5BS1A

Crystal structure of rbcx-iia from chlamydomonas reinhardtii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
118
Chain Sequence
b'MHIPADSFSGASPERKAAVALRSLFTFVAARVVLEQLQGTTYNQQAYLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRETREANTRLMRAAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CrRbcX-IIa
publication title Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Chaperone
total genus 37
structure length 118
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5bs1A00
3HYBA 2PEOA 2PEMA 2PENA 5BS2A 2PEQA 2PEIA 2Z45A 2PEKA 3Q20A 4GR6A 3RG6C 5BS1A 2PY8A 4GR2A 2PEJA 2Z44A 2Z46A
chains in the Genus database with same CATH superfamily
3DS5A 3G71P 2M5RA 4GR2A 5JPAA 2XXMA 3P05A 3NY7B 4GR6A 4U0CA 1AYIA 2KR5A 2L9FA 1KLPA 5I4TG 2PENA 4WYMA 2FVFA 2AVAA 5HGOA 7CEIA 1QRJA 3GZLA 1FR2A 2EHSA 1YJWP 2GZIA 2KWLA 2MF4A 3G28A 1GXHA 2XV6A 4U0EA 1VQMP 2KOQA 1YJNP 2EG5A 2EFJA 3LMOA 1M90Q 1ACPA 4PWVB 1VQ5P 3HYBA 1X3OA 1NQ4A 2JGPA 2AF8A 4XROA 4XFYA 2VLOA 3I56P 2FADA 2PEOA 5BS1A 1D1DA 2PY8A 4U0BA 1F80D 3G6EP 1OR5A 2GDYA 3G29A 3CCLP 4H2YC 1YJ9P 3CCSP 2KW2A 1M1KQ 4DG9A 3GZMA 1RO0A 1VQLP 1ZMBA 1RO2A 3G21A 2KGAA 2QEXP 3CMEP 2JO0A 3DPHA 2BUOA 3M1MA 1YITP 3DS3A 4CA3A 1QVGO 2VLQA 1A8OA 1E0HA 1AUMA 3G1IA 2JBGA 1T8KA 3GJNA 2K0YA 1Q86Q 4QKOA 4R0MA 3DS4A 1IUQA 2NO8A 5KP8B 3CC2P 2XT1A 1HY8A 1VQKP 2CG5B 2N5HA 1Z6MA 2JU1A 2EHTA 2MR7A 2KG6A 3CCQP 3CC7P 5F2NA 4PH1A 1VKUA 3G0VA 1IMPA 4U0FA 2K92A 1EMVA 2GDWA 2FQ2A 2LKIA 1ZNVA 1Q81Q 1UJZA 2JAZA 4F37A 2MR8A 1KQSO 3CMAP 5DCKA 1Q82Q 1S72P 1M74A 1W2BO 2LIUA 4XRQA 3H4EA 1VQOP 2N6YA 3U43A 1BXIA 2QNWA 2MVVA 3DS1A 5HVCA 2FAEA 5F2KA 4HKGA 4M0IA 3GKLC 2JB0A 2JU2A 2K93A 3CCVP 1CEIA 5EW5E 2GZEA 1A43A 2K2QA 5KP7B 2GZGA 3DTJA 5HGLA 1L0IA 1E6JP 3CE7A 2BHVA 1K8AQ 2N98A 2L22A 4COCA 4UHPB 1EOQA 1AF8A 1K9MQ 4PXHB 2GYKA 2L4BA 2MD9A 3H47A 1VQPP 2KG8A 3G1GA 2OARA 3B5IA 1Q7YQ 4XFXA 2KGCA 1VQ6P 2LTEA 3VRLC 2FHSC 2K5XA 1VHNA 1JJ2O 1GXGA 2N50A 1N8RQ 3H0DA 3E2DA 3EJEA 3Q20A 2Z45A 3CCUP 3WBHA 5EJDA 1VQ7P 3CCMP 5F2OA 3CD6P 2CGQA 3MGEA 2WPTA 2EIAA 5BS2A 4IZ6A 4H2WC 2X2BA 1VQ4P 2CQ8A 2FVAA 2PEQA 4BPFA 2P9XA 2GDXA 4BPGA 2OTJP 5KP6B 2Z44A 2CNRA 2KGDA 3RG6C 2ROQA 5HGMA 3CPWO 2PEIA 2K0DX 2FQ1A 2LL8A 1HQBA 2OTLP 2JQ4A 1DNYA 3CCJP 2CWOA 5HGNA 2QA4P 2L6EA 1IMQA 5HV8A 2VLNA 1GPJA 3NTEA 2XZ0D 2KOOA 4COPA 2KOSA 3CC4P 2E1MA 1NJIQ 2M8LA 2N6ZA 3HZQA 