5CBEA 4Y4HC 3NTCL 2G60L 5JXAL 1GGBL 2BNUA 3Q5TA 4KI5D 5D7IE 2YK1H 4GMTH 4XCFH 1PG7W 1W72B 2MWCA 4O51A 3FO9B 2A2QT 3E1F1 4NBXB 4JEGB 4WUUA 2V5YA 1D5MA 4D0DA 5SWZE 1WJ3A 3KPNB 2HG5B 4WWID 1KT2B 4LQFL 3ILQC 3C6LA 1P7QA 1IKNC 1XF2B 2A6JB 5DS8A 3O6LH 4KUCF 5EU3A 3T4AA 3BIBX 1HCFX 5K9JL 1DVFC 2YBRA 4WTWA 3MRPB 4U6TA 3RZWA 5EU6A 4F57L 1RJZA 3G04A 4ODXA 5C0ND 4K9EL 5T1KB 1FO0L 1RMFL 2KQMA 4AM0A 5HHXL 5DMKA 1LNUA 1S7RB 1W72L 4NQSA 1QSZA 5IVOA 3WDJA 1JPTL 4MAUH 3MRFB 4RA3A 2D9QB 2DYPA 1OW0C 2CK0L 5D1QC 4FQ2H 3OKNB 2R2BB 5L8LB 5I2IB 1IFHL 1AQDB 1NCAL 1I85A 4J1UB 2IH3B 1MCLA 1S7VA 4P48A 1VPOH 1R3HB 4Y5XB 1CLZH 4L8DB 2OI9B 3MOQA 1SMAA 3GSOB 1X7QB 4YFEA 4Y5YA 5EZLA 4JFXA 5I1HL 5BRZB 2YD6A 4M7JH 1DDHB 4ZUUA 3D1MC 3C5ZD 1MCOL 2MOVA 1MCBA 3UPCA 1MI5D 1BGXL 3DUUA 3RDTB 4NFCA 5I1AB 5CJXA 1OM3L 4S1DD 3ARFB 3K46A 4WO4A 1T1XB 4HGKC 5E94A 2ARJB 4I8DA 2FX9H 3ZSTA 1JNJA 1B4RA 5MI0B 2EE3A 4EDXB 3BDXA 4G8EB 2NNAB 5ESVB 3L3OB 1Q94B 4IRZH 3V95A 4XPBL 2M1KA 1EFXB 4QY8A 3GRWA 4JFPA 5FDWB 3CVIL 3HZKB 5HYQA 4BSJA 4OTXH 5C3TA 3VJ6B 3MPCA 4PRBA 1W8OA 4QYOB 4OI8A 2WLZA 1CGSH 1UKTA 12E8L 5MP6H 4FZEH 4M7KH 1K8DB 1QBLH 4Y1AA 2ZOKA 1E4XH 1GPOH 5HYFA 1H3VA 2DQCH 1DE4A 2MQ0A 1CFVL 1QD0A 5MEPB 1KJVB 3BZ4B 5ICXB 4POZD 3GMOB 3PGCA 4JKLA 3H3KA 4Q7DA 4Y8AA 4RGMC 3RX7A 4ZFZA 4U1IB 5C7XH 3CUPA 2PO6C 2KZ1B 2Y9RT 1S9XA 4JFOA 4WI2A 1KJ2H 2YEZB 5LCVH 5TF0A 2NY1D 4PJEE 3QIWB 3ZDYF 2GQHA 4ZUVA 1PY9A 4IRSB 5GRUH 1F90H 3PJSB 2ZKHH 3V5KB 1I8MA 3PDDA 1G9MH 3O6ML 5I75C 2DOCA 4ODHL 2SEBA 2XKUA 4MSWA 3VRJB 4PB0L 2IBZX 4Y5YC 1TMCB 2DQDH 4G6MH 4G7VL 3BWUC 4GMSL 4LHUA 4CAGA 3CFBB 4LSSH 4FXKA 3G5YA 2C9AA 3QCUL 3DV4A 2PW2B 2Z9TA 4YXKH 4HX1B 3P9LB 5CP7A 4M1GL 3Q6FA 2IBZY 4DUVA 4Z0XA 3REWA 5CSGA 2DQIL 2H2SD 5IFAH 1SJHB 1QSEE 3N1GC 4J3SA 4UOW0 2LE9A 1VA9A 3ZTJG 1QA9B 1OPGL 3LKSA 2EIDA 3MXVL 5AZEL 5HGDA 2FYYB 3MLUH 1JMXA 5GRZA 3ROLA 3E8UL 3JWOC 5M94B 1NFDB 5IVXF 4AT6B 3MXWH 4LRIA 4O58L 4PRPD 1DQQA 3ZL4L 1A4JB 2P1YA 3F65A 3WFBH 4I2XB 4NZTL 5GRJL 3LN4B 5BZDA 4M02A 3ZKND 4BSWA 3NACH 2GY5A 5BVPL 4KJPC 1WQVT 4MB4A 3LEXA 2JCCE 5DD3L 4UAOB 2V17H 1OB1A 3GBLA 4Y19D 1MRDL 3ARVA 3MRGB 2JF1A 2NY2D 4D3CH 3ARBA 1CGWA 4HMCA 4N0RA 4RMUA 2EYSA 2EDDA 4XMKL 4AEIH 3M8OH 4JM2F 3JWNC 4OZFH 4MD4A 3T3ME 4PLNC 4JFYB 5J9PB 1MQKL 1T3FA 1RFDH 1YNLH 1BQLH 3MLPA 4I48A 3JWDC 4UUJB 4CUCA 1LQSR 2Q76A 3H2WA 3PV6B 4KVNH 3SJVB 5DQDL 4U1SB 2R0LH 2A9ML 3PWLB 2VC2L 4LOUC 4DGYL 1WT5C 3R0NA 4FFWC 4UT6H 2J6EL 5KOVC 3WLWC 1IKFH 4EI5D 5JORA 4QHLA 4P2RE 2R0ZH 2Q6WA 4CU7A 3FAWA 2NY7H 3QDJA 2ZG2A 5CMAB 2QSCH 3MQIA 4Q0XH 1OP3H 5MEQA 2FZ3B 2PYEB 1ULVA 5F9JA 1JZ2A 2E8YA 2FBJH 5H94A 1A3RL 4JRXA 1L9NA 4U1NA 4XGZA 4PJGB 3EOBA 4F3FB 4HK3N 3L5HA 5E7FA 4TTGA 2XWTA 1MLBA 4DN3H 1JGDA 5FUZL 5KSBB 3CC5B 3DURA 5T5FH 1XR9B 4LRIC 5DQJB 5F72S 4G9FB 1CR9H 4GJTB 1FFQA 3RU8L 1A7NH 3LEYL 5DFWH 3KJ6H 2HAZA 1OD9A 4D9QD 2A83A 4WTZA 4YBQD 2VUOA 5J13B 1CDHA 5DJ8B 1KGCE 2GAZB 3MGOB 4U3HA 1I9JH 1W0VA 4HHAB 2GUOA 4R2GC 4CMMB 4JHAH 3I50H 4OT1H 5L2KA 1QBML 1KJMB 2AK4A 2NY0C 4LVNC 3ARBC 4LMQI 1EAPB 5DYOA 4QHKI 3BP4B 4N0FA 1FC2D 2L4OA 4H88L 5IVXA 3CU1A 4B41A 5ANMA 4N0CA 4X0KA 3X14B 2AV1B 1H3PH 1IGIH 3PWUB 5BS0B 4JHWL 3FMGL 2FHFA 4S1SH 5JIPA 1MFDH 1F6AB 3JVGC 2CDFB 1FJ1B 2CMRH 4OM0H 2VL5B 5BZWB 1KBGL 4P2YA 5JOFB 3ARWA 4A6YH 1TQBC 4MCYB 2OK0H 4K8RC 1C7TA 3WDHA 1MJ7H 3P30H 4URTB 