5BS6A

Apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
NYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription
molecule keywords transcriptional regulator AraR
total genus 53
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5bs6A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5bs6A01
2F5EA 5DUIA 5E17F 1Z91A 3GRNA 2AXLA 1XN7A 3F6VA 2H6CA 2VN2A 1D8JA 1TW2A 3H92A 4PDKA 3QU3A 5TJJA 1B1BA 1HSJA 1TQMA 3I5UA 3ZP5A 1ULYA 1V4RA 4C9WA 3F6AA 1LVAA 4KDPA 2I8TA 2OA4A 3K1MA 4RGUA 1MD0A 4HFQA 3EESA 4HAMA 4GXOA 3MCZA 2IPQX 2R3SA 2Q8KA 3BJ6A 1ZAOA 3E57A 3Q93A 3KP4A 4KIFA 3JAMK 4L0YB 3MZHA 5ICGA 5FD5A 3ID9A 3E3VA 2MLGA 1LDJA 2FMLA 1W5SA 1B6AA 1J0RA 3U9GA 2W25A 1FYLA 2EA4A 2H94A 4EM1A 1FC3A 2PLYA 3DKWA 1O3RA 1ZYRF 1XDUA 2HWVA 2KIFA 1GHCA 1NHAA 2UXNA 3J80Z 2KIMA 1RYAA 4A6EA 3G3ZA 5JVTA 1LJ9A 4ZYDA 2P5KA 1HXDA 3MDIA 1YW7A 4OMZA 4QLCU 3LSTA 2MH9A 2A8TA 3PQJA 2RC4A 2A3SA 3E5QA 1D5VA 2IA0A 4IXAA 4OIPF 1BM9A 4R8HA 2HDCA 2BEOA 2HQRA 1XCVA 3HHHA 1UCRA 1XD7A 3HHJA 3ZMVA 2HFHA 1QBJA 1B4AA 2JPCA 1P4XA 4CO8A 4LK1F 1ZGAA 2V79A 5HS8A 3ULQB 2CGPA 1BI3A 4KN4X 2F2EA 1FY7A 1VIUA 4I0BA 4EJWA 4I09A 2CQKA 1VHGA 1HW2A 1USSA 4Q48A 1RUOA 1JHFA 2KJBA 1MDMB 2EWNA 1KYWA 5L3CA 2W84A 1PP7U 2YPRA 2XGXA 1RZ4A 3DF8A 2MH2A 2EA2A 5HLIA 2E1CA 3I7VA 2UZKA 3ZMTA 5H6RA 4M74A 2MBFA 1LEBA 4HDVA 4HLYA 1EH8A 4OIQF 2DSDA 3EDPA 4H0EA 2K4BA 3RYPA 1O3QA 3K2ZA 4BH9A 2GAUA 2YU3A 3BJOA 2ADUA 1PPWA 1HQCA 2ICKA 2YX7A 3KCCA 1KQ8A 2FRHA 2CG4A 3LQRA 1YS7A 1K78B 1J5YA 3V8KA 4PGGA 1IRGA 1XGSA 3X0QA 4HLXA 3WTZA 4K6EA 5CLSA 2TDXA 3JW4A 2P8TA 1DPUA 4YOQA 2P4WA 3JSOA 1PPXA 3X0IA 4L0ZB 4DYWA 2GZWA 2PBIA 3HSEA 2PJPA 3REOA 3GZ6A 4WXCA 1R5HA 1Z9CA 1SOIA 2XVCA 3OV8A 3GFMA 4IJAA 1SZ3A 3FFUA 1FNNA 4IRGA 2YVNA 2NNNA 2MA3A 1LQ1A 2W85A 5K5OA 4KG4A 3HHGA 2PFBA 1U20A 4HF2A 3FSPA 2STTA 4EV0A 2RKHA 4HX7A 3SQNA 1UB9A 3ECHA 1ZG1A 1V8TA 3V4GA 3GYHX 2L02A 5BOXA 4B8XA 4UVAA 2EB7A 4Y15A 1U3EM 5CVRA 1ZARA 3KEOA 1MKMA 3OOPA 