3DS0A 4MRTC 1M6NA 2GZJA 2LOLA 1L0HA 3I55P 1EIAA 4XFZA 2PEMA 4QNBA 3CXCO 2FQ0A 2DGYA 2K0XA 4IPYA 2M8PA 2KORA 2N5IA 3G26A 2DNWA 1VQ9P 2JYLA 2FVEA 2KGEA 1YI2P 2FACA 4H2XC 2KOPA 3B4QA 1K30A 2VLPA 2LIWA 2MY5A 3LRYA 3EJBA 2AFDA 2VSQA 2MVUA 3DS2A 1BAJA 1VQ8P 4U0AA 2GZFA 4PH0A 2Z46A 1KC8Q 2ONTA 4NEOA 2K94A 1M6EX 3CCEP 2LMLA 2KG9A 2PEKA 2ERHA 4BPHA 1KD1Q 2M8NA 3G4SP 2XZ1C 2PNGA 3RG2A 3OW2O 4U0DA 1QVFO 2LF4A 2PEJA 1DV5A 2L0QA 2LPKA 1UNKA 1VQNP 1YHQP 1K73Q 2JYGA 1MZ8A 1YIJP 2KODA 1RNIA 5CZDB 3CCRP 3EJDA 2AFEA
chains in the Genus database with same CATH topology
3DS4A 1IUQA 1YJNP 3CC4P 1E6JP 2E1MA 3DS5A 3G71P 3CC2P 4GR2A 2XT1A 2XXMA 5JPAA 1NJIQ 3P05A 2BHVA 1VQKP 1K8AQ 2M8LA 4GR6A 4COCA 3HZQA 4U0CA 3DS0A 3CC7P 1EOQA 3CCQP 1K9MQ 5F2NA 1M6NA 4PH1A 5I4TG 2PENA 4WYMA 3H47A 5HGOA 1VQPP 3G0VA 3G1GA 4U0FA 2OARA 3B5IA 1Q7YQ 1QRJA 4XFXA 3I55P 1YJWP 1VQ6P 1EIAA 4XFZA 1Q81Q 3G28A 2PEMA 3VRLC 4QNBA 2XV6A 4U0EA 3CXCO 1JJ2O 1VQMP 1KQSO 1N8RQ 3CMAP 2DGYA 2EG5A 3E2DA 5DCKA 3Q20A 2EFJA 2Z45A 3H0DA 3CCUP 4IPYA 1Q82Q 1M90Q 2M8PA 1S72P 1M74A 1VQ5P 1W2BO 3WBHA 1VQ7P 3G26A 3HYBA 3CCMP 5F2OA 1VQ9P 2JYLA 3CD6P 3MGEA 4XRQA 3H4EA 4XROA 4XFYA 3I56P 1YI2P 2EIAA 2PEOA 5BS2A 5BS1A 1VQOP 1D1DA 2PY8A 4U0BA 3G6EP 1K30A 1VQ4P 3G29A 3CCLP 1YJ9P 3LRYA 3DS1A 2PEQA 2P9XA 3DS2A 3CCSP 2OTJP 2Z44A 1BAJA 1VQ8P 4U0AA 5F2KA 1M1KQ 1RO0A 3RG6C 4M0IA 4PH0A 1VQLP 5HGMA 1ZMBA 2Z46A 3CPWO 1RO2A 2ONTA 2PEIA 3G21A 1M6EX 3CCEP 2QEXP 3CMEP 2JO0A 3DPHA 2PEKA 1KD1Q 2BUOA 3M1MA 1YITP 2OTLP 2M8NA 3CCJP 3G4SP 3DS3A 3CCVP 4U0DA 2CWOA 3OW2O 1QVFO 2LF4A 2PEJA 5HGNA 1QVGO 2QA4P 1A43A 1A8OA 1VQNP 1YHQP 2L6EA 1AUMA 1K73Q 3G1IA 2JYGA 1YIJP 2KODA 3NTEA 1RNIA 3DTJA 5HGLA 3CCRP 1Q86Q 1KC8Q 4COPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYB A;  2PEO A;  2PEM A;  2PEN A;  5BS2 A;  2PEQ A;  2PEI A;  2Z45 A;  2PEK A;  3Q20 A;  4GR6 A;  3RG6 C;  5BS1 A;  2PY8 A;  4GR2 A;  2PEJ A;  2Z44 A;  2Z46 A; 
#chains in the Genus database with same CATH topology
 3DS5 A;  3G71 P;  2M5R A;  4GR2 A;  5JPA A;  2XXM A;  3P05 A;  3NY7 B;  4GR6 A;  4U0C A;  1AYI A;  2KR5 A;  2L9F A;  1KLP A;  5I4T G;  2PEN A;  4WYM A;  2FVF A;  2AVA A;  5HGO A;  7CEI A;  1QRJ A;  3GZL A;  1FR2 A;  2EHS A;  1YJW P;  2GZI A;  2KWL A;  2MF4 A;  3G28 A;  1GXH A;  2XV6 A;  4U0E A;  1VQM P;  2KOQ A;  1YJN P;  2EG5 A;  2EFJ A;  3LMO A;  1M90 Q;  1ACP