5BS0E

Mage-a3 reactive tcr in complex with titin epitope in hla-a1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
AGVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSFNMATGQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bs0E01
1BQLH 2DLFL 4M5YH 4ONFL 4M4PA 1WBZA 1HIMH 1MCNA 3BZEA 2UWEE 3TPKA 1JBJA 1HDMB 4ZODA 1U2CA 4ZOBA 4XWOC 3FN9A 2OL3L 4G6FD 4W68A 4PJHE 4BYHA 3LKOA 4HS6A 2HT4C 1G7HA 4MGXA 1A2YA 3MCLL 4JRYA 3UBXB 1AH1A 5IVXE 1NAMH 4ZFZB 2IPKA 3QHZL 2L7JA 2VISA 5SX5K 1H8SA 2DQJH 4IMLB 5F7UA 2OJEB 3LQAC 3KLSA 2BY0A 1RQ5A 1TQBC 4NIKB 2VDQH 5KSUB 1FZMB 1C16B 1O7VA 4GRMA 2H8PA 5LG1A 4J6RL 1JNNH 3MRLA 3C5ZD 5EWIL 1EXUB 3RWIA 4URTB 4ZMAT 5DJZB 3UTPE 1TJGL 1QLRA 2C1PB 5JR1L 2YD3A 1YYLL 5KTEL 2VXSH 2N56A 1MCLA 4HIJB 4M6NL 2YN5A 1K8DB 4CU8A 3HZVB 1C5DA 3KDMB 4AENB 1ZHKB 1SM3L 2VXQL 3IDMA 4H1LB 4RWYH 1CGVA 1NSNH 1JNHA 1LE9B 2NW3B 1LNUB 1U8LA 3OKLA 4NRXA 1YMHA 4ZTOH 2BNRB 5DRNA 4UU9B 5D6DC 3SKJH 3NIDF 5FHAL 3QUXC 3L3GB 3LQZB 3MRKA 5JQ6H 5K59F 3ZO0A 1T1WA 3ULVE 5KJRL 4QRRD 2JCCE 2ARJQ 1I3GL 1KIUA 1FNFA 2GJZB 4E41E 3SDAB 3HE7C 3MJ7B 1S7XB 3SO5A 3T65B 1FFNA 3U7YH 3KPRA 3BP4A 1F90H 2ATPB 3PL6B 4M48L 3RDTA 4PGJA 3V0WL 1FG9C 3G9VA 4R4ND 4Z7WF 2YC1A 3T2PA 3ZZ1A 5J56B 4PJBF 5HVHC 2XZQL 4LCCB 4PGEB 5IB5A 3BSZH 3RNKA 1B3JA 2EC9U 1UWEL 1HEZB 5ITFA 3IKCA 1RPQA 2EE3A 3U36B 5C8JB 1M05A 3BOVA 1IGFL 4X6DE 2I9LA 3BESR 3AB0C 4D8PA 5BJTB 1RZ7H 4NNYB 5GQBA 3MXWH 4M93B 1KC5H 2VIRB 3MGTA 3VH8G 4C58B 1E27A 5FYJH 3LV3A 4PBXA 3SEPA 3IB4A 1A9BB 1PLGH 2K1MA 1MCIA 5GRXG 1G7MB 4NO2B 1NAKL 2J8OA 1Z9LA 2UWEB 5E7BA 5J11B 2QL1A 2X1XR 5IW1A 1FZOA 5GISL 4PJHB 3WLWD 1BBJA 3FAWA 4HIEA 5E2VL 3RX7A 4GO6B 5IVXB 4MJ5A 2H32H 3W39B 3RY5A 2AJSL 3CCHA 2CIKA 4OM0L 4RGNE 3NOIA 1YYMH 1UWXK 3V8OA 3TYGH 1BZ9B 2PTTB 4MQTB 2ADGB 3B9DA 3LKPB 1RZIB 5TPWL 5IMMA 4HUWA 4Y19A 4MA7L 1KTDB 4KGJA 2FGZA 1XGQB 3H7LA 3MV7D 2VLLA 1AXSB 1ZA3A 4X5WA 3MPCA 1MAMH 4GG6E 3QUZD 2AEQH 3VXNA 5BQ7B 3KYMA 3U83A 3NZHH 3DVGB 1U8MB 3EW3B 4IRZL 1RJZB 2MMXA 3CVHL 4OSUH 5F72S 5CLTA 1WQVT 4C56D 4J23A 1CLZL 2HT2C 4RMTA 4L8DB 2YUZA 3H9SA 1QLEH 1VPOL 1BQSA 4KRLB 2G2RB 4XCCH 1XR9B 2BX5A 2JJTC 3H3KA 5F9WC 1A6ZA 4PJ8B 1Q38A 2QQNH 1Z3GL 3MREB 5HYJA 3QRFM 4G8GD 4KRMB 4U1IB 4OD2A 3RZCC 4KKNA 2ZNWA 1M7IA 1QSFE 2CRZA 4PJAF 5GGTA 5KVDH 2V5TA 2P8MB 4HUVA 4LSUL 1NUNB 4F9LA 2IH1A 4DUWA 5B8CC 4WV1C 2ENYA 4X9IA 1KXQE 1EEYB 4JRXD 2JCCB 3HI1A 3STZB 4E41B 2X4PB 2F74B 3DGGA 1ZT4B 4G42B 5KOVC 4LFHD 2HG5A 2WP3O 1HN1A 1V05A 4XMPL 5DHVB 3SN6N 4AG4H 4Z78B 1DQQA 5IT2H 3MBXH 1DBBL 1SBSH 5FHBH 4MDIA 5DK3A 1G1YA 4EN3D 1UVQA 4P46D 4D9RE 3D39A 4K94C 1QYGL 1R5VA 2X1OA 5LGJA 2JJVA 3FT2B 2HLAB 3VWJA 5HHXL 4ZAKC 1Z0NA 3F5WB 1C12B 1FNEB 5D1QA 4GMTH 1CQYA 3DV4B 3EYFB 3FO2A 3SKMB 5C0AA 1KGCE 3B2UC 5JOFA 2Q86B 3S6CA 1WUNT 3B5HA 4HCRA 5F9AC 1S5IL 5C0JB 1AGEB 2B4CC 4UOJA 5BRZE 1NCTA 4XMLL 3DYMA 3VE0A 3G08B 4YJZL 2DJ4A 4MCYB 1CFQA 5KVEH 3SPVB 1JV5B 2HFEA 4OGAC 2ZP0T 4KJQC 4I0CC 5T3XE 1IM3B 4RGNB 3TVMA 5ETUB 5DD3H 3GB7B 3O2VH 4G7YL 1I9JH 2P24B 3SDXF 3IETB 5FUCC 4ONGH 5GS2D 5GGRB 4K3EH 4MJIB 4R97C 5J11C 3PV6A 5D96B 3V52H 2BVPB 3PDGA 2XRAL 1BX2A 1O7SA 1LMKA 5CEZD 4AIZA 3OX8B 1L7IL 4YUEL 4HIHB 1NGQL 3ARTA 3D25A 5EZLB 1SHMA 2AJYH 4YBQC 4N0YL 1RUQL 2ID5A 1YNTB 4WI7A 3MV8B 1Y6MR 4NKDB 3MC0A 1DUZA 4MD4A 4MX7B 4GW5B 3QG7L 3CVIL 4FABH 4KROB 2CJUH 1S7RA 2ZUVA 3R06B 4EUPH 1JIBA 4MVBC 2IG2H 3E0GA 3EAKA 5A3ID 3ZSSA 3CFEB 1QSFB 4GXUM 4N0FB 4LLQA 1NC2B 3ZE1E 2VAJA 5ACZB 2ZJSH 4NC0B 1WEJH 4J8RB 3DGCR 2X1WL 1CFTA 3UYRH 5D6DA 1J8HA 5TQ0L 1XIWC 2Q6WA 4YHIB 4ZTPL 4LGPB 5DEGB 4PV9B 4LSSL 1T04B 4YHYB 1KIRB 2YEZB 1CK0L 4HWNA 4I0PD 2CUHA 4QTIH 3QDME 1BFTA 3E2HB 3R0MA 1OAXL 2ESVD 4GQ9H 1MIML 4P5MA 4Z7UA 5D7JB 3VU2A 3ZT5A 2YZ8A 4KJYB 4U1NB 3OWEA 3W0WB 5C0RL 4X9HA 2FX9H 1G6RB 1RUPH 2PCPB 1UCBH 1A7RL 3G5XB 1F45A 3TP4A 4NQUA 4EI5B 3GBMH 15C8H 1P4LB 4O5LL 1H15B 4KZEL 1HHKB 1ORQA 2AJXL 2B1HL 5FCUL 2X42A 1KT2B 3D85D 3V4PL 4QXUL 3SGKC 1CXKA 4GKSB 1ZHLB 3EJYC 3EOBA 5EU7E 3ALPA 3BPNC 4M7KL 4LCWA 3L6FB 2RBLA 2VSDA 2VKXA 5ESQB 1P6AB 4AMKH 2YS4A 3MYJA 3QHFH 2E5EA 1P4IH 4N1CA 1IL1A 1ZV5A 5I8EB 3MACH 2XN9D 2EO9A 1I7TB 2VOTA 4OI8A 5FOBB 3CFBA 1DL7L 4X99A 4NT6A 2YBRA 5T3ZE 1T0MA 5CIPB 4XI5C 2J5LB 4K7PY 4OT1H 2QQKL 3M1BA 4HWEL 5I16B 1NEZG 2AQ1A 4A2MA 3NCJH 5DVKA 1C5CH 1NBVL 4R9HA 1A4JA 4M1CD 3AY4C 1G7IA 4UV4H 1U41A 3BHBB 3I6LD 1Q72H 1NGXA 1A6TA 1MAKA 3FB5B 4EBQH 4ODSH 2MFNA 1PZ5B 3THML 5E9DD 1WFNA 3MNWA 1RK1A 1DBAL 1B2WH 1R0AH 4Z0BL 4QHUA 3UZQA 3RZCA 3DURB 2ZKHL 1RJLA 1JNJA 3BQUB 4P2QA 1FQ9C 3TV3H 1X5LA 3X3FH 3T8XA 4L9LC 1BVLB 3SE9H 4L9DA 3FCTA 5EZOH 1DZBA 2CDEA 4XP6H 1RULL 5E8EA 4KXZH 1IGJA 4OLXL 4NC2B 4JFHD 1TVBB 5B8CA 4WV1A 4DKEH 1CBVL 4QY8B 4KROC 4PJFA 1I3VA 2FECI 3HZVA 4Z0XB 5IHUH 5I19H 1FO0H 3QDMB 4N8VA 4QHMA 5EC1B 4OCNC 4CADA 5ANME 2BRQA 2NY1B 3S36L 3GGWA 5SWSE 3VMNA 3NACL 3WNPA 5I2IA 3IDIA 2HRPH 1ND0A 4MXVE 1JCKA 4JFEA 4GMSH 4YHNA 4YX2H 2CLRA 3E6FA 1SY6A 2OQJB 4Z77A 4YQXH 4Y7MA 3P9WB 1C1EL 3OF6D 2A1WL 4YHYC 4B7IA 1F97A 1S7WB 4R7DB 