2HJLB 3VFRA 4JM2A 2WBWB 4JFED 5IQ9B 1OT2A 1WZKA 2R4RH 3B8YA 2I60H 3AS2A 2B39A 4G8GE 5C71A 1WBYB 1KPRB 3FAXA 3ULVC 1R3JA 3LEVL 1QYGH 1MREH 1WZ1L 4Y16D 1NMCB 5F6HJ 5B3JF 3GMRB 4LBEB 1S7WA 2WV3A 3ME0A 4M4RA 4X6CB 4M6MH 5HGHB 5KSUA 3ULUH 2E7LE 1MRCH 4OFIA 3BEVA 3ZZ1A 1UKQA 5A2FA 3I85A 5IW1A 3EYFB 3LH2L 4P9HC 3VXSA 1X6NA 3FRPG 5I8CA 2WIIB 1A6TB 4N90D 5BCAA 4UTAH 1NMAL 1I3GL 4XCNB 4GLRH 3F7PC 4PY7B 3C5JB 4YPGB 1JWSA 5JW4Q 1YY9C 4NQDA 4OZFA 2WQRA 4X8JB 4YHML 2WWKT 2GKIA 5C07E 3INUH 4GXUM 1AGDA 5I73C 4NUGH 3HS0B 3G5VB 4R4FH 4R4NC 3TCLB 3V5DA 3ULUF 1Z9OA 4F58L 1I3RB 1AP2A 3MO1B 1M7IB 5IMOA 3V52L 2FCBA 1ZHKA 3RGHA 5CGTA 5C9KA 4P23D 3DLQR 1FNHA 2BVPA 4N0CC 2L0DA 4D9RD 1ZGLA 4N0YH 1JWMB 3NPSC 4MCZB 1XCQA 1YPZE 1V3LA 2H1PL 4LAJH 4X6EB 5T3XD 3QEQA 1A21A 2OZ4A 2GFBB 4GG8A 5J12B 5ETUA 4M48L 1A7QL 3HN3A 3T0XA 1T6VN 5C1MB 2P49B 1C5DB 4XCEB 3QG7H 2LAGB 1ZK9A 3GHEL 4MAYD 1E4XI 5F7EH 1CWVA 4DTGL 4OCNC 2P5WD 3NABL 2UZXB 1F11B 4O5LL 3LN5B 5MEOA 5L8KB 4UB0H 5CCKH 3QDME 2O93L 5CBAA 3RNKB 4XC3L 5SWSE 3TYFB 5I1CL 4XI5C 4LU5L 4WWKA 4YNYB 4CN1A 5F7HA 3BGAA 5A2LH 4Z95H 1AC6A 3RWHB 3FHQA 1XGPA 2X4OA 5SX5H 5GGSA 3UC0L 4NZUH 2FRGP 4FQXA 5EH1A 1OAKH 3TBTA 1N59A 2B4CL 1UM5H 5HYSB 1XGRA 4ZUWA 3RAJH 3MV7E 5BXFA 4XMPH 4UBDC 5CEZH 2BVQB 2C4FU 2XT1B 3N50A 1T04A 1P7KA 3KGRA 5K93A 2A77H 3A0OA 3C5ZB 5E1HB 3I3BA 5ESQA 1MI5B 4Y4FD 4XNYH 3DUHA 4LNVA 1BHGA 1FNLA 4FP8L 1LEIB 1D9KA 3SDXF 5C0JA 2EE6A 4N8VA 4JPKH 4IM8A 3OKLA 1F4XL 5J56B 4X7SH 5IEHA 5DJAA 4WDIA 1RQ5A 4M1DL 1ZLSH 2RBLA 4X9HA 1M7DA 5JDSB 2MKLC 2BVTA 4UDUA 5DJ0A 1PY4A 1PQZA 4R96B 4J4PD 2NZIA 1RZGA 5GSRB 3VFGH 2Y6SD 1BAFL 4OGXH 4S10A 4XP5H 5TQ2L 4LKCA 2R0KH 3VFMA 4NN7B 2PTUA 4NQCD 2VDNL 4LCIH 1NBZA 1AHWB 4LLQB 4JY6B 1T2QL 5SV3A 3VXRE 4UIKL 4MXWH 4P2QE 1NLBH 2BFVH 2YPLA 3KYMA 3LKPA 3EGSA 1KUMA 1FVEB 4X4XA 3C8KB 1GHFH 3EDKA 3E2HA 1NL0L 4AIOA 1CLOL 5AAWA 2AJUH 1V7NL 4GH7B 2YPKB 4Q6IA 3MRDB 1WZMA 3VH8A 3QO1A 1E6JL 3ALPA 1Z3GL 1F6LL 3NCBB 3RVWC 3BKCL 3L3KB 4YDLC 1A6WH 1QRNE 3C5SB 4XX1E 3WIHL 4LIQL 1N3NA 2NTFB 2NY1B 3FT4B 3GBNH 4MJ6B 4HAGA 4F9PA 5T33L 3F7VB 2VTFA 5DJCB 4DKEL 5IFHL 5BVJA 3KLHD 5HBBA 5I6XC 1NGYA 1YMHB 5CUSL 1BM3L 1J0IA 2HKFH 5TFSL 2ESVE 3IDMA 5HI4D 3FO0L 1QP1A 5TJWK 5E99L 1FZJB 3DIFA 1OP5H 2R9HC 3S5LB 3MRLB 4HCRH 4OCRH 2BXYA 1MJ8L 2GY7B 4XNMA 4F80A 3RL2B 3GGWA 1Y18B 3QO0A 4PYHA 2R2HB 4JDVA 1B0RA 5I1IH 4NCC2 1OAZL 3MA9H 4XNUH 1WCQA 3QJHA 4OD2B 1WITA 3DETD 3MR9A 2EDWA 4N0UE 5FOBB 3PWJB 5DR5L 1U41A 1B2WH 1OQOA 2Y4SA 1XIWD 2HFTA 3D2UA 2P8MA 3BZEB 2VDLH 4F9LA 3IDGA 2X10A 1DQLH 3MLXL 3LRHA 1A0QL 1MY7A 3BSZL 1JVKA 4Y8DC 4JDZA 4PRPB 3ZDXE 2NX5E 2P8PA 4HF5H 2NYYD 3KYOB 3OXRA 5F44A 4QTIL 2O5YH 3T3PE 4YDKH 4TN9A 1QLEH 1FG2B 1LDPH 3DVGA 3MBXH 5H8DA 3UTTA 1BVZA 3E2HC 5L0QB 1YMMA 2QADC 4XX1G 3BAEH 4Y19B 2D7TL 2NY2B 4Q6IC 3E3QE 3OX8A 2XPGB 5B38G 1BLNA 3SO3C 2XA8H 4KI1A 2GITB 2V5TA 2XI9A 4ELME 1GGYA 3FQXB 3UBXG 3V8CA 3TM6A 3QUKA 1ZT7B 4F9PC 4FTVD 5KS9F 3DX9A 1I7UB 3TVMC 1LP9A 5C08E 4G8GD 4JRYD 2I9LB 3BT2L 1EXUA 2APVA 2GSGB 1JGEB 4XAWL 5C0EA 1DUZA 4Y0GA 2JJUA 1YY8A 3KJ4B 1EVTC 3P0VH 2FJHB 4XH2A 1UM4H 2YOCA 4KQ3H 2E5EA 5EA0L 1ORSA 4MNGB 1J88A 2X1WL 2W07A 3PUCA 4HFWA 2W65B 1UWEL 3QDGA 4P2OC 5EC2B 4NP4H 5KANI 5HGAB 4EI5B 5I19L 3MUY1 1KTDB 4QHNA 4I18A 4XBEL 3T0EC 3M45A 4UDTB 5DRWA 5I8EB 2H2PD 5DD1L 1YEHL 3KNBA 4GG6F 1JHTA 1J8HD 