5BS1A

Crystal structure of rbcx-iia from chlamydomonas reinhardtii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
118
Chain Sequence
MHIPADSFSGASPERKAAVALRSLFTFVAARVVLEQLQGTTYNQQAYLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRETREANTRLMRAAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CrRbcX-IIa
publication title Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Chaperone
total genus 37
structure length 118
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5bs1A00
5BS1A 2PENA 2PEIA 2Z44A 4GR2A 2PEOA 2PY8A 3HYBA 2Z46A 2PEQA 2PEMA 4GR6A 2PEKA 2Z45A 3RG6C 3Q20A 2PEJA 5BS2A
chains in the Genus database with same CATH superfamily
2K94A 2PENA 2JAZA 1VQLP 3CCJP 2KGAA 4XFZA 2QNWA 1Z6MA 1VQPP 1YI2P 2MY5A 4U0AA 4XFYA 2MD9A 1Q7YQ 3HZQA 2CQ8A 4QKOA 2N6YA 3GZLA 2PEJA 1VQ6P 4U0DA 5HGLA 3DS3A 1UJZA 2NO8A 5CZDB 3CD6P 4WYMA 1VQKP 2KR5A 1YJ9P 4R0MA 2FQ2A 1YITP 2GDYA 1K9MQ 2N5HA 3CCSP 3DS4A 3G28A 4PH0A 2LPKA 3DTJA 1M74A 1YIJP 2LF4A 2ROQA 3G4SP 3EJEA 3CCQP 2KOSA 1YJWP 1M90Q 4H2WC 1AYIA 3CMAP 3CC7P 7CEIA 3CE7A 2GZGA 1VQNP 4XRQA 5HVCA 4XROA 3CCRP 3CCUP 2AFDA 2FVFA 2PEMA 3G6EP 2BUOA 2K92A 2M5RA 2FQ1A 5HGMA 3G1GA 2JO0A 1NJIQ 2XXMA 2VSQA 2LL8A 2L4BA 2LKIA 3Q20A 2M8PA 2KGEA 1X3OA 4U0EA 2K5XA 1JJ2O 1AF8A 1ZNVA 1KD1Q 2KG6A 1QVGO 1QRJA 2AF8A 3G71P 2GZFA 1VQMP 3GJNA 2FHSC 1CEIA 2JU1A 3DS2A 5HGNA 1E6JP 3DS5A 1K30A 1VQ7P 1EIAA 2N50A 1VHNA 2JBGA 1ZMBA 2N98A 3G21A 5BS2A 2GYKA 2OTJP 2L9FA 3E2DA 4IZ6A 1K8AQ 2LIWA 1VQOP 3LMOA 3OW2O 4BPHA 2CNRA 3H0DA 2M8NA 2GZJA 2PEQA 2K2QA 3CC2P 2WPTA 3VRLC 5F2OA 1OR5A 1KC8Q 2ERHA 2KODA 2KWLA 3U43A 2QEXP 1EMVA 2L6EA 4HKGA 1RO0A 3G26A 1YHQP 2VLQA 2KOQA 5I4TG 2PEIA 3WBHA 2ONTA 2OTLP 4COPA 3GKLC 2JYGA 1HQBA 1F80D 1QVFO 2X2BA 3B4QA 3CCEP 2OARA 1YJNP 2K0YA 3CC4P 3EJBA 3CPWO 2Z44A 3G29A 2P9XA 4COCA 5HGOA 1VQ4P 1L0HA 3P05A 2K93A 4BPGA 3CMEP 2MR7A 2XT1A 1S72P 4PXHB 1W2BO 2JQ4A 2K0XA 2FQ0A 2E1MA 4F37A 4XFXA 4U0BA 2EIAA 4M0IA 2GDWA 2N5IA 4BPFA 2LIUA 2KGDA 1DV5A 4MRTC 3EJDA 2JGPA 1T8KA 4U0FA 2CWOA 4GR2A 1IUQA 2Z45A 3DS0A 1AUMA 1HY8A 2GZEA 4PH1A 2L22A 1A43A 2PY8A 2MVVA 3CXCO 1N8RQ 3RG6C 2AVAA 1VKUA 4GR6A 2EG5A 2XZ0D 2JU2A 3RG2A 2XZ1C 2FACA 2VLNA 4DG9A 2KG8A 3CCLP 2JYLA 1K73Q 5JPAA 3CCVP 2QA4P 4U0CA 1M6NA 1M6EX 3MGEA 3DS1A 4PWVB 3B5IA 1FR2A 1RO2A 2FAEA 2EFJA 5BS1A 5DCKA 2K0DX 2M8LA 1KLPA 2MF4A 1MZ8A 5KP7B 2CGQA 2PEOA 4H2YC 