A;  4PWV B;  1VQ5 P;  3HYB A;  1X3O A;  1NQ4 A;  2JGP A;  2AF8 A;  4XRO A;  4XFY A;  2VLO A;  3I56 P;  2FAD A;  2PEO A;  5BS1 A;  1D1D A;  2PY8 A;  4U0B A;  1F80 D;  3G6E P;  1OR5 A;  2GDY A;  3G29 A;  3CCL P;  4H2Y C;  1YJ9 P;  3CCS P;  2KW2 A;  1M1K Q;  4DG9 A;  3GZM A;  1RO0 A;  1VQL P;  1ZMB A;  1RO2 A;  3G21 A;  2KGA A;  2QEX P;  3CME P;  2JO0 A;  3DPH A;  2BUO A;  3M1M A;  1YIT P;  3DS3 A;  4CA3 A;  1QVG O;  2VLQ A;  1A8O A;  1E0H A;  1AUM A;  3G1I A;  2JBG A;  1T8K A;  3GJN A;  2K0Y A;  1Q86 Q;  4QKO A;  4R0M A;  3DS4 A;  1IUQ A;  2NO8 A;  5KP8 B;  3CC2 P;  2XT1 A;  1HY8 A;  1VQK P;  2CG5 B;  2N5H A;  1Z6M A;  2JU1 A;  2EHT A;  2MR7 A;  2KG6 A;  3CCQ P;  3CC7 P;  5F2N A;  4PH1 A;  1VKU A;  3G0V A;  1IMP A;  4U0F A;  2K92 A;  1EMV A;  2GDW A;  2FQ2 A;  2LKI A;  1ZNV A;  1Q81 Q;  1UJZ A;  2JAZ A;  4F37 A;  2MR8 A;  1KQS O;  3CMA P;  5DCK A;  1Q82 Q;  1S72 P;  1M74 A;  1W2B O;  2LIU A;  4XRQ A;  3H4E A;  1VQO P;  2N6Y A;  3U43 A;  1BXI A;  2QNW A;  2MVV A;  3DS1 A;  5HVC A;  2FAE A;  5F2K A;  4HKG A;  4M0I A;  3GKL C;  2JB0 A;  2JU2 A;  2K93 A;  3CCV P;  1CEI A;  5EW5 E;  2GZE A;  1A43 A;  2K2Q A;  5KP7 B;  2GZG A;  3DTJ A;  5HGL A;  1L0I A;  1E6J P;  3CE7 A;  2BHV A;  1K8A Q;  2N98 A;  2L22 A;  4COC A;  4UHP B;  1EOQ A;  1AF8 A;  1K9M Q;  4PXH B;  2GYK A;  2L4B A;  2MD9 A;  3H47 A;  1VQP P;  2KG8 A;  3G1G A;  2OAR A;  3B5I A;  1Q7Y Q;  4XFX A;  2KGC A;  1VQ6 P;  2LTE A;  3VRL C;  2FHS C;  2K5X A;  1VHN A;  1JJ2 O;  1GXG A;  2N50 A;  1N8R Q;  3H0D A;  3E2D A;  3EJE A;  3Q20 A;  2Z45 A;  3CCU P;  3WBH A;  5EJD A;  1VQ7 P;  3CCM P;  5F2O A;  3CD6 P;  2CGQ A;  3MGE A;  2WPT A;  2EIA A;  5BS2 A;  4IZ6 A;  4H2W C;  2X2B A;  1VQ4 P;  2CQ8 A;  2FVA A;  2PEQ A;  4BPF A;  2P9X A;  2GDX A;  4BPG A;  2OTJ P;  5KP6 B;  2Z44 A;  2CNR A;  2KGD A;  3RG6 C;  2ROQ A;  5HGM A;  3CPW O;  2PEI A;  2K0D X;  2FQ1 A;  2LL8 A;  1HQB A;  2OTL P;  2JQ4 A;  1DNY A;  3CCJ P;  2CWO A;  5HGN A;  2QA4 P;  2L6E A;  1IMQ A;  5HV8 A;  2VLN A;  1GPJ A;  3NTE A;  2XZ0 D;  2KOO A;  4COP A;  2KOS A;  3CC4 P;  2E1M A;  1NJI Q;  2M8L A;  2N6Z A;  3HZQ A;  3DS0 A;  4MRT C;  1M6N A;  2GZJ A;  2LOL A;  1L0H A;  3I55 P;  1EIA A;  4XFZ A;  2PEM A;  4QNB A;  3CXC O;  2FQ0 A;  2DGY A;  2K0X A;  4IPY A;  2M8P A;  2KOR A;  2N5I A;  3G26 A;  2DNW A;  1VQ9 P;  2JYL A;  2FVE A;  