4L3CB 4PFEA 3WFHB 4I3SL 1OSPH 3OPZL 4QGYA 1KTLA 3QH3B 2MNUA 5C07D 3UO1H 5EIQA 5L2JB 3G08A 5DEFA 5J6HB 2XZCL 1YDPA 1TZHA 1E4KA 2V2WB 1FFPA 3QQ4B 2HT2D 4NRXA 3RWFB 4LCCC 3WUWA 4EBQL 4F9LC 1OSZA 1RIVH 4RGOH 4KTDL 4NQVA 3GSNH 2BRRH 2FR4A 3HZMB 3H9SE 3HCVB 3O8XA 2ZUWA 4WUKL 3NCYS 4HUXA 1KCSL 2V7NB 5DVKA 5KW9H 4GBXC 4AEEA 4K23L 4N68A 2EDYA 3THMH 3MNWA 3IJHA 3JV0A 4G59A 4NZDA 1I8LA 1EX0A 2GJZB 4XP4L 4ZYKB 4EUPA 4GLRI 2ICCA 4F7PA 4MA1C 3VXMA 2FHBA 3UDWA 1IEAA 5H37H 5IV2A 3FFDB 5F89A 4PJ7F 2AJXH 3EYSH 4KKLD 3S4SG 2MMXA 4RNRA 2BVOA 1RUKH 2AEWA 3VWKA 5J89A 2OTUA 2BY1A 1KENL 2NY3C 5DMIL 2IPTH 3CFEA 4XBPA 3VXUE 5F3HB 4FQIH 1FYTE 1C1EL 4OCMC 3T65A 4NNYB 1PG7X 5AYUH 3S37L 1ZEAL 1NAKH 2BNRA 5SWSD 1KCRL 1ZGLP 3NZHL 3ELAT 4G6AD 3PHOA 1HH9A 2R8SL 2CUIA 4HWEL 1HKLL 3L7FB 1SYVA 2GIYA 4OD3H 2O5XH 4XRCB 3QI9A 4JFZL 5IIEA 1U36A 3NTCH 4JFEB 4ZS6C 2G60H 3S34L 5JXAH 1GGBH 3KPTA 5C9JA 1KACB 4GRLD 5KS9A 1ZA6B 3T2PA 1CS6A 3PP3K 4M8QA 4LSQL 3VXPB 3VDBA 3QBTB 3BRGC 1TPXC 3FQRB 4GKOA 3RUGB 4Y16B 5I1JL 2HTKD 3U6RB 3NAAL 1Q9KA 4Q6YA 4JZNB 4QRUB 5EB9A 1E4KC 2QL1A 4XZUA 3DPBA 1SBSL 4LQFH 1WVZA 1JHLH 3LKRA 3LZFL 4PJDE 1TTGA 4P5TD 4IJ3C 4RMRA 5K9JH 4QOKD 5I1DA 2YSSA 1LD9A 3NFNB 3H6JA 4U1LB 5DLML 1J1OL 4F57H 3RX8A 1G7LB 5AWNL 3DSNA 4K9EH 5DA4A 2X4RA 1FO0H 1RMFH 2D9CA 1N2RA 5HHXH 4EDWL 5J57B 2F15A 1FNGA 5E6IA 3U0PB 1K6QL 1IAIM 1JPTH 4L9LB 2OLDA 4C56A 3B4NA 1RHHB 3UDWC 4YHIA 2B7DT 4M9OA 2CK0H 1NH6A 1FNEA 1TVBA 1MCEA 1MCWM 5DHYA 1X5JA 1KOAA 2FECI 3KPSE 2DLHA 1IFHH 1NCAH 2ERJB 1UQSB 3HUJA 1R3IL 1FZKA 4P23B 1EEYB 5EZJA 2D0FA 4Y5VB 5F1IA 4KRPB 4O2CB 5I71B 1CE6A 3HG1E 4U0RB 2VZOA 1HDMB 1KXQE 3UJTL 1V8HA 2R0WL 5I1HH 1QLFB 2LABA 3ORJA 3U1SL 4C55A 3U4EB 2BOBA 1MCOH 3FT3B 4UNVA 2AQ1A 1VFBB 1BGXH 4PJ7A 3WUZA 3S96A 4NKIL 1OLZA 5CJ8A 4OLWL 5E4EC 4DQOL 1OM3H 3QI9C 3SE3A 5DC0A 2IPUG 2P5WB 4RZCA 3RL1A 4N8PA 5J06A 4KJYB 1RUAH 4C58B 1NGWB 5KZCD 5KN5B 3GIZL 3C2AL 3JUYA 4JZOB 4XPBH 2ZZUT 2NZ9C 3JXAA 3CVIH 1MEXL 1X5YA 4R7DB 1ZGLM 1PEWA 5T3XL 3GZKA 1BZQK 1H9VA 1NDGB 1JGLL 2WANA 4WENB 3F58L 1PVHA 1R3LA 3OBAA 1F13A 1JHKL 5DUPL 4CADA 3GSQA 12E8H 5GJSL 2V9TA 4G9DB 1NCDL 4H8WL 1G6RL 4ZDHB 3UZEA 5CEXB 2YMXL 4JFFD 2UUDH 2QKIA 2FJGB 1UFUA 1S9VA 4Y4FB 4LCUA 1BQUA 4KK8C 4LPUA 3UTZA 2E9JA 4ZTOL 2HLAA 3OXSA 5E6IC 3TA3A 4HG4K 4ZFGL 3TIDB 2GTZB 4HJJL 2DLGA 2AK1L 5IR1B 3QUML 1F3JB 4EJ1C 3OR6A 1J10A 3D85A 1IM9A 3IDYB 5F7UA 1JL8A 3UYOD 4ZAKD 3D69A 3O6MH 4OCLC 2OTWA 2A74B 2YHGA 4ODHH 3NIFE 4M93C 5CZKA 2A1WH 4NQCB 3OAUL 3RTQA 2R1WA 4HJ0D 4EN3A 4L3EA 4G7VH 2MCG1 1J7VR 4GMSH 4QT5B 3DRTB 5DJZA 3H3PL 3STZB 2EDTA 3KLAB 3PE9A 4OZIF 3QCUH 2ZCHL 2P7TA 3I6KB 4XPHL 2W9EL 3FRUB 4M1GH 1MCJA 1T0NA 5EU5B 4S2SA 4U7SA 4Z18A 2JIXA 2DQIH 3RRQA 3G6JA 3V6FB 4KMQA 4XPGL 4MGXA 3SY0B 2E8ZA 1OPGH 3WSQL 5JO5B 4BQCA 3MXVH 5AZEH 3D3VE 5DJ2A 3E8UH 4YHKH 1BQHB 2P47B 3GM8A 5FO9B 4O58H 3QZWG 3ZL4H 1U91A 1RHFA 3EO1A 3QIBA 4NFBA 4G6FD 3SN6N 1P84K 4CN6A 5FYJE 5KTEL 5CILL 1YYLL 1OGAB 4YC2C 5MENA 5GRJH 4XHQA 3FOMA 3I02B 5BVPH 1QQDA 4MNGE 43C9A 5GS0D 5IMLA 3FKUS 4NRYA 5DD3H 2CRMA 4YHPA 1I8IA 5I1GH 1CTOA 4OCYL 4YHYB 1MRDH 4CKVX 1KYOK 3PXHA 2W59A 1K8IA 1BEYL 3DMMC 4NRZA 4EKXA 2BSRA 4XMKH 2OL3L 1SVZA 1UWXK 4P3DA 5KSVB 4MXQD 2AJSL 1T0PB 3IAPA 2UY6A 1XIWB 3IRPX 4L8BB 4EOWL 4PJCB 1MQKH 4P4RB 2WP3T 5JQHC 2WSKA 3DXAD 3WFEL 2FB4L 5EOTA 4X4MA 4Z7WA 2JJTA 5F71A 