5BS0A

Mage-a3 reactive tcr in complex with titin epitope in hla-a1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 71
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5bs0A01
2R9HD 1YECL 4TSAH 5IVXB 5JLZA 2W0LA 5E6ID 2ZSWA 1DBMH 1TVBA 1XIWC 4X4ME 2AV7A 5JXED 2P49B 4TQEH 3ARFC 3LMJL 5IIEB 4JPWL 2ADIA 5ADOL 3VXTA 5T3XH 3C5ZA 2DN7A 4GKSB 1I8LA 1LEIB 2N7AA 4Y19A 5C0JA 4PG2C 1NMBL 3TIEA 1T04B 4XRCA 5ACZA 4HT1L 1CICA 2IPTL 3GBMH 1A7PL 4MAUH 5I15H 5J89A 1A7BA 1S9VB 2A0LD 4KKNA 4B41A 3V2AR 2RAMA 5KSVA 2DQHH 1I7RA 1FL3B 5SWQB 3N1GC 4P2QE 1U0QA 5I1JH 3FO2A 1F8TL 2EDWA 3V4PH 5AZEL 4YHKL 5I66B 3FAXA 1A6UH 3OMZA 1LQVA 1RZFH 1M05A 3TCLB 5HHMB 1Q9LB 4JO3L 3S36L 5HYJE 4N5EC 4X9FA 4LEOB 1XF4B 3ULUD 2GTWA 1A14H 4D2NA 1FYHB 2Y23A 4FQIH 3UROR 5D5MA 5T1MA 2Q86B 5J1AB 4EUPH 1KEGH 3OAUH 5F71A 4WEUD 1TZIA 1IGCL 2P8MB 3KPRB 5B38B 5GGUB 2D03H 1MUJB 4TUKH 2LTQC 1OLLA 4C83A 4MAYB 3INUL 1OTTD 4NFDA 5C7XL 1KTLB 1YEDA 5HTSA 5F6HJ 3N9GL 4L4TE 4EN3A 4AEIH 3VWJA 4RGND 4NJAL 1NBZA 1TQCB 3IGAB 12E8H 1ZKAA 4FTVE 3MRDB 3ZSTA 1RUQH 4LKCA 3O8XC 3VRLF 3TYFB 5EO0A 2CLRA 3RGVC 3ULSA 5GRZA 4DGIL 4WWKC 2XZCL 1OARL 4H5SA 5DSCB 4YAQB 3H7BA 4LSDA 5L8JB 4OZ4B 3MNZB 2I9LA 2R39A 4N90D 1A9EA 4Y2DA 1VCAA 1DVFC 1N64L 1FC1A 2PETA 4D3CL 5KSBB 1RUPH 3LH2H 5JW3H 2B0SL 3OHXA 1T89C 3UYOD 3ARSA 1TJIL 5T3XE 3RY5A 4BSWB 5GZOC 4O9HH 1FRGH 1N8ZB 4U6YB 1R24B 3RI5F 4QF1A 3D9AL 1IC7L 1MNUL 4HUKB 5HDLA 4AYFA 4S1RH 3DVGB 4MA7L 3QNZA 5FDYA 1HH9A 4KHTH 5C0GA 3OAYH 4JFDB 4P2RD 5TH2A 5I9QC 4V1DD 1K8IA 1MCFA 4HGMA 4M9OA 3TVMD 2XZZA 3UTPD 3VW3H 4PRIB 4PP2A 1UH2A 1CFBA 2CRZA 3BYYA 4YHNB 3SDAD 4M6MH 4O4YL 1Z5LB 1X5JA 3R06A 1IEBA 3MUJA 2BNRB 2Y07L 4NWTH 5TJWK 3BRDA 1EHLH 2MPAL 3QH3A 4PJDB 3C5JB 4K94L 3GKWL 4JY6A 2ICCA 5C0AD 3MLVL 4UB0H 5B22A 2X4RA 1JZ8A 4NRZA 3U9PL 3BZ4B 4GMTH 3WO4C 5E08L 3TZVA 1X44A 1R3IL 3LEYL 3X14A 4GW5B 3O2WH 5I1IH 4X7CC 3KPTA 3L3GB 3LRSB 4JDVB 3TBVB 1ED3A 1G7QB 1AIFB 1FZKA 5T1LA 5IM7A 3BE1H 1I7TB 1F2QA 4JB9L 2HLAA 1NFIB 1OCWL 2VLMD 1UC6A 3FMGH 3THML 1MQKH 3Q5TA 3BH8B 4BH8A 2IG2H 4HKJA 2ARJQ 4L3CA 3QUKB 4YFDB 4UDTA 5ILTH 2HRLA 4G8GE 1S7VB 4Z8FH 5HDBF 3QDGD 1W0WB 4R7DB 3REWB 2BOBA 2E6QA 3SDCB 4KKLC 1JMZA 1MJUL 2ICWJ 3CFBA 3P9WB 4P5MB 2X4SA 4GS7C 3MRHA 2CPCA 3MV9D 3FQXB 1TQBB 5CBEA 3KPLA 5E6YA 4PBWD 4UT7L 3BPCA 4KDWA 4ZPTB 1BP3B 4LLMB 2DWEB 2GI7A 1P4BL 3QQ9C 4MS8D 2WP3O 1RZGB 3CU7A 4IIQC 1T2JA 3RX8A 3UTQA 3WFEL 2H1PL 2FEDC 4EEEA 2XN9A 4P49A 4PPTA 4P2QB 3Q0HA 1DBAL 3QHFL 4PJ9A 1MFNA 5LGKA 4KU1A 5DMIL 1DBBL 4LCWE 4OM1L 4HFUH 5EU6D 4P3WA 2MQCA 3RIFK 2DQCL 4TVPL 1WT5C 2YC1A 4LHUB 3BFOA 1DE4A 5K9QG 3HNTH 2IFGA 3QFJA 4UT6L 2YMXL 3CNKA 3DMMB 5C09A 4NKOB 4ZNCD 3OG6B 4YWGL 3ULUF 3QQ3B 3TT1L 4PGEA 4Q2ZB 3O2VH 4GO6B 1CIUA 5D2LB 3FFCA 4P2OD 1MCSA 4F57L 3U4BH 3UBXA 2UWEA 2DQIL 1JZ2A 3GO1L 4HSQA 4EI5A 3KLDA 4ERSH 1H3PL 3HE7B 4L4TB 1JPTH 4NC1C 4F8TA 4WU5B 1K4DA 1SEQL 4ETQB 2XRAH 4HS8L 5FV1L 3OXRA 3QEQD 4U1IA 1GVIA 5FKPA 4NUGL 4PUBL 4WW2B 4YDVB 4QOKD 4Y5XA 3DROA 3VFPB 1RIHL 5FCUH 1B3JA 4LVHC 3EYFB 5JMRA 1A1NB 4FZEH 3SJVA 4WFGE 1AQDB 3N85L 4WI9A 3ARFB 2J6EL 3O9WD 2YD2A 4PV8A 3DUHA 5IVNA 3QDJE 3G6DH 2Q3AA 4X98A 4XCNA 3EYUL 2VIRB 4X7SH 5E2WL 1A1OA 4XBPA 1JGLL 2PYEE 1MWAA 2CIKA 5D93C 1FGVL 3SGDI 3WKML 4X83A 4U0QB 4LSRL 4Y8AA 3HMWH 3FO9A 1HI6B 3MRIA 2ZJSH 4KTDH 1T7WA 3JTTA 4U3XA 1QO3A 5D1QB 1KCRH 3B9AA 4PGCA 3PV6B 4PG9A 3W5MA 1YEIL 3GJEA 2EEAA 4BYHA 2JJUA 4ELMA 4YGAB 1KTDB 3E8UH 1EK3A 3B9KC 1QSEE 2G5BB 3T08A 2D0FA 3FZUC 1E4XH 3PWVA 4N0YH 3BGMA 3MXVH 5FCSH 3SE3C 1C8PA 1WZMA 3V6ZA 3PL6B 1V5JA 2DOCA 4NQDD 4G8FA 1CQKA 1FJ1A 2IQAA 4MCZB 4HKXA 4R3SB 1EO5A 1X7QB 4YBLC 3B43A 2F74A 5DC9B 5ENWB 1H3TA 2LTQB 2XNAA 5HGHB 3GM8A 2Z35B 2WINA 1AXSA 4NHUA 5HYQA 5J8OA 3QA3B 4KQ4L 5HHQB 4NC1E 4K9EL 1G9NC 1OLZA 3OJDB 4JRYB 1KPUA 5C0BB 3P0VL 3GSVA 3AREA 3HRZA 4LU5L 4M5ZH 3VFTB 4Y5YA 3O8XB 5KJRH 4MXVF 1MEXH 4WIQA 3VRJB 1DQQA 3MLYH 5GJTL 1J1XH 3OF6A 5E8PA 5DJXB 3O6FA 5GGQH 3MACH 3WO3B 2F19L 5JDJA 3I9GL 2AK4D 1KB9J 3DHMA 1G0XA 1X5AA 4QRRA 3H3KA 2R2EA 3NTCH 4NQCD 1WJ3A 2PW2A 2VLRE 5I16A 2ITCB 4LSPL 4PBVC 4MJ6B 4O5LL 3H0TA 3IU4H 2J4WL 3VH8G 1JYWA 4FNLH 2C4XA 5ABDE 4GSDL 1MWAH 3QRGL 2AEIT 1LK3L 3NCBB 3K3QA 3V6OA 1D9KB 4HK0A 4G6ML 1OGTB 4DZ8A 4DEPC 1J05B 2ZCHL 5FA3B 5CILL 4WW1B 1KJMB 3KNBB 2V5RA 4H0HB 1NDGB 4JR9L 4LKXA 1YPZE 4MCYB 3NIGE 2JELL 3QDHA 4JGMA 5CZVH 3WXWH 4HWBL 4EBQH 2VZTA 3LS5L 4WEBH 2IGFL 4HBQA 5KVDH 4LCWB 4HQQL 4L9LB 3D6GA 4OCWH 5E4IA 4FMFA 2FWOA 5B8CB 1RV6X 3VH8A 3SEPA 3F58H 3L3DB 3RL1A 1EUUA 5IJVB 1NUGA 4OTXH 3RWDB 1AGBB 1WFNA 1G7IB 5E9DE 5TE4L 3VDCA 1FVEA 1CD0A 2DL2A 3SDXA 3VCLB 4H25B 4I2XA 1FYTD 1CL7L 3S35L 4IRJC 3E2HC 3T65A 1WBYB 1KN4L 3KVQA 2FEEI 3ZKND 3GJFA 3I3BA 4XNQA 3D0LB 1AD0B 1Z3GL 3LB6D 4M7KL 1UJ3C 4CU8A 1XF5A 3BMVA 5CBAA 4ZFFB 4KJYB 1TNNA 4OI7A 3ARGC 4P4KC 1F90L 3GSUA 3TF7A 2IBGA 3BXNA 3IJHA 3I6LD 3FB8A 3U4EA 4OZIB 5EU4B 3AAZB 4ZTPH 2H2SC 4NRYB 4F33B 3MXWH 3S36X 4M48H 4ODVH 4XNUH 4EIGB 4OGAD 4UBDC 5D1XC 5FO7B 1MY5A 3O3AA 1GOFA 5C9JB 7FABL 3C09B 