4FQXB 4Y4KD 1F4YH 2ICWI 4TSCL 3VRLF 4ZAKA 5FDWB 3MRQB 4LQFH 4UUJA 5D7JC 4QF1B 3GSVB 4TTGA 4APQC 3UYPA 3GBNH 4RMUA 3CDFA 5CD3A 3PWNA 5IQ7L 2BVEA 1YECH 5F3BA 1FNHA 1EO7A 3O6FC 3WEXA 5DT1H 4HIXH 4P9ML 2W1NA 2NW2B 1CG9B 4QYOB 1PBYA 5F89B 4C57C 4NQDE 4UDTA 1VFBA 4GRLD 4ELKB 5IMLA 2LAGB 2Z92B 3PABA 1KB9J 4K3GA 4NUJB 4IOIA 1N6QL 3QNYB 3F7YA 3IT8D 1LO0L 3ARFD 3SDCB 3C5JB 4RISL 1YPZF 4G8FB 2YRZA 1JPFB 4PJHA 3WFBH 3WFHB 1LD9B 1NKRA 5IB1A 1F11A 3OXSB 5CP3A 4YHZL 3AU1A 5CCKH 2J5LC 4K8RC 3HZKA 3L5JA 4QOKE 5D6CB 4LLDB 3QDGA 5KSBE 5HDBE 2NY4B 4LEOB 2DIJA 4ZS7H 1JHTA 3L5XL 3UPRB 3IJHA 3WD5H 4F3FB 3T1WA 1K4DA 2I60L 4ODUA 3WDIA 4U6XA 2R0KH 3MOBL 1XIWA 4A6YB 3BEWB 4XTRD 3LS4L 2CO6B 5DFTA 4YK4C 4YDVB 4U05A 5EU4B 4XPGL 5CP7B 1JPTH 2AV7B 4JFFD 3NPZB 4X5XA 2Z9TA 5BW7C 2R9HD 4NM4L 3S3PA 1JN6B 1OGAD 4DVBB 5HYSG 1S3KH 5ANMB 4U3HA 3JTTA 5T1LD 5I8OL 4LOUD 5SWSB 2GT9B 2CR3A 1GPOH 4HLZH 4LLWA 1P5VA 2P8MA 3QULB 2Y5TA 5JIHA 2A6JB 3BZ4A 2ZUQC 5BV7H 1U8HB 1E4XH 4R26L 3DUUA 3MLYL 3MA9H 2AI0H 1E6JL 5DJ0A 2H6PA 3O3AB 1FFQA 2QJDA 3D3VE 3QDJD 3A6OA 4FXKA 2VYRE 1N0LA 1GGBH 5CMAA 5HHNB 3FO0H 3IF1A 4L3EE 3RWDB 3BUYB 3TBVA 3SGKA 1N3NB 2ZOLA 5C0FA 3WXVH 3PWJA 1F6AA 2DIAA 4OCXH 4KMQA 1MQKH 4OD1L 1II4E 5CINH 5IHZB 3BISA 5ABDE 5IR1B 2IFFH 3TBTB 2XWTA 5F9JB 1SQ2N 2COQA 2BXZA 2Z93A 3IAGC 4X6DA 4FQXC 3E3QE 1DTUA 1VGEH 3IJYB 4JN2B 4WEBH 1EJ6A 4KGLA 4ZO7A 3F5WA 1NPUA 4DGIL 5JXEC 3QCVL 2DF3A 4NQDB 4P2YA 5I74B 3VH8A 4TUKH 4KMTH 1WISA 4NN5B 4MZ2A 4P9HC 5D2LF 5KSAC 4X6FB 3O2DA 3F7QA 1HSBA 4NNPL 3KPMB 4U0RB 5EOCL 1EAJA 3REWB 2R2CA 2MNUA 5DGRA 2KQNA 5KAQG 3AY4A 1NFDF 1YEKH 2FATL 4ZFOL 1ACZA 3MRFB 1PG7X 1CD9B 2NPLX 1QRNA 3LCYA 2DDQL 2DLHA 1BJ8A 4GT7A 1T21B 1TJIL 3KPOA 3SCMB 4HSQA 4QOKB 4NBZB 4P3CH 5KSBB 1YEIL 1BD2B 1UM6L 3SKNB 3WDJA 5DJYA 2YPLB 4GG6A 3HUJE 2BDNL 4WWKC 4XVTH 2FIRT 4ZDHB 2AABH 4L9LA 1VFAA 4IJ3C 5D9SA 2ADIA 1EEUA 3MOQA 5ID0A 4HGMA 4OZ4A 1EO8H 1FV1B 2W0KA 1ACYH 4QRRE 1FL5A 4ZNEA 3V5DB 5C9KA 1JZ7A 4MAYD 1XMWA 2JLLA 2F8OA 1A47A 1WBXB 5FGSA 2P5WA 3T1FB 1RUAL 1LQSR 2BJMH 2I07A 5EU6A 3FAXA 5KG9B 3NBNA 4NO0A 3SJVA 3UTTD 5JPNA 1QFUL 1HHJB 4Y2DB 4F7CA 3V0AC 1Y18A 3TNNA 5FGCE 4Q9QL 1MRFH 2AXJA 4EKXA 4JKMA 3S37X 5JXAH 2VE6B 3D3VB 1RI8A 3GSNL 1KJVB 5FUZH 4L3EB 1YNKL 4N5UA 1UEYA 3V7MA 5D8JL 5FOJA 2AKRA 5D7JA 3LPFA 3HNSH 4APQA 3CXDL 3D0VB 3VD3A 4YAQA 4ORGA 3CSYB 4Q9RH 5IOPB 1YEEH 2WNGA 4FA8A 3MZTA 4OBRA 5D2NE 3FQNB 4G80B 1V7MH 1VDGA 3MRIA 3KLAA 3O6FA 1T1YB 5BZDA 5L2JA 4WGVB 3ZDYE 1I75A 2GI7A 5DRWA 3VDCA 4TPRH 5F7DB 3BPCB 1MFNA 4XHJC 1UGNA 3WS6C 2DMBA 5F7NC 2ORBL 4OFPA 1ZHLA 4P3DB 4RMQA 3S9DB 3U79A 5E00B 2A6IA 4I13B 5I1IH 1C08B 5E8PB 5FYJU 3A0OA 5TQ2H 5C09A 3JV0A 2VL5B 1XGYH 4XP5H 1RMFL 5DMGC 5BRZA 1H3PL 5FV2A 3DX6A 5IFHL 4NHCH 3F7VB 4C56E 1PAMA 3PDDA 4OGXL 3RAJL 5DJ8A 5GJTH 2FDBP 4YDIL 5C0IA 4K9EC 1K2DA 3K3QA 3WNOA 1KNOB 4Y16C 2BMKB 1L6XA 1LK3H 4HHAB 5GIRA 2VXVH 3F6IA 4NN5C 4PP1D 2FYYB 5GJSL 2O5XL 4U3XA 5IKCB 4OZHE 3VMPA 4OGYH 3G5YB 1J1PH 3QZWA 4RFOL 3V4UL 3VFVB 4ZYKA 2AVGA 4DJMA 3HUJB 1G9NH 2R69L 4X8XA 5F9OH 1SJEB 4HXAL 3HG1D 3UTQB 5I0ZA 3D48R 3C6LC 5TF1H 5HHOD 4JRXE 4QRRB 3VDAA 4IDJH 2V2WB 4PJDE 5ID1B 5F7YC 2GFBA 5I8KH 2DQGH 3E8UH 3TCLA 2EDEA 4RAUB 5BW7A 4S0TD 1MF2L 1PKQE 2DYPD 4XPFL 4NQXA 2AEPL 5EUOA 4DK6A 1V8HA 4H8WC 3T4YB 5JHDD 3UTZA 4YH6A 5FO8A 3GSXB 1A4KB 2V9RA 5C0BA 2XTJD 1FL6B 4IOFC 5CS7A 5FGCB 1V7NH 3BP6B 3N85L 4JGMA 3EHBC 4PJCE 2EYTA 1KJ2L 2A73A 3LEXA 3WE6B 1FCGA 3WLBB 1WC7B 4BJLA 1J8KA 2UZIL 4HQQL 1UZ8A 3A67H 5J06A 1LE5B 3QFJA 1L4IA 5GZND 3MUGB 5A2KH 1I9IL 2EH8L 1QR1B 1JF1B 5IEHB 3DECA 5D2NB 3KPSD 1PX4A 4LNRB 2H3NA 5IFAH 1HHGA 2P5ED 3LZFL 4NQTA 3NA4A 1DN0B 4KJWC 1J0JA 3LDBC 4FZ8H 4JJ5A 4H0HB 4LU5L 4FQXA 3BZFB 2FO1A 3RUGE 1PSKH 3V4VH 5JXEA 1E28B 5DS8B 5GHWL 4XCEA 5FKPB 2APWA 4W6YB 4DZBB 4HFWB 3VFSB 4JKPH 5KSAA 4M7JH 3QA3A 1U95B 4X80L 4M7LL 4UT7H 3KYOA 3LMJL 3QUZB 3QHTC 4NM8H 1UH2A 2HRLA 1DDHA 5DQDH 4C56B 3S8WA 1R3IH 3E3QC 3F8UB 1WCBA 5IW6A 2W60B 1DLHB 4M3KB 2CK0L 1IEBB 2B39A 4NBXB 3TBYB 3GSUB 2BY3A 3OTTA 1UWGL 3N9GH 4K3DH 1XZ0A 4OQTH 3FOLA 3G6DH 2Z92A 5CILH 1N0XL 1I7RA 3PWUA 4LSVL 4OZHB 4UT6L 1MFBH 2FO4A 3C5ZC 1AI1L 5CZKA 1H0DA 3RU8H 4FQJH 1NEZA 1D6VL 3DHMA 4EEEA 4HMDA 1ZLVH 4EVNB 1I8MB 3PV7A 1IFHH 3FFDA 3F62A 2EXYD 4HFUH 4WWKA 4MNQD 1O5DT 5FYKH 1MNUH 1U9KA 3LEVH 1KCUL 4QRSB 4Y5VB 5L88L 3VXTA 2DKSA 1S7SB 3OXSA 4JRXB 1YEFL 1JGUL 4PJDB 3UEZA 1QHPA 4KKAD 3VW3H 4M9OA 1J0IA 5T1KB 1BBDL 1TQCB 4MCZA 3ET9F 4U6HB 3UO1H 1D9KD 1PKQB 3I3DA 5CWSB 4L4VD 2DJSA 4LEOA 5E6IC 3VRIB 2HJLA 3MV9D 3U0WL 4EN3B 3T0ED 2MHAB 5CD5D 4U4BA 1QBMH 1U8NB 1UJTA 5TH2B 3GIVB 3VRJA 1LEIB 2VL4A 2BERA 4JM2B 4PJCB 4PJ9C 5I8CA 1MVUA 4YPGA 3ZE2F 4HG4J 5IK3A 1EGJH 3ARXA 4AK1A 3NIDE 2WUCH 4PS4L 3ARGA 3MGOB 3PGFL 4QRPD 5LAXB 3M17A 5K59E 4DVBA 2MCPL 1D5ZB 3DVIA 4R4NC 3GMOB 3BWAB 3OXRB 3QDAA 4Y5YB 4ORZC 4ODVL 1OAZL 1J0ZA 1J1XH 4X7EC 3LKNB 2QKIB 1XGRB 3Q3GA 4Z7WE 5EIVA 3W11D 3MRCB 2VJXA 4PJBE 3TA3D 3LKSA 2NY5L 3J7HA 3RUGB 4I9WD 4FRWA 4ZUWB 1N59A 1MJJB 2YUWA 4Q2ZB 3WS6A 2R1WA 1HSAA 