5E5UB 1H3XA 5IOPB 3LQAC 1QSVA 1A2YB 3CIQA 5DQDH 3RTQC 3VFSB 4HQQL 3LB6C 2A9MH 3P4OA 4TQEL 4XPFL 1VKXA 2VC2H 2ZNXA 4DGYH 3MSPA 2VZUA 4CMHB 2J6EH 4JANA 1AO7A 1A7PL 4XNZC 1A9BB 2YUXA 5HPOA 1HSBA 1BECA 2CIKA 4FABL 3GK8H 1S9WB 4F8QA 2ED9A 4NQXB 1A3RH 4AH2A 2Z31C 4H1LB 4KTEL 3BHBB 4GW5B 1YA5A 4FTVB 2VZVA 3H9YA 1FN4A 5FUZH 1RZIA 4JRYB 1PKQE 3QUYA 2PCPA 1OWRM 5GIRA 1BREA 3VD9A 1FVDB 1ZVYA 3VMOA 3O6FD 1OAXL 1OD7A 5EULV 2E7HA 4J6RH 5HVFB 4OZIA 1ND0B 3RU8H 3GMNB 3IF1B 3LEYH 1CK0L 5EUOE 1XFPA 5E9DA 4HUUB 1Z5LA 2EH7L 2VMFA 4YDVB 5JA8B 1DQDL 4YHOL 5DD0H 1U8NB 3U82B 1I1YA 1QO3B 2CKBA 4C83A 1QBMH 4DOHB 4ETQB 2YRPA 4J8RB 1INDL 5HHME 1J8HB 5C6PB 1BJ1J 3FB8A 4YX2L 4H88H 5B39G 4NHUA 5F9WC 3D6GA 2RFXA 5JIKA 4LPXA 3HR5B 4L4VD 5FM5M 3EKCA 1BX2B 4JHWH 3FMGH 3CXDL 4GRWF 5D93B 4TUOA 2W9LA 4ZS7L 5J11B 4Y4HD 3VI4E 2JJTC 3GBML 3MV9D 4IHOB 3W39A 4HKZB 1KBGH 2P43B 5D5MF 4ENEC 4E9LA 4PV8B 4ORGB 1G7JB 1H15A 2VLKA 5DRXB 5FA3B 4LFHG 1IGYB 1LEKA 2J88L 1R3KA 1VSCA 4WFEE 4GW1A 1L0XA 4BKLA 4U1HA 3CH1A 2RAMA 2BVYA 3PWPB 1DLHA 4E0RA 5FKAA 4DZ8A 5I9QB 3QULA 4LLDB 4G6KL 3VXTB 2IADB 1TTFA 3LEVH 2CIIA 4N9GB 1WZ1H 3WXVL 3QUZC 1DVFD 2QQLL 2Z35B 3DVIA 3DGGA 1EH9A 5C0AB 4G6JL 4GW4A 4K3HA 3W0WA 2CPCA 3B6SB 5EU7E 4APQB 3QUYC 4ACPA 3LH2H 4XPTL 1EEZB 2NW3B 1QG3A 4MA3A 1I3GH 5C0BA 4LARL 1ZA3A 4UTBL 5C2UB 4W6WB 1WCBA 1UJ3A 1V05A 4HH9A 1J0KA 3JV4A 5D1QD 1CGUA 2DM7A 4YHMH 5I15L 1X5GA 5EO9B 1AY1L 5IVZA 5LVEA 2DLIA 2VE6B 4PJBA 1G7HB 1RD6A 2DS4A 4WHYH 1WSST 4GRLB 3B2UC 3RHWF 1G7IA 4JFDD 1NDMA 4OM1H 2CRIA 5FFLA 2UZIL 5MHSD 5FCUL 4PGDB 4LPWA 3WFZA 4F58H 5BJTB 3WIFA 1HEZB 1D6VL 3LV3A 1TFHA 3V52H 4HV8A 2DF3A 2C26A 2BSSB 4UQ3A 3QNZB 2XWBB 2UWEA 4Z7VB 3EFFA 4CW1A 3VGEA 1ZVSA 2YD8A 3HC0A 1MWAB 3MROA 3V0VA 4EVNB 2J12B 1RJCA 2ZG3A 1MHHB 3L3DA 1IQWL 3ECBA 1T20B 2AKRB 3ULVE 2VR4A 4P5TB 4BH8A 2DQTL 4LLVA 3VFPA 4QOKB 2H1PH 4O2FB 2UV3A 4XTRC 1ZT4B 1F4WL 1FPTL 4L8SB 4UNUA 5DJ6A 1ZS8B 3OZ9L 1A7QH 4Y89A 5HXMA 4YHLL 3QQ3B 1FORL 3WEXA 3N0PB 4U6YA 4DVBA 3GHEH 3BGMA 1J0HA 5JHDE 4DTGH 4WFFE 4WUUD 4MJIE 1TENA 4FFZL 3NABH 4AIXA 4O5LH 3H9HB 3VI3F 1MWAL 3CSPA 5FGRA 2DIAA 1FDLL 4XC3H 5I1CH 3C6LD 1P7QD 1HILA 4YQXL 4LU5H 3W2DL 3CSYA 4RAHA 3MBEA 2DQFA 3SCMA 2J5LC 3WO3B 3UC0H 2DI7A 2IG2L 3ZYJA 5EU6D 1LEGB 5D5MA 1RK0A 3PNWB 1WC7B 2B4CH 1G1YA 3TBSB 3B9VA 1A7BA 3TPUA 1XGTB 2CXGA 3SKNB 3BQUB 4YO0A 5ICYA 2DIJA 2H3NB 5GSVA 1WUNT 1JF1A 3GMMA 4PY8I 2DYPD 4AIZA 4WEMB 1UJ3C 1IILE 3LN9A 4TUJA 4FP8H 4JFQA 4F7EA 3NVQA 1UT9A 5D2LF 3RQ3A 1A47A 1HI6A 5FYJD 1F4XH 5D2NE 4KDTC 1FL3A 4WV1A 5KZCB 1TQCB 2NMSA 1HHHB 4YWGL 4KDWA 4M1DH 1BZ7B 1Q9OA 1ZLVK 3KXFA 3OJDB 1NCCL 4OIBA 1BAFH 1KLGA 4RIRB 1C16A 5TQ2H 5D71L 1HHKB 3T0WA 4M62L 1YN7A 3RKDC 1IC4L 3K2UL 4M6NL 4PR5B 2OSLB 2P24A 1T2QH 3K1DA 3QFDA 4WO4D 4UIKH 4JFFB 1PFCA 5T5NG 1T6WA 1OGAE 1LO5A 1J8KA 1RZ7L 1MUJB 4FQQB 1NL0H 1CLOH 5HDQL 3DI2B 3BPCB 1V7NH 5IBUB 4XMLH 2Q8BL 3VXSE 3FB7B 1FL6B 4WW1A 5IF0B 1TCMA 1WBXA 4FXLA 4JM4L 1QNZL 3BKCH 5HGBA 1KIRA 1T83A 1C8PA 1QSFA 3WIHH 4LIQH 1FRGL 3QJFB 1KEML 3L5JA 1D5XA 2FIRT 3OKKA 5T33H 5CEYB 1M71B 4ODSL 4CVWA 5B3NA 4DKEH 5IFHH 5AAMA 3MBEC 5E1AA 2J2ZA 1IGTA 1KNOB 1S7XA 1QFOA 1BM3H 4Y1AD 5CUSH 4ZAKB 5TFSH 5B4MC 5C0GB 5IMMA 2WNGA 2WUCH 3A6OA 1AIFB 3FO0H 3HLAB 1WTGT 4X6DB 4KJPD 5E99H 3QT2A 2VAAA 3EOTL 1SYSB 3AU1B 3MGAA 4JGJA 1QLRB 3GSUB 2IANA 3LKQA 2JJVA 1MJ8H 