2GFBB 5A3IC 3QDJB 1IGJA 4W6YB 4EXPX 3HI5H 5BXFA 1LP9E 1U6AH 1UWEL 4HKBB 2ADGB 4NN5B 3BKMH 4HX1B 2VL5B 2C1PA 3AUVA 3ILPA 1NGPL 5EIIA 4O2CB 3IXAB 4OD1L 3TNNA 3MUZ1 4FP8H 1VSCA 1EXUB 4UOW0 4AL8H 5HHPA 4YHPB 3QIBA 2AKRB 3WMSA 1MFBL 4D8PA 1KPRB 5KVGH 4Q9CA 4B50A 5BRZE 4L4JA 3B5HA 1MVUB 2R1XA 2OQJB 4U4BA 4LLQB 4MWFA 2BNUB 3GGWA 4YGVA 1T7ZA 1LMKA 1J1PL 3TESA 1Q94B 5TQ0H 5KVMC 2VZ1A 1J87A 5DD1H 2HTLC 1DQDL 5B4MC 1OT2A 1R6VA 4NQED 5D70L 5AD0A 1KBGL 1BHGA 4Y1AD 5IBUG 3MA9L 4XCYB 4XBEL 4X8JA 3A6CH 3Q5OA 3DO7B 2H32B 5IBTL 1L6XA 3REVB 5FECA 1MJ8H 1PSKH 1S7XA 4PJBF 4KQ3L 2PXYA 5B39A 1EO7A 4JFXB 2VABA 2UYLB 5ACLA 1N59A 3EKCA 3QJFA 1T5WB 3DV4B 1XZ0A 3TV3L 4KJWD 2D3VA 2GKIA 4K8RD 1CDYA 4NPYB 3RPIA 3DRTB 4DJMA 1FN4A 3VXSD 3B6SB 3DI3B 4EKXA 5ADPH 1UZ6E 5I76B 3BISA 1A7OH 4OLEA 5IB2B 4Y5VA 4O2EB 1FG2A 2NW3A 3ROLA 5L2JB 1UADC 1YECH 4HUMB 1EAJA 2JE8A 4WI8A 3MROB 4PR5B 5DMKA 1J0JA 4H1LB 3QWQB 3WJJC 2GJJA 3LMJH 3QNXA 4JPWH 5ADOH 3BEVB 4Z7VE 2CD0A 1EA9C 1ZT1B 1NMBH 3PXHA 5DD3L 3U79A 4HT1H 1KTKE 3S5LB 1ZANL 2IPTH 2XQYK 5F9JA 1A7PH 5F21B 5IEHB 3OKDB 4PJHB 3P4MB 2X05A 4WEMB 1HE7A 2BY1A 4MB5A 3BZDA 4NIKB 5ACMA 3TA3C 2H6PA 3ULVD 1F8TH 1CL7I 5E4EC 1MCWM 4IHOB 1SMAA 1I3GL 3MLTA 5AZEH 4YHKH 1FNEB 1YZZA 4F7EA 5GIRB 5BMFL 1U8PA 3HFML 4N0UE 1JPGA 4F7MB 4O2FB 3HZVB 3MFFB 4NO3A 4U31A 1BJ1J 1FIGL 3S36H 4JO3H 4FG6C 1R3HB 2Y5TB 4ODWB 1P2CB 1P5UA 2CKBL 2I24N 1NC2B 1NCCL 5MEOA 3QDMD 3L3JB 1Q72L 1IGCH 4NSKB 2C4FU 5FDWA 1BQSA 3GI8L 5DO2D 4Z7UF 4WUUE 3INUH 4NC0B 5JO5A 1TJHL 4CAGA 1MFEL 5C7XH 4P2CG 1YMHA 1QSFA 3LD8C 5EUKA 3VXUA 2PTVA 1MRDL 3N9GH 4JM2B 2BNQE 2EYSB 4NJAH 5CS7A 1UWXK 5IVXA 3VXME 1OTUC 4TUOB 3AS3A 3C8HA 2YSSB 3V4VL 3CC5B 5IIEA 1PBYA 4GAFB 4DGIH 1PEWA 2XZCH 4GKSA 1OARH 2NY3B 3VMPA 5ISZD 4JQXA 1LEIA 4MVBD 4Z95L 3TO4D 4JLRB 1T04A 4WVRA 3CDGB 3C8KB 3NFNA 4XNXL 1N64H 5HI5C 4D3CH 5KS9E 2GJ6E 1RZJC 2B0SH 1G7MB 1S9VA 5DWUL 1CD1A 1TJIH 2NR6C 2OJZL 3AROA 3I84A 1FL3A 5SWQA 1ZXQA 2YHGA 1PAMA 3D9AH 3EO1B 1IC7H 1MNUH 1WICA 5LVEA 1TDQA 4MA7H 3V8OA 4D9RD 5I66A 2R23B 3D5OF 1A2YB 3TCLA 4YK4B 5HHMA 4NGHL 3RWCB 1Q9LA 5D7LE 3V5KB 3LQZA 2XOTA 3SGDH 1XF4A 2VDLL 3QXAB 2GY7B 1CWVA 3HC0B 2J8UF 3IS1X 4AH2B 4PJCE 2LV4A 1TTGA 2Q86A 5J1AA 5DEGA 4O4YH 1IAOB 2FATL 3BPLB 1RFDL 2P8MA 3GMPB 4Y4HC 5CZKA 2Y07H 5C0RL 3KPRA 2MPAH 1MUJA 4RISL 4K94H 4MAYA 3JVGA 3GKWH 2EE6A 1KTLA 1LK2B 1MCBA 1JTOA 3DIFB 3MLVH 2V2TB 2EIBA 1J86A 2HT3D 4KAQL 5L8LB 4M4RA 3VRIB 5FA4B 3U9PH 4CBPA 5E08H 2D9CA 3IGAA 3V0VA 1R3IH 3LEYH 2BVOA 2QHRL 3ARGB 4X0KB 3MRDA 1BZ9B 3BW9B 3TYFA 2B4CH 5E8EB 1KJ2B 2O5YL 4MNGE 1FZOB 1F3DJ 4YPGB 2LAAA 1BZ7B 2EDXA 5DSCA 4APQC 4YAQA 4JB9H 4KK5D 4M43L 4OZ4A 1OCWH 3MNZA 2QADB 3THMH 5HD8D 4OLWL 5DD5L 2R0WL 2BVYA 4F58L 4JFYB 1PY4A 5KSBA 4RFEB 4BSWA 2CXGA 1RQ5A 3P40A 4FXGB 1N8ZA 4U6YA 1R24A 2JIXD 3RKDD 1FVDA 1UA6L 2J6EA 1XFPA 1MJUH 1JZ5A 3DVGA 3ZE2E 1V3JA 2BVTA 3VU2A 5HVFB 4JFDA 5C08E 1BWMA 4UT7H 1DUYB 2WBJB 3SDDD 1HKLL 4BQ8A 1NKOA 1P4BH 1G6RB 2MWCA 2FJGB 4PRIA 3DXAE 4MQ7A 3WFEH 4R4ND 4YHNA 2H1PH 2MCG1 1Z5LA 4P2YA 2FLRT 4FQXD 2H9GB 4L1DA 1PKQE 1DBAH 1JMXA 3QUXC 3QHFH 4XPGL 4PJDA 5DMIH 2NY0D 1DBBH 1N26A 1DL7L 3KPMB 4OM1H 3ULVF 1RZ8B 4GOSA 1X6NA 4NQSB 3RDTC 2DQCH 4TVPH 3P4NA 2WWKO 3WD5L 5D2NC 2P5WE 1FCCA 3FO0L 5KAQG 4K3EL 1UJTA 4Y4KD 4UT6H 2YMXH 2J8OA 4MNQB 3T0VA 4LF3B 4QEGA 4GW5A 4YWGH 2PF6A 3EAKA 3TT1H 1YNTB 1U8HB 3L3GA 4JDVA 1GOGA 2R4RL 5GS1C 1G7QA 1AIFA 2ESVE 4OFYA 1I7TA 4F57H 4L29B 7CGTA 5A40E 1NFIA 2DQIH 3FT2B 4QHUB 1N7ML 3GO1H 1H3PH 3BH8A 4OD3L 5F72S 1FCGA 5ID1B 1AKJD 2BNQB 1A64A 4LVNB 2CXKA 1SEQH 3QUKA 3HUJF 4HS8H 1NAMB 1AFVL 4M5YL 2Y25A 3NH7L 4OBSA 3VXMB 1T7VA 3FN0L 4NUGH 3VI3F 5I1HL 1S7VA 4PUBH 1W0WA 5EUOE 3QQNA 3P77B 3AS2A 5F6IB 4Z7WB 3REWA 5AG8A 1N0XL 1RIHH 3SDCA 5KVFL 4JPKL 1OAZL 2J8HA 4JCLA 1WLHA 1IGTB 4P5MA 1I1AD 3ESVF 5EZOL 3FQXA 3S35X 3N85H 5DHVH 1XF2B 1N6UA 4ZPTA 2DYPD 5T3ZE 4LLMA 2DWEA 1CGSL 1FFQA 1VGKB 3BDXA 5DJ2B 2J6EH 1A3LL 1CGVA 2GJ6B 3TBSB 2ZOLB 4MJIA 1UWGL 3EYUH 5E2WH 4GAJL 1JGLH 2OI9B 3K46A 4WO4D 1Z9SA 1FGVH 5C0CA 4P2QA 5AYUL 3UTTE 4NZTL 3WKMH 5LAXB 1I7UB 2OR8A 4LSRH 4YPJA 5H37G 1FFOB 5C71A 2XV6B 1T5XA 1BOYA 3DX9B 3W11C 8FABB 5KBNC 3BWAB 2A74B 1YEIH 4HWBA 4LHUA 4HK3N 3DMMA 4PJCB 3X13B 4XCEB 4NKOA 1GGBL 1IVLA 1T1WB 4R2GC 3FO1B 1AGEB 1C5BL 4Q2ZA 5D2NE 2DQUL 3ZKSD 3MLPA 5A2JH 4HGWB 5D2LA 4F7CB 2WQRA 4QGTA 2FO4B 5SX4H 2DQJL 3W2DL 3HE7A 4L4TA 4WU5A 1E4KA 2D0GA 1Y6NR 4ETQA 1PKOA 3CXDL 5E95B 3S97C 2LVEA 1MSPA 4KQ4H 3VFPA 4K9EH 5FYJL 3EYFA 3P0VH 4LU5H 2EEDA 1AQDA 2F58H 5FYKD 1VHPA 4XWGL 2V9QA 5GJTH 3MREB 1HHKB 2F19H 1LDPL 4CMMB 4NRXB 2VIRA 3I9GH 2FX7L 2CDEB 2B39A 1DJSA 4G8IB 4LSPH 4O5LH 2J4WH 1ZVSB 3FN9A 5JXAL 4AG4L 1RULL 4FQJL 4GSDH 1HI6A 4PJIF 4PJGE 1H3UA 5ALCL 3NMEA 3QRGH 5D1QA 1LK3H 5JHDE 3KYAA 3PV6A 4G6MH 3QG6B 1WUNT 1HHIA 1KTDA 3KPPB 2DLFL 3DXAB 2ZCHH 3SBWA 2G5BA 3BQUC 5CILH 1FHGA 1VACA 5ICXB 4JR9H 1PKQB 3SCMB 2JELH 2D4FA 1IZJA 3PL6A 3UTSD 4HWBH 3HPJB 3ZDZF 1QQDB 4PJ8D 1M7IA 3LS5H 1XCQB 2IGFH 3RA7L 2GJZB 4XI5C 4HQQH 3RZCC 3OKYA 