3L7FB 1CIUA 5ESAB 3BP7A 4XNXH 4FQPA 1KLUA 2IEPA 2BP3A 4FTVE 1A3LH 1FNGB 2EDLA 3GIZL 4JHWH 4WEMB 2BY2A 2DLFH 3VI4F 3WLWC 4ONFH 5H2BB 1G84A 2ZCHH 3BIBX 4P4RB 4M03A 5IGXL 2V2XB 4TTDD 2P44B 3I6LE 3RTQD 2OL3H 3GNML 1ZVSB 5BZWB 4JDVA 4JHAL 5EFIB 4Y16A 4NQDA 3MCLH 3VXRA 1YMMD 3QHZH 3MLVL 2WANA 5IMKA 2WLYA 4K23L 4AL8H 1HHIB 1X4ZA 4X6FA 2J8HA 1IM9D 3KPMA 2MPAH 1E4WL 3BN3B 3QUZC 4DGVL 1IRAY 1BFVL 4Z95L 4J6RH 2DAVA 2A74B 2H41A 5EWIH 3MX0A 5FYJD 3ULUL 1TJGH 1RZGB 5GSRA 1RUKL 3LD8B 3S4SA 3MRFA 5DUBB 5JR1H 1YYLH 1IGML 4WW2C 5KTEH 5A16B 5TDNB 1K6QL 2VQTA 3C6LA 4GRWF 5JZ7C 2CMRL 4M6NH 4I0PB 1I7UB 5ICYA 5ELIA 3P0VL 2FGWL 4P0DA 4DN3L 1QLFB 5DHXB 2FR4B 3MTRA 4P5TB 3PWPB 5F8QC 2G75B 1HOCA 2Y25A 4HKXB 2ZOKA 5K9KA 4K3HA 1SM3H 2VXQH 1ZGLB 3EYUL 2YZ1A 2AJ3B 2PXYD 4LVEA 2BC4B 5AZ2L 4CU6A 4LLMA 2C3VB 4S1DD 2PW1A 4FFVC 4L5FL 3LIZH 4LDEB 1K5NB 3TNMB 4PJAE 5FHAH 4BFEA 2D9CA 2DOCA 3U1SL 1XF2A 1TQCC 3BKJL 1ZK9A 5HHVH 3IFNL 3UMTA 1FIGH 1NUGA 5E95B 5HYSA 4NRYA 1YN6B 4X4ME 4LASL 1XF3B 5CKAA 4G9FD 3GKZA 1F3DH 1J05B 1CLOH 4EN3C 4P46C 2EDYA 4M48H 1U8OB 2XQBL 3V0WH 1WTLA 3K8LA 3IJSA 1HWHB 3W9EA 2VWEE 4V1DD 2XZQH 4NJ9L 4XC1L 4Z7WB 4YHPB 4HZLA 1UWEH 4PJBB 1YDPB 1WWCA 2B4CL 4XZUB 2NR6D 1EEZB 3WIHA 2W0PA 4FS0A 4BQBA 2R2HA 3KHQA 5CP3H 3Q1SL 3GDBA 4G3YL 1E4KC 2FHBA 3FT3B 4FTVB 2VABB 4Y5YC 3CSYA 4GAFB 4TULL 4KI1A 3LPWA 2FCBA 1CICD 1NAKH 2VITB 5K33A 2NZ9D 1BZQK 4JZNB 4UV7L 3VG0L 3UPCA 4KDTC 5GISH 2HVKA 5E2VH 4AEFA 3BPCA 3ARYA 2LAAA 2X09A 1X5AA 1DBJL 2ED8A 4P3DA 5SX4I 3K2UH 4HKJA 1I8KB 3C5ZA 4L3AA 5E8PA 5TPWH 2VL5A 4MA7H 2R23B 3RKDD 3L3HB 3O3DB 4MS8C 2IC2A 4PJEF 5CSZA 2HKFL 3SDXE 3X14B 2VQ1A 4CVUA 4OD3L 4QHLA 1AXTL 4OF8A 1S9VB 4IRZH 2HFGH 3MRRB 4HHAA 1ROWA 1CLZH 5IQ9A 3RVUD 3RKPA 2AGJL 3GFUA 1VPOH 2FECL 2ATKA 2DMKA 4JFFE 4TUOB 1OGAE 5SV4A 1Z3GH 4ZO8A 2VR4A 4WI4A 3SBWC 5GS1A 2PTUA 3C9NA 5E6IA 1T20A 4Z7VE 5L2KD 3VJ6B 2Q3ZA 5GGSY 7FABL 1ETZA 3E6HA 3DBXB 3WNNA 4B53A 1GZPA 3UTQA 3P0YL 4PJAB 5A2JH 3OJMB 2N7BA 2VLJA 5F21B 4I0PC 4QRRA 3BFOA 3QDJE 5SWZA 4PJ9A 1G7LB 3WUWG 1IMHC 4WRLA 2GITB 2PYFA 2XKUA 3GO1L 5EBWA 4JDZA 4HKBA 1WZLA 3NCCB 3ULVL 2D2OA 5GGUA 3CDCA 1DCLA 4L8BB 1YY8B 2KZ1B 1QSZA 3TGXA 4QTHB 4JZOB 1AR1D 4XMPH 2YA2A 3B2VH 3AC0A 5E94A 5MP6L 5DI8A 2A83B 3KLDA 1CDIA 5EU5B 3V9FA 2NTSP 1QYGH 2MTPA 2YA1A 3JWOC 5HI5C 4GRLB 4YFLF 3UCRA 3U4EB 3U30B 3TBSA 3OG6B 2XA8L 35C8L 3ARFB 3ZHLA 4UMGA 1G7JB 1NC4D 2RHEA 5JW4Q 5AAWA 1S5IH 1KEGH 3QPXL 2NLJB 2FJFA 4KK8C 3B9KB 3HS0A 1MCWM 3O41A 4XMLH 1F4XL 4CVXA 5JLZB 3EYOB 5DD6A 1OQXA 1H8NA 3D1MC 4LKCA 5C6WH 2DLIA 3SGEH 1DFBL 1HILA 4FNLL 4FQHA 1I1CA 3MV7A 4M1CC 4YZFE 3BPOC 2ITDB 2MCG1 1BM3L 4JO3L 1UB5A 3KJ4B 3L7EA 1U6AL 5IVOA 3SDXB 5FGRA 3C09B 4RA3A 2CKBA 3MRDB 2XRAH 3ROOA 3WHXB 3MA7B 5JDSB 1L7IH 1NLBH 4M43L 4WW2A 1NGQH 1YEGL 4GW1B 3A6BL 1FFOA 4TNWF 4N0YH 1RUQH 2J6EL 4JFFB 1T7VA 1YN7A 4UBDD 1OGAB 4G8GA 3CVIH 3B4NA 3EO9H 1W0WB 4I4WA 3GSOB 3UROR 1AXIB 3ZYOA 5F7EL 4F15C 3Q5TA 4BFIA 2X4UB 5CGTA 4Z7VB 4I18A 5JOPD 5HI3D 2VDNL 4PP2A 4GAJH 1GHFL 2VLRD 2Z35A 3MUJA 4J12A 1S7SA 2O61B 3VA2C 4BH8B 5DD1L 4JR9L 4UOW1 1DQML 1UXSB 3QDJB 1A3RL 5TQ0H 4ZTPH 3WUWB 2G9HB 4LSSH 4Z7OF 5GRUL 1BLNA 1CK0H 4HJ0D 3WJJC 4IBLT 4D0CB 4OFYA 1OAXH 2AW2A 1XEDA 2DL2A 3OKOB 4LPYA 4P46A 2RCSL 5C0GA 5IM7A 3V79C 4XVUD 2B0SH 5BXFA 5C0RH 5CZVL 4PJ5D 1KTLA 4OGZA 4Y4KC 5D93C 5EU3A 1AC6A 4F80A 1OAKL 4M1DL 4GBXA 1G6RL 4O5LH 3EDEA 4JPKL 1U3HB 4H25A 4KUZL 1A6WL 1MLBA 4U7KA 4MA3A 4KZEH 1EBPA 3MGOA 2B1HH 2VB5A 3O8XD 5FCUH 1IQWL 3AVEA 3V4PH 1LO3L 4X9GA 4QXUH 3VGGA 2VZUA 2V7HB 3VRLE 3WS3A 2FWOA 4ZFFA 1E4KA 3SDDD 4K71B 2JJSA 4M7KH 4HC1L 1QQDB 3T2NL 2UZYB 3MRJB 1T3FA 2K9UA 3WFEL 5HSFA 4KDTA 3IFLL 3C08L 4GRLC 3JWDL 2D7QA 2BFVL 2V6HA 1WF5A 1MJJA 5J6HB 2WLZA 3MLZH 1EV2E 4PB9L 4JO4L 5E8OB 5I1EL 4QEGA 4HAFA 5TE6L 1Q0XH 4CMHC 4JO1L 1RY7B 1AY1H 4FQQA 1A7QH 3QEGL 4K8RL 1P2CB 3LSOA 1CFBA 3W5NA 1HXMA 3HG1E 3IVKA 4JANB 2HJKA 1NGYA 3FO1A 4B50A 3IXAA 3GMNB 1YPZE 4JAMA 1MCBA 1HQRA 3HAEG 3UC0L 4X4YB 3THMH 2YRLA 4CN6A 1DBAH 4WFED 4NRZA 3KJ4C 3IYLW 1HH6B 1SYSA 1DUYB 3SBWA 1NCAL 2ZKHH 5JHDE 4R0LB 1WFTA 1X4YA 1ZLWH 3O9WD 4M5ZL 4ZUTA 3MV01 4PG9B 1RULH 1OPGL 3OKMA 4MB4A 5F7WC 4GG8A 12E8L 3EGSA 4I0PA 4OLXH 2R9HC 1CBVH 1S9WB 3KPTA 2ESVA 2D9QB 4HUUB 4O2EB 5MEQA 1FZJA 4JREB 1ZT1B 4KDVA 1JNLH 1REIA 4CVWA 1F3DJ 5EPMA 3RBGA 3UXFA 2B5IB 3S36H 3OZ9L 1A7OL 3NACH 4XVSH 3H7BB 2BC4A 1CXFA 3VFTA 2P7TA 2FJHB 1K5NA 1A1OA 3T2OA 1AD9B 4DCQB 4ETQA 5GRWA 1MRDH 1HNFA 3KPQB 5IMOB 3D85A 2EDTA 3HRZA 1C1EH 1KLGA 1FLRH 2A1WH 3Q6FA 1T2QH 4TSCH 3MLTB 2P8LA 1PJ9A 1FFPB 1E4XI 2NTFB 3PWLA 4DQOL 1QA9B 2LE9A 5DMKA 3HB3D 3SGDH 1M6OB 4U1KA 3DROB 4J3OC 3RNQA 3G5VB 1T89C 2VO5A 1JPST 5IQ7H 1MCFA 3LRSA 5SWQB 4P9HL 4Z7WA 1HQ4B 3TO2B 1U3ZA 4YHPA 1RJCA 2XN9A 5CJ5A 3D5OF 4QRQB 2NX5D 1EFXA 1BOGB 1VA9A 4P9MH 2B1AL 2DLTA 3EO1A 2Q8AL 4ODXA 4RDQG 3O81A 2X40A 3PWVA 4ONHB 3RVWD 1W8NA 4UOW0 1CL7H 5EUKB 2VABA 3GSQB 1D5XB 4ZUSA 4K71C 5T3ZL 1RFDH 1T66C 1OY3B 3VDBA 1INDL 1JWUA 5D2LE 1LO0H 5EULV 3X17A 3MRMA 4OZFG 4KRNA 5H35A 3HG1B 