4PGBA 4YK4B 4OQTL 1B90A 2HP4A 2LU3A 3LSOB 5GZOC 3VRIA 1AR1C 4NNPL 5DI8A 1W8NA 1OVZA 5F9OL 1CFNA 1D5ZA 1D3CA 2VABB 1S5IL 2I26N 2OR9L 5HD8C 2X1XR 1OAZH 4A2MA 3CPLB 5F8QC 3OL2A 3HR6A 4KWUA 4X4YA 1YN6A 3WHXA 3BXNA 5HY9B 5DR5H 3TH4T 4ZPVA 3OKEB 3FB6A 3DV6B 3QWOB 2VLJA 4K94C 3DUSB 3MLXH 4LOUD 1A0QH 4LHUD 1I1AA 5ENWA 3BSZH 5A1AA 1LILA 3QUXB 3WO4C 4FFWD 3MJ6A 5IB1A 3QQ9D 5FGCB 4G6FB 2ADIA 2EECA 3WLWD 5E5MB 5DMYA 2DL9A 2D31A 2EC9U 4ZNEE 4QTIH 2EYRA 3CFKA 5IJKA 2DWEB 4V1DB 4YR6B 2GI7A 4NQEA 3G6AB 4WJ5B 5F7MC 3PQYA 4NKDA 4PRNA 3VRLF 1PW3A 5E08L 5C09A 2ATPA 4NWTL 5JDJA 1L0YA 3K4AA 2IALA 3WNKA 2D7TH 5EO1A 4KTYA 4AENB 1VADB 2LTQB 3I84A 5GHWL 4Z7OF 2CO6B 1DLFL 1T83C 4MMZC 1JRHL 3UYRL 3KR3L 1HYRC 3MJGX 1AR2A 1MHPL 1LGVA 3MMEA 2J8UB 3SPVA 4OCXL 3DXAB 4J3TA 1PYWA 1U92B 3BT2H 1SJXA 2D2OA 4F7CB 2WBKA 4XAWH 1KV3A 2X4NB 5C0CA 3BE1L 5GS0L 3GHBL 4Q2ZB 4R2GD 1B6UA 3C6SA 4NN5C 3MFFB 3MGTB 4NSKB 2DD8L 1UVQA 3PV7A 1A1NA 4XAKE 2NY0D 4IRJA 3ARBD 5FECB 2X4TA 1R24B 4KK5C 3I6LE 1UWEH 4JZJA 1QKZL 4OF6A 5I19H 6FABL 3CX5K 4FZ8L 4G43B 5DD1H 1YEHH 1TETL 3ZT7A 4X80L 4I3SH 3CGTA 3OPZH 3C87A 2H6PB 3ULSB 4JQIL 4TYUA 2FH8A 5E00A 3GIVA 3UAJC 2ICWB 2XZCH 3BGFB 4GOSA 5A16A 5FF6A 3F7YA 1JTTA 1LE5B 1NGXA 4WHDA 4EBQH 1BOYA 3QXDB 5C0AE 4K8RD 4KTDH 4NM8L 4UOJA 3ZDZF 3O6FB 2YD7A 1TDQA 2UZYB 3D87B 1AE6L 2P44B 2X4PB 4WUKH 3WS3A 3O0RL 1KCSH 4OZGB 4LDOB 5CD3B 4K23H 3KYKL 4F37K 1I4FA 1S3KL 4LEXL 4LCYA 1YUHA 3QDJD 4OB5L 1P53A 2DL2A 4F8TA 4YIQB 5HI5C 3ZKSD 4OUUB 4XP4H 5EPMB 4JRXD 5ITBL 2IGFL 4JJ5B 4PP1C 2VNCA 4XXDB 4IS6B 3V5HB 3Q3GB 3V2AR 3IS1X 4M4PA 3L7EB 2CKNA 3OGCB 1U9KA 3IXAB 1GXEA 2OTPA 1A6AA 3K74B 1KENH 5DHVB 5DMIH 3T0EE 4POUB 4ZQKB 1YC7A 4L4VB 4Z7VE 2UVFA 3MJ9L 4B50A 3S37H 1ZEAH 1YY9D 4MNQE 3ARGA 2C3HA 1KCRH 2JJWA 4MDJA 4Y4HB 4H5SB 4HD9A 4M8VA 1T1YB 3MV9B 3T4YB 3NZHH 4Y88A 3CVHB 1JFQL 4WI9A 5JIIA 1ZLWK 4ZPTA 5L2KD 3EO0A 2O5ZL 3O4LB 2R8SH 1HKLH 2AK4D 5HDBE 5E8EB 1TZIB 4IRJC 1A7OL 5D7IF 4JFZH 3GJFB 4JZJC 3S34H 5C0IA 2V2XA 2NY5L 1AGBA 4N0CD 1FZMA 3X12B 1U8LA 3MRNB 1XGUB 4LSQH 3BO8A 2FJFA 2I5YL 1DVFB 2AXGA 5DWUL 5I1JH 3NAAH 5D9SA 3M17B 2G5BA 3V7MA 4FQCL 3CVHL 1EUUA 3I6GA 5C8JA 3LZFH 4F2MB 5ID1A 4B7LA 3M1BB 1FSKC 2CLRA 4YDJB 4FQLL 5DLMH 1J1OH 4JM2D 4DZBB 4LVEA 5AWNH 3DYOA 5D1QB 5J6GA 4LLAA 4EDWH 3ES6A 4XI5D 4KU1A 4PJAA 1GGUA 2G5RA 1B3JA 1K6QH 1OGTA 4WEUD 1HIML 3TT3L 5IB3B 3ZKMD 4PJ5E 4JFDB 4LPVA 4L8CA 2XNAA 1IL1A 4OJFL 2EXYC 4HT1L 1ZSDA 1KXVC 4JY5L 5EC1B 4JAMB 3CDCA 3K3QA 1UZ8A 5I17B 5JPMA 1KEGL 3SE8H 3VXSD 4UBDD 3H7BA 2VJXA 1BVLA 1U3JA 1JNLL 4Z7QE 5HHOA 5IHZB 4ZOBA 3TCXA 2KDGA 4O2EA 1S7TA 4NQDD 3ARGC 1CU4L 4AY0A 3UJTH 2AJ3A 3IFNL 3OB0H 1HE7A 2XWJA 2R0WH 1RIUL 3MLVL 3U1SH 2BNUB 3AC0A 4FQ1L 5DQ9A 1J86A 3A6CL 4U1MA 1FYHB 3UPAA 1GOHA 3F62A 4NKIH 4O51B 3PABA 4OLWH 3P4NB 1F02I 5CD5C 4WUUB 4D0DB 4QCIA 1NBVL 1ZHLA 1UXWA 3FCTA 2DM4A 3GIZH 3C2AH 3C6LB 1P7QB 3CFDB 5I30L 5DS8B 3H7LA 2IQ9L 5EU3B 3T4AB 3VXME 3O3DB 4M00A 2YBRB 4KKCD 1MEXH 4K7FA 4L1DA 5T3XH 1BFTA 1DSFL 4ODXB 1WISA 3QEQD 1JGLH 4MQ7B 2UUDK 1Q8MA 3F58H 3QAZB 4Z9KB 1JHKH 5DUPH 4AM0B 4BK5A 1FV1A 4IMLB 5DMKB 1LNUB 1JJUA 4NQSB 1DQJA 1CQYA 3BDYL 1NCDH 1U3ZA 3BKYH 4H8WH 1G6RH 2YMXH 4TNVF 3BEWA 3RVWD 5HDLA 2DYPB 2NY4D 2F5AL 3DGCR 5SWZA 1U95A 3SO5A 4ZTOH 2WWMD 2HJKA 4WWKD 3KHQA 4PRIB 3WE6A 1MCKA 3DWTA 4IIQA 4JCMA 4PJEF 5EZOL 2IH1A 2OJZL 1S7VB 