1K78A 2IP2A 5I8UA 1SMYF 3GO5A 1W7PA 1ZGJA 3T8TA 2WWYA 3SHFA 1X51A 5HLGA 2FNPA 2HKOA 3O61A 3N77A 2EJRA 2XV4S 1BC8C 1BN5A 3P9KA 5GHJA 3D0SA 2E7WA 4G6QA 3I64A 4XLNF 3GXOA 1V8NA 4ZYEA 1VC9A 2KRFA 3EUHA 5FFZA 2PEXA 1I9AA 2DK8A 5LRSA 2JVBA 2ZKZA 1XSAA 1XSVA 2ICJA 2Q0OA 3IC7A 1P92A 3MAJA 2EFQA 2BYVE 3EEUA 1V8SA 4UNOA 3IWZA 5FGMA 3FMQA 3GEZA 5EEHA 3I59B 3FWEA 4V14A 1HZTA 4HVYA 5TRDA 3I54A 3WG9A 5FSIA 3PFIA 3K1PA 3LWFA 3I9XA 3DEUA 2EV5A 4UUVA 1S7AA 4G7OF 4U0YA 3F23A 2EV6A 2NAZA 1UHMA 4A0ZA 5K5QA 2DT5A 5JFRA 2YR2A 1BOAA 3RKYA 1YIOA 1G3YA 5FLXK 2QENA 3Q91A 4OIOF 2DTRA 2L3DA 3DFGA 2A5YB 1KYZA 5LHIA 1EH6A 1R5GA 2LKPA 3TOAA 3F13A 2XHKA 1QO0D 5HS9A 3GWYA 3CNGA 4AIJA 1SFUA 2AZWA 6PAXA 1FWZA 5F6FA 1QZYA 1XGMA 3ZN0A 2A8RA 1P4WA 3MZYA 3C18A 1KQ9A 4UXNA 1V8VA 1QGPA 4I7HA 4EJTA 3BM4A 5L3EA 1J2XA 1O57A 1V8IA 3FXQA 2W24A 1BC7C 3ISPA 2PG4A 1UHWA 2Q2EA 3Q4IA 2O8XA 3RKWA 4WCGA 4U88A 2GA1A 2GIVA 2Z5UA 1OPCA 3RYRA 2XKOA 2FOKA 4M6XA 5K5RA 1USTA 2J5PA 4IF4A 5HDNA 2FKBA 4A0XA 3J7AO 2P7VB 4P55A 5ILSA 3QOPA 1R7JA 4QWQA 3HTSB 1YG2A 4ESBA 1DP7P 4MEXF 4HV5A 2K02A 2ZBKA 3TOBA 3EYIA 3KP7A 3FMSA 1VK6A 2LSOA 2A07F 2OU2A 4RB3C 4Q47A 1J75A 3JTGA 2ZNZA 2DHOA 1I1SA 1FBSA 4D0PA 2VT3A 4A5NA 1G0SA 2KDVA 3M9AA 3R60A 1TNSA 2IT0A 4U0WA 4R79A 3G73A 2HS5A 2ZNYA 5FFXA 1PDNC 3QSJA 3I0TA 2Y75A 3O2PE 3TDUC 3RPUA 4HQMA 4UVBA 3BZ6A 2L4AA 3WU1B 2LF8A 2ZMEA 4IPAA 1ZLKA 2G7UA 4OU0A 1Z05A 3X0LA 5HS7A 2H09A 4OMYA 3MQ0A 3IKTA 5LGTA 2O5FA 1PPVA 4P96A 5BPIA 4I0AA 1V8MA 3KLNA 1J9IA 3LQQA 2P7CB 2YVMA 2VC0A 4ZH4F 4CXFA 1VC8A 5AIPA 1FYKA 3EETA 4HZFA 1V8UA 3GX4X 1IXRC 2R7DA 5D4RA 3EQLF 4ETSA 1FP1D 3H3ZA 3IWFA 5D5WB 5DCMA 2FNAA 1L0OC 3FXUA 2QQ9A 4JZSA 2VBXA 3L9FA 4O6JA 5BMZA 4EJOA 4PZJA 2O5WA 1YO5C 1LEAA 4L9VA 3HRUA 4P5OA 3HSRA 1FLIA 1O3SA 1P4AA 4EJVA 5DCFA 4NFWA 5BONA 1IAWA 2Z3YA 5CVUA 3EF5A 4AIHA 4JZTA 1DUXC 2IW5A 5CVIA 3F3XA 1STZA 1W4MA 1NQYA 1YW8A 2P6SA 3MEXA 1KU3A 1KGSA 2VE8A 4M9ZA 1R00A 1RRSA 3RKXA 1FX7A 2FBKA 3ZMDA 