4MCZA 5C3TA 4R3SA 1X7QA 3R0NA 1HYSC 5ENWA 4WTWA 4OM0H 5HGHA 2XPGB 2Z35A 4L4VD 3TYGL 5EU3B 1Q9WB 3MV8E 3QEGL 4LDLB 5GSRA 3QA3A 4P5KB 1CL7H 3S35H 5HHQA 4M3JA 1HQ4B 1KN4H 3OJDA 4JRXD 1HSBA 5GXBB 4JRYA 5J13B 5H37H 5C0BA 4JREB 1Z3GH 1CGTA 3VFTA 4M7KH 1QFUL 1IKNA 5KANI 2GK0B 3VRJA 5E1HB 3QI9C 1S7UB 3B9VA 3ARXA 5DJXA 4RMQA 1JZ3A 1F90H 5EUOB 2MKLC 4RCAA 4BSVB 3ARQA 2K3TA 1I85A 2ITCA 1XMWA 4MJ6A 3TNMB 5JR1L 1I8MB 3RFZC 5M95B 3FB7B 5AAMA 3KLSA 1RK0B 1UACL 3TP4A 1D9KA 7FABH 1BQHB 5HHOB 1OGTA 4J3XA 4LGRB 3FB5B 1J05A 3S98A 3LN9A 4M9PA 5FA3A 4WW1A 5ETUB 1KJMA 3KNBA 3UAJD 1KB9K 4YFLF 2CDFB 4OB5L 4YR6B 1NDGA 4MCYA 1UWEH 3FQNB 4KUZL 1NGPH 4JO2L 4OD1H 3QPQC 3CFIC 5CIPH 4U1KB 1TLKA 4WTXA 1NGWB 4L9LA 5DTFA 4XP6L 1UG9A 3J8F7 5CFHA 3Q48A 1MFBH 1NFDB 4YO0B 3MX0A 2P5ED 5EULV 3MOQA 5B8CA 1ZT7B 2HT2C 3L3DA 2Z31C 2CH8A 3RWDA 1AGBA 1NANH 1G7IA 4FFVD 4GW1A 1GZQA 1F00I 3RDTB 3VCLA 3S3PA 1WBYA 1J1PH 4AZ8A 3TFKD 1BJMA 1AD0A 1DQDH 4E9LA 1HWHB 5D70H 2LAGB 1KBGH 5CGYD 4DKFL 3MA9H 1T83C 4HWZB 4XBEH 4ORZC 4KJYA 3HRPA 2VXUL 5IBTH 2A73B 1AJ7L 1AHWB 5C07E 4OZIA 3MUGB 5EU4A 3AAZA 1INQB 4KQ3H 5C0DA 3FJTA 3RTQD 4NRYA 4F33A 4IOFD 1CE1L 5FO8B 3Q1SL 1DQML 4DGYL 3TV3H 5JMOC 4M93B 3T2NL 1TPXC 5HYSG 3U2SB 5FO7A 5C9JA 3OQ3B 2JLLA 2GFBA 2EXYD 3NZHL 3QDJA 4AEFA 4OFDA 1JGEB 4JN2B 3P11L 1KN2L 4XH2B 4HKBA 2ADGA 2VLJD 5CSGA 4HX1A 4QYOB 3IXAA 2AK1L 4UQ3B 1IM9D 2VZVA 2Y1VA 1EXUA 4PJGB 2A1WL 2ZCLL 3I6KB 4YHPA 1RJCA 1JZ4A 2AKRA 1KPRA 2EDBA 3M07A 1Q38A 3KPSE 5HGGS 3MBEC 1NCAL 1RZKL 4QRUB 5DD3H 3K8LA 2OQJA 1ZANH 5HYSA 4LLQA 2QTEA 2BNUA 3HN3A 4OQTL 1Q94A 5DZLA 2ARJB 1I8KB 4C56E 4WFFD 4R2GB 3B8SA 4XCYA 4NWUL 3C8DA 1I3GH 5BMFH 5IVZB 2B2XL 3QB7C 4HMDA 3HFMH 4JFFE 4OCSL 3DO7A 3L7FB 2H32A 1WEJL 2RBLA 3REVA 2B5IB 1FIGH 4U2ZA 1AQKL 2A6IB 2YS4A 4JFXA 2CKBH 2UYLA 1NCCH 3DNKA 2CO7B 3RVWC 1T5WA 1AO7D 4YIQB 1Q72H 5DJ0B 4NPYA 3GI8H 3S5LG 3DRTA 5INDB 1ZV5A 3B6SA 1K4CB 1TJHH 1MFEH 3H9ZA 4ZMAT 3GI9L 2FH6A 5I76A 1A6ZB 5JZ7C 1MRDH 1U8KB 3X3FL 5IB2A 4O2EA 3TLRA 5L2JA 4XHJD 4D94A 5GS0L 3MROA 4PR5A 4OZGE 4WWKD 4NZJA 2ZG1A 2OR7A 5IB5B 1QRKA 3PDDA 4ZUWB 2EKJA 2HKHL 3M8OL 1W8NA 1OY3B 4I48A 4Z95H 1ZT1A 3C5ZD 4NQXB 2WV3A 3JWOL 3MRBB 4XNXH 3S5LA 3QBTB 1V3KA 1JRHL 4Y19D 1HK6A 5DWUH 2EC9T 3QRFM 4QHKJ 2GITA 3OKDA 2OJZH 3P4MA 4PJHA 1I9IL 3FOMB 4J3SA 4LSVL 1ZAGA 5SWZE 3L1OL 4OFKA 4OFVA 1KCKA 4ZUTB 4IHOA 4M02A 1FNEA 2DKMA 3F7VB 5GIRA 4E41B 4F7MA 1QACA 4O2FA 3HZVA 3MFFA 4NGHH 1P6FA 4NZDA 3NGBB 2Y5TA 5F96L 2FBJL 2VDLH 4KH2A 4A2LA 1WBXB 1P2CA 2UZIL 1NC2A 1P53A 1P7QD 2H32H 1PVHA 2FATH 4YHYB 4NSKA 1RFDH 5TDOB 5KANG 5C0RH 5EU7E 1ZS8B 2QQKL 4ZS6C 4HGKC 2UUDH 3VWKB 5HVWA 3BGAA 4JJHA 4QLRA 3AMLA 2YA1A 5C07B 3QO0B 4JM2A 4KAQH 2EYSA 5I1GL 3WFHB 5ITBL 4EN3D 4TUOA 2QHRH 3VWJD 2UV3A 1MCRA 2YSSA 2ID5A 2CO6B 2O5YH 2AXJA 4R4FL 3CC5A 1UKQA 2RIKA 2NXZC 4F2MB 4M43H 3BN9C 4XNYL 4OLWH 5DD5H 2R0WH 1QFPA 2ADFL 4F58H 4U0RB 3CDGA 3C8KA 2VLLB 1DLHB 4RNRB 1G7MA 4KKLD 2R2CA 3HLAB 1P7HL 4Y2DD 3UPAA 3X17A 4LGPB 5BV7B 5D7JC 3DVIA 3EO1A 2R1YB 1UA6H 5C86A 3LIZL 1T3FB 4JDTL 5CJOL 2I07A 3STLA 1C12B 4JJ5B 2R23A 4PJAE 1A2YA 4UMGA 2Q6WB 3KPSB 4PRDB 3RWCA 1PDKA 2FHBA 1HKLH 2PYFB 1MVFA 3V5KA 4GBXB 2JJSC 3QXAA 3TPKA 3HC0A 4AH2A 3EFDL 1YJDC 1U3HB 1G7LA 3DJ9A 4IRSC 5FXCH 1NUFA 2N4IA 1U3ZA 3T0EC 3GRWA 1GGUA 3GMPA 4C56B 3DWTA 3NA9L 4XMKL 4XPGH 1YMME 3CFJB 3K80A 2B1HL 1DL7H 5JHLL 5F7EL 1LK2A 3DIFA 5E2UL 3LKOB 2V2TA 3WD5H 1M1SA 3H9SB 3FO0H 4K3EH 3VRIA 5FA4A 4GRLB 4F9LC 2WANA 2A6DB 2P46B 4M62L 1S5HB 3OL2A 1TNMA 4MQXD 1QR1B 3AMKA 4X0KA 1BZ9A 3BW9A 4JHZA 5DVOA 3TZVD 1KJ2A 4YPGA 2GT9B 1FZOA 4BJLA 3ZT7A 4LDOB 1NBQA 3KWWB 3S37L 4KVNL 1PG7W 3DRQB 1HH6B 1N7MH 5TE6L 5T1LD 2CJUL 4OD3H 3SKJL 3D39B 4JFYA 1TPXB 1JTTA 2QQLL 4M5YH 1AFVH 4N8VB 3L5XL 3NH7H 4RFEA 1TVDA 4MXQA 1BECA 3FN0H 5I1HH 2VSCA 4OZGB 4RAHA 4ZXBB 3S4SB 3VFMB 2C3HA 1EBPA 3MV01 4NCDA 3O3DB 5E6ZA 3L95B 1CLYL 1JRHI 1N0XH 3V0WL 5KVFH 2DJUA 4JPKH 1OAZH 1VADB 4Q9BA 3JTCA 5EZOH 5DVLA 3I50L 4HIJB 3MGAA 2HT4D 3QCTL 4DKDC 1H3GA 1DUYA 5FYLE 5BS0B 2WBJA 3KS0H 1CGSH 1G6RA 2FJGA 1A3LH 5LBSL 3DSNA 1KPVB 5IFJB 3O4LE 1UWGH 4GAJH 1H3XA 3HB3C 4QNPF 1SY6L 3W82A 4Z0BL 5TDPB 5AYUH 2H9GA 4NZTH 2XFXB 2H26B 4R0LB 4F15B 1WZ1L 1D5IL 2XN9D 1MFCL 3F65A 4PY8I 3GM0A 4X9GA 3KPMA 1RZ8A 4J12A 3F62A 2BVPB 5GGTL 4NQSA 4PJ9D 1A6VL 2D7NA 4AENB 4GG6A 3PGFL 4FMKA 4K8RL 5EZIL 4IBLT 5IV2B 2E6PA 4MNQA 4LF3A 1D6VL 3CX2A 5DFVC 4HAFA 4JZJC 3VRLE 1GGBH 2NY6C 3RHWK 5JOPE 3BIAX 3D2UB 2YA0A 3QFJD 1YNTA 3KPNB 5C09D 1PYWB 2DQUH 4QHMB 1ZA3B 4HULB 3RIAF 3SE4C 1RK1B 3EDKA 4L29A 3RX5A 5D5MF 3V0AC 2Q1EA 3MO1B 4QHUA 2DQJH 4KK6D 3W2DH 3FFCD 5ID1A 5IW6B 2AEQL 1FZJB 4HH8A 5JXEC 1NAMA 4EI5D 4POYA 3CXDH 1LE5B 3MRFB 1WV7T 5TPWL 1HILB 2DBLL 4Z7OF 5JW5B 3EJYD 3P77A 1KJVB 4Z7WA 4ELKB 2Z91B 5FYJH 2DWDA 1IGTA 1KXQE 3G9VA 1XF2A 4R97C 2Z0BA 1Q9KB 4KDTA 2A0LC 4QWWD 4XWGH 1ZLUK 3RVVD 3SJVD 5BV7L 1VGKA 5DJ2A 1O7SA 3TJHA 1PFCA 4LCYB 3TBSA 2ZOLA 4H26B 4YFEA 1LDPH 1T2QL 2ERJC 2ZG3A 2FX7H 1OAXL 3MRQB 2OI9A 4XP5L 5I6XB 3BGFB 1T4KB 3ORJA 4X6CB 