4K3GA 4BM7A 2DMKA 2R56L 1J05A 4HJJH 2D0HA 3SKMA 4LSDA 4FQXD 2AK1H 4DUXA 3QUMH 4J12A 4NN6C 4NYLA 2CR3A 4Y5YB 1WGOA 4HK0A 3VD5A 5EZLB 4GXUN 5I74C 1C12A 1CF8L 5FO7A 4KROD 1W0WA 1UACL 3OAUH 3DUUB 3UTQA 3F12A 4RSVA 3B2VH 2H41A 4WO4B 1D9KD 2P48B 3KS0H 4QRSB 4I0PC 5E94B 3VGBA 1BIHA 5FYJL 1JN6A 4YDIL 1GVIA 4M7ZC 2FGWL 3H3PH 2BHUA 3NZ8B 4S11A 5E0QA 4KQ4L 3W11C 3JTSA 2ZCHH 2F53E 3RBGA 4PJXE 4QY8B 4XPHH 4JFPB 3IU4L 4DW2L 2W9EH 5HYQB 3WN5A 2XQBL 3RIFK 4PRBB 5BQ7A 2CLVB 4V2BA 1E6OL 4XPGH 1TNMA 2XIDA 3WSQH 2H8PA 4L4JA 3F8UB 2YPLD 2GW5A 1OAQL 1DE4B 5F7DA 4WW2A 4LRNL 4R4BA 2ZUTA 5CJ5A 1A4KA 2QADD 3PGCB 4JR9L 5KTEH 5CLWA 5CILH 1YYLH 2JCCF 3GRWL 4U6XA 4ZFZB 4JDTH 3CUPB 3JWOL 3BP7A 4JFOB 3WFCL 1AH1A 4W6YB 3HNSL 4ZUVB 1J1PL 4NKMA 4OCYH 7CGTA 2H9GA 4PGJA 2ZSWA 1U3HA 2IAMC 2Z4QA 2BMKA 3OKYA 1N6UA 4IIQC 3SDAA 1I8MB 1BEYH 3T3MF 2OL3H 3ERYA 3EJYC 5BV7C 1XZ0A 2AJSH 2VITA 3R8QA 4MSWB 1OTSC 1SEQL 4M7LT 5ISZE 4EOWH 1TVDA 1SM3L 4LHUB 3WFEH 3W9EA 2FB4H 4HWZA 5CZVL 4P2OD 1FL5A 3G5YB 2IC2A 4Z5RA 5F97E 1LO4L 3DV4B 3CK0L 3MLRL 4ODTL 4HQQH 4PLKD 4TQEH 4XPFH 1CGTA 1U6AL 4PJEA 3RI5K 3PL6A 3Q6FB 4MNQD 4C57C 3JWDL 4Z0XB 5GGTA 3REWB 4L29A 1A7PH 3ZE2E 3HI1A 3LMJL 5I1LA 3OAZH 4PJ9B 4U31A 1RZJC 3DX8A 3REVA 4FABH 3D2UD 4U1KB 5HGDB 3ROLB 1UGNA 4XBGA 3WN5C 1U3YA 3MNVA 1I9IL 1I3VA 4KTEH 1DQQB 4JPWH 3BIKA 3HAEG 4GBXD 5KBNC 3FN0L 4Y2DC 1YEEL 2WBJB 4LLYB 4PG2A 5BZDB 2CR6A 1OAXH 3UTTD 4WW2C 3LEXB 5ACLA 1OB1B 1YMMD 1R0AH 3TNNB 5IJVA 2NY0B 4LVNB 3ARBB 1QSEA 1DQML 4OZHE 3O4LE 4X98A 2EYSB 3VFWA 2EH7H 1DQDH 4YHOH 1I1CA 4QHKJ 3C09C 2NY3D 4H1LH 3Q1SL 5GGRY 3FFCE 1U58A 2XG4A 4MD4B 1U3HC 4HPYL 4DGVH 1INDH 3NMEA 1T3FB 4UMGA 3SDAC 5TE4L 1XF4A 4I48B 2NQCA 4YX2H 2C7UA 1A6ZA 2Q76B 1LMKA 4CNIA 1A1OA 3VXOA 4YFLF 3DRQB 1TQBB 3CXDH 4RGNC 2JCCA 4MMXC 1ERNA 4OFVA 4ZS7H 1WIPA 3K2MC 3TH3T 2WWKO 3QDGD 3G6JE 1FBIL 3KHOA 4OLVL 3GBMH 4YEFA 3L95A 4ZS6D 4QHLB 1WIUA 4BH7A 5LKNA 5EUKA 2PN5A 1J5OL 3MUJA 3IKKA 4WU7A 2AJVL 5MEQB 2FLRT 1OT1A 4QHMA 1GH7A 2J88H 5H94B 2VXQL 4NBZB 3VD7A 4JRXB 4U1NB 1L6ZA 3JZ7A 4XGZB 3EOBB 4Z77A 2XWTB 3C8HA 1MLBB 4H26A 2F74A 3CZFA 4G6KH 2IFGA 4HBCL 4I0KA 2ZP0T 3GSVA 4M03A 4K8RL 2PW1A 3DURB 3BP5A 5JIHA 3WXVH 2QQLH 3D25A 1QR1A 3O8XD 4NUJA 1KJ2B 3NGBB 5JNYA 2VISA 4G6JH 1K5NA 3SE4A 3VG0L 1ODAA 3U30C 2A83B 5MP6L 4P2RA 3KPRE 4FZEL 2JK5B 2YS4A 4PG2C 5DK2A 5ELIA 4JQVC 4XPTH 4DEPC 2YZ1A 1JZ7A 2IQAA 5IKCA 3AS0A 4OIIL 3VXMD 1W0VB 2GUOB 2WM0A 5L2KB 4LARH 1JGUL 4R7NB 1AXTL 2X9XA 2CUMA 2HJFA 2AK4B 4UTBH 4NGHL 6CGTA 1T80A 1K4CA 5I15H 5DYOB 5C6TL 1AY1H 4GKNA 4N0FB 3VWKD 5IVXB 3L3JA 5K33A 5ANMB 3RPIA 5KVGH 4X0KB 4RMWA 5LCVL 3V0WL 3NPSB 2UZIH 5FCUH 1D6VH 2VDML 4Q58C 5LBSL 2BNRD 1WBZB 3LRSA 5HVHB 2PYFA 3FRPA 1AJ7L 1NJ9A 4OKVA 4MVBC 4Z7UE 1IQWH 2RR3A 5AD0A 2DQTH 4G6ML 1CICB 3EUUA 3QI9D 1QACA 1Z9MA 4JM2B 3EIFA 1F4WH 4KK9C 1FPTH 4GAYA 2HRLA 4OLEA 1YNTA 3OZ9H 4P46A 4NCDA 1JGVL 3S88L 4TVSa 4YHLH 1FORH 3VG9B 4JVWA 1R3JB 4OF8A 4X5WA 2GK0A 5FA4A 2NZ9D 3ET9F 4XNXL 4FFZH 2A6JA 2C3GA 1MWAH 3GI9L 5KSUB 1FDLH 1PJ9A 3VA2C 4ZUTB 4OFPA 4YQXH 1FIGL 3BEVB 3P0YL 3W2DH 5IW1B 4HG4J 5I8CB 4YUEL 2IG2H 1IM3A 1JWSB 2D7OA 1QR4A 3QNYA 2ZG1A 4NQDB 4OZFB 1IAIL 3SE4C 3FQUA 4L5FH 5J8OA 3U46B 1EHLL 5E6ID 1AGDB 5JW4M 2PXYA 4C56D 4ONGL 3C08L 5I2IA 1BBJA 1EBAA 5D7LE 1E28B 1JPGA 3V5DB 1SHMA 5FYKE 2IH3A 1AP2B 5EU4B 4OLZH 2E7LA 1ZHKB 2F58L 