3G1IA 2KGCA 2MR8A 2BHVA 3H47A 1EOQA 3LRYA 1E0HA 1A8OA 2KOPA 2GZIA 3HYBA 5EJDA 2KORA 4CA3A 2DGYA 2FVEA 3NTEA 2KOOA 4QNBA 2JB0A 2PNGA 3H4EA 2KG9A 1BAJA 1VQ5P 3GZMA 2VLPA 5F2NA 1ACPA 5EW5E 3M1MA 4UHPB 5HV8A 1KQSO 1IMQA 2VLOA 2CG5B 2LMLA 1GXGA 2N6ZA 1RNIA 5F2KA 2PEKA 3CCMP 2GDXA 3NY7B 2XV6A 1VQ9P 3I55P 2KW2A 3I56P 2EHTA 2AFEA 2LTEA 2MVUA 1DNYA 1L0IA 3DPHA 1M1KQ 2FVAA 5KP8B 5KP6B 1Q81Q 4NEOA 1UNKA 2DNWA 1NQ4A 1BXIA 3G0VA 1GXHA 1IMPA 1D1DA 2L0QA 4H2XC 1Q82Q 1Q86Q 2Z46A 1VQ8P 4IPYA 2FADA 1GPJA 2EHSA 2LOLA
chains in the Genus database with same CATH topology
1YJNP 3CC4P 2PENA 3CPWO 2Z44A 3G29A 2PEOA 2P9XA 1VQLP 1KD1Q 3CCJP 3G1IA 4COCA 1QVGO 5HGOA 4XFZA 1VQ4P 1QRJA 3P05A 3G71P 1VQPP 1YI2P 4U0AA 4XFYA 1VQMP 1Q7YQ 3CMEP 2BHVA 3HZQA 3H47A 5HGNA 3DS2A 2XT1A 1EOQA 3LRYA 1S72P 2PEJA 1VQ6P 1E6JP 3DS5A 1W2BO 1K30A 1VQ7P 4U0DA 1EIAA 1A8OA 3HYBA 5HGLA 3DS3A 3CD6P 1ZMBA 4WYMA 2DGYA 3G21A 1VQKP 2E1MA 3NTEA 1YJ9P 4XFXA 4QNBA 4U0BA 1YITP 5BS2A 3H4EA 2EIAA 2OTJP 4M0IA 3E2DA 1BAJA 1K8AQ 1VQ5P 1K9MQ 3CCSP 3DS4A 3G28A 5F2NA 4PH0A 3DTJA 1M74A 1VQOP 1YIJP 3M1MA 2LF4A 4U0FA 3G4SP 2CWOA 1KQSO 3OW2O 4GR2A 1RNIA 1IUQA 5F2KA 2PEKA 2Z45A 1AUMA 3DS0A 3CCMP 3CCQP 3H0DA 2XV6A 4PH1A 1YJWP 1A43A 1VQ9P 3I55P 1M90Q 3I56P 2M8NA 2PY8A 3CXCO 3CMAP 2PEQA 1N8RQ 3CC7P 3RG6C 3CC2P 3VRLC 1VQNP 5F2OA 4GR6A 4XRQA 2EG5A 1KC8Q 2KODA 3DPHA 4XROA 3CCRP 3CCUP 1M1KQ 2QEXP 2L6EA 2PEMA 3G6EP 1RO0A 2BUOA 1Q81Q 3CCLP 2JYLA 3G26A 1K73Q 1YHQP 5I4TG 5JPAA 3CCVP 5HGMA 3G0VA 3G1GA 2JO0A 2PEIA 3WBHA 2QA4P 1NJIQ 2XXMA 2ONTA 4U0CA 2OTLP 1M6NA 1D1DA 1M6EX 3MGEA 3DS1A 3B5IA 3Q20A 4COPA 1Q82Q 1Q86Q 1RO2A 2JYGA 2Z46A 2M8PA 2EFJA 1QVFO 5BS1A 1VQ8P 5DCKA 4IPYA 2M8LA 3CCEP 2OARA 4U0EA 1JJ2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS1 A;  2PEN A;  2PEI A;  2Z44 A;  4GR2 A;  2PEO A;  2PY8 A;  3HYB A;  2Z46 A;  2PEQ A;  2PEM A;  4GR6 A;  2PEK A;  2Z45 A;  3RG6 C;  3Q20 A;  2PEJ A;  5BS2 A; 
#chains in the Genus database with same CATH topology
 2K94 A;  2PEN A;  2JAZ A;  1VQL P;  3CCJ P;  2KGA A;  4XFZ A;  2QNW A;  1Z6M A;  1VQP P;  1YI2 P;  2MY5 A;  4U0A A;  4XFY A;  2MD9 A;  1Q7Y Q;  3HZQ A;  2CQ8 A;  4QKO A;  2N6Y A;  3GZL A;  2PEJ A;  1VQ6 P;  4U0D A;  5HGL A;  3DS3 A;  1UJZ A;  2NO8 A;  5CZD B;  3CD6 P;  4WYM A;  1VQK P;  2KR5 A;  1YJ9 P;  4R0M A;  2FQ2 A;  1YIT P;  2GDY A;  1K9M Q;  2N5H A;  3CCS