1P7HL 2X4TB 5HGHB 4JRYD 4D94A 2CDFB 1N7ML 1IGYA 4HG4K 1YPZB 5AZEL 4WFFD 2FX8H 4YHZH 5E9DA 1TTFA 4WIQA 1H9VA 2HTKC 2HAZA 3NAAL 5DTFA 4PJGF 2DYPB 1RZJL 3NCMA 2P1YA 4L4VE 1SEQH 3QUYC 4KRPD 3QO1B 2R0ZL 3MV9E 3O3DA 3PIQA 5JHDB 1PGRB 3T0EE 3ZL4H 2EDRA 1IKNA 3X14A 4XP4L 3L5XH 4MAYC 2XXMB 5FYKU 1MAJA 2BZDA 2I60H 3VFMA 3WN5B 3MOBH 3SOBL 3P4LA 1N64L 4QRPE 4EDWL 3WUZA 2X4SB 4XPGH 1T6WA 5HGBB 3H3PL 4NM4H 4R4BB 1ZA6A 4WDIA 2PTVA 2H1PH 2XG5A 4XCNA 1D5BB 1K4CA 4R0LC 3VJ6A 3DX8A 3W9DB 3C60B 3DBXA 4NP4H 4KQ4L 3OF6A 1D5MB 4PJAA 4Y4FD 4Y4KA 4R26H 4TNWK 1QRKA 5T1DL 5FO9B 4RZCB 4I9WE 3MLYH 3ZKXB 3PXJA 1YY9D 1NGWB 3T77A 1JHKL 4F58H 5IV2B 1E6OL 4M61B 3KPRD 3RDTD 4L8BA 3VFGL 1DANT 1NGZA 1EEQA 3ARVA 5DJ6B 4OD1H 4OTXL 4PREA 3OKKB 1CFNA 2ARWA 5BVPL 3FQUA 1FG2B 4KKBC 5EU5A 1W72B 1MCSA 1NANH 5T1MB 4M6OL 1MH5B 4YIQA 2ICWA 4ZSOA 4PY7A 1MCEA 3L95A 3BUTA 3OJVC 2DQFA 4WTWA 1G7PB 3P4OB 1RVFL 2GTZB 1YMME 1T4KB 4AEIL 2YWZA 1F42A 3QCVH 2VN7A 5EOTA 1I4FB 5D7IF 4HEPG 2Q76B 2VZVA 4G9DA 4PRNB 5DR5L 2J2ZA 1NCDL 1K3IA 3MRBB 4NDMA 4NNPH 1PD6A 5EOCH 1HI6A 1HXYB 4HBCL 5D2LB 1VADB 5BS0D 3BMWA 4H5SB 3BPLB 4GAYA 5FYJE 2FEEL 1T0NA 3NZ8A 1T0PB 4XPAH 2FATH 4PP1C 5IVZA 2YA0A 1OSZB 4I3GA 1BVKB 2DDQH 3CMOL 1D9KB 2A6KA 4MD5A 3OKDB 4L4VB 1I1YB 4ZPTB 1G9ML 1KB5L 1NAMB 2J7LA 1XH3B 4PJFF 2IANE 3MV9B 1ZSDA 5H37H 3CFDB 1YEIH 3C6SA 4P4KD 1UM6H 3T0EB 2GIYA 3HE6C 2JELL 3GUTB 1MCJA 3HI6L 4Q6YA 2FHFA 4XMKL 2Z8VC 2HFTA 5B4MD 1MI5D 3RJDA 3RX8A 4G43B 1GGCL 4Q9CA 4HDIB 1AIFA 4QRPB 4FOMA 5HYJD 3V6OC 3BRFA 4GQPH 4YPJA 5T1LA 1YQVL 1H5BC 1CN4A 2R1YB 1I1RA 4G9FE 1ZHBA 1U92B 3ARRA 1VACB 3WIHH 4LLVA 1FL3A 1RUAH 3RWFB 2E8YA 2YWYA 4OF7A 3NPSB 2XTJC 1MY7A 3MBEB 4NQVA 5I1JL 2O61A 2ZCKL 1QFUH 1FYTA 3CFJB 4UILL 1PX3A 4YGVB 4KK6D 3WN5C 2AK1L 3RWJA 3TA3B 4CDGC 4Q9QH 4OB5L 3WUWA 4L4TD 5CZXD 3AM8C 5E99L 2G9HA 3ILPA 1R3LA 3GSNH 5GZNC 3UPAA 1R6VA 5FM8A 2CRIA 4U1MB 3P30L 2VZ3A 5EOQL 1SEBB 1AO7A 5D8JH 1KYOJ 3ULSA 3CXDH 3D39D 2RQ8A 2C3HA 2R15A 5C07A 3B8SA 3RVVD 4D0BB 1T89A 3VWJD 3RTQB 1S9XB 5D72H 5DYOB 1ZTXL 3PHOA 2IPUK 3ZKXC 3BD5A 5I6XC 4Y5XB 1PYWB 3NGBC 5DUML 3DO3A 1YMMB 2HH0L 3O4OC 4HPOL 3QQ4A 1HWGB 2EIZA 1IM9B 1Q9OB 1QNZL 4GAGL 4LEXL 5HHQA 1UH3A 2PETA 4HGKC 1MCKA 2Y4SA 2GK0A 2O26U 2DTSA 2C7UB 3BT2L 5DJAB 1RMFH 2HT4D 2X6MA 4HWZA 4XPBL 1H3PH 3BGFC 3BN9D 3U9UB 1UM4L 3M8OL 4C54A 4OGXH 3RAJH 3KWWA 4NZTL 3TVMD 1NCCL 4O4YL 1G0XA 4LRIC 4YDIH 4Q0XL 4LSDA 2AJVL 3PQYE 3TH4T 1IARB 3UAJD 1B90A 4QRTB 6CGTA 2OK0L 1I3RB 3VXMA 4AY0A 1MIEL 3ZE0F 2H32B 4TOYL 3B5GA 5GJSH 2KBGA 2EO1A 2IANB 4DZ8B 4K2UH 2EXYC 4GKNA 3QUYA 3DYOA 1EIBA 3BPLC 2PXYB 1TZIA 5E2UL 3B9EA 1FE8L 1JWSA 1MWAA 1XGUB 3ARPA 4NO5B 1M1SA 3CK0L 2E9JA 2R69H 3RPIB 1U58B 4KKAC 4MQXD 4PRDA 1P7KB 2F9BT 2LABA 3RVTD 2K3TA 4Q7DA 1OP3H 4HXAH 1FAIH 4JM4L 4MAYA 4L1HA 5DD5L 5F3HA 3GMNA 4ZXBC 4X0KB 4F7EA 1OLLA 3TJHD 4KTDL 4ZQKA 1DQJA 4GOSA 3QNZA 4G9FB 4UTAL 1XGTB 3UTTA 4WHYH 1FZKA 3T0EC 5CD5C 1MF2H 3KR3L 3ZT7A 4EUPG 3PNWA 4XPFH 5CHNB 2X4OA 1OSPL 5IFJB 2AEPH 5TF0A 1RHHB 3FOMA 3FQTA 2W59A 2AJZA 2XWBB 4PG9A 1U93A 5IHBA 4L29B 5AWNL 2C26A 3EZ8A 2DICA 4HF5H 3KPLB 3TH2T 5FYKD 2X9XA 1Z9OA 3QYCA 3U7WL 3DUSA 1ADQA 2UZIH 3QUKB 4HQQH 4I48B 1IGTA 4LCYB 4PJXF 1ZT1A 3WL9B 3FB7A 3RGVC 1ZLVK 2AK4D 4F7TA 4PRPD 5I1AA 1ITBB 1JGVL 1SBBA 3GMLA 3NPSC 4XPHL 2OSLB 3O6KL 2EH8H 2ZG2A 1Q9WA 1JGEA 3W11C 3N50A 4F8QA 3PHQB 5MEOB 1JZ8A 4WNQB 3L3KA 3LZFH 4IIQC 1KXVC 4LU5H 4MA1C 2Q87A 2CKBH 4I2XA 2X4QB 1HH9A 1I8IB 3CH1A 2EYSB 3E1F1 4LCWD 3DWTA 5GHWH 3QQNA 2BXYA 4CNIA 4CW1B 3FRUB 3OV6A 3G5VA 5DMIL 4JPVH 4X80H 3P77A 4M7LH 3NFNA 1U8QA 3RTQC 2FL5A 3LMJH 4RAVA 5J12B 2R2EB 4Y5XC 4BK5A 4MA8H 4QRQA 2IBGA 2WUBL 2JIXA 1EMTH 1TTGA 3QXUA 4UQ2B 5AYUL 1R3JB 3PQYB 3ETBF 4UNUA 4XCYA 5JTWA 1TMCB 3L3IA 4ZUUB 2E7LC 1U8KA 2X4NA 1MRCH 1N0XH 3GMPB 4HS8L 4LSVH 4UT6H 5I1CL 3MXVH 4L8CA 1D6VH 5HGDA 4KDWA 5H94B 5JW4R 4XNQA 3HE6A 2VLRE 3HNTH 5DQ9B 2CDFA 5HTSA 3U6RB 5HHOA 5IWLC 4YXKL 3D2UB 3GRWL 4FG6D 1B0RA 1WK0A 1YEFH 1JGUH 5FK9A 4EI6A 4XNMB 1FVDB 4TSAH 1A1MA 3V6OA 3WXWL 3HAEA 1SYVB 4XP1H 4JLRB 4GRWE 1H5BA 4DFIA 5L9DL 4P2QD 1F13A 2EIBA 2PXYC 4XRCA 3I9GH 2ICEB 4S1DC 1TIUA 5F7HA 3U0WH 3KJ6L 3QWOA 2F54E 3MMEA 4Z7QF 1A6PA 1QUNA 3VFRA 5IG7B 2XZAL 3GJFH 3OHXA 1KPRA 3VMOA 1JZ5A 2OLDA 3IS0X 5I9QB 4PS4H 3PGFH 1TJHH 4PJ7B 1HINL 2MCPH 4NZRL 3KPSA 1D5BA 2GCYA 5K93A 4U1JB 4DFHA 2Z8WC 1KIQB 2P5EA 3QJFA 3PDOB 5LWYH 5EO1A 4XAKD 4ODVH 1UB6B 1OAZH 2GW5A 4B5EA 3X11A 3AXLB 4OZGF 5EO0B 2NR6C 4BSVB 5C0EB 1P4BL 4EJ1C 4GLRH 1MSPA 3UYOD 3BXNA 5GZOD 2NY5H 1MHCA 3BKYH 3BH9A 4PV8B 4U6VH 3GSRB 1IQDB 2VH5H 1AKJB 3BP5A 5HHMD 2EDNA 5TDPA 2UV3A 1CICC 3DXAA 1CD1A 5KZCD 2V5SA 2NZ9C 3N1FC 3OKKA 2I9TB 5EOCJ 2IPTL 2XKNB 1AD0B 3F6LA 5HGAA 5T1MA 1S9YB 5I75B 4OGAD 4WCYL 3D6GA 3GNMH 1GGUA 1OAYL 3EOAB 2ARJA 4LRIA 4JHAH 2EKSB 3QJHB 4J3TA 4L8SA 3EYSL 2CLVB 3JTSA 3ES6B 3MLVH 5I76A 5ILTH 3OGCB 3RKDC 3MCG1 1CXLA 4WFEE 4ACPA 3SHSA 2H26A 1ZWIA 4MNQA 1RZKL 4KFZC 4DGVH 5J12C 1BFVH 2VLRB 4OZFA 4Z95H 4CVZB 4YBQD 1M71A 1CGSL 3RVUC 3ULUH 3GMRB 4LVOC 1RUKH 