4XVSL 4Y5XA 1A1MA 2BVPB 3SDYL 4ONFH 4YWGH 1ZGLB 3K1KC 1JYVA 3MZGB 2JLLA 1XCQB 3HMXH 2ZUYA 1YYML 1T22B 1NCCH 3R1GL 1XAUA 3QEQB 5J1AB 5ETUB 2BZDA 3MJ8A 5D71H 1BZ9A 5GGVL 5SWQA 2R0LL 1IC4H 3K2UH 4X9FA 5HHVL 4M6NH 4P3CL 1JZ5A 1FQ9C 3DTXA 3QHFL 5DFVD 2W9DL 3GMPA 4YHNA 1CIDA 5T3ZE 4G8EA 4YDLB 5MEOB 2Z8VC 1RZ7H 2NY4B 3BW9A 2X44D 4P46C 1DANT 5CBAB 5FDWA 1P84J 3BYYA 5HDQH 4WWKB 5DO2C 2Q8BH 1M05A 4Q0XL 4XC1H 1FLRL 1XGPB 2X4OB 1MNUL 1YPZA 4JM4H 5GGSB 5C0BE 1QNZH 2OZ4L 1K4DA 4LMQE 1FRGH 4FQXB 1J9CT 1KEMH 3NIDE 2WMPA 5CGYC 3TBTB 1N59B 1K8DA 1SY6A 1YJDC 3ARYA 5FAAA 1XGRB 4QKXB 1KYOJ 4ODSH 4ZUWB 2LU4A 5HTSA 5BXFB 1EUTA 4MS8C 4O02L 3MJ7A 4EI6A 4LCWE 1P7KB 4KROB 1TJIL 4RFNC 4PIRF 4YBLC 5ESQB 1IQDB 3KG5A 5E8NB 1WFUA 3QDMA 3EOYG 3EOTH 3KJ6L 2ADFL 1D9KB 2C4XA 4N8VB 3TA3D 1L8JA 1MQ8A 1ACYL 3OKLB 2PXYC 5IEHB 5DJAB 3O3EB 4Y2OA 4WDIB 4OQTH 3DMMD 2X4UA 3GB7A 4HLZH 4NNPH 4IRSA 3V6ZA 1M7DB 5F9OH 4GQ9L 2QTEA 4UDUB 5DJ0B 5H35B 3V5KA 1PQZB 1S5IH 2OR9H 3LPFA 2E7LC 2BY2A 3BH8A 1RZGB 4Y5XC 3ARDA 3D85D 1IM9D 2EEBA 4R0LB 3MV7A 1DN0A 2FSEA 2J3SA 4XWOD 3ZYIA 3NBNA 4LKCB 1BF8A 3VFMB 2P5EE 3RTQD 1NBZB 3AAZA 4LDLB 3ABZA 1HKFA 4BUGA 1XR8A 1ADQA 3IS0X 1UG9A 4EN3D 4L3ED 1CXEA 2D3VA 3LKPB 2YPLB 3KYMB 4PLOB 3EGSB 5JZ7C 3RDTC 3BVNB 4X4XB 4NFDA 3E2HB 2N4IA 2C3XA 2QADB 3P9LA 2AEPL 4D9LL 3VH8B 5C0FB 5MI0C 3JV5A 4PG9B 1KFAL 1MCFA 5AUMA 5E08H 1FP5A 1SJHA 3UTPD 4YFLI 4NWTH 5TDOB 4MZ2A 1N3NB 1QA9A 5FYLD 2JIXD 3TPUE 1IZKA 5F7LB 2ADJA 5BVJB 1H8OA 1RI8A 3SE9L 3S6CA 1FFOB 4AT6A 5GHWH 1DLFH 3UYRH 1JRHH 1BBDL 3KR3H 3IDMB 3VXRA 4P2QA 3L3GA 1OARL 1GCFA 1TLKA 4JKKA 3T0BA 3DIFB 1MHPH 4OCXH 1ZWIA 2DM3A 4KPHL 5C3LD 1G7PA 4QRRB 1JI1A 5MEND 3BWAA 1HHIA 4J7RA 4XNMB 3S97C 4PGEA 2EZ0C 1RK1B 3BE1H 3EAKA 3GGWB 4KHTL 5GS0H 3GHBH 4LHJB 3QO0B 5LG1A 2LVEA 4JDVB 1M7XA 1B0RB 4QRQA 1QRNA 2EIEA 3HMXA 5FHBH 2DD8H 3ZDYE 2AXHA 4J3VA 5B38A 3D39B 3QJHB 4HEPG 2XV6B 5D7KD 3MR9B 3QIWC 1QKZH 4IRSC 3UBXA 6FABH 5IHBA 4JFYA 2ESVA 3SDCA 4FZ8H 3HA0A 3D2UB 5INDA 1DBBL 1TETH 2P8MB 3TESA 3BRFA 1MH5A 3IDGB 3WJJA 3WMSA 3ARDC 4X80H 2QJDA 3HE6B 4JQIH 5FEBA 3F6LA 1HHGB 1XF3B 3S9DB 2P8PB 5FV1L 4G3YL 5F7NC 1A5FL 4ENED 3W82A 5LGJA 1IGML 4NM8H 5FUOL 3ZKXC 4QNPF 4PDCE 3DVGB 2AJZB 3UTTB 4MA1B 1AE6H 4K3DL 4RDQF 5TDNB 3O0RH 1AO7D 3S35X 1RZ8A 1YMMB 3SGKC 4N0UA 3QEUB 1EDQA 3KYKH 3OX8B 4OFYA 1S3KH 4OB5H 3V6BR 2KH2B 5FIEA 2J8UF 3O11A 4CVXA 2NY3B 5ITBH 2IGFH 3WD5L 3QUKB 3R8BB 3C9NA 3DX9B 2HVJA 4RMVA 2DJSA 2NX5A 4KRMB 1LP9B 2OX5A 3FN9A 3QUYD 1EXUB 1RV6X 5C0EB 2VOTA 1G9EA 4TTDC 2PF6A 1DUZB 4D94A 1VGKA 1YY8B 1P5UA 3DO3A 3VGGA 4QRPE 3MJ9H 3OKOA 5GZNC 2FBOJ 3LKOB 3L5IA 1ORSB 5C0RL 5E9DD 3E3QA 3OV6A 3QDGB 4HFWB 5E4IA 4CMMA 4UAOC 1KJMA 4R8WL 4YAQA 1OLLA 4I18B 4QHNB 1JFQH 1VEMA 2BP3A 3B2UD 4ELMA 1K3IA 2O5ZH 5CJBA 1MRFL 2FHCA 3CU7A 3KNBB 2VLRE 1JHTB 2NW2A 1GYAA 3S4SA 1TPXB 3AY4A 4KGJA 1KTLB 1UJTA 2QQKL 5C08A 4X7SL 5KVFL 2AQ3A 3X14A 3QNXA 5DHVH 2NY5H 3G08B 2I27N 5DEFB 4PJFE 3VDAA 1EPFA 3KYNA 3SDCC 4AEFA 1DBKL 4NRXB 1N26A 3WUWB 2BCKA 1OSZB 1F6AA 1KC5L 4IJ3B 4NQVB 4YHZL 4Y4KA 2I5YH 2AS5M 3LS5L 3BPOC 5CKAA 3MLSL 5DWUH 5L9DL 2FR4B 3STBA 3O8XB 2MSPA 4MCYA 4HUXB 4WU5A 4FQCH 3CVHH 4UU9B 4PS4L 3WLBA 3MNWB 3KPQA 3IJHB 3RIAF 2VLKD 1A6VL 4FQLH 5CHNA 1A8JH 1ZOXA 2EO1A 5D7JB 1IEAB 1UADC 1TXKA 5IV2B 5F89B 5DRZB 1JPSH 4RNRB 1J11A 2BVOB 3RWGA 5IW6A 3FL7A 3S3JA 5ERWB 3VWKB 