3LAPA 3B73A 4EM2A 3O3KA 1UFMA 1ZN2A 3FF5A 2OQGA 3I71A 4LB5A 1FSHA 3K69A 1F1ZA 1VRLA 3RTRA 3X0OA 4IVNA 1ON2A 4HQEA 3T1BA 4XSZF 3TQNA 4RS8A 2F5CA 1OKRA 1G9QA 2MLKA 4UVCA 1H9GA 4P9FA 1DDNA 1XSDA 3GLXA 4GO1A 2HTJA 1SU2A 3E6CC 2X0LA 3Q2SA 4IRIA 3CUOA 4JK1X 1BI0A 2G74A 1B9MA 1PUQA 1VHZA 2CO5A 3ERED 2KKOA 4BNCA 3X0NA 4GYIA 3QAHA 3JSPA 1T2KA 4RB1A 4KYWA 2HGCA 1K6OA 4JBAA 2LF7A 3F8BA 2IRFG 3HYQA 2HEOA 3DXJF 1I6XA 3U53A 1F4KA 1T0FA 4ESJA 4I01A 2J5OA 3BP8A 4RB2C 1YS6A 1CF7B 5CYVA 4HYEA 2ESHA 1XB4A 5HOOA 2ZMEB 3SXYA 1J59A 1IN6A 4JZVA 5D4SA 1FBUA 4ILQA 3SZPA 1NQZA 2E7XA 3NEUA 3F22A 2L54A 3R0JA 5C8LA 3WTTC 2A8SA 1HW5A 3Q1PA 1SD4A 2GQQA 2MD5A 3F8NA 2A61A 1SFXA 3VFZA 2QWWA 5BPDA 1G6NA 4M9SA 1GVJA 2CW0F 2VONA 2RQPA 3KETA 1IRYA 1MQWA 4CICA 3RPQA 1X83A 1BJAA 3L00A 4NHJA 1PVFA 1G4DA 2YSRA 4ON0A 1YTYA 4LFUA 1TLHB 4ZZDA 3S2WA 3M7GA 2QLZA 5FO5A 1XSXA 3GG6A 3O69A 1HW1A 1XSBA 5E18F 5DEQA 1IF1A 1ZREA 3D5LA 4N9HA 1K7AA 1IN7A 3DQVC 1JGSA 1K2EA 4M73A 4ASNA 4EGZA 3FHZA 2C6YA 3CDHA 1ZRCA 4KA4A 3HRMA 4JQFA 1S8NA 3FMRA 4IHTA 2GXGA 1MK1A 4WWCA 2RNJA 3ECOA 2IA2A 2DI3A 4UV8A 4KNYA 1TQPA 5L3DA 3I53A 4RAYA 3KE2A 5HDGA 3WGGA 5LHHA 2Q9PA 3VOEA 2FVVA 4OOIA 2DUKA 1JKNA 3SONA 2KJCA 2EK5A 3ZMUA 3R03A 1KT9A 2VE9A 4Z2YA 5J8FA 2HZTA 4BAYA 3O8SA 5D5XB 4U7BA 1CGPA 5FSOA 1BIAA 3LA7A 1C0WA 1ZG5A 4N1TA 3ZR1A 3ZN1A 3KZYA 1CF7A 1VCDA 3AC9A 4I02A 3BHOA 5AONA 1ONVA 2A69F 1ZH5A 3GVAA 2ESNA 3AAFA 5HLHA 2JTVA 2A6HF 3FM5A 4B09A 1KQ0A 1E17A 3J81K 1MJAA 2DPUA 3QRFF 3ABUA 2ZO4A 2KIUA 2X4HA 2DAOA 1FZPB 3FCMA 1FYMA 1Q1HA 4CDGA 4N9IA 3ZQ7A 2GT2A 4LJZF 3WODF 5ANWA 3FX3A 5CFIA 4L18B 2M5WA 2QZ8A 3DUPA 4HW0A 4G7HF 2BV6A 4YIFA 1X3UA 4LMYA 4HA8A 4LGWA 1WSUA 1QNTA 4BYYA 4IHSA 2XAHA 2QBYA 4KG3A 4RGRA 2CFXA 3CUQC 2A6EF 5L3GA 3JAMZ 2FBHA 2BGCA 3ML6A 3H3UA 1TW3A 3O52A 2B0LA 3BAPA 3CTAA 4G9YA 5A2QK 3TKYA 1ZRFA 5H20A 1MR2A 2D2WA 4YPRA 3WTSC 3MCFA 3LA2A 4L5IA 2HR3A 1Z7UA 2ISZA 1LDKB 3HOTA 3DPTA 4LG0B 3R61A 2PI0A 2M1BA 2Y0MA 