5LAXA 1I7UA 5T1KD 3JBG7 2AERT 35C8L 1F2XK 1FFOA 5JXAH 4AG4H 1RULH 4FQJH 5DRXA 3DX9A 3ULUC 5ALCH 8FABA 1DDHB 3BWAA 2A74A 1UCTA 2OM5A 1H3VA 3QAZB 3I3EA 1MJ7L 2DLFH 1T0MB 3K81A 4PJCA 3X13A 4XCEA 5HI4D 1MCLA 1T1WA 3LN4B 3FO1A 1AGEA 1CK0L 2IAMB 2KQNA 1I7ZB 5IHZB 1OTTC 5F7HA 4HGWA 4PRHB 1YMMB 3RA7H 3VFNB 2E7LA 4F7CA 3T3PF 2FO4A 4LQ1A 4RGNC 3GBNL 5EN2B 5HGAA 2IADB 4ODHH 3KAAA 4RSVA 1A02N 2XYCA 3RAJL 3B5GA 1E27B 1NKRA 4TOYL 5HDBE 3B3IB 4EXKA 3TYGH 3QEGH 3MBXL 4RZCA 5EBWB 1RUAL 2EIZA 5DUBB 2OXGA 3K2UL 2VR9A 2YPKB 4TN9A 3F7YB 3IDGB 1TXKA 5B3JF 5J4MA 1I3UA 1OWWA 1VERA 1QFUH 4S1DD 4YDLB 3ARED 1GOHA 4Y89A 3MREA 5T1DL 4GAYB 1HHKA 5T5FL 3PE9A 2W0PA 4CMMA 5D1ZB 2PR4L 2CDEA 5SV4A 3V52L 1VENA 5IESL 3O6FD 2OJEB 4G8IA 3ZDXF 3K0WA 2KZWA 3PP3K 3T0BA 5JR1H 5FGBA 5E99L 1ZVSA 4QRRD 4R4BB 4FA8A 3TVMC 2CIIB 4FFYL 3QIUB 3HI6L 4M7LT 1IC4L 3PWUB 1A22B 1UACH 4W4OC 5MERB 1YYML 3QG6A 4CRPA 1T2XA 3KPPA 1VFUA 3DXAA 4Y16B 3ULUE 3MOAL 4RX4A 4OB5H 5ICXA 1T66D 1PKQA 4U6VL 3SCMA 1OF2B 3HPJA 2X9XA 4KUZH 1QQDA 5ANMA 4ISVA 1XCQA 3FCTB 2HA1A 2XTJB 4JO2H 4KTEL 3QUYB 4BZ1L 3DX7B 2GJZA 5D96C 4AJ0A 4XP6H 5BZWB 5J1SC 5HDOA 3DURB 3AS0A 4JHWL 2XPGA 3GB7B 3EJZD 4RGNE 5EU3A 3RWEA 1Q9WA 1QLRB 4PLNC 3T8XA 1TVHB 4I1NB 3T4AB 4P5KA 1ACYL 3GSXB 1KG0B 1DEEB 1HQ4A 3V7AE 1EFXD 1WAAF 1QHOA 2QJDA 3CFKA 1EVUA 1NH6A 4DKFH 2GK0A 1HOCB 1S7UA 3FTGB 2VXUH 5A2LH 4N90E 1AJ7H 1VGEL 5I19L 3MRGB 1XGPB 3V5DB 2UWEF 4FRWA 3GKZA 5F9DC 4BSVA 3TNMA 1I8MA 4JKLA 1OD7A 1CE1H 1RY7B 5ESQA 3QXVA 1JZ7A 1DQMH 4DGYH 3FB7A 2QQNL 3T2NH 1RK0A 4H20L 4PGBB 1JUFB 5JTWA 4AMKL 4LPTA 4P2RE 5HHOA 1BQHA 4LHJB 4V1DE 4JFOB 3FB5A 3WNNA 3NZHH 4KRPD 4HG4J 3QO1B 1MCEA 5ETUA 3UTPE 2NY4B 3OZ9L 3P11H 2YD3A 2CDFA 1KN2H 1FC2D 4MA8L 3SN6N 5L0QB 3FQNA 3HZMB 1FG9C 1WCQA 1M7DA 2BCKB 1J5OL 4L8CB 2AK1H 1FIEA 4PLKC 3C60B 3MJ7B 3ECBB 5EOTB 4U1KA 1NGWA 2A1WH 2ZCLH 1MQ8A 1NFDA 4YO0A 4X5LA 5C0AE 3VXRB 1ZT7A 3QIBD 1UB5B 2NY2D 1NCAH 1RZKH 4XAKE 4NCC1 1NBYB 1DANT 1XGTB 4LLWB 1RZKC 2DI9A 3VA6A 2BDNL 4P2OC 4QGYA 2GIYA 3KS0J 5BQ7B 4OQTH 4ONHB 4ELMF 5E56A 1HDMB 4NKDB 4JZJB 2XXMB 4MXVE 1X5FA 5EU5B 2CKNA 2P44B 4FG6D 4NWUH 4HWZA 1QP1A 2B2XH 2HRPL 2VLME 5D6DC 4OCSH 3EDEA 3G5VB 5BVPL 1WEJH 2ZSVB 1JYXA 1AHWA 1AQKH 4FN0A 3MUGA 2X6MA 3WV0A 2XA8L 3HE6A 1INQA 1HCFX 1AI1L 2Z8VC 5E6IB 3RVXD 3QDGE 4HUXA 5JW4N 3U36B 4WHYG 1F42A 5FO8A 2PXYD 5CSBA 2SEBB 1CFTB 1KUMA 2MTPA 2EDYA 5JNYA 3LKRB 3MV9E 4KK8D 3U2SA 5E7FA 1JGUL 1M6OB 1VESA 3GI9H 1JGEA 5KZCB 4K3JL 3W0WD 3X3FH 5BCAA 2IJ0C 3F5WB 4XH2A 1ND0B 4I0PB 5GS0H 4G6AC 1TETL 4QYOA 3NIDF 5EOCL 4UQ3A 4CN1A 4O58L 5D7KD 5J12C 3IDXL 3I6KA 4J8RB 1QPPA 1QBML 5EU6E 2FJHB 4LCCC 2HKHH 3M8OH 3R0MA 3CDFA 2N1KA 2NR6D 4QRUA 3S37X 3JWOH 4D9LL 3AB0C 3BHBB 4LL9A 3VGHA 1JRHH 5HVGB 4KROB 4IRZL 4PP1D 4J3WA 1I9IH 4LSVH 1FNAA 1NGXB 2V9TA 2ARJA 1I8KA 4HBCL 3L1OH 2A2QT 1CFNB 5IGXL 1WFOA 3PGDB 5IVZA 4UOJA 3L7FA 1W0VB 4LNVA 1J8HB 4P23B 5DFTA 2YR3A 4RGNB 3O3BB 2A6IA 3QEQE 4I0CC 5F96H 2FBJH 3PWJB 2UZIH 4NP4L 1UQSB 4QOKE 2COQA 4YIQA 4HHAB 3VFRB 4FQLL 3D0VA 5DJ0A 1VEOA 3TO2B 4JCMA 2VYRE 5INDA 3SDXF 4GW4B 4XTRD 2QQKH 4HMCA 3GDBA 1EEZB 4WENB 2AJUL 2VERN 3MJ9A 4NKIL 4DGVL 3L3HB 1A6ZA 1U8KA 4PJFF 3SE9L 3IJSB 1QSFD 5I1GH 3VXUD 2G5RA 4MZ2A 5ITBH 2Q76B 2NXYD 1NGZA 5CJBA 4KKAD 5DVNA 5IB5A 4R4FH 5MENB 1IEAB 4H88L 4CNIB 4ZUWA 4V1DB 4XNYH 4NQXA 2ADFH 1RHHB 3WFDL 3HG1D 1S9YB 1JF1B 3SDAB 2NTSP 3SY0B 4N9GB 1A4JB 2XY2A 3FOMA 4WHYH 3MGOB 3TPUE 5EO1B 3B9EA 1CQYA 4M8VA 4NQDE 5L7XL 1RMFL 1W8OA 1T1YB 3LIZH 4JDTH 4M7ZC 4M6OL 5CJOH 3OPZL 3PHQB 3F7VA 5C0AB 1CG9B 4E41A 2EZ0D 4PJBE 4DQOL 4X7TB 1QBAA 4C4KO 3DYOA 1PZ5B 5HHMD 2ITDB 3EFDH 3LB6C 1OAYL 5J0BA 5GGTA 3AM8A 5IG7B 4QKXB 2ATPB 5CGMA 1MJJB 5TDOA 3NA9H 3DUSA 1OM3L 1B6DA 4XMKH 5IEKB 4TVPD 1X5ZA 1NLDL 3BD4A 5AUMB 5GS2H 2B1HH 5JHLH 3KPRD 5F7EH 3NCYS 3VWKA 3T4YA 5E2UH 5F7WC 4CJ1A 5KN5B 1QVOB 1NPUA 3QO0A 3X3GL 3P73B 3G6JB 3WFHA 4NNPL 2AK4E 4M62H 4OGAC 3MLSL 1U58B 3WNMA 1YY9D 4NQCE 4FQ1L 1MREL 1PZUB 3ARYA 3EO9L 2YEZB 3ZDYF 6CGTA 2RFXB 4GXVL 3SGJA 3MV9B 5FFLA 2QQQA 3S37H 4B7IA 4KVNH 4F2MA 5TE6H 2VDKL 4K3GA 2CJUH 3SKJH 2E8ZA 4ZSOE 2VLLA 1NJ9B 1O5DT 2QQLH 4L3EA 1DLHA 4RNRA 5F6HI 3L5XH 2WNGA 3HLAA 2A9NL 1WISA 2FX8L 4HUUB 2LE9A 5EG6C 4G59A 1CLYH 4G42B 3RWHB 1SVZA 3V0WH 3WIHL 1T3FA 3CVHL 1UXWA 2YRLA 4NKQB 1C12A 4JJ5A 5EC2B 5EU6B 3I50H 2Q6WA 5C0FB 3QCTH 3CH1B 3KPSA 1P4IL 2FECL 3AC0A 2PO6B 2ICES 4CN6A 4JRWA 3QHTC 4GBXA 1B4JL 4JFDD 4DTGL 1O7VA 2H8PB 5LBSH 5TE7L 1D7FA 1FNFA 2MJWA 2DQGL 5CD3B 1U3HA 3LQAL 3EDFA 1FYTE 3MLXL 4MA3B 1SY6H 3OAZH 4Z0BH 4C56A 4FQCL 4ZFGL 3EHBD 4Z7UE 5KSAB 5C70A 1WZ1H 1D5IH 2EC9U 1FSKB 4XPBL 1GGCL 1MFCH 3CFJA 1H0DB 1CFQB 3V6BR 2C3VB 2RR3A 3LVEA 4DK6A 5GGTH 1A6VH 3LKOA 3PGFH 3H9SA 2NY1B 4GRLA 4K8RH 5CJXC 3C2AL 3I6LE 1S5HA 1D6VH 4K8RC 1QR1A 4LSSL 3EDDA 1KIPB 4DVBB 3CCHB 1AGFB 3NCMA 2GT9A 1Y6MR 5L88L 4ZDHB 1T03L 2OMBA 2X1QA 5IB4A 3KWWA 3BWUC 2W0KA 1QBLL 1ZHKB 1JNHB 3DRQA 1HH6A 1QLFB 1ZOXA 5EO9A 4OFYD 3O9WB 3D39A 2B7DT 1TTUA 4GRWB 4RMWA 5ESAB 4KMTL 2AEQH 2VDQL 3UPCA 4N8VA 