1AGDA 1TXKA 4ZPVB 5EUOF 3RA7L 1EX0A 1IGMH 1NFDA 4PJEE 1K6QH 3G6AB 4ZXBA 4HJGA 2Y72A 4D9QD 2CMRH 4MVBD 3QDGD 3P0VH 5JO5A 4DN3H 3OKDA 5E4EB 3HZYB 4GRWB 3WO4C 1KENH 4S1QH 2G60H 4CRPA 1CF8L 3PGCA 1UQSA 2NNAA 1T2XA 2O5YL 3HMWH 2NY7L 4RQQA 4XNYH 3CUPA 3O2WH 4XP9L 3EYUH 4LCUB 4NBYB 1ED3B 1FCCA 2F54B 5EBMB 4JFDD 4H1LH 5AZ2H 4WTZG 4HEME 3SQOL 4NQEE 1UJ3B 3NCEB 1T5WB 1WITA 4L5FH 2L0DA 1NBZA 3Q48A 2QSCL 4PY8J 4G6JL 3BKJH 4MNGE 25C8L 2R1YA 2W65B 1AR1C 1AP2A 3IFNH 3QIBD 3ALWA 1JHLH 1XFPA 4AT6B 4FXGB 1KSRA 5B38B 3SDDB 3VWKD 3RGVA 3QIUD 3QUMB 3QFDA 1B6DA 3KVQA 2ADJB 4LASH 1FGNL 1FO0B 2Y07H 4PTTA 5AG9A 1NDGA 5JNYA 3SKOB 5IB3A 2NMSA 3D0LA 4WJ5B 3V6FA 3GMQB 4BQ6A 1U42A 4WU7A 4HLZG 2NX5E 2XY2A 2CUIA 5DZOA 4NJ9H 4O51A 4XC1H 1XF4A 2DKMA 1XR8B 4IIQA 4ALAL 4HT1L 2NY0C 5EDXA 1QVOB 4O2CA 5INCA 2X4RA 2HTLD 1A1NA 3BKML 3VCLA 2DBLL 3QEHB 1EAPB 4EOWL 1MCHA 1AHWB 4XXDB 4WHTA 2J1KA 1MFAL 2D0FA 3Q1SH 2UY6A 4G3YH 2A6DA 5JW5A 4NFBA 2VAAB 1S8DA 3RTQA 5GS0H 4JRYE 4X7TB 3JVGA 4G6ML 2Z91A 1ORSA 3DOSA 2YPVL 4UV7H 3VG0H 3PHSA 1EO5A 2IH3A 3HPLA 2BNQA 5FO7A 1K8IA 2GQHA 3B3IA 4QRUB 2X7LA 3WNKA 2E7LA 2W9DL 1TNNA 4X5LA 4O02H 1DQTA 4JKKA 2C7UA 4R8WL 2M26A 4N5EC 2B20A 1X7QA 4XT1C 5HJ3A 3S3SA 3VFNB 2BHUA 2F53D 2WP3T 3IDYC 1QRND 2ZCLL 3VGHA 1G0DA 2YK1L 5IWLA 3QXAB 4UBDC 2MKLC 4J4PD 4OUUA 2YOCA 3BVNB 5GGSB 4RRPG 5CKGA 4UINH 1TVHB 2AGJH 5J13B 5F1KC 2MQCA 4LF3A 4BA8A 5HI3C 5IBUG 5CEXA 1UT9A 4LDLB 1P1ZA 5LBSL 2R2BA 2CSPA 1JK8B 3QRGH 1KF9B 3IDNB 2IQ9L 4PYHA 5IW3A 3OR7B 2DQIL 3FQWB 4CKVX 2C1OB 4H0IA 7FABH 1T1ZB 3V5HB 4NQEB 5EBLA 2OR9H 3P0YH 3L3DB 4GKZA 4WY7L 1KCVL 1A7NH 4HJ0C 4PB0L 5ALBL 4NOFA 2V5MA 3BJ91 4U1LA 3KPRE 3O45A 2P5WD 4MNGB 1LO5B 5HYIA 3GO1H 5J7CC 2Q20A 5JW3L 5J1SC 1XGTA 3HKFA 1YJDL 3ULVH 4AEEA 2R39A 4XVUC 3ZTJH 2DD8L 4KV5F 4Z7OE 1B0GB 3GSWB 3MRNB 1BAFL 1P6FA 1F58L 4V1DA 4R2GB 3V6ZA 4M8VA 5MP6H 5HY9A 4PRIA 1UZ6F 1PZUB 1I85A 3B6SA 4LP5A 43CAA 5C2BL 4X6BB 2NX5B 3CMGA 4QXGL 5DHVH 5EORL 3O8XC 4LSRL 1L7TL 5FB8B 3QCTL 1CT8B 5I17A 4NWUH 2XPGB 3DRQB 4Q74A 3ZDZF 4UNTA 2GSGA 3QI9D 4LCYA 4U1GB 3SDDC 1WBZB 5I0DA 4OQ1A 2Y36H 3BZEB 3TYFA 3BGAA 1CICA 1GAFL 2XA8H 3HNVL 35C8H 5IBTL 1B4RA 3LKOB 5JW4N 5BS0E 3OJDB 4HS6B 3O6FD 1G7HB 2J88L 2XA3A 3FB6A 1A2YB 2XQYK 4JRYB 3G6JA 2P8PA 1I8LC 2IPKB 1I9RL 2XICA 4PGBA 1FPTL 2DQCL 2VISB 4JB9L 2WW8A 1F4XH 4GRMB 3NIGE 2H8PB 4Y19E 4OLZL 4ZD3H 3MRLB 1P7QD 3RWIB 1DLFL 1DFBH 4KRPB 1QLRB 2UVEA 3R0NA 1LGVA 1R5IA 5DEFA 3S35X 4JVWA 2J12B 3KYNA 4ZOEA 1BM3H 2MSPA 1U36A 4JO3H 5F1SA 1U6AH 1MI5E 3DIFA 1C5DB 4W4NA 5HYJE 4M43H 1ZHNA 3IDMB 1YEGH 4M7ZB 1MFCL 2VMFA 3A6BH 4P2OA 1JNHB 2J6EH 4I5BA 1KYOK 3C8HA 3LB6D 1IC7L 1Q1JL 3OKLB 4NRXB 1YMHB 1BF8A 4HX1A 5DRNB 5L2KA 3U9PL 3T04D 1GC1L 5F7EH 5H94A 2HMID 4OLVL 2PYEA 5GGVL 3O9WC 3MRKB 2F19H 1T1WB 2EZ0C 2VDNH 4KHXL 5IIEA 3RHWF 1GHFH 1QEWA 2V5RA 5JOEA 3B9VA 4L4TE 4UAOB 5DD1H 4JR9H 3L3OA 1DQMH 2B7DT 1SJXA 1A3RH 2L4OA 5J13C 1BFOA 5J6GA 3KPRB 3BP4B 3RDTB 1DE4A 4MQ7A 4TUJA 3DVNA 2YC1B 3IFPA 5GRUH 1INQA 2IPUG 2I27N 5IB5B 1RSFA 1MELA 2XG4A 1M7DA 3RNKB 3D39E 4EUPA 5ITFB 3IKCB 3P11H 5C0BD 2EYRB 2D7OA 5JQHC 1M05B 3DTXA 4WHDA 2RCSH 2I9LB 5IB4B 5GS3A 3DX7A 3FHQA 3MGTB 3QQ3A 5F97E 3HZMA 1E27B 4M1DH 2BOBA 3QFJD 4JPKH 4PGCA 4JGJA 2QSTA 4JFPA 1A6WH 4KUZH 5C0AE 4WHCA 3HB3C 2D7PA 5D1XA 4UB0L 2OI9B 5J3HD 2E6JA 4KVNL 1NC4A 1OAUL 5IW1B 4F57L 3MV11 1BBJB 4HIEB 4MJ5B 1ZLWK 4HC1H 4LMQE 1UADC 4HH9A 2CIKB 1Y6NR 5GRJL 3CDYA 4S0SD 4YDLB 4X6CF 4XH2A 3HFML 4OCLC 4Y1AA 3WFEH 3SGDI 5BV7C 3IFLH 3D69A 5IMMB 3C08H 5LQBL 2EXWD 3ECBA 5K9JL 4Y19B 5KAQF 3JWDH 2EE6A 4U1GC 2BFVH 4FMKA 4PV8A 5KSAD 3ZYIA 4O9HL 4U33A 4DEPC 2VLLB 1FVCA 1ZA3B 4X5WB 4YE4L 4PB9H 4JGUA 4JO4H 4DAGL 4LHUG 5DRZA 4Z9KB 4PLJD 3VXNB 5DDHA 3KYMB 3WKNA 5I1EH 2J4WL 5TE6H 3O3EA 4NKQB 4JO1H 2PR4L 4X98A 5CIPH 2BHZA 3H9SB 4I0KA 3QEGH 4I3RH 2Y5EA 3DETC 4HV8A 1A6ZB 3BE1L 5HYJB 3VI3F 4U6YA 1GL4B 1B4JL 4OD2B 5KOMC 4K55A 3RRQA 1M7IB 2DLGA 4KRPC 1ES0A 4HUVB 5C9JA 2IH1B 4ZO9A 5DD0L 4Z18A 2FEDC 2GY7B 1ADQH 2YSSA 1NCAH 5IF0A 4Q6IC 4OI7A 2D31A 3HI1B 3H0TB 4M5ZH 1EERB 4XB8A 3DGGB 4OF6A 1T1XB 1OPGH 4LARL 2HG5B 4X7DC 3V7AE 2JB6A 1IAMA 2GJ6A 1DQQB 1LEGA 5C08A 4NWTL 1X44A 4LVHB 4MDIB 1SVCP 5I66A 4WU5A 2AK4E 4N9OB 4R7NA 3K2MC 1VCAA 1UVQB 4OKVA 3D39B 5EZIL 2LV4A 3PP3H 4PJ5A 5LGJB 4UIKL 4Y4FC 3VWJB 5EBMA 3OZ9H 1A7OH 3BH8A 3UJJL 4UAOC 1YY9C 4X4XA 3FMGL 3O8XA 3ARGD 3INUL 4ODTL 5D1QB 4PFEA 2E9WA 2HA1A 3RDTC 3S34H 3FO2B 5C0AB 1MHEA 1AGFA 2DM7A 4LSTL 5JOFB 2VDML 4LCWE 3OAUL 1OT1A 4PPTA 5F6HI 4TN9A 4PBVC 2ZSWA 3VE0B 1NCUA 1BP3B 1RURL 1CFQB 4YR6A 5C0CA 2HFEB 4LPWA 3GMQA 1U0QA 2XWJA 1I8LA 4N8CL 3TVMB 3NABL 3S97C 1KFAL 2H45A 5EN2A 2CKNA 4XHJD 4NQCD 3BJLA 2B1AH 5ENWA 2Q8AH 2E7CA 1EAPA 4TVSa 3PV6B 1LK2A 1U8JA 3OL2A 3V5KA 1CDJA 4MXQC 1BX2B 1MCCA 1MUJA 1A3QA 2G5BA 4AIZB 5DMGD 5T3ZH 2SEBA 3D25B 3HAEH 1OAQL 5D7IE 1AJ7L 5E2WL 1AQKL 5MENA 1DUZB 4MD4B 1Q94A 3MJ8A 2OMNA 4HWBL 4Y16D 3VXRD 1S7RB 3P9LA 1CU4L 2IMNA 3H42L 5AZEH 2IAMC 4LLQB 5HI4D 4NKOA 2OYPA 4P2QE 1WFOA 4P4KC 3NAAH 3DI3B 1CFTB 1RZJH 2NZIA 