P;  3DS4 A;  3G28 A;  4PH0 A;  2LPK A;  3DTJ A;  1M74 A;  1YIJ P;  2LF4 A;  2ROQ A;  3G4S P;  3EJE A;  3CCQ P;  2KOS A;  1YJW P;  1M90 Q;  4H2W C;  1AYI A;  3CMA P;  3CC7 P;  7CEI A;  3CE7 A;  2GZG A;  1VQN P;  4XRQ A;  5HVC A;  4XRO A;  3CCR P;  3CCU P;  2AFD A;  2FVF A;  2PEM A;  3G6E P;  2BUO A;  2K92 A;  2M5R A;  2FQ1 A;  5HGM A;  3G1G A;  2JO0 A;  1NJI Q;  2XXM A;  2VSQ A;  2LL8 A;  2L4B A;  2LKI A;  3Q20 A;  2M8P A;  2KGE A;  1X3O A;  4U0E A;  2K5X A;  1JJ2 O;  1AF8 A;  1ZNV A;  1KD1 Q;  2KG6 A;  1QVG O;  1QRJ A;  2AF8 A;  3G71 P;  2GZF A;  1VQM P;  3GJN A;  2FHS C;  1CEI A;  2JU1 A;  3DS2 A;  5HGN A;  1E6J P;  3DS5 A;  1K30 A;  1VQ7 P;  1EIA A;  2N50 A;  1VHN A;  2JBG A;  1ZMB A;  2N98 A;  3G21 A;  5BS2 A;  2GYK A;  2OTJ P;  2L9F A;  3E2D A;  4IZ6 A;  1K8A Q;  2LIW A;  1VQO P;  3LMO A;  3OW2 O;  4BPH A;  2CNR A;  3H0D A;  2M8N A;  2GZJ A;  2PEQ A;  2K2Q A;  3CC2 P;  2WPT A;  3VRL C;  5F2O A;  1OR5 A;  1KC8 Q;  2ERH A;  2KOD A;  2KWL A;  3U43 A;  2QEX P;  1EMV A;  2L6E A;  4HKG A;  1RO0 A;  3G26 A;  1YHQ P;  2VLQ A;  2KOQ A;  5I4T G;  2PEI A;  3WBH A;  2ONT A;  2OTL P;  4COP A;  3GKL C;  2JYG A;  1HQB A;  1F80 D;  1QVF O;  2X2B A;  3B4Q A;  3CCE P;  2OAR A;  1YJN P;  2K0Y A;  3CC4 P;  3EJB A;  3CPW O;  2Z44 A;  3G29 A;  2P9X A;  4COC A;  5HGO A;  1VQ4 P;  1L0H A;  3P05 A;  2K93 A;  4BPG A;  3CME P;  2MR7 A;  2XT1 A;  1S72 P;  4PXH B;  1W2B O;  2JQ4 A;  2K0X A;  2FQ0 A;  2E1M A;  4F37 A;  4XFX A;  4U0B A;  2EIA A;  4M0I A;  2GDW A;  2N5I A;  4BPF A;  2LIU A;  2KGD A;  1DV5 A;  4MRT C;  3EJD A;  2JGP A;  1T8K A;  4U0F A;  2CWO A;  4GR2 A;  1IUQ A;  2Z45 A;  3DS0 A;  1AUM A;  1HY8 A;  2GZE A;  4PH1 A;  2L22 A;  1A43 A;  2PY8 A;  2MVV A;  3CXC O;  1N8R Q;  3RG6 C;  2AVA A;  1VKU A;  4GR6 A;  2EG5 A;  2XZ0 D;  2JU2 A;  3RG2 A;  2XZ1 C;  2FAC A;  2VLN A;  4DG9 A;  2KG8 A;  3CCL P;  2JYL A;  1K73 Q;  5JPA A;  3CCV P;  2QA4 P;  4U0C A;  1M6N A;  1M6E X;  3MGE A;  3DS1 A;  4PWV B;  3B5I A;  1FR2 A;  1RO2 A;  2FAE A;  2EFJ A;  5BS1 A;  5DCK A;  2K0D X;  2M8L A;  1KLP A;  2MF4 A;  1MZ8 A;  5KP7 B;  2CGQ A;  2PEO A;  4H2Y C;  3G1I A;  2KGC A;  2MR8 A;  2BHV A;  3H47 A;  1EOQ A;  3LRY A;  1E0H A;  1A8O A;  2KOP A;  2GZI A;  3HYB A;  5EJD A;  2KOR A;  4CA3 A;  2DGY A;  2FVE A;  3NTE A;  2KOO A;  4QNB A;  2JB0 A;  2PNG A;  3H4E A;  2KG9 A;  