2AQ2A 5HHNA 4D9QD 4GKZA 4U7MA 3U48A 5EZLB 4ZXBA 1BMGA 4OZGA 5TPWH 1G84A 2MQ3A 2DBLH 3VFMA 3UDWC 2JCCA 3L95A 1YY8B 1IKFL 4F37K 3BO8B 4DFIA 4G3YL 4NUJB 1ZSDB 5T33L 4HIJA 3L3IB 5HHVL 5IVXF 2WP3T 1BZQK 3SDCD 5HVHC 1LILA 5BV7H 1FAIL 3PF2A 5BS0A 4U33A 4YUEL 5FUZL 5C0EA 2J8UE 4JKKA 1KPVA 4OF7A 4HLJA 5IFJA 3QP3A 3WLBB 1T2QH 3ZKMD 2XQYG 3ULVC 1OAXH 5GQBA 2NY5L 4XP5H 4MJID 2R2BB 5TDPA 2XFXA 2H26A 4R0LA 35C8H 5C0CD 4NQEE 1P7KB 4XP1L 8CGTA 1BF2A 2ICWI 4PLOB 4Y1AE 2BVPA 3M17B 4AENA 3ARRA 4RBPK 5F7MC 4X5WB 5DFWH 3I02A 2VLKD 1WQVT 5HDQL 1MJ7H 5IV2A 5GRUL 2JJVA 5DO2C 1AP2B 2GAZB 4LP4A 1CXIA 4XI5D 3D2UA 3KPNA 3DMMD 1CK0H 1PYWA 3FRPA 2MHAB 4KI1A 4TTDD 4QHMA 1ZA3A 1DQTA 2P43B 3ZZ1A 4F7PB 1RK1A 4N0CC 2E7CA 1EO8L 3MO1A 2ADJB 4QTIL 3GBNH 4DCQA 3VXSE 4X9BA 3EOAB 3RRQA 2G9HB 5IW6A 1FZJA 3RAJH 4TOYH 5F1IB 2AK4B 4QCIB 1LE5A 3MRFA 3HE7D 4L4TD 1F13A 1HILA 5JW5A 1OP3H 3C5SB 4G8EB 3MBXH 4WWID 1RUAH 3MNWB 1KJVA 3K2UH 4OKVB 4ELKA 4TNVF 2Z91A 4MVBC 5K93A 3PNWB 1CXHA 1H8NA 1Q9KA 4IMKC 4LIQL 5T1DH 5T5FH 3T0WA 3V8CA 4G43A 4H26A 2RGSA 1BFVL 2EO9A 2PR4H 3V52H 5C3LD 3MRQA 3MOBL 3ZTJG 5IESH 3BI9X 4I13B 1MCNA 2F54B 2IAND 1A0QL 1T4KA 4HPYL 1MHPL 4X6CA 4DOHB 4JQVC 4TRPH 5E99H 3Q6GL 5KSBF 3ULVE 4OGYL 1G7HB 4FFYH 4WDIB 1KJ3L 3HI6H 1IC4H 4D0CB 1DDHA 1NMAL 5CEZL 1X9QA 5EBGA 1YYMH 1XGUB 3E6FB 4WUKL 5D1QD 1T0MA 3BPOC 1HXMB 1FH5L 3MOAH 3QPQD 4JVWA 1J0KA 4A6YB 2IAMA 1I7ZA 4G80B 4U6VH 3IB4A 4Z7UB 1DFBL 3QDME 4PRHA 1YMMA 3V6FB 5B3NA 3VFNA 4P46B 4KTEH 4BZ1H 5GS3A 1S9KC 1ZTXL 2Z31D 3PL6D 5FEBA 2R1WB 2AQ1A 4OIIL 3GMOA 5EN2A 4UUJB 2V2WB 1MLCB 3T0DA 2IADA 15C8L 1KYOK 4MDJB 3HUJE 4JHWH 4LEXL 1EJOL 1E27A 3VI3E 3QULB 4PJDF 4FXKB 3B3IA 5EBWA 1ACYH 5DUBA 4S0UC 4KK5C 4JFPB 4XXCA 2VSDA 1HHGB 2YPKA 2YD4A 3F7YA 3IDGA 5HD8C 3MLUL 1GGIL 4RFNC 3L5HA 4PJXA 2VQTA 3KXFB 4W81A 4JRYD 1KLFA 5C0BD 2VE6A 2AXGB 5ISZE 4IS6B 4GAYA 3L5JA 5SWSA 5EORL 5E8NB 4U1HB 4J3OC 1ORQB 3RY6C 1VGEH 5D1ZA 5I19H 2GTZB 3MV7B 2XQBL 3MJGX 1A5FL 2VO5A 4U1NB 1VA9A 4HWNA 5DXWA 1C08B 5CEYB 1BF8A 2R2HB 4LRIA 3SDDC 2KZ1B 4R4BA 5JPNB 3K74B 2CIIA 3QIUA 4I77L 2E6JA 2LU4A 2QQNH 4D9RE 3PWUA 3SKOB 4AMKH 2ILLA 5KTEL 4R4NC 5MERA 2J8UB 5KAQF 3TWCL 4FQXC 4Y16A 2FCBA 1CXKA 3OZ9H 4WI2A 4RRPG 2NY0C 4ETYA 2FBOJ 4MA8H 2BXZA 3DGGB 1OF2A 4PFEA 3FCTA 4TSBL 3QUYA 5JIPA 3DX7A 1ZGLB 3SKNB 4E42A 5BZWA 3P4OB 3H2WA 5AG9A 3DVFA 2RB8A 3CSPA 4S1QL 4PJ5A 3GB7A 3ZTJH 3LDBB 1FQ9C 1QLRA 3CVIL 1TVHA 2VNCA 3T4AA 1K3IA 1YEJL 4RMTA 2BDNH 3GSXA 1KG0A 2VDNL 2XG5A 3ALPA 2C1OB 5J56B 5EWIL 2HFFB 4RRPA 3VXSB 2P45B 4PJ7B 1C16B 1MI5D 1MCOL 5DDHB 1HOCA 2HRPH 3S3SA 3FTGA 3WHE1 2OK0L 5BVPH 3U30C 5D2LF 5DUML 2AJXL 1OVZA 3MRGA 1XGPA 3V5DA 2XA8H 5L9DL 1I1AC 1AI1H 3UZEA 3C6LA 2BZDA 3U7YL 1JWMB 2ZUQC 4PJIE 1IC5L 4RA0C 4L8SB 5GHWL 5CKGA 2YKLL 2BXYA 4PGBA 1JUFA 1GIGL 5F97E 2NZIA 2XKNA 5E24E 3BP4B 4LPUA 4WO4C 4JFOA 2WUCL 1JGUH 4LLAA 1GYAA 1IEHA 1KV3A 3QO1A 4K3JH 1X5GA 3VFWB 5DHXB 3ZDZE 5D7IF 2EDFA 2F53A 1CXFA 2F15A 2R0KL 1TETH 3HZMA 4PJEB 2J5LC 4J1UB 2BCKA 4L8CA 5EOCH 2GY5A 2O5XL 3C60A 3MJ7A 3ECBA 4U3HA 4O58H 4UQ2B 5EOTA 1JGDB 4CMHC 3DYMA 4ZFZB 3IDXH 4A6YL 5HY9B 2VAAB 3K1DA 4JGUA 4MNHA 4AQ1B 1QBMH 3VXRA 3RNKB 2P1YA 1UB5A 4YH6A 5CGTA 3WDJA 5IQ9B 4HG4K 3OV6A 4D9LH 1NBYA 4ODTL 1XGTA 4LLWA 5CJQL 3S9DB 2BY2A 4IRZH 5BQ7A 1VFAB 4ONHA 3QDMB 2V5TA 2WIMA 4RGMB 4TNWF 4ESKA 2Q3ZA 4I18C 3EO0B 4NKDA 3LKQB 4HBCH 5EU5A 3VG9B 5IGXH 3ARTA 3WFCL 3FB6B 3HUJB 4QHLB 4NNYB 4QRPB 3G5VA 1INEL 3JWDL 2ZSVA 4P4RA 4OUUB 2UY6A 4LVOC 1KIUA 1J1XL 2ZUWA 3W5NA 3IDYB 1B0RB 5E6IA 3DI2B 4NP4H 2P48B 3VJ6B 2CQVA 1R5WA 1G1CA 4FQLH 2SEBA 1CFTA 1MFDL 3BKCL 3LKRA 4N8PA 5J7CC 4Z5RB 5J11B 3WLWD 2F8XC 1HEZA 2AJUH 3TO4B 4NKIH 4DGVH 4ONOA 5D71L 4BFEA 1JK8B 1JPST 1DBJL 3SE9H 3IAGC 1ND0A 1QSVA 3K4ZA 3RX7A 4I0PA 5IMMB 2DDQL 5BW7A 1CLOL 4NFCA 3H9YA 4PDCE 5EBLB 2G75B 2X89A 4F7TB 4J8RA 3ILQD 3ZSSA 4H88H 1JI1A 2FJHA 4ZAKB 5JQHC 3WFDH 3BHBA 4PJ8C 1NGQL 3WIHA 1X5YA 1GJIA 4WJ5B 4HXBL 4IJ3B 3T2QA 4Z76B 3RNQB 1NGXA 4X4XB 3VFSA 2OL3B 4FOMA 1ZT4B 5L7XH 1RMFH 4X6FA 3BVNB 4M6OH 4L1HA 3OPZH 2XICA 3DLQR 5I1AB 1EAPB 1W0VA 1YNLL 1J8HA 4P23A 4IRSD 2EIEA 4DQOH 5DUPL 1MIEL 3O3BA 1LHZA 3KJ4B 3T0ED 1EFQA 3PWJA 3VFOB 4NN6C 3CDCA 1OAYH 1PD6A 3FFDB 1UQSA 1IQDB 4P3CL 1C5DB 3D3VB 4HHAA 3VFRA 1NC2D 1DANU 5J9PB 1D5MB 3RUGA 1OM3H 4GW4A 3GMLB 1NLDH 5FYKE 4P5TB 3VDAA 1EEZA 1ULVA 3QIWB 3WHXB 1OT1A 1JNNL 3L3HA 4QT5A 5I75C 3X3GH 4KFZC 4KKCD 4NNPH 4Z0XB 3S88L 3MLSH 4JM2D 3FN3A 1BOGB 4M6NL 1LEKB 2AV1B 4JDZB 4FQ1H 2H45A 3SE8L 1MREH 4XWOC 2EDHA 3EO9H 4BUHA 5MENA 5BVJB 4GXVH 3I6GB 4OZIF 2BK8A 5CP7B 2L7JA 4CW1B 3EOBB 4Q9QL 4CNIA 1XGRB 1RHFA 2CLZB 3UAJC 4UNUA 4V1DA 2BC4B 2ZCKH 1BX2B 2VDKH 3KYKL 2NY3D 1JHTB 1RHHA 1UKTA 4FS0A 4M61A 5DRNA 4XP9L 1S9YA 1JF1A 3SDAA 2XT1B 5FM5O 2VUOA 3PWNB 2A9NH 4N9GA 1A4JA 3MGOA 4FQXB 4ZQKB 2FX8H 5DZNA 4F9PA 2JF1A 3UTSE 1KB5B 4JFQB 4EQ3A 1A7NL 3IKKA 3WIHH 1T1YA 4NBYB 2DAVA 3CVHH 4XVUD 4OF8A 5GPRA 3PHQA 3UBXI 1CG9A 1QNZL 1P4IH 3BZEB 4KWUA 3HB3D 4QRSB 3C08L 4HS3B 1JYVA 3TFKC 4X7TA 4WV1B 1PZ5A 1B4JH 