1A7PL 1GOHA 2GTWB 2Q6WB 2R0ZH 2PF6A 3O9WA 1VFMA 4PRAA 1F00I 4PJFE 4DN4H 4XP4H 2CIIA 2NXYD 4PJEA 2CO7B 5GGSA 4P5MB 4Z7UB 2VDLL 2DM4A 3QBTB 4JY5L 3SOBH 4NKIL 3L3JA 3HLAA 1VFOA 4EDWH 2HFFA 2AK4B 1A0QL 3BI9X 3DVFA 4KUCD 4F9LC 5FECA 4JFEE 5F1NA 4OF0A 5HVHB 4RFEA 3I75A 2OZ4L 4XAKE 1TPXB 1ORQB 1E4JA 1NDMA 5CZXC 3AB0B 5T33L 3EHBD 3CSGA 4WTZA 1S7VA 1G9NC 4KQ4H 1NJ9A 3HMXL 3L3DA 5DLML 5CBEA 1JMXA 3BO8A 1ZEAL 5T1DH 3Q6GL 5D5MA 3EOBB 3FZUD 3ZT6A 4N90D 4LCWB 2BVQA 1INEL 1F4WH 1E6OH 1Z2KA 1QFWI 2EICA 3RVVC 1RIUL 6FABH 3VFWA 3VFGH 3MYJB 1MCRA 5E5UB 1IL1B 4DGYL 5I15L 4OTXH 3RHWK 4KJWD 4M9PA 5IESL 5BVPH 4YHKL 3MLXL 3KPNA 3QIWC 1CR9L 5F7LB 1WGOA 4X99B 4YNYA 3SE8L 4NT6B 2YBRB 4LLUA 5GRZA 4X7SL 1IKFL 3EUUA 4E0RA 4OZFH 3M1BB 5B3JF 1W72L 4CN4A 1OGTA 4MHHI 1TZHA 2EIDA 4YHOL 2ZSVA 3C2SA 5FUCE 1KCSL 3OKNA 1A4JB 1MREH 2F8XC 4MD0A 1G7IB 1X5GA 5DR5H 1NCDH 2VDRL 3OJDA 1UKSA 1ZLSL 2CGRL 5KVGH 3BN9C 3G04A 3TPUA 1NGXB 4HBCH 1A6TB 3TVMC 2BRRL 4Q97A 5F9WB 4F37F 4K3JL 3UAJC 5C6PB 5JA8B 3MNWB 3I3EA 3D9AH 1RK1B 5GSVB 3S5LG 4D9QE 1WZKA 3QDGE 4M5YL 4QHUB 3RZCB 4P2RD 4Z6AT 1RJLB 4P2QB 4XWGH 5EZJA 3T8XB 3CMOH 3FCTB 1KBGL 5B3NA 2CDEB 4EXPX 1G9MH 1KB5H 5E8EB 1IGJB 5K9QG 1JFQL 4MQXC 3ZE0E 3RVTC 5B8CB 2ED7A 4WV1B 4JFDE 1NAML 2JELH 4PJFB 1KCLA 1WIUA 4Q6IA 3HI6H 3ULUF 4XMKH 5IB2A 4N8VB 4QHMB 2EDJA 3TJHC 4RRPA 4XX1G 1KOAA 2FSEA 4CADB 4PIRF 1GGCH 1A14L 1T80A 3GGWB 3U0PA 4M8QB 5I2IB 3IDIB 3RL2B 2YPKA 3MJ9L 2A77L 1ND0B 4JFEB 5E6ID 5FGBA 1YQVH 1Q9KA 4YHNB 3CSPA 1BPVA 2CLRB 3E6FB 2VXSL 4Z77B 3IDXL 4JFQA 4HK3N 3WSQL 4Y4FA 4NZDA 2VLJD 3BZDA 4G8EA 4EIGB 3F7RA 4ZAKB 5SWZD 5I1JH 4PJ9D 5I18H 4UUJB 5D4QA 4IMKA 3N1PC 4RMSA 4J2XA 2AK1H 4OV5A 5CD3B 3BIKA 2LTQC 3PWNB 2OP4L 5E99H 4J7RA 1FH5L 3FFCA 4GKOA 5DK0B 1S7QA 4ISVA 4TVPL 5F3BB 5E8NA 3P30H 2QR0A 5CGMA 5EOQH 5HVWA 3FQRA 3WEXB 2Q3AA 3ARBC 2X70A 2EYRA 5JQ6L 1TPXC 3K7UA 4XBPA 5IB4A 5F88A 3QG6B 1JVKA 2P42B 1ZKAA 1OP3K 4UDTB 1VFBB 5IMLB 1OARL 2O93L 3G5ZA 1OHQA 32C2B 3P73A 3PABB 1ZGLM 3MRPB 1D5IH 3U7YL 5DUMH 2HH0H 4IOIB 2F58L 3ZLQC 3L1OL 3F7YB 5HYQA 4WFGD 1FNLA 4R97B 1GGIH 5FV1L 3PGDA 3BSZL 4ETYA 3X3GL 4LEXH 1WBYA 4WUKL 5BS0A 1J86A 2GAZA 5IB1B 3IU4L 1F11B 3VD9A 3AU1B 1RZ7L 1QRNE 3BT2H 2YD6A 2GK2A 2APTA 1JTTA 1KC5L 4XPBH 2XTLA 3HZKB 5FYJL 1UM4H 1G7QA 1I7ZA 4AH2A 3VGAC 4NZTH 2UWEF 1NCCH 2VDOL 3QDGB 4O4YH 4Q0XH 2AJVH 2NY6C 1J7VR 2IAMA 2NY2D 3CFKA 1JHTB 2OK0H 1L0QA 3F65A 4E42A 1MIEH 3IJHB 4P4KA 3SDYL 4TOYH 5FA3A 5DJ2A 1OM3L 3TO4C 1K4DB 4ODUB 4L3CA 4U6XB 4BSWB 3P40A 1GIGL 1XIWB 1ZLUH 3C5SA 1FE8H 4DWHA 1MI5A 4FG6C 3GI9L 4ZNEE 3CK0H 5JZ7D 2CLZA 2BCKA 2IALA 4X5XB 1DEEA 3VXQA 3JTTB 3CFIC 2P5WE 5EU6E 1N6VA 4GSDL 5FA4A 4LLWB 3SJVE 2Y5TB 4KTDH 2AEQL 3BZ4B 4LCIL 4WFHD 1MY5A 2X41A 4OSUL 4F33A 3DUUB 4WGWB 1Q9LA 3QEQD 5DJ0B 1LILA 2H6PB 3KR3H 3QNXA 1RJYA 5JIKA 1K9TA 4FFVD 4FXKB 4IRJD 3TIDA 4YHMH 1OSPH 5DVLA 3H0TA 5CMAB 4L4TA 4HUMB 3IF1B 5DC0A 1T1XA 3TBVB 2ZOLB 5AWNH 4ODHL 5C0FB 3EOTL 3PWJB 1F6AB 2XQYG 1QG3A 1J5OL 3OKEA 3BPNB 4OFYD 4D3CL 1GSMA 3U7WH 1IAII 2X1PA 3QXVA 3KG5A 5F1IA 2OXGA 3ULVF 2X89D 2XWTB 4O2FA 1A6AA 2FBJL 2JCCF 1MCWW 2Z93B 1JGVH 4X6DB 1J12A 2OTUA 3O6KH 1JWMA 1BQHG 1W0YT 4NC1C 4GBXD 2BSTA 4MB3A 3QIWA 3CXHJ 4G6KH 4XNZB 3VH8B 5GZOC 1VESA 2AV1A 2AXGA 3H2WA 1OB1A 3N06B 5B39G 3QXDA 1HSBB 5I71B 1SBSL 4OZGE 5HDQH 4LSPL 5C09E 5AEAA 4XBGA 5LCVH 5M7QA 4BZ2H 2R0WL 5TDOB 3KS0H 4LP4A 5SX4H 4RNRA 2EE9A 3MLWL 1WZMA 4GLRI 4FQ2L 2PO6A 3FO9A 5DMIH 3PJSB 5AUMA 1QRNB 1R3KA 2QADD 3GJFK 3P2TA 1ULVA 3ZKMD 3JXAA 3KPOB 3JUYA 2BVTA 4GMTL 3MLUH 1JRHI 1YUHA 1JE6A 2P46B 2WUBH 4JHBA 1FAKT 3QZWG 5AYUH 1JGLL 1JTOA 5CLWA 5DJYB 3O6MH 4K07A 4GG6B 4KAQL 3BIAX 3H9YA 4LHUA 5D71L 4QXWA 4L9LB 1KJMA 1VFAB 4MS8D 5D9SB 3CX5J 2R1XA 2ADIB 4HS8H 1J87A 2RJMA 3DJ9A 5I1CH 5ID0B 1SVZA 2ERJB 4OZ4B 4P3WA 4AIXA 1FL5B 3DSNA 1CFVL 2CQVA 3MLSL 3MRHA 5KN5A 2X9WA 1CXEA 1U91A 4NPYA 4CGTA 3UBXI 4CJ0A 2FH8A 5DA0B 4YXKH 1I9JL 3GRWH 3IFOB 1CZ8L 3IAPA 3LVEA 3T4AA 4ZUVB 3FJTA 1G1CA 2P5WB 5DJCA 2I07B 1JTPA 4ONGL 5EU6B 3GM0A 4NO0B 3SJVB 5EUOE 3UJTL 3WXWH 5JPNB 4OQTA 4F7CB 2GTWA 1EK3A 1Y18B 3TNNB 5C0BE 4PJGA 3NH7L 2ZUXA 1LP9A 2J8UF 4F37K 4RGMB 2DQUH 4FABL 3KJ6H 2WBJA 1AQDA 5GGRY 1NBQA 1Z9SA 1CXHA 2AKRB 2XZAH 3NFSL 2QSVA 3QFJE 3QIBC 4APQB 1MCQA 3VXOA 4YAQB 1OCWL 4ORGB 3MQIA 1NEUA 4U31A 1ZVHA 4ZS6D 3QIUC 3C2AL 3VWKC 2AK4A 3ROLA 4PRPA 3NIFF 1QKZL 1XGPA 1F2XK 5FEBA 3MRIB 3KLAB 2NYYD 3RL1A 3O6FB 5BZDB 3ARBA 5L2JB 5BO1L 5DRWB 4OLUL 1S7UA 1DN2A 2WWMD 1WZ1L 1HCVA 4Y2OA 5HI5D 2HTLC 4U3CA 4PLOB 5J89A 1UM5L 1P4BH 4QKXB 2A6IB 3O3BA 1P7QB 4QCIA 3RWCB 4NHUA 5C09B 2FX9L 2GSIA 3T0DA 1EGJA 3FT4A 1EH9A 5J4MA 5BRZB 1JMZA 2JB5L 3DX6B 4QNPF 5I1HL 4JFXA 3GBML 5E5MA 5DJ8B 2BNRD 5C0IB 1K2DB 3MCKA 5GIRB 4KK8D 4MJ6A 4XNZC 1EFXD 2XFXA 3QEUA 5GS2H 1QBLL 5TE4L 2F15A 5I71C 1A6VL 1HNGA 2C5DC 3SDAD 1OAYH 5IBLD 5TJWK 3QZWB 4OCWL 1W2KT 4ZYKB 3REVB 1QOKA 1YEJH 3OR6A 4KJPD 2CH8A 3PL6D 4KPHL 2VZTA 4WO4C 1KXTB 2E7BA 3HR6A 3TO4A 5D7IA 1GRWA 2KQMA 5DQJA 1NCBL 4RSVA 4XVJH 3QO0A 5E70A 1RZKH 3QWQB 5CSBA 4J4PC 