2PN6A 2RRKA 2DFIA 2V6CA 1KU7A 4M71A 2XUBA 3R4KA 1KA8A 2YYHA 5CVVA 5FB2A 2GXBA 4YG2F 4U7DA 3IRQA 5LPGA 4KYXA 1QQIA 2NYXA 1S3JA 1OYYA 2Z33A 5E8GA 4EJUA 2VBZA 3M8EA 3GFIA 3FM3A 4I2OA 1ODDA 2ISYA 2PMHA 3N9UA 4ZYHA 1U5TC 3WTWC 3X0SA 1V8WA 3E97A 3ROUA 2R7FA 2YVPA 3HYIA 1HKTA 5HDKA 2YVOA 1AOYA 5D5VB 4MQVA 1R67A 3QPHA 2PNYA 4XRFA 4K2EA 3F21A 2RV8A 3WTUC 4Q4ZF 3WTXC 4FX4A 2HTSA 5JHUA 2H27A 3LA3A 3P5TA 2PQVA 2DSBA 2M45A 1WI9A 3L85A 2VODA 1WQ2A 2M8EA 4DNCA 3SFZA 3W6KB 3C7JA 3GZ8A 4U0VA 3V8LA 3W6JB 2F5DA 2XKPA 4YPHA 3HRTA 1R1TA 2O0YA 4S04A 2GT4A 1KU2A 2EFOA 4WXDA 5E1XA 5JI6A 3P9CA 2XRNA 3Q9SA 1NFZA 2PMUA 2K86A 1E2XA 3WTVC 2YX4A 4XSXF 4O5VA 2CSOA 3HOSA 5ANSA 2MC3A 2CYYA 1IW7F 2KDWA 4MQ9F 1GXPA 1LB2A 1F5TA 5DYMA 1BI2A 2XROA 1FOKA 2GB5A 3U1DA 1SFEA 4FT8A 1I1GA 2P5LC 1ZG3A 1MUTA 2JRTA 5A2QZ 3C1DA 1TUMA 3TGNA 3COUA 1V8YA 4BHCA 5FSNA 2DW4A 5ED4A 2CL3A 4PGHA 4PCQA 1SMTA 5ILVA 4C9XA 2DO7A 1OR7A 3ZMSA 2P6TA 3HIFA 4ENMA 4NFXA 3EYYA 3CLOA 3TO9A 1XGOA 4MEYF 4GCVA 1BIBA 2Y48A 2F5FA 5DCMB 2HQNA 4A2UA 1RUNA 1WRJA 3ACAA 4KIGA 5DUKA 3DV8A 2QKMB 2VT2A 5E1ZB 3CUQB 3HRSA 1MJ9A 4LD5A 4HDUA 1GXQA 1W5TA 3X0MA 4ENNA 1FSEA 4P9UA 3E6BA 3A6UA 4A12A 1V8RA 3FJYA 5CVJA 2FXAA 2FEZA 1MZBA 2W57A 2HKXA 1R36A 1YYVA 2O1CA 4ZYGA 3V7CA 1ZLJA 5D5UB 2DLLA 2OBPA 2L01A 1IUYA 2G7HA 1QZZA 4A0YA 1S6LA 5C7QA 3B02A 5IT3A 3IRRA 2ACJA 2J8QA 4IRHA 5H6QA 3M1EA 3VODA 3GZ5A 2V1XA 4HX8A 5EEGA 4Q5SF 1W7PB 5CJ9A 3ZR0A 3V8JA 2EFWA 1H0MA 1LDDA 3R6SA 2VBWA 4MHGA 5FSMA 1YW9A 3I7UA 4L9JA 1B59A 4M6YA 1DPRA 5L3FA 1R1UA 5AIQA 1RI7A 2QBYB 3MWMA 1U5TA 3F6OA 3BJAA 3BROA 2GWRA 3BOQA 4MTEA 1KU9A 1R22A 3T8RA 1SD6A 4HF1A 3BPVA 2I6KA 1PUNA 5GHQA 3FZVA 3CO6C 2NS0A 1XCBA 1G3SA 2B06A 3A6TA 3NQOA 3Q5FA 5FD6A 4N1UA 3ZMZA 2OQRA 1Z1DA 2IJLA 4S2VA 1OW2A 1O7FA 4GGGA 1K26A 3V7SA 4ENJA 3GWZA 2VOPA 2PQ8A 3J81Z 1IN5A 1TTYA 4MGRA 1IXCA 4LLGF 1J7KA 2EV0A 1XMAA 3QP6A 3IKVA 4FX0A 3T0YA 2Z9OA 1OYWA 1AWCA 5L3BA 4S05A 1EV7A 3L2CA 4M72A 3L7WA 1BI1A 5D8KB 