4Y4KB 4DTGH 3PWPB 2Y7QB 1RJZB 5TE7H 1JN6B 2JJTA 2ITDA 4L4VE 2I25N 1SJVA 1EGJL 2DQGH 3LQAH 5CGYC 3IFOB 5DA4A 3MLXH 5IG7A 4JRXE 2ATPA 1GC1C 3DPBA 3LQAC 1MJJA 4FQCH 4ZFGH 2L7UA 4Q97A 2X4UB 2ED7A 5IEKA 4XPBH 5I1LB 1GGCH 5AUMA 3F12B 2A6JB 2BJML 5D7SL 3RTQC 5KN5A 1QVOA 1H5BC 4IOFC 4LSQL 3P73A 3QUZB 4L8DB 3G6JA 3C2AH 2K1MA 2X2YA 4HH9B 1U58A 4W4NA 4LSSH 4YZFF 4ENED 2YEZA 3VE0A 5L88H 1T03H 2RFXA 1U92B 2EXYC 3CU1A 5C6WH 1QBLH 2DKSA 4QY8B 2NZ9D 3BP5B 3TN0B 1IRAY 2O26U 3DGCR 4K55A 4MS8A 4KMTH 1NJ9A 2VDQH 2QADD 2PTUA 1T7XA 1MLBB 2Z9TA 5FYJD 4R26L 3L7EB 3MFGB 4HUUA 3KYMA 4MXQD 1FZMB 1IKFH 4G42A 2BOCB 3RWHA 1KCVL 4OCLC 4WI7A 4G3YH 3ZTNL 3GHEL 1VB9A 5EC2A 5T33H 5CEXA 2J5LB 5HHVH 4S0TD 2WK2A 1BIHA 2EECA 3CDYA 3F7RA 3MA7B 2JTDA 1MCDA 1KC5L 1FAIH 3K4AA 4KRMB 2PO6A 2C26A 1WWCA 2FR4B 1P9MA 4YUEH 5FUZH 1S7WB 2H8PA 3ZYIA 1IBGL 4POUB 1WIPA 2WBJD 4Y4FB 5CD3A 4FFZL 2NY5H 4MA3A 4G9FB 1L8JA 4X9HA 1LDSA 2NY5C 5IJKA 5DK0B 3ERYA 5KSAA 2WWKT 1CE6B 3N06B 4XP1H 1H0DA 1CFQA 2C3VA 4PJHF 5EOCJ 3OKNB 2O5ZL 3PQYB 3OB8A 3DBXB 4D0DB 4HXAL 1KNOB 2I27N 3R8BB 3O6LL 5HDQH 5F7NC 4I3GA 5GRUH 3BT2L 1WGOA 5ITFA 1KIPA 4DVBA 1CF8L 1WFUA 1IAKB 3CCHA 1AGFA 3N0PB 4MNQD 3VFGL 1ZHKA 4OLZL 1EO8H 1JNHA 3BH9B 4UOW1 1G6VK 4QTIH 2CRIA 4XHJC 3SKMB 3O9WA 3WBDA 1N5AB 5I74C 5ESAA 5A16B 4LCUA 1CFSB 3QFDA 5IMLB 5EZLA 2IC2A 2QLVB 3KYNB 2VLJE 3V5HB 1YY8A 5SX5H 4Q6IB 5IHBA 4JM2F 3BO8A 1SJEB 5I71B 4NUJA 1ZSDA 3C5ZC 3WN5B 1I8LC 5JUEL 3L3IA 1AGCB 1PLGL 1LO3L 4PRPB 2J2ZA 4XMLL 3WNKA 1TITA 4YQXL 4JPIB 3FKUS 2C3WA 4Z7NF 4LIQH 1CICC 4U6XB 3OKEA 2M2DA 2ZG2A 3NAAL 4LARL 3OJVC 3WLBA 1BFVH 4JY5L 1CT8B 3TJHD 5CLWA 1KF9B 3MOBH 2DD8L 2BMKB 1A0QH 2R2BA 4HPYH 1MHPH 5K33A 1DN2A 4PJ8B 4DKAA 3OB0H 5C8JB 2R69L 4OIAA 1KCSL 3DETC 3JV6B 3Q6GH 1P7KA 3MRCB 4OGYH 4WFFE 2H3NA 1P69B 2WAHA 1BPVA 3ARDB 3IFPB 3NCJL 1KJ3H 3M17A 1NMAH 1GPOL 1UH4A 5CEZH 2VDPL 5A2KH 5FOBB 4WUKH 1JI2A 4L4VB 4OZHB 1FH5H 1SBSL 1AP2A 2GAZA 3ZT6A 5I18L 3SKUD 4JRXB 3FQRB 2AS5M 2MHAA 5EPMB 1AO7E 1DFBH 3DV6B 1OGAB 5D9SB 4C57C 4UV4L 1ZTXH 2B4CL 3DVNB 1BFTA 4MXWL 2ADJA 4ODUB 4GJTB 4OIIH 4J3UA 5C0IB 3EOAA 3F8UB 1SVCP 15C8H 1MAML 4EN3C 2G9HA 3VWJC 3VXPB 1A9BB 2E27L 4LEXH 1EJOH 5F1IA 1UENA 4QCIA 3S8WA 4KV5F 2HKFL 4LMQI 3C5SA 4G8EA 4K71B 4JFHD 3MNWA 4OKVA 4GRWH 3BPNC 2DQFB 5E1AA 3MLUH 1GGIH 4NQVB 3PNWA 5EFIB 4NNXB 4Y2DC 3Q6FB 1J0HA 3UPRB 4YBHA 4HF5L 1UKSA 4R6UA 1QTYT 5EORH 4Z7QF 1BJ8A 4QNPE 1RIVL 4UIKL 1T20B 2F54A 2XQBH 4BQCA 1A5FH 1JHLL 1HZHL 1DP0A 2PCPB 3UBXG 5MEQB 5JIIA 1WZKA 1G7HA 1BBJB 4I77H 4TNVK 4WDIA 2QV2A 4D0CA 3HR5B 3QEUB 5KTEH 2EXWD 1GSMA 3EJJX 2WZPD 1XGUA 3PG2A 3E6FA 3JUYA 3TWCH 3GSOB 5E94B 1HXMA 5I73B 4OCYL 3P9LB 3BEWB 4PLKD 5HYJB 4A6YA 3RVTD 1DSFL 3NVQA 2YUVA 3GMNB 4G80A 3GEWB 4Z7UA 2NLJB 5L2KD 4RX4D 1RJLB 4K7PL 1ITBB 3V6FA 5D5ME 5I1EL 4P46A 1G0DA 4TSBH 4MA1C 1X5LA 3SCMD 1YA5A 2VQ1B 2R1WA 3QXWA 1MFAL 3LEXB 2V2WA 4UUJA 1MLCA 1AR1D 4MDJA 4MHHI 4MQXC 2WMPA 3OTTA 3QJHB 2PTTB 4S1QH 2VH5L 3VGAC 3TZVC 4I5BB 2X44D 3QULA 4V3DB 4FXKA 4Z7OE 5DK2A 3U7WL 2FO1A 3TJEL 4UI2A 1N3NB 3CVIH 3E3QA 3MNVB 3UTOA 1YEJH 1E28B 1H5BB 3C6SB 4GG6F 1VFOA 1Y18A 4JFPA 5EBMB 2VDNH 2FEEL 4LLDB 2KUTA 4FTVB 4JANB 5FUOL 1SQ2N 3FT3B 5EWIH 4Q74A 3KXFA 4NO0B 5GJSL 5IP4A 4BK4A 3ARBA 4RIRB 2ARWA 1BVZA 2AXGA 4IS6A 1MCOH 3G6AB 2W65B 1NMCC 2D4DA 2OK0H 2G2RB 1QEWB 5E8NA 1XIWB 1ORQA 5DUMH 2AJXH 2GTZA 1T0PB 3MV7A 3WCYA 2VLJB 3MRKB 5IVOA 5L9DH 2VXSL 4U1NA 5CEYA 1UT9A 4Q6YA 2HT4C 3U7YH 3TM6A 3UMTA 1MHHB 2R2HA 4NC2B 2RHEA 3CPLB 5JPNA 1IC5H 5GHWH 3TH3T 2YKLH 2YUZA 5DD6B 1GIGH 3SKOA 2P4AB 4LPWA 1BJ1H 4Z7WF 2X4PA 4PV9B 2WUCH 5I30L 3QWOB 4G6AD 5HYIA 4MMXC 1R3KB 4XPTL 5HHOD 5GS0D 3MJ8B 1KLUB 3I3DA 3Q3GB 5IK3B 3DGGA 2R0KH 1U36A 4PJ9C 5GSVB 1G9ML 3T3PE 3PDGA 4W68A 2O5XH 5E00B 1ZGLA 3PWLB 3SKNA 3BJ91 4A6YH 3DOSA 3P4OA 3U46B 4Z78B 4ZFOB 3A6BL 3W39B 5BO1H 2K7QA 3OR7B 3TBWB 1NCWL 2VN7A 4XNZC 1NEZG 1MRCL 2APWA 2AAVA 4EUPB 1WFTA 4ODTH 5CJQH 1RIUL 3IT8D 3X11B 1J88A 5B3JE 5DS8A 4XNMA 2Y9RT 4UAOC 4KK6C 1EIBA 3ZYOA 4OV5B 2C1OA 2OLDA 3RPKA 2HFFA 5JPMB 3LSOA 5D6CB 3VXSA 4EI5C 4N9OB 4PJ7A 1C16A 1TMCB 3LAFA 3WFCH 5DDHA 5BOPA 1A6AB 1FV1B 4YJZL 2F58L 4N8CH 5C1MB 1INEH 3EJYC 3JWDH 3LKSB 3RGVB 1P84K 3RBSA 5DVMA 3ZDXE 4Y5XC 4WWKB 4N0FB 1PQZA 3K7UA 1JWMA 4OFIA 4G8GB 3HE6D 4QWWC 3RVVC 3QWRA 5DJCB 2AJZB 4WI4A 1NEZA 1ZK9A 2JKXA 5ERWB 4L8SA 1BLNA 1DVFB 4PBXA 1MFDH 3BKCH 3U6RA 3AY4A 3BP4A 4ZUSB 4GQPH 4HDIB 5D71H 1U8IB 5HPMB 1DBJH 4KMLB 3VFWA 5F9AC 2JB6B 2DDQH 4PJEA 4J1UA 1CLOH 5I9QB 4LLYB 4UQ2A 2XA3A 1JGDA 3MLZL 2IBBA 4ZFZA 3HCVB 2XN9E 3SGEI 2APTA 5HY9A 2VAAA 1CI5A 1QKZL 2V6HA 3FO2B 3OKMB 4HIIA 5HI4C 3RNKA 2YA2A 1RURL 3MRNB 1WTGT 5D72L 5DJ6B 3M1BA 5IQ9A 5IWLA 3FOLB 3PDOB 5DK3A 2XWTB 1NGQH 4LBEA 4C59B 4ZO7A 2F8VA 2I5YL 5HYEA 1WAAE 1ADQL 4OM0L 1P7QB 1N0LA 2CSPA 2W9DL 1VFAA 4JVPA 5DR5L 1L0YA 3HKFA 3QFJE 1F3DH 4HXBH 3EO0A 5C09E 1RJYB 3U1SL 4JFEA 4WRLA 1OSPL 3LKQA 3V95A 3O6ML 1L0QA 3WO4B 1AH1A 5CD5D 3FB6A 3HUJA 4QHLA 4NNYA 4QRPA 1EGJA 1KOAA 3FFCE 4AEHL 5ICZB 1YNLH 4R96B 4UZGA 2UWEE 