2GFBB 4YK4B 4LDOB 4M6ML 2YMXH 3TCLB 2IBZY 1CGSH 5GSVA 3K4ZA 1DQLL 3T0VA 5I1DB 2OL3A 5GS0D 4M4RA 4NQXB 1C5CL 2D0GA 4L4JA 5EUOB 3ABZA 4UV4L 3UTZB 5FO8B 4P2CG 3AFLA 5C0BB 2ZUQB 1CF8H 2FJGA 1KJ3L 4YXLL 2ERJC 2ICES 5A2FA 2NY7H 1VSCA 5FKAA 4J1UA 1CLYL 2EYTB 2A73B 3LEXB 4XP9H 5DK2B 4FFZL 1UACL 4YC2C 2Z0BA 1UZ8B 3DX9B 1F6FB 5E4IA 3QFJB 3SQOH 4M8QA 3RL2A 5MERA 4G6JH 3DRTA 1ZXQA 5B22A 2X05A 2H3NB 1OOAA 25C8H 5JIIA 1HHGB 2B2XL 1KTKE 3UTPD 4UT9L 4POZD 2XI9A 2BVOA 4DKEL 4JJ5B 4RGMC 4HUXA 1FGNH 4LKXA 5ERWB 2EDWA 3QUML 4RIRA 5IHUL 5D1ZC 1CDUA 1FO0L 2D7TL 5DUPH 1DR9A 2DI9A 3IXTA 5ADPL 1J1OL 4XAWH 5INDA 4XCEB 5JPMA 4U2ZA 5ALCH 3QI9C 4DUVA 1HHHA 2JK5A 1UZ6E 5KSAB 5HDOA 4ALAH 2LU3A 2EE2A 3QA3B 8FABA 1R5WA 5F7KC 5DK0A 4BKLA 2FIKA 3KYOB 3BKMH 2E3VA 4PRHA 1QFPA 4EOWH 5HPMA 3SE4C 1DDHB 2H9GA 1MFAH 3MODL 1WCBB 5IW6B 2ZUWA 4Z76A 1IAOA 4Z8FL 1KIPA 3GK8L 1F4YL 3QG6A 1BEYH 4R3SA 3ULVD 4ELMA 1BHGA 1XZ0B 3VXRE 3FOLB 2DLEA 32C2A 4G6MH 1I7RB 3MRPA 3PWUB 2FO4B 1GGTA 1H0DB 5DRXA 1NEZB 3H6JA 3S88H 3DYPA 1N5YL 2EDXA 3U7AA 3FFDB 4WWKB 2C4FT 2H2PC 4OLYL 2W9DH 4HIXL 4IJ3B 3S4SG 1TETH 3VXTB 1PY4A 1TLKA 4WI3A 3MR9A 4R8WH 2AERT 3TZVA 1CDGA 5LVEA 2EEAA 2ZCLH 2OXHA 1BMGA 3CPLA 2YK1H 4MCZB 1Y0LA 2O5ZH 3S5LA 4JG1L 1OTTC 4NKMA 3CFCH 3LB6C 3VD5A 2BSRA 4OCYL 5MI0B 3TM6A 3TN0C 2HJLB 3TBWA 2HMIC 3FB8A 3NCYS 3GBLA 1VEOA 3VGBA 4BSWA 3VRJB 5LBSH 4JFDA 4OAWA 3MUY1 3WIIH 5I8CB 1MVUB 4YPGB 5SV3A 2GUOA 1UXWA 3OMZA 5IK3B 2DQIH 5H37G 5IVNA 5FM4A 3ARGB 3M17B 1T7XA 4NCC1 3QIBA 1KCVH 4N90E 4PB0H 5ALBH 1VGKA 3CVHA 4ZS7L 4D2NA 3MRGA 3VWKA 1XCQA 3QIUA 1NUFA 1WAAA 5BCAA 4F7PA 4MJID 5EH1A 5JW3H 1TITA 4JFYA 1NUDA 5F44A 3VFOA 1YJDH 3BW9A 3Q3GB 2RGSA 1FYTD 5ICZA 2HYMA 1F58H 2EDKA 3LKSB 1N59B 1RD6A 4OI9A 4R90L 1JPTL 4M3JA 3MV8D 2W38A 3AS1A 5C2BH 2R1WB 4QXGH 3TIEA 3TLRA 1HSAB 5EORH 2GHWB 1EBAA 4LSRH 3BP7B 1L7TH 3QCTH 1KLUB 1AO7D 5J3HC 4S1SL 1F4HA 2IGFL 4NFDA 3KS0J 5C07D 4JO2H 4RDQF 4EXKA 4HWUA 1EHNA 1VKXA 1IAKA 3RBSA 1F3JA 4NZUH 4PJXA 2N7AA 1GAFH 3HNVH 5IBTH 1EVTC 4JDVB 4C55A 2J88H 3I84A 4Y16B 2DTMH 3VXRB 2YKLL 3I50H 3FO0L 3IDUA 2EXWC 1I9RH 5IMKB 2BHYA 1JUFA 2NCMA 3HCVA 1FPTH 2DQCH 4FQIL 1DANU 3ZKND 2WWKO 4BQCA 3MUZ1 1JZ2A 5I73C 2IFFL 4PLJC 4YGAB 5E24E 2IQAA 4OLZH 1IC4L 5TDOA 4AEHL 4MQSB 1P84K 2ZPKH 4WO4A 3W0WD 1DLFH 1T66D 3PP4L 1UKQA 1K3ZA 5GSRB 3S4SB 1HKLL 5TFSL 2FX7L 1NMAL 2F53A 3PJSA 3D18A 3C6LB 5DMJB 5ICYB 3WFDL 4J4PA 4RBPH 2BK8A 4H20H 5CUSH 4KMTL 3VXMD 3X13A 1BREA 1HOCB 2HTKD 2ZOKB 5K9KB 1MFCH 5EB9A 1TCRA 3JSSA 1AGBA 2Z8RA 3QUYD 3GHBL 3VI3E 4MNHA 3OQ3B 1IC7H 1Q1JH 5F6IB 1YEKL 4YFEA 4LLMB 2V9TA 2PW1B 1NL0H 1FDLL 1GC1H 4HD9A 2AJUL 2Z31A 4NQSA 3U2SA 2PKDA 2VLJE 4OLVH 5GGVH 5D7SL 5SWZE 5EIIA 1XF2B 5KSBF 1NFIA 4KHXH 2V5YA 3PF2A 3IFOA 5HYSB 4ZUVA 4NRYB 3JV6A 3VXPA 5MI0C 3MO1A 1PG7L 4LLYA 5C70A 1H3WM 3I02A 3VGFA 4YBLB 2AXFA 1QFWL 3WCYA 3IJSB 3W9EB 5FUOL 4HZLB 2Y06L 1E0OB 3LDBB 1EO8L 3EJZC 4NN6C 4NN7B 1FYHB 2OR8A 3ARGC 4WHYG 4UQ3A 5D1ZA 2R2HB 3GHEL 4S2SA 2OM5A 1GVIA 3QI9A 3EKCA 3SGJC 1KELL 1OL0A 4WFGE 1KPVA 4G6FB 1GZQA 3BQUD 3SE4A 3MOAL 2VNCA 4KVNH 1MRFL 4LGRB 4KKBD 1OAUH 4P48A 2R29L 1BQHA 1CGYA 4F57H 2HVKB 4F2MB 1EVUA 3P4MA 3QPQD 5C92A 3WFCH 2Y23A 3WIFA 2FBOJ 3BDBA 4OZIA 8CGTA 5L7XL 3HNSL 3HFMH 5B39A 3B5TA 4HKJB 4OZGA 3C5ZB 3QDMD 1P7QA 3S37L 4DTGH 5FIEA 3RWCA 4Q9RL 3MV7E 3OG4B 5LQBH 1YEEL 1CE1L 1DVFC 4O9HH 5CSZB 2WK2A 3PP3K 4DAGH 5A40E 2VQ1B 1JPGA 3CZJA 4NCC2 4QHLB 2J4WH 5IROA 2PR4H 3HTLX 5IQ9B 2JIXD 1VFUA 2A9ML 1TTUA 2VR5A 2ATKB 5I1GL 1WWWX 4POUB 4G8GE 2RFXB 5HI4C 3O0RL 3BE1H 4DKDC 1T6VN 5I1IL 2DQDL 5TQ2L 3REVA 3T0WA 5GS1B 3C87A 1B4JH 3C9NB 5E6IB 1T20B 1EA9C 3TN0A 1ONQA 2C3GA 4WFHE 1XF1A 1ETZB 5DJDA 3HE6D 3E6HB 2VXTH 1GZPB 2FB4L 1L0XA 2DQTL 3ARDA 5GGTL 2VLJB 2IADA 5SWZB 4PJ9B 2NXYC 4Q58C 4TNVF 3A6CL 3CXHK 2PYFB 4Y8AA 5EBWB 4JDZB 4HKBB 2UZXB 5T3ZD 2W0LA 5GGUB 4IM8A 4OGYL 1J1PL 5I1DA 4LBEA 1A9EB 4LARH 1ZAGA 1HYRC 1CDCA 5E94B 4NWTH 1NQBA 5F6IC 4P57A 5DI8B 4XCFL 5F9OL 3SDCD 2X1QA 5D7LD 5TF1L 3ESUF 4IHOA 5DK2A 5ADOL 2W0FA 2WIIA 4UIKH 1MFEL 4JQVC 3DX9A 3UJJH 1NLDL 3TF7C 1MOEA 3FZUC 2ADFL 3T3MF 3TBSB 3FMGH 3INUH 3G6JF 3HR5A 4FQ1L 4EQ2A 4YBLC 1LEKA 4GS7B 2NY4D 3FTGA 4JY4A 1MFDH 2VDMH 3NTCH 4LAQL 3CX5K 3OAUH 3EIFA 3BD4A 2DWDA 1LDPH 2FJFB 4NN7C 3U0TA 3HS0B 3O41B 4HCRL 4CVXB 5ERWA 4S1RL 1RURH 5DD6B 4ZG1A 4LKCB 3I6KA 4MSWA 4OBSA 4M7LT 5AD0A 4DK3A 1VB9A 1HILB 4N8CH 3VFUA 2AP2A 4KQ3L 1FN4A 1QBAA 5FYLH 4FQHB 3MNZA 1I1AD 3MV7B 1KN4H 3VG9C 3BAEL 2XNAB 3CDGA 1D6EA 2AQ2A 4PD4J 3DXAD 3VXUA 5A2IH 2UUDH 3ZDYF 1UB5B 3L7EB 5CEZE 3LQAL 4X8JA 1JP5A 2CKBB 4FZ8L 1EHAA 3ROOB 5DF0A 1GJIA 1ODAA 2ENSA 3VXSA 3QXTA 4WW2B 4CMMA 3EFFA 1PSKL 1FFOB 5E2WH 4KMLB 5KS9A 1YN7B 4G8GB 4LIQE 5D7KD 4I4WB 4M7JL 4F7MA 1CU4H 3HA0A 4BFIB 3O11A 2H2SC 3H42H 1BOYA 4I18B 1WSST 1F3RB 4NM8L 1AR2A 3BGMA 4PP2B 3WV0A 1QBBA 2FEEI 4C59B 3MROA 2Z35B 4UDUA 3EYQD 4KTEL 4H26B 1OW0C 4IRJB 3LN5A 3UBXG 5BOPA 4OZHF 4K3DL 4PJIA 4MYWB 3G6DL 4ZXBD 5LGHH 5CILL 1BLNB 2ESVE 3HHRB 1MFBL 3RU8L 4FQJL 5C0ND 5GS1C 2BNUA 1JI2A 1MHHA 