1ZHFA 3P9IA 2BBYA 5JR3A 4M9XA 1K79A 5HZXA 4EGYA 2DPDA 4G94A 5LEKA 3C3WA 1SD7A 4WK8F 3GW2A 5ERIA 4Y13A 4MTDA 2EFNA 1Q27A 3KP5A 2ZXJA 2A6TA 3G0QA 2FA5A 4OINF 1T98A 1SAXA 1JRKA 3Q2TA 4KIBA 5ANVA 1A04A 1G3WA 4L9NA 4O3MA 1P2FA 3ELKA 4HOBA 1YFHA 4IJXA 2HOEA 2FMYA 1U6GA 5LBQA 2RN7A 3BPXA 3J80K 1FT9A 1IXSB 3K9TA 1WKMA 3HTUA 5C7TA 1IRFA 3F8MA 2NRAC 1MQEA 3BDDA 4AWXB 4LLLA 4HX4A 4S2YA 2FF4A 5E1WA 1R1VA 1OMIA 2E1NA 1FPQA 4FHTA 4NQWA 3J7Ye 1XSCA 5LGNA 1S29A 5ISYA 2BE5F 5DV5A 3DP7A 4YIIA 4AD9A 2DK5A 1HKSA 3H95A 1W7PD 1KHZA 4ZZLA 2P5VA 2WV0A 4KICA 4KTBA 3COAC 4L9TA 4BXUA 3O6BB 5E20A 2XAJA 3CJNA 3HSFA 3V7RA 1ZRDA 3NRVA 3WTYC 2CWEA 2O3FA 3R0AA 2XAFA 3SMDA 2B2KA 4GYGA 1YQAA 1T38A 3JTHA 2WTEA 4MPOA 3WE3A 3DKUA 3E5UA 4E70A 2XIGA 2NNYA 3K0LA 2JPBA 1V3FA 4LG0A 4G8XA 2OAZA 3GFJA 4RGSA 5ICEA 1X84A 1I5ZA 3PQKA 4TV7A 3K1NA 4ENKA 1R23A 5D6FA 1U8RA 1P6RA 3WGHA 5HVQC 1U2WA 4RGXA 3VB2A 4ZG0A 2Z99A 3FXRA 2AS5F 2O61A 3O6ZA 3A6VA 1HKQA 2COMA 2JSCA 4HF0A 4BHPA 3WE2A 5CFJA 2FQ3A 5J8CA 2V1DA 3RIRA 3RDIA 5GHNA 4G6DA 3WHWA 2DU9A 3P7NA 5DDGA 1L3LA 4XLPF 4MNUA 5IW4A 2EFPA 3KVHA 4EQQA 2HYGD 4WF2A 2W4EA 4Y17A 1Q54A 2O03A 3KLOA 4DQ2A 1BBYA 3RH7A 5LRRA 4RAZA 5GHMA 1F3YA 4YFNF 1REPC 1EH7A 4JZUA 2V9VA 1Z6RA 4CHUA 2DQLA 1V8LA 2DSCA 2RGVA 1PUEE 1HSTA 4NB5A 3E6MA 3KP2A 2VC1A 3MDGA 3N4MA 4HBLA 4A5MA 1Z6TA 2XSQA 1GA7A 2RVCA 2QJTA 3LAJA 5F1RA 2GA2A 1NFSA 3VEPA 1JE8A 4I98B 5D6EA 3RI4A 3BWGA 5DD8A 1IZ1A 4EVIA 2I8UA 2OD5A 4LB6B 1Q33A 4S2XA 5F64A 3ABTA 4XBFA 4YFKF 4F7ZA 2K7LA 4LK0F 1HX3A 3I58A 1OYIA 1XMKA 3GFLA 3CUQA 5KK1A 3A6SA 2XASA 3X0JA 1IN4A 2LDUA 3GF2A 3SZTA 1HBXG 3E5XA 4ICKA 3QP5A 1T39A 2QQAA 1WWXA 1XGNA 2VBYA 1S7OA 4WX9A 1U5TB 5D8LB 3I4PA 2HYFA 4CYDA 2B0VA 5ANTA 3TO7A 3KZZA 2M30A 1QPMA 5ANUA 3X0KA 1RNLA 5IT9K 2LNBA 1I27A 4ESFA 3MFKA 2G73A 2DQRA 3E6DA 2UWMA 5K1YA 1ON1A 5BQTA 1Y0UA 3RJPA 2FU4A 1MP2A 1XDSA 2QJOA 3WU0A 5ILUA 2RDPA 2K4JA 5LHGA 3X0PA 4AIKA 4WXHA 5LEJA 4KT5C 2O6GE 5FSLA 2L4MA 3QPTA 