4ODSL 4OUUA 5DUPH 4YXLL 1MIEH 4G5ZL 3ZT5A 5A1AA 2QEJA 4KY1L 1I8IB 5DC0A 3GSRB 1B0RA 3VJ6A 1QRND 4M3KB 4S1DC 5EZJB 4CKVX 2ZUYA 2LVCA 3AREC 4P3CH 1JVKA 4HC1A 5GS2D 4LKCB 4U1GC 4Y5YC 5EO0B 2YN3A 2NYYD 3BPNB 1X5IA 1IGFL 4Z5RA 3O6FC 3P30L 2FB4L 3SJVE 2X09A 3TO4A 1PJ9A 1JNNH 2FIRT 1JK8A 2EE2A 3G5ZB 1A9EB 4GS7B 4K23L 3SDYL 5IMMA 5CINL 3S88H 5DYOB 4M6NH 3IAQA 2HG5B 4EDWL 2PYEB 5EBLA 3SE8H 4HPOH 1J18A 3E0GA 4F7TA 1PGRB 2V5SA 4WFHD 4Q9QH 4IIQB 3V6OC 2DB8A 3HA0A 2ED8A 1T66C 1TCRA 4HWEL 4ZAKA 5HGDB 3KYKH 5C0ND 5B39G 4J4PA 1Q0YL 2HVKB 3NN8B 4XP9H 4H0GA 3G04B 4ELME 1QSEB 3AFLA 4WJ5A 4PLJC 3UJTL 2Z8SA 4Z76A 3RNQA 4OLVL 4X4XA 2OL3A 3PHOB 5DLML 1ZT4A 1A7NH 3BVNA 5M94B 3SO3C 1FNGB 1K5NB 1Z6JT 4MHHG 3RP1A 3FHAA 3EJZC 4K3HA 1QNZH 1PG7L 3K8MA 4HCRA 4XP4L 3C08H 2VISB 4E41D 5LGHL 1K9TA 2F9BT 1OD9A 2ZUSA 3VFOA 3GJFH 2Q8BL 1NFDF 3QSKB 4OUOA 43CAB 1EGJH 5GRWA 3FFDA 1IQDA 1C5DA 3D3VA 3BX7C 4NHUE 4QHKI 3WJLA 1A3QA 3X14B 3MODL 5IMKB 4PTUB 5FIEA 5J9PA 2MMXA 3NPZB 1WWAX 2Z8RA 1V7NL 5F44A 1ED3B 4NZRL 4P5TA 1FZKB 5KOVC 3QIWA 2WLYA 2BJMH 3D85D 3EUUA 5D7SH 3TF7C 3WHXA 1VFMA 3JTSB 1OOAA 4LSQH 1X5HA 3RVUD 5I8KL 4LVHB 4P3DB 2NX5E 2IWGA 4L9DA 4Z0XA 3NIDE 4QXGL 1BOGA 1DCLA 2AV1A 1LEKA 5FGCE 4JDZA 1CCZA 4TSCL 5FGRA 5F89B 1U3JA 2VLRB 4D0BB 2VDML 4QRRE 4G7YL 4X7DC 5BVJA 4KRPC 4O51B 5CP7A 4ZPVA 4CW1A 4LAQL 3EOBA 1XGRA 2AW2A 3RIFF 2CLZA 2HFGL 3IYLW 1QPXA 2BC4A 4ORGB 2EKSB 1AC0A 5D93B 2CLVB 3CAFA 4HIEB 1YUHB 5F8QC 4U2YA 1JHTA 2BY3A 3BMWA 3IF1B 4XX1G 3V6OE 3PWNA 3TBTB 1F11B 4R26H 5D4QA 4L3ED 1KB5A 4JFQA 4X6DA 1WF5A 1YPZB 1F58L 2VC2L 1KCVH 5ICYB 3QIBC 2NY2C 3ZTNH 3DTXA 3GHEH 1NEUA 1ZGLP 3L3OB 3B9KB 2AJSL 2X4NB 4PB0L 1W0YT 3BZEA 4UV7L 1KC5H 4QRSA 4HS3A 2UVFA 5K59F 4WI5A 4WV1A 3D1MC 4Y4KA 3PWPA 2Y7QA 1RJZA 1JN6A 1AR2A 1IBGH 1T1XB 4GBXD 3ARUA 4FFZH 2FX9L 5E9DB 3IFOA 1KEML 3CSYB 4JKMA 5I1CL 1TJGL 3PP4L 1OW0A 3SDXE 4YBLB 4I2XE 3E6HB 5IROA 2X4UA 5I1LA 2EE9A 2VXTL 4POZD 2KL6A 3ZLQC 1BD2D 3F12A 4U6HB 5F1KC 4AY0A 2A6JA 1U41A 4PJFE 2O5ZH 3RVXC 5DJYB 3IDIA 1PW3A 4HUVB 4HXAH 4YLQT 3QUZA 5DRZB 2PXYC 4L8DA 3GSQB 3O6LH 1JGVL 4HH9A 3H9SD 3BT2H 4N0CD 2K9UA 4KK8C 4OSUL 1VEPA 1CF8H 1X4ZA 1IGYA 3R4DA 5IF0B 3STZB 3VFGH 2HMID 1U92A 2YPLD 5J6GB 1FORL 4OLZH 4QY8A 4JY4B 1RD6A 3NACL 5JIKA 3TN0A 1T0NB 4ALAL 3ZKXC 3TIDB 2E3VA 4K7PX 4Y5VC 5FO9B 1FLTX 4PB9L 1MLBA 3D39D 3RWFB 2D7QA 4PIRF 3L7EA 5MHSD 5CUSL 2OZ4L 1LP9B 4CVWA 5B38G 1T80A 1U8LB 5T1KB 1FZMA 3RJQB 2CIKB 5JW4Q 1CYGA 2BOCA 4ZXBD 3MCLH 4DEPB 1J0IA 1U8QB 2YZ8A 5JUEH 4OZFB 1PLGH 1LO3H 1A4KB 4XMLH 2I26N 3MA7A 4OJFL 4YQXH 4K7PY 4PP1C 1C7SA 3NAAH 3CSBA 3IU3B 4LARH 5BS0D 5F8RC 4ELMB 4OT1H 5BRZB 4JY5H 4NN7C 4Y4FA 4JG1L 2DD8H 4LEOA 4G9FA 4WGWB 5I8EB 5DK0A 3PWVB 2R69H 1KCSH 1CE6A 4JG0L 1F6AB 4GAGH 3NCJH 5J06A 5B38A 3OKNA 5GGUA 4IRJB 1GPOH 3PQYA 2VDPH 3E2HB 3QNYB 3DBXA 4U1JB 4HKXB 4D0DA 3V79C 1KNOA 4K2UL 3G5XB 4GQ9L 4K94C 1C5CL 1SBSH 5I18H 1UJ3B 2XNAB 4L8BB 1EHAA 2YRPA 3ZDYE 4NHUB 3CFCL 4KRLB 1IAKA 4XTRC 4P4KB 1S7SB 3BH9A 4UV4H 1I75A 2C3XA 3OX8B 3AREB 3IFNL 4MXWH 1S9WB 2HH0L 3OGOE 3SKMA 2B4CC 1MAMH 4U1GB 1N5AA 5A16A 2NXYC 2E27H 5I2IB 2NX5B 3WS6A 3VMOA 1CFSA 1CDUA 1NLBL 4KKAC 3W0WE 5IMLA 1VPOL 3KYNA 2HKFH 5D1XB 5C6TL 3V5HA 1NC4D 4Q6IA 5DJDB 1SJEA 5D7KE 3WN5A 1YEFL 4JQXC 1AGCA 4PRPA 4NO2B 4JPIA 3WXVL 4Z7VB 4U6XA 4HF5H 5DHYB 1CT8A 1RIVH 3BUTA 3MRRB 1A3RH 3PV7A 4I4WB 4UIKH 2BMKA 1JJUA 3I2CL 1JHLH 1HZHH 4KJQD 4KVCL 5C8JA 1QYGL 2EZ0C 4Y8DC 4H8WL 3JV6A 4RFOL 1YDPB 3MRCA 4LP5A 1ZEAL 3ARDA 3IFPA 2ZUXA 2BNRA 5DVKA 2JB5L 3C5JA 3SO3B 3CX5J 3RI5K 5FOBA 4N0UB 3JZ7A 1D5BB 5KW9L 4L4VA 4OZHA 4W70A 4OCYH 4X5XB 4FQ2L 3NCCB 1DSFH 1NAKL 4NBZB 3BZ4A 1EFXB 1FBIL 4JVUA 3FQRA 3SGEH 1FVEB 1G9NL 5EPMA 3DV6A 4K7PH 3VA2C 1K3ZA 1OGAA 5I1EH 5D9SA 4MAYC 3JVGC 1CIDA 2NW2B 3DVNA 3WL9B 4ODUA 4PRHD 1MFAH 4K07A 3LRSA 4PJFB 1YNKL 3TBVA 1JNJA 1F4HA 4WUUB 4N68A 1YY9C 1A9BA 3VXPA 1TQCC 2VH5H 5KG9B 3FHQA 3U7WH 1QSFE 3TJEH 1L0XA 3VXUE 4OCXL 4WHCA 3IJHB 2QSCL 3SGKA 3U4EB 1JE6A 3V9FA 2ATKB 4LPVA 2A83B 1CGWA 5IVXE 4FQPA 5FUOH 4X4MA 5GRVL 5EFIA 1KIRB 5GJSH 3WSQL 4R7DA 3VDBA 3MLWL 3JSSA 4NNXA 4LHUG 3IFLL 2D31B 3Q6FA 3LV3B 3UPRA 5DMGC 2E9IA 1OTSD 3EZ8A 3HG1E 4CVZB 4L5FL 5SWSD 1T20A 3BRFA 5KS9B 2WSKA 2VXSH 4YX2L 5D1ZD 3MLRL 1RZGA 4BKLB 1A7QL 1XAUA 2PCPA 1YN7B 3GMRB 5MEQA 2EDLA 3BUYB 1BBJA 2AXFB 1MF2L 2VUYA 3HR5A 3QEUA 5IFAL 2JCCF 3ZL4L 3UTZB 5I30H 4PYHA 3O6KL 3V4UL 2VDOL 5E94A 3UO1L 3QZWB 4XPTH 3TA3B 3EHBC 3BEWA 5HYJA 5HPOA 2EC8A 3GRWL 5D7LB 2H2PC 5E4EB 5HHME 4J6RL 3GMNA 4Y16D 1O0VA 2NLJA 3GSNB 1G9MH 1RJLA 4M7LL 4FFEX 3LRHA 1HXYB 4YBQD 3QQ3A 2DQTL 2VQ1A 4TVPE 3LEXA 2XTJD 1ADQA 3QUYD 5AD0B 3KPRE 3A6BH 3QJHA 4G6JL 2PTTA 2PW1B 2X1OA 4X8JB 4I5BA 1NCWH 1MRCH 4OQ1A 1KJ2L 4QRTB 1N3NA 3MNVA 1E28A 1EEYB 1MCJA 3C6SA 3OJMB 4PJ5D 1RIUH 5EBMA 3U0PB 4LLDA 3KPOB 1XT5A 4FTVA 4JANA 4WW2A 3LD8B 3FT3A 4YDVA 1OSZB 1P6AB 4NO0A 3SO5A 4MNGB 4RIRA 3V7MA 1J1OL 4AT6B 1A1NA 1HN1A 3G6AA 2CRMA 4K9EC 3Q5YA 1JFQL 1NCUA 4CN4A 2G2RA 1QEWA 3W0WB 1XIWA 5E7BA 3O81A 3ARFA 2VLJA 3MRKA 1PG7X 