5DHYA 3MNVA 1RU9H 4BFGA 3RWHA 4P46B 1HZHH 4NKIH 5IM7B 5C0GB 1AFVL 1IAIL 3GM8A 5BXFB 4KHTL 4BK4A 1A0QH 1KTLB 1UFUA 5HGGS 5EU3B 4GBXB 3MLRL 3P0GB 1TCMA 4H25B 5C0DA 1MLBB 4MA3B 1TZGH 4R4FL 3ARZA 1OTUD 3UZEA 1A5FL 5T33H 3ARUA 2FZ3A 3ZTNL 3UO1L 5DLMH 3SCMD 4WW1A 4NO3A 1ZEAH 4QOKD 4DVRL 3WS3B 4H1LG 2FWOB 3LY6A 4ZFFB 3Q6GH 5DC9B 3SGJA 3CU1A 2BOCA 3RGVD 1BD2D 4JM2F 2YPLD 1QBML 4NJAH 2BNRE 1T3FB 1RIUH 1JYXA 2XN9E 3I6GA 4HMCA 2HVJA 3STLA 1NKOA 4GUPA 4LSQL 4DGYH 4V2BA 5IESH 4YHKH 3MLXH 1CGXA 1CR9H 2M8XA 3JV5A 4NQCA 4XHQA 1JRHL 1LVEA 1IKFH 1W72H 4GS7C 4J3VA 4FQQB 1C5BL 4BQ9A 2NQCA 3B83A 1DVFA 3LSOB 1KCSH 1PQZA 1HXMB 3IVKB 2HJKB 1NGYB 3RUGF 3FO1B 2LU7A 4FP8L 4Y2DD 3QH3A 1F2QA 5MEPA 1ZLSH 2CGRH 3IXAB 4XNUL 4MXWL 4HIIA 4JAMB 5E9DE 2BNQD 1HQRB 4K7FA 2BRRH 3K4DA 1UEMA 4L3ED 2NY2C 1L9MA 3HC4L 5CBAA 4NRZB 1SYSB 4JHWL 3SY0A 5KSVA 3KPPA 3WMSA 5E8DL 5L8JB 1DBML 2ZCHL 2QHLA 3EYVA 1OP5H 4JFHE 4ZUTB 4KZDL 1KBGH 2Y7QA 4JFZL 4IRSC 4X9BA 5JORA 3F12A 3OKMB 2ICCA 1VHPA 1JFQH 4AM0B 3KLHD 5JHLL 4GG8B 1KPUB 3EGSB 3L5WA 4QLRA 2YD7A 5ISZD 2F5BL 1OF2A 2ESVB 5MEQB 4AL8L 1FZJB 4BM7A 1ITCA 2VDPL 1Z5LA 2OTWA 3FN0L 4C83A 2MPAL 4I18C 2FD6L 5EPMB 4N1HB 1A14H 2HN7A 4ZFOA 2HP4A 3MJ9H 2A77H 3O4LA 3VFTB 2P7TB 4IRJC 1A1OB 4ETQB 2QEJA 2EDFA 3IDXH 3D85B 1PEWA 3WSQH 3HRZB 1KLGB 3Q6FB 4FHBD 5KJRH 1SY6L 2N4IA 4JQVA 4K94L 2P8LB 4CDHA 1I3GH 4JZJC 3PWLB 4NSKA 3SO3C 1QO3B 3EO0A 3CU7A 5DMKB 4U1KB 3W81A 2OP4H 3RNQB 1FH5H 1BQUA 3LRSB 4TVPH 3C8KA 1RIHL 1J0KA 2W91A 3UDWA 5M95B 4GBXC 4PRID 3WNLA 3LIZL 4ZSOE 1ZLUK 2XN9B 4F8TA 4TNVK 1IJ9A 2AXHA 1AGCA 1H3TA 1EFXB 2M2DA 3EO1B 1QSED 4ODXB 1IGFH 3ZTJG 2NXZD 5HHVL 1GH7A 5BVJA 2CXGA 43C9A 1XF5A 3JV4A 3PWVB 5CEYA 1FIGL 4BELD 3RJQB 3T2QA 1OARH 4ZUSB 2ITCA 5A43C 1CLOL 2JJSC 2ZZUT 4N9GA 3WBDA 3BPOB 5EC2A 3OAYH 2F58H 2OTPA 3L1OH 4XGZB 1JWUB 1BIIA 1OP9A 3MRMB 3GSNA 5H35B 4N1EA 2JJUA 4Y4HA 5HDLA 3X3GH 1IGYB 2QADC 3QISA 4WUKH 4ODWA 3ZKMC 4F2MA 2IBBA 1MQ8A 5DJXA 3IU4H 4HK0A 2DJUA 4PTUA 5E9DB 2AJSH 4OM0H 4MWFA 5DTFB 3WFZA 4P2RA 2QLVB 4X6CA 1P69B 4P5KA 2VDOH 4F15B 3PIQB 4R96A 2NY5C 4JJHA 3EDDA 1DP0A 3SDYH 4N0UA 1OM3H 3CVHH 3VFMB 1OW0A 1LO4L 1T5XA 1GIGH 4X6EA 4LNVA 3GI9H 5FF6A 5ITBL 2RFXA 4P2OD 1KCKA 3NCBB 3K2UL 1CDYA 1ZA6B 4WDIB 3SQBA 4OIAA 2OX5A 4XCNB 1K4CB 4KKCD 2KDGA 1KCRL 3CC5A 3DX8B 4MJIE 4GSDH 2PYED 4BH7A 4CUCA 3WKML 3QCUL 4LSUH 1CFSA 4CBPA 3GMMA 1FYTE 2PW2A 4LCIH 5D5MF 4Y4KB 5D93B 2HFGL 4IS6A 4QXTA 3LN4A 4KI5F 1VEPA 3IDJA 1S5HB 2EEDA 3T77B 3MV8E 4OUOA 4OIIL 4NUGL 3GJEA 4HBQA 4ZS6C 2J8UE 5JMOC 3KGRA 3ULUC 1AO7E 1A9EA 1NGZB 2YXMA 4ODHH 2XZZA 3EOTH 1J5OH 1DBBH 2NYYC 1I9EA 4PREB 2Q7YA 1CFNB 4D3CH 5C07E 3FQUB 4JPIA 4U1SA 3NN8A 2D4FA 4YIQB 2ICWB 4ZSOB 1DBKL 2WWMC 4PY7B 2FBJH 1KTRL 3VFPB 3L95B 3NIFE 2DQFB 2DBJA 1U8IA 5HHXH 2GKIA 1IGIL 1EHLL 2NY0D 4LPXA 1MJ7L 5DURD 5EOTB 2VLMD 5T1KD 4G9DB 4WUUD 2UY7A 5D1XD 3KNBA 2BSSA 4CMHB 4M00A 3B2VL 4NDMB 1MLCA 5F7MC 3ZDXF 1HI6B 3W0WE 4GAYB 1KJ2A 3S98A 3O2DL 4LSPH 2R0WH 1T0NB 3NZ8B 3MLWH 1FJ1A 4FQ2H 1PVHA 4Y1AD 1X5FA 2CRMA 5IVZB 5J0BA 4JM2D 4QNPE 4OF5A 3SDAC 5IBLC 4GW4A 2HJFA 2A6KB 3VXME 2DKUA 4MD5B 3U4BL 2DQHL 1B6UA 3IDGA 2XIDA 4KJPC 4G7YH 5IJVB 3PL6C 3L9RA 2XNAA 1JZ6A 4LHJB 4F9PC 1ZSDB 4YDJA 3C6SB 1JGLH 1ZS8A 1A6UL 4LCCC 1KEGL 4KAQH 2E7MA 4N5ED 2W9EL 2X5PA 5D71H 3KYKL 4YUEH 4IRSA 4QWWC 3H9HA 1AIFB 4HMEA 5TGBA 4MDJA 4M93C 1J0YA 3VGDA 3OKYA 1CFVH 2CPCA 3MLSH 1F5WA 3QG7H 5GS0C 5T1LB 1ZHBB 4WEUD 1CZ8H 5L8KB 2AEWA 3UTTE 4LLVB 1FL3B 4NNXA 5KANI 1IKNC 4NQVB 4X7CC 1EFQA 3UJTH 3P4NA 3QEQA 3N1GC 2CDGB 1FYTB 3RWGA 2Z4QA 4H26A 4IRJA 1JGDA 1NLBL 3RWJB 3DO7A 1RUML 2VTFA 2VXUL 3CZFA 5DSCA 3NH7H 3ILPB 1R3LB 1T22A 1RZFL 3OSKA 3TFKC 1FBIL 2GJ6D 3EO9L 2J8UB 5C08D 4KK5D 4Z7VF 1AO7B 3RIFF 4JZJA 1U8PA 5J1AA 3UTSA 5GRVK 1MIMH 3NFSH 3ULSB 1EZVY 1X5XA 1U3YA 1OCWH 3CJJA 4POZC 5C07B 2X89A 4GAJL 3C2AH 5GGQL 5J9PA 4P23D 1A7RH 2W07A 1QKZH 4GFTB 5ICXA 5T5NF 3PHOB 5GGVY 3QUXA 1QR4A 1GGYA 3BEVB 5K9OA 2AJXH 5BO1H 4OLUH 4PJ8C 1SJHA 1WZ1H 3QQ4B 5ESVA 1NBYA 2EIZB 3OBAA 4I2XE 3AAZA 2IFGA 1UKTA 1UM5H 3HE7A 3P9MA 3GJFA 3PWPD 4P5TD 5HHQB 2GK0B 1BZ7B 2VN4A 2B0SL 4RX4D 1NCWL 2VLKA 5C0CD 4HWZB 1BVZA 5E1AA 2JB5H 1RZ8A 1KG0A 1YEHL 1QFWM 5I1HH 3B8YA 1X5KA 3ULVC 3DARA 3KWWB 1FIEA 5KVMC 3LH2L 4U0QB 4HUNB 5C2UB 4M1GL 2EDHA 3PE9A 1DL7H 1QBLH 3VXMB 5T3XL 5TE4H 3Q0HA 1R24A 4E5XA 2QQKH 1RAMA 4HWEH 4QHKI 1A6VH 4GKNB 1MVFA 3QUYB 2YXFA 4OCWH 1TZIB 4HGWA 1JWSB 1MWAB 1NBVH 5KVFL 3FQXA 4KPHH 3QDHA 4PRDB 3LKQA 5HHOE 5MEND 3L5IA 4JY6A 1ZVYA 4MAYB 4ZNCD 5F3HB 1NCBH 2ZWLT 3U46A 3S96B 3BDYL 3MLZL 4F7EB 2XV6B 3IGAA 4YZFF 2QHRL 3V2AR 2V2TA 3V6OE 4ZQKB 1DQJB 2HLFC 3QNZB 4M6MH 4I77L 2EKJA 1Q0XL 4KKLD 4O00A 3HPJA 4OM1L 3UTTB 1AY1L 1FP5A 1DQLH 1FZKB 4Z0BH 1A7QL 4FTVD 3R4DA 4Y8DC 3PNWB 2X4OB 1HDMA 2XTJE 3FOMB 1QD0A 3FQTB 5D7LE 2AJZB 2EZ0D 4JHZA 1U93B 4YXLH 4AM0A 1KJ3H 1KPUA 2YHGA 3S36X 1DQDL 3UBXA 4GXVL 4GRWH 4RGNC 1CLYH 4ZFZA 4FFZH 1UACH 4WVRA 5EA0L 3UZVB 2JJTA 3DUSB 4IMLA 2OJEA 3UTOA 1IGTB 1AE6L 1OTSD 3FB7B 4GJTB 5KSUA 1FZMA 4F7TB 1C16A 4PD4K 5I1AB