2FE3A 1YLFA 5DD4A 3F72A 4UHTA 5ICFA 3IL2A 3BY6A 1MJBA 2UXXA 2ZCWA 2JZYA 4EM0B 4R1HA 1TBXA 1U78A 5LLQA 2K27A 4OIRF 1SD5A 2M87A 2D1VA 2FBIA 1R58A 2ZFWA 3Q9VA 3KP6A 5FLXZ 5ICCA 1LNWA 5GHIA 4A6DA 5J6XA 2XAQA 2A8PA 1QVJA 3M8FA 3CO7C 3F8CA 4UV9A 5IT9Z 4CGZA 4YFXF 2D1HA 3WGIA 2ETHA 4KMFA 2ZJ2A 1KTGA 4KMUX 2WC2A 5E8IA 3KEQA 3QU6A 2G9WA 5IW5A 3T5XA 3I59A 1MGTA 2V1UA 1TNTA 2QVOA 1D3YA 2OZ6A 1D8KA 1O7LA 4KFCA 4L5JA 3GUDA 2VOOA 1O3TA 1JHHA 2QYOA 2IVMA 1RRQA 2VXZA 2STWA 1TQIA 2OZUA 1SJYA 1PUSA 2ELHA 5GHOA 1RIOH 3F8FA 3HUGA 3DPLC 3EXQA 3U2RA 4HV6A 2FSWA 4CZZA 4AVPA 3IHUA 2IA1A 1T6SA 2QM3A 2XAGA 4BHBA 5GHPA 3ZPLA 4KUMA 2DBBA 3TDZC 4LLNA 1FBQA 3LFKA 1PP8F 4BQAA 1F9NA 3P6YA 3MGMA 4RB0A 5FSKA 3SHDA 5DPKA 3TO6A 2D45A 1B9NA 4N0BA 1FP2A 1VIQA 3OGAA 2VNPA 3N97A 4KN7X 1H9TA 2QUFA 1IN8A 3KP3A 3X0RA 1G3TA 1MDMA 4EMSA 3L09A 2A8QA 5BS6A 2A68F 5LGUA 1JXSA 3FK9A 4G7ZF 2H6BA 5KVRA 2R5WA 2QQBA 2VNQA 4S2WA 1VTNC 2JT1A 3KFWX
chains in the Genus database with same CATH superfamily
2F48A 1E3PA 2F5EA 3A0BC 5DUIA 1GVDA 5E17F 3S2HJ 1Z91A 2VL8A 3BC8A 3H0DA 3GRNA 2AXLA 1XN7A 3F6VA 1WHUA 2H6CA 2VN2A 1D8JA 1TW2A 5GPAA 3H92A 2UUZA 4PDKA 3QU3A 2DMTA 2R7QA 5TJJA 1B1BA 1HSJA 1TQMA 2KQRA 3I5UA 4M3DA 4QPOA 2XSJC 3C2HA 3ZP5A 1ULYA 1V4RA 4C9WA 2CQ7A 3F6AA 1LVAA 4KDPA 2I8TA 2X1EA 3DBHB 2X6WA 2OA4A 4ZJZA 3K1MA 2KRCA 4RGUA 1MD0A 1DU0A 4HFQA 3EESA 4HAMA 4GXOA 2JWTA 2JJ7A 2JSPA 3MCZA 3DLLF 1W1WE 2IPQX 2R3SA 2Q8KA 4KITB 3BJ6A 1ZAOA 3S32A 3E57A 3Q93A 3KP4A 4KIFA 1XC5A 3JAMK 2D5VA 4L0YB 3MZHA 3HOVJ 4A3LJ 4II2A 3VSLA 3FXKA 1QHGA 3QQAA 4XLHA 5ICGA 3A02A 2JN6A 2HDWA 1YRNA 5FD5A 2EZLA 2VQLA 3ID9A 3E3VA 2MLGA 1LDJA 1VQLI 4E7SA 1W5CC 1MBHA 2FMLA 4M6VA 3ZQIA 5GAGJ 1VQ7I 3KZIC 1W5SA 3S3OA 1B6AA 1J0RA 2M8GX 3U9GA 1FOWA 2W25A 3GBGA 1FYLA 2EA4A 2H94A 4EM1A 1FC3A 2PLYA 3DKWA 1O3RA 1ZYRF 1Y0NA 5EZHA 1XDUA 1DGRM 2HWVA 2KIFA 3DWLE 2QSFX 3RSNA 1GHCA 1NHAA 4JX6A 4KISA 2UXNA 1R49A 3J80Z 2KIMA 2QF7A 1RYAA 4DZJA 3CJTB 3GTLJ 4FTHA 