2H41A 3SDCC 5KSBE 1MHHA 1Y6KR 2Y36L 3CPLA 4PG2A 1HNGA 3C6LD 1LVEA 1TQBC 4UTBL 1BIIB 1G6RL 2EEBA 5DD6A 5DQDL 3ZKMC 3I85A 2EH7L 1TZHB 2XZAL 4I9WD 2YD8A 3QWOA 5FV2A 5C08B 4DKEL 2EIDA 4JFDE 3MJ8A 1KLUA 3Q3GA 4LHQB 1EPFA 1ZLWH 4JO4L 5IK3A 2XKUA 3AS1A 2NY4D 5GSVA 4ZNEE 3WYRA 4TUJB 1HINL 1AGDB 5E00A 2I9TB 3PWLA 2F53D 3MLZH 1GXEA 4N5EA 1YEKL 3BSZL 4HIHB 2DJ4A 1QKZH 3U46A 4Z78A 4ZFOA 2HVJB 1B9ZA 4HJ0D 4X6CF 3W39A 2W07A 4ZS7L 4PJDE 1CD9B 1RURH 3OR7A 3BP6B 3TBWA 4F7EB 5D72H 1V7ML 3DMMC 3DUUB 4TTDC 3VXRD 4ODHL 4EUPA 4Y4HB 2P5WB 1MCHA 2I5YH 1ADQH 3QPXL 4JO1L 4X6EB 3X11A 2W9DH 5HGBB 5DR5H 4OV5A 4YEEA 4ZOBA 2YOCA 3U1SH 5BZDB 1OSPH 5JPMA 3A0OA 1REIA 3O6MH 3RWJB 3H3BC 2ESVB 1VFBB 3HE7C 1NAML 5FDWB 2D2OA 1A7RL 1A6AA 1E4KC 1FV1A 4AEHH 3O8XA 5GRXG 2CRYA 3LKSA 4HD9A 4P48A 4ODSH 3RGVA 4YHIB 4YXLH 4G5ZH 5EUKB 3VXUB 2GCYB 4KY1H 4D9QE 1FNSL 2X70B 4WWKA 4N0FA 4APQB 2R29L 4G8GA 5DJCA 2AJZA 4CVXB 5ERWA 1DVFA 4NT6B 2YUWA 1T89A 1IGFH 4HJJL 4LDEB 5H2BB 1LO4L 4ZUSA 3P30H 4KRNA 2FB4H 5CZXD 4HDIA 3HG1B 1U8IA 4B53A 2EYTB 4PJXF 5HPMA 4XWOD 3ZE1F 3NFNB 3OSKA 4JKPL 4K23H 4QRQB 3SDYH 5KZCD 5I1KL 5CINH 2JB6A 3UCRA 4MJIE 1CD1B 4LLYA 4EDWH 3FT4B 5EA0L 4M1GL 2IMNA 4K7FB 4I0PD 3UTTB 4BUGA 5LWYL 3HCVA 1DN0B 2PUQT 5C0CE 5D1QC 4TULL 3OKMA 2BSRB 1QUNA 1I3RB 2X89D 4G6FD 3GSNL 4LCWA 3MRNA 2W0FB 1T7YA 4HWEH 5DJ6A 3L3KB 3SBWC 3P3YA 1P5VA 4V3EB 3FOLA 2VLKE 3PDOA 5CKAA 2XWTA 5DJAB 1Q0YH 3QUXB 4ODBD 3QHZL 3LQZB 1P7QA 3PL6C 5IJVA 4P9ML 2W59A 3UJTH 4OLVH 1RJYA 5TDNB 3OKLB 4H25A 4KROD 4HUWB 5DEGB 1W2KT 2EDRA 5D2NB 4S10A 5DLMH 3GIZL 1UM4L 1NBVL 3HTLX 1CR9L 2E7MA 3D0LA 1TCMA 1FGNL 3SOBL 5D2LE 1PG7H 5ICZA 5K9JH 4OV6F 4R96A 4XP4H 1EH9A 4ONFL 4LGSB 4ZFFA 5LGHH 5GS1B 3S96B 1I8IA 4KGJA 3GSRA 1J8HD 4P23D 2Q8BH 2FZ3B 3R1GL 3I75B 1YN6B 3JWNC 3MYZA 5EZJA 1PY9A 4CADB 4M00A 3V0VB 4PD4J 2BVOB 2X4TB 3MODH 2EDNA 4EZMA 1BFOB 1IKNC 5FGSA 3NCYP 1V7NH 4F80A 3MYJB 2MNUA 1L9MA 4RBPH 4NZRH 3VD3A 5FF6B 1D5ZB 2P8LB 3VGFA 5HHXL 4WFED 1F4YL 2C5DC 5J3HD 5D7IE 5I8KH 3G5ZA 1RZJL 4PREB 2BVEA 1I85C 1CDCA 4QXGH 5DMJB 5DYOA 1ZLVK 2IANE 2HG5A 1F45A 2PYEA 4TSCH 5DC4B 3LQMA 1GAFL 5DHVB 2VDMH 5F7YC 4G7YH 2QBWA 2VL5A 1FVDB 4LAQH 1HHHB 4O2CA 4EVNB 4IIQA 5CSZB 1D9KC 2HFGH 5MEND 2OZ4A 5HGDA 4YNYB 3WHE0 2VAJA 5JHDB 2YN5A 2HVKA 3NN8A 2UZYB 3G04A 1FNLA 5E03A 1QSEA 1MVUA 5IOPB 3TEUA 3EYQD 4MQ7B 1H15B 1FPTL 1MAJA 1WT5A 3PHOA 3W9DB 1F58H 4L9LC 2FYYB 2VC2H 2R15A 1FNGA 1K5NA 4C4KT 3U83A 5B8CC 2AJSH 3O3EB 4Q7DA 4PB0H 4UV7H 2VISA 3P4NB 5J6HB 5CP3A 2AEPL 3TBYB 1E4WL 4XAKD 1RUML 43CAA 5A2IH 3CH8A 4H1LG 4OAWB 2FX9H 3MV8B 1KEMH 5I1CH 1TJGH 2VRAA 3PP4H 5IMKA 4PTUA 3KLAB 4P0DA 4BH7B 2VZOA 4LK4A 5H35B 1KTRL 1MCKA 5AYQA 1RVFH 5JIHA 4JRYE 3DV4A 2VXTH 4MD5B 5C0BE 5JOFB 3ZHLA 5FB8B 3JTSA 1ZA6B 3NFPB 5F9OL 1M71B 1SMOA 2CDGB 4P3DA 1JGVH 4R90L 1U8JB 3ZE0F 2V5YA 2V7HB 2GSGB 4JN1L 5F89A 4PRBB 4OSUH 5T3ZL 2VLRA 4D0BA 4Y2OA 1V05A 3WS3B 4O51A 1FORH 4H1LA 4BELD 3C09C 3NACH 3QYCA 2EKSA 3QISA 4ORGA 2CLVA 4ALAH 4TTGA 4HIEA 3BEVA 1YUHA 1HHJB 2X4QB 3QG7L 1Z9LA 3IF1A 2FIKB 4PB9H 4NN5C 4U6TA 3TBTA 4MJIB 1SJXA 1F11A 1A8JH 5CUSH 4HJGB 2OZ4H 4XC1L 2YZ1A 3MZGB 5F9WC 1YPZA 5C0CB 5IEHA 5ICYA 4ZOEA 1CICD 1CN4A 3L3OA 3B9KA 4C54A 3BQUB 2X4NA 1B88A 3KYOB 1T5XB 4OJFH 3SE3A 2VLKB 4P57B 1TIUA 3ALXA 1WAAA 3WIFB 3VG0L 2PO6D 1KULA 1T1XA 3DETD 5E9DA 1JWSB 4JG1H 1R3HA 3RZCB 3CSYA 4CUCA 4ODWA 4N1EA 5GISL 3E6HA 4XB7A 5DMYA 4EI6B 5CP3H 2VXVL 1OPGL 4JFZL 5CEZD 1YEEL 3L3JA 1RU9L 1RUKL 4LPCA 2WIIB 4JG0H 4U6HA 5KSAD 5TFSL 3HI1B 1MI5E 1OQOA 5DJYA 4HUVA 2WY3A 2XKSA 4K2UH 5DRZA 3GSQA 5MP6H 4GQ9H 1A6TB 3VI4F 1C5CH 2IEPA 3NCEB 5DQ9B 4ODXB 4OZFG 2NY1D 3RWGB 3CFCH 4JPVL 5IF0A 2M1KA 3STZA 4OZIE 3WLWC 2V2XB 3QI9B 1WCBB 1UM6L 5J6GA 4JY4A 2V5MA 3IFNH 1T0NA 4YEFA 2HH0H 3CD4A 4OF3A 4UDUB 1ZHNB 3TIDA 4Z18A 5D7IB 3TT3L 5FO9A 1J0ZA 3RUGF 1NLBH 2W9LA 4H1LH 3RWFA 4JLRA 2IANB 1VPOH 3ILQC 5C6TH 1IFHL 2VXQL 1LP9A 2ZWLT 3F6IA 4XMPL 3ZO0A 1U8LA 5T1KA 4XBGB 3GHBL 1U8QA 1E4JA 4JGJA 1WIOA 3MC0A 2BSSB 1YEFH 4OZFA 4XVJL 1N6QL 1A4KA 4JZOB 4Y7MA 2X1PA 5JW4R 3WXVH 4CU6A 2VN4A 3IKCB 5AEAA 3IU3A 2EDTA 1DZBA 5E0QA 5JQ6L 1FO0B 5BRZA 1HHIB 4HS6B 5CIPB 1JZ6A 3I2CH 4RMSA 5I8EA 1VACB 4KVCH 4S1SL 1QYGH 4H8WH 2Z31B 4RFOH 1IAOA 2ENYA 1M7IB 2FH8A 3VXNB 1F6AA 1ZEAH 4H8WC 2D0HA 5F1NB 3LPFA 4IRJA 3QNYA 3E2HA 2JB5H 2KKQA 2WWMD 4U1JA 4JFFB 4G9DB 1BVKB 4I8DA 3G5XA 5KW9H 2VR4A 5JOEA 4YZFE 1UJ3A 4FQ2H 4L8BA 4M6AA 1LEGB 1NAKH 2I60L 3ME0A 1FBIH 3VGDA 1G9NH 2WUBL 5GSRB 1ITCA 4RWYL 4AIXA 3MMEB 3ARGA 4P4KA 3MJ9L 1HSBB 1S7SA 4X99B 3IS0X 3OX8A 5E8EA 3CZFB 1S9WA 4KKCC 2Y6SD 1YNKH 1BZ7A 3GMQB 1UEYA 1EUTA 4JM2C 4GMSL 5I2IA 2NX5A 1IQWL 3CXHJ 1CDIA 2DLIA 4YDKL 1CXLA 5D1XA 3RJDA 4OCXH 4AIZB 5GGVL 2QSCH 1IMHC 2HLFD 2OSLB 2QSTA 5DJDA 1JWUB 3G6JF 1QLEL 4FXGA 2NY3C 3OAZK 5CCKL 3WSQH 4NO2A 3MLWH 1BEYL 2FGWL 2DMBA 3BDBA 3IFLH 2O61B 4Z7VA 2AEWA 5DI8B 4YXHL 3QT2A 5DHYA 1PX3A 4OZFH 3MRRA 4XVUC 4L5FH 4I4WA 4V2CB 4P59L 4RMRA 4YX2H 3MLRH 1A7QH 3DARA 2FRGP 2F54D 1YDPA 3MBEB 4PJHE 4HMEA 5SWZB 4CJ0A 4YK4C 2HJKB