2KGE A;  1YI2 P;  2FAC A;  4H2X C;  2KOP A;  3B4Q A;  1K30 A;  2VLP A;  2LIW A;  2MY5 A;  3LRY A;  3EJB A;  2AFD A;  2VSQ A;  2MVU A;  3DS2 A;  1BAJ A;  1VQ8 P;  4U0A A;  2GZF A;  4PH0 A;  2Z46 A;  1KC8 Q;  2ONT A;  4NEO A;  2K94 A;  1M6E X;  3CCE P;  2LML A;  2KG9 A;  2PEK A;  2ERH A;  4BPH A;  1KD1 Q;  2M8N A;  3G4S P;  2XZ1 C;  2PNG A;  3RG2 A;  3OW2 O;  4U0D A;  1QVF O;  2LF4 A;  2PEJ A;  1DV5 A;  2L0Q A;  2LPK A;  1UNK A;  1VQN P;  1YHQ P;  1K73 Q;  2JYG A;  1MZ8 A;  1YIJ P;  2KOD A;  1RNI A;  5CZD B;  3CCR P;  3EJD A;  2AFE A; 
#chains in the Genus database with same CATH homology
 3DS4 A;  1IUQ A;  1YJN P;  3CC4 P;  1E6J P;  2E1M A;  3DS5 A;  3G71 P;  3CC2 P;  4GR2 A;  2XT1 A;  2XXM A;  5JPA A;  1NJI Q;  3P05 A;  2BHV A;  1VQK P;  1K8A Q;  2M8L A;  4GR6 A;  4COC A;  3HZQ A;  4U0C A;  3DS0 A;  3CC7 P;  1EOQ A;  3CCQ P;  1K9M Q;  5F2N A;  1M6N A;  4PH1 A;  5I4T G;  2PEN A;  4WYM A;  3H47 A;  5HGO A;  1VQP P;  3G0V A;  3G1G A;  4U0F A;  2OAR A;  3B5I A;  1Q7Y Q;  1QRJ A;  4XFX A;  3I55 P;  1YJW P;  1VQ6 P;  1EIA A;  4XFZ A;  1Q81 Q;  3G28 A;  2PEM A;  3VRL C;  4QNB A;  2XV6 A;  4U0E A;  3CXC O;  1JJ2 O;  1VQM P;  1KQS O;  1N8R Q;  3CMA P;  2DGY A;  2EG5 A;  3E2D A;  5DCK A;  3Q20 A;  2EFJ A;  2Z45 A;  3H0D A;  3CCU P;  4IPY A;  1Q82 Q;  1M90 Q;  2M8P A;  1S72 P;  1M74 A;  1VQ5 P;  1W2B O;  3WBH A;  1VQ7 P;  3G26 A;  3HYB A;  3CCM P;  5F2O A;  1VQ9 P;  2JYL A;  3CD6 P;  3MGE A;  4XRQ A;  3H4E A;  4XRO A;  4XFY A;  3I56 P;  1YI2 P;  2EIA A;  2PEO A;  5BS2 A;  5BS1 A;  1VQO P;  1D1D A;  2PY8 A;  4U0B A;  3G6E P;  1K30 A;  1VQ4 P;  3G29 A;  3CCL P;  1YJ9 P;  3LRY A;  3DS1 A;  2PEQ A;  2P9X A;  3DS2 A;  3CCS P;  2OTJ P;  2Z44 A;  1BAJ A;  1VQ8 P;  4U0A A;  5F2K A;  1M1K Q;  1RO0 A;  3RG6 C;  4M0I A;  4PH0 A;  1VQL P;  5HGM A;  1ZMB A;  2Z46 A;  3CPW O;  1RO2 A;  2ONT A;  2PEI A;  3G21 A;  1M6E X;  3CCE P;  2QEX P;  3CME P;  2JO0 A;  3DPH A;  2PEK A;  1KD1 Q;  2BUO A;  3M1M A;  1YIT P;  2OTL P;  2M8N A;  3CCJ P;  3G4S P;  3DS3 A;  3CCV P;  4U0D A;  2CWO A;  3OW2 O;  1QVF O;  2LF4 A;  2PEJ A;  5HGN A;  1QVG O;  2QA4 P;  1A43 A;  1A8O A;  1VQN P;  1YHQ P;  2L6E A;  1AUM A;  1K73 Q;  3G1I A;  2JYG A;  1YIJ P;  2KOD A;  3NTE A;  1RNI A;  3DTJ A;  5HGL A;  3CCR P;  1Q86 Q;  1KC8 Q;  4COP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...