4A6EA 5FROA 3G3ZA 5JVTA 1LJ9A 4ZYDA 2P5KA 2MABA 1HXDA 4BJTA 1ERDA 3MDIA 1YJWI 3CCRI 1YW7A 4OMZA 1VI0A 4QLCU 3TL4X 3LSTA 2HXOA 2HYJA 2M7BA 2MH9A 2A8TA 4ZTFA 3PQJA 2RC4A 1MIJA 2A3SA 3E5QA 1D5VA 2IA0A 1RESA 3HKZA 3D5SC 4IXAA 5C3EJ 4OIPF 2IGMA 1BM9A 4R8HA 2HDCA 2BEOA 4HSTA 2HQRA 1XCVA 3CLQA 3HHHA 1OISA 2EIJH 1UCRA 1XD7A 3HHJA 3ZMVA 3CCYA 4Y3OA 2HFHA 5M5XJ 5EG0B 1QBJA 1B4AA 1E0EA 2JPCA 1JGGA 1P4XA 2LG4A 4W1UA 4CO8A 2UV1A 4LK1F 1EKEA 1ZGAA 3AL0B 1FIPA 2V79A 4CCOA 5HS8A 1JKOC 3ULQB 2CGPA 1BI3A 4KN4X 2FX0A 2FJ1A 2F2EA 4XKVA 1WJFA 1QHHD 5FKNA 4JX4A 2G0EA 5CPRB 2CMPA 1FY7A 2K9MA 1VIUA 1TZLA 4F93B 4I0BA 4EJWA 4I09A 1LE8A 2CQKA 1VHGA 2DMNA 1HW2A 1USSA 1E3HA 4Q48A 2HI3A 4NDLA 1RUOA 1JHFA 2KJBA 4BU2A 1MDMB 5HLTA 2EWNA 1KYWA 3H5AA 2M7AA 5L3CA 3I55I 3L2UA 2W84A 4ABZA 1PP7U 3ZQHA 2YPRA 3MN2A 2XGXA 1RZ4A 3DF8A 5J4VA 2MH2A 2EA2A 5HLIA 2E1CA 2P81A 3I7VA 2UZKA 3ZMTA 5H6RA 4HSRA 4M74A 2HVSA 1VQ6I 2V1NA 4BQQA 3OYDA 2MBFA 2EILH 1LEBA 4HDVA 4HLYA 2VKHA 2OTJI 3M8JA 1EH8A 1HDDC 1N75A 4OIQF 3DEWA 3MD2A 3EDPA 2DSDA 4H0EA 3H9GA 3HPHA 2LRDA 2K4BA 3RYPA 1O3QA 3K2ZA 4BH9A 1AKHA 3BLYA 3ABLH 2GAUA 2YU3A 2I10A 1IDYA 5F27A 3BJOA 4HPQA 4BXXJ 3K4NA 2ADUA 1PPWA 1HQCA 3BCBA 2ICKA 2YX7A 3KCCA 3IV5A 1KQ8A 2FRHA 2CG4A 3LQRA 1YS7A 1K78B 1J5YA 3V8KA 4PGGA 1IRGA 1XGSA 4XRMA 3X0QA 4HLXA 3WTZA 4K6EA 1YX3A 3K6GA 2IEKA 4V19K 3ERMA 2JA2A 5CLSA 2TDXA 2NVYJ 1A31A 2HOAA 1D1AA 3JW4A 1X19A 4AIDA 1XMXA 2P8TA 1DPUA 4YOQA 5FJ8J 4PJNA 2P4WA 4C2TA 3JSOA 1PPXA 2F6CA 3X0IA 2NXNB 4L0ZB 4DYWA 2GZWA 1VF9A 2PBIA 3HSEA 2PJPA 3HGYA 3REOA 1WVRA 3GZ6A 4WXCA 3OYFA 2GOXB 2EINH 1R5HA 1Z9CA 1RKTA 4XN0A 1SOIA 2XVCA 3OV8A 1U0JA 3GTPJ 3GFMA 3HG9A 5EG0A 4IJAA 1SZ3A 3FFUA 4C3HJ 1FNNA 4E6KG 4NNJA 4IRGA 1MMDA 3K2AA 3DU5A 4XKCA 4PSWA 2GBYA 2YVNA 2NNNA 2MA3A 1LQ1A 5J3LA 2BZTA 2W85A 5K5OA 2QGUA 4KG4A 5J40A 3HHGA 2PFBA 4NUBA 1SVMA 1IJWC 3FK7A 1YOVB 4F91B 1U20A 3OYKA 4HF2A 3FSPA 2DA4A 5CQEA 2STTA 4EV0A 2RKHA 1MSEC 1X1AA 4HX7A 1XG1A 