1BAJ A;  1VQ5 P;  3GZM A;  2VLP A;  5F2N A;  1ACP A;  5EW5 E;  3M1M A;  4UHP B;  5HV8 A;  1KQS O;  1IMQ A;  2VLO A;  2CG5 B;  2LML A;  1GXG A;  2N6Z A;  1RNI A;  5F2K A;  2PEK A;  3CCM P;  2GDX A;  3NY7 B;  2XV6 A;  1VQ9 P;  3I55 P;  2KW2 A;  3I56 P;  2EHT A;  2AFE A;  2LTE A;  2MVU A;  1DNY A;  1L0I A;  3DPH A;  1M1K Q;  2FVA A;  5KP8 B;  5KP6 B;  1Q81 Q;  4NEO A;  1UNK A;  2DNW A;  1NQ4 A;  1BXI A;  3G0V A;  1GXH A;  1IMP A;  1D1D A;  2L0Q A;  4H2X C;  1Q82 Q;  1Q86 Q;  2Z46 A;  1VQ8 P;  4IPY A;  2FAD A;  1GPJ A;  2EHS A;  2LOL A; 
#chains in the Genus database with same CATH homology
 1YJN P;  3CC4 P;  2PEN A;  3CPW O;  2Z44 A;  3G29 A;  2PEO A;  2P9X A;  1VQL P;  1KD1 Q;  3CCJ P;  3G1I A;  4COC A;  1QVG O;  5HGO A;  4XFZ A;  1VQ4 P;  1QRJ A;  3P05 A;  3G71 P;  1VQP P;  1YI2 P;  4U0A A;  4XFY A;  1VQM P;  1Q7Y Q;  3CME P;  2BHV A;  3HZQ A;  3H47 A;  5HGN A;  3DS2 A;  2XT1 A;  1EOQ A;  3LRY A;  1S72 P;  2PEJ A;  1VQ6 P;  1E6J P;  3DS5 A;  1W2B O;  1K30 A;  1VQ7 P;  4U0D A;  1EIA A;  1A8O A;  3HYB A;  5HGL A;  3DS3 A;  3CD6 P;  1ZMB A;  4WYM A;  2DGY A;  3G21 A;  1VQK P;  2E1M A;  3NTE A;  1YJ9 P;  4XFX A;  4QNB A;  4U0B A;  1YIT P;  5BS2 A;  3H4E A;  2EIA A;  2OTJ P;  4M0I A;  3E2D A;  1BAJ A;  1K8A Q;  1VQ5 P;  1K9M Q;  3CCS P;  3DS4 A;  3G28 A;  5F2N A;  4PH0 A;  3DTJ A;  1M74 A;  1VQO P;  1YIJ P;  3M1M A;  2LF4 A;  4U0F A;  3G4S P;  2CWO A;  1KQS O;  3OW2 O;  4GR2 A;  1RNI A;  1IUQ A;  5F2K A;  2PEK A;  2Z45 A;  1AUM A;  3DS0 A;  3CCM P;  3CCQ P;  3H0D A;  2XV6 A;  4PH1 A;  1YJW P;  1A43 A;  1VQ9 P;  3I55 P;  1M90 Q;  3I56 P;  2M8N A;  2PY8 A;  3CXC O;  3CMA P;  2PEQ A;  1N8R Q;  3CC7 P;  3RG6 C;  3CC2 P;  3VRL C;  1VQN P;  5F2O A;  4GR6 A;  4XRQ A;  2EG5 A;  1KC8 Q;  2KOD A;  3DPH A;  4XRO A;  3CCR P;  3CCU P;  1M1K Q;  2QEX P;  2L6E A;  2PEM A;  3G6E P;  1RO0 A;  2BUO A;  1Q81 Q;  3CCL P;  2JYL A;  3G26 A;  1K73 Q;  1YHQ P;  5I4T G;  5JPA A;  3CCV P;  5HGM A;  3G0V A;  3G1G A;  2JO0 A;  2PEI A;  3WBH A;  2QA4 P;  1NJI Q;  2XXM A;  2ONT A;  4U0C A;  2OTL P;  1M6N A;  1D1D A;  1M6E X;  3MGE A;  3DS1 A;  3B5I A;  3Q20 A;  4COP A;  1Q82 Q;  1Q86 Q;  1RO2 A;  2JYG A;  2Z46 A;  2M8P A;  2EFJ A;  1QVF O;  5BS1 A;  1VQ8 P;  5DCK A;  4IPY A;  2M8L A;  3CCE P;  2OAR A;  4U0E A;  1JJ2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...