2OTUB 1S7QA 1HIMH 3TT3H 3OG4B 3P4MA 3CFEB 4XBPB 1I9RL 1CIUA 2DIBA 1OP9A 1CD9B 3H9SA 4OJFH 3T65B 1C7SA 1CT8B 3EYFA 4HT1H 4PTUA 1MCRA 2B5IB 3UYPA 3W0WD 4JY5H 4V3DB 4CVZA 2BNRB 2OJEB 3MZTA 1KEGH 3OB0K 4LSTL 4ZSOE 1JF5A 5KJRH 5ESAA 3VGHA 1JNLH 3ZKQD 3PHOB 4MQTB 1HH9B 4X8JA 3N1PC 1HWGB 3LDBB 1F2XK 5C0BD 5J13C 4UOW1 1R5WA 4JKMA 1SYVB 1CU4H 3E3QC 3QI9B 5IIEB 1EO5A 3IFNH 5TH2A 4L4TE 3JTCA 4E41E 1RIUH 4ZO9A 5C9JB 4FQ1H 5KS9B 4WI4A 3A6CH 3MO1A 4EIZC 2KKQA 4M8QB 2X4SB 3VXUA 5E6ZA 2EDBA 1FYTA 3AY4C 3O9WA 1AC0A 1N64L 3DYMA 1BOGB 2DLTA 2N56A 5EBLA 1P4BL 1Q9KB 1NBVH 5JQ6H 4LLUA 3S98A 1BWMA 4MQSB 4XZUB 3V0AC 3E0GA 3LKRB 5I30H 1ACZA 3CXHK 1RSFA 2IQ9H 1MCPL 3MRCA 2R39A 1TZGL 4QWWC 5I1DB 2YSSB 3TV3L 3U7YL 3AROA 4I9WD 4WGVB 4FQHA 1DSFH 4F33B 3D0LA 2X4RB 1CG9A 2BK8A 1N2RB 1ZXQA 4PGCA 3IJSA 1FNGB 4JY4B 1KSRA 4JPIA 5E6IB 3BDYH 2B1AL 2P5ED 2MHAB 4PP8C 4RFOL 2BHYA 5FM8A 2J7LA 4KUZL 1FNEB 1TVBB 4WIQA 5B3JE 1YQVL 5DHYB 4ZUSA 4JJHA 3FO2A 2A6IB 1NMCC 1YEJL 2NR6C 2XA8L 1CFQA 4PJDA 1FZKB 2OJZH 3MBED 4X5LA 2AEIT 5EOCJ 3SCMD 5EZJB 5B4MD 5D6CA 8FABA 2R56H 3CMOL 5F1IB 5HYSA 5BOZG 3EO9H 1CE6B 4M93B 3FOLA 1BF2A 2BVQA 3GSRA 3PG2A 1V3KA 3NIFF 5C6WH 3TEUA 2BSED 1CF8H 3CDGA 1QHPA 2BOBB 1UACH 5GZOD 1AR1D 2FX7L 3ISWA 4PJ7B 1IMHC 3S96B 1UM4L 3VGDA 5ACZA 5HHNA 4HUWB 3ULUE 2BNQB 4I0CC 4RZCB 3RL1B 5FYJH 4DVRL 3KPSA 4YDIH 5INCB 3U9PL 1CDGA 2FGWH 1IAOB 4KQ4H 1HXMA 3KAAA 3IU4H 2XTLA 3GKWL 4DW2H 3KXFD 3HG1A 1OSPL 3QFJE 3ZT5A 2WP3O 2XQBH 1R3LB 3WCYA 1E6OH 1T2JA 4CADB 1IKNA 2OR8A 1X5FA 2YUZA 5C0NC 5ITFA 5IHUL 1JRHI 4DAGL 1IC1A 3U7AA 1P9MC 4HKJA 1P4IL 2YXFA 1UH4A 2B4CC 4V2CB 1UENA 1OAQH 2QKIB 5EWIL 1S9VB 4LRNH 4LCUB 1IRAY 2NXYC 4MJ4A 3ZYOA 4JR9H 2HLAB 3TA3B 5KANG 3T0AA 3C5SA 4PUBL 4XVTL 3DX6A 2DQEH 3U4AA 4NC1E 3PGDA 4MJ6A 3D39E 2CQVA 3JWOH 1QSFD 5F1KC 4HC1A 3WFCH 5IQ7L 4N8CL 1OW0A 2YD1A 3HNSH 4KZDL 1J1PH 1JP5A 2FX8L 1F3DJ 3EHBC 3D85B 1IM9B 2K7QA 1HINL 3AS3A 2P42B 2FDBP 1UKSA 2IPTL 1FE8L 5E24E 2OTWB 1HQ4A 3CX5J 3QZWA 3V79C 3RTQB 1ED3A 2W38A 3L3IB 4D8PA 2R1WB 4CGTA 1NAKL 4EN3B 1SM3H 3HNTL 3SDXE 3BZFA 1Y18A 4W70A 2IAND 5D1XA 5CZVH 4KK5D 5DJZB 1WZLA 4XNZB 1LO4H 1I9EA 3CK0H 3MLRH 4ODTH 3OAZK 2P7TB 1CD8A 1U6AH 3OAYH 2V5SA 2N7BA 1BD2E 4OCWL 3JWDH 4S2SB 3GSXA 1ZHBA 5CEZE 2JIXB 3BZEA 3UAJD 1FO0B 3LMJH 3LQAL 2F8XC 4BFEA 1LK3L 1CN4A 3O2DH 1H3GA 4OV6F 3L5WA 2VLJD 2EDXA 5DJ2B 4CRPA 1PSKL 3EZ8A 1I1AD 4NN7C 1I9IH 2C3VB 2ICWI 3KYOA 4KHXH 1AHWC 1U91B 3QIBB 3EO1B 4Q9QL 1JHLL 3GI8L 3O6KH 3FN0H 4PJIE 1YEEH 2XKNA 3MCKA 5MENB 3KLSA 4YXLL 3UTSE 3FOMB 4NQED 5EUOF 4POZC 3PQYD 5HI5D 1QQDB 2Z8SA 5F7KC 5C09D 43C9B 3CLFL 5IMLB 4NRYB 3BKJL 5FYLL 3E6HA 1BFVL 4HJGA 4YHPB 1I8IB 3LY6A 1U93A 1KLUB 3QHZL 3CSBA 1G9NL 4JFHD 1DQMH 1RU9L 3FQXA 1K8IB 4NRZB 4WFHD 3WNPA 1CDYA 4H25A 4P3DB 5E2JA 5F9WB 3D3VA 2PO6A 4XP1L 3Q1SH 3GMQA 5FXCH 2GSGA 4TVPD 4HPYH 5E2UL 1QUNA 1J18A 5TE4H 1XH3A 1VESA 5EOTB 3MRMA 4Z7WB 1RUQL 4OI9A 4WRLA 1U2CA 5C0CD 1N4XL 2E7BA 3HI5L 3K80A 1FFNA 4MNGA 3VI4F 3MV8E 4ODVL 1I3UA 3P4OB 1VKXB 2W65A 2FNBA 3FO1A 2XXMB 4HWBA 4IRJD 1LVEA 1KTDA 1NEZG 1NCNA 5D1XC 3NCEB 1FBIH 4OLVH 1XF1A 4JANB 2F54E 3PXJA 1AO7B 5IB2B 32C2A 1EMTL 1X44A 3MRKA 2NXZC 1HSBB 1RJYA 1J5OH 3HZYA 2AJVH 1N5YL 2VXQH 5J6HA 3B9AA 4AH2B 5EBMB 3OG6B 5B39A 3RWFA 4BZ1L 5F3BA 1RUAL 3TH2T 2ITDA 1TIUA 2F19L 3MUHL 1FN4B 1JTPA 1RZIB 4HBCH 3HZMA 3QUYB 2PCPB