2M4KA 4XKWA 3SQNA 4YIRX 3QYEA 1UB9A 3MVPA 1DU6A 3ECHA 4QSHA 1ZG1A 2CV1A 1V8TA 3V4GA 3GYHX 1JUPA 2AHQA 2L02A 5BOXA 3DTKA 2QSGX 2L9VA 3K4BA 5FKKA 2E5NA 4UVAA 4B8XA 2KDZA 2EB7A 4Y15A 1U3EM 5CVRA 1ZARA 5F0FA 3KEOA 1MKMA 1N25A 3G6EI 3OOPA 4LOCA 1K78A 2IP2A 5I8UA 1SMYF 3GO5A 1ZGWA 1W7PA 1ZGJA 3T8TA 1RPWA 2LTPA 2WWYA 3SHFA 1X51A 5HLGA 2DT7B 2FNPA 2HKOA 1NK2P 3JRAA 3N77A 3O61A 3CP8A 2EJRA 2XAUA 5DM7F 3BZCA 1TT0A 2XV4S 1BC8C 1BN5A 4XLAA 3GTQJ 1X1PA 3P9KA 5GHJA 1BL0A 3MKLA 2KP6A 2Z16A 3K4KA 3D0SA 4GFBA 2E7WA 4G6QA 3I64A 4XLNF 3GXOA 4BBRJ 1V8NA 4ZYEA 4BBSJ 1VC9A 2KRFA 3EUHA 4H4KC 2CUZA 5FFZA 3WHBA 1X3ZB 2PEXA 2HQAA 1I9AA 2BXYA 2DMUA 3F0CA 2DK8A 2R7ZJ 5LRSA 3Q0WA 3HPGA 2ZKZA 1SAUA 1XSAA 1XSVA 2JVBA 2ICJA 2KHMA 2Q0OA 3IC7A 1P92A 3ZQFA 3MAJA 2EFQA 3K70C 4ZDPA 2BYVE 1IO2A 3S93A 1QVUA 2Z2SB 2BY2A 4BDZA 1XX5A 3EEUA 4RAFA 1HA8A 4UNOA 1V8SA 2E1OA 3IWZA 3IP4B 5FGMA 3HZJA 3FMQA 3GEZA 5EEHA 1SC7A 3I59B 3FWEA 2L7FP 4IHYA 4V14A 1LPQA 1HZTA 3W3CA 1BR4A 1Y39A 2QEXI 4HVYA 5TRDA 3I54A 5F04A 3WG9A 5FSIA 2PMZA 3PFIA 3PO2J 3K1PA 3IH2A 4II3A 3LWFA 1IV6A 2LREA 5B1BH 3I9XA 2LD5A 3BTLA 3DEUA 5JLXA 2R7XA 2EV5A 4UUVA 1S7AA 4G7OF 2DA7A 2LBFA 4U0YA 3F23A 2EV6A 2NAZA 1UHMA 3VWBA 4A0ZA 1TWHJ 5K5QA 2NVQJ 2DT5A 1OR7C 5HNFA 2Y9YA 2F4OB 3IAS2 2VJ4A 1Y1WJ 5JFRA 2YR2A 5E3NA 1BOAA 3LSKA 2L9SA 3RKYA 1YIOA 1PUFB 1G3YA 2FQ4A 2NVTJ 5FLXK 1YX5A 3DTEA 4P1WA 2QENA 3Q91A 4X6AJ 4OIOF 2DTRA 2ME6A 2L3DA 3OSFA 3DFGA 2A5YB 1KYZA 5LHIA 2K85A 1B72B 2WV1A 4BDYA 1EH6A 1R5GA 2LKPA 3TOAA 2X6OA 3QOEA 3F13A 3OS2A 2XHKA 1QO0D 1WFXA 5HS9A 1JT0A 3GWYA 3CNGA 3A01B 2IS1A 4AIJA 1SFUA 2AZWA 4B43A 6PAXA 1FWZA 5IP9J 5F6FA 1QZYA 1XGMA 4XIDA 3ZN0A 2A8RA 1P4WA 3MZYA 3BG7A 5M3FJ 3C18A 1KQ9A 3IH3A 4UXNA 1V8VA 1QGPA 5HNHA 4I7HA 3CCEI 4EJTA 3BM4A 5L3EA 1J2XA 1O57A 1YRNB 1V8IA 1ETQA 3FXQA 2DFHA 1RC9A 2W24A 1BC7C 3FKIJ 3ISPA 2PG4A 1UHWA 2Y31A 3BG6A 2Q2EA 3Q4IA 2O8XA 5B1AH 3RKWA 4WCGA 1TP4A 2B63J 4U88A 2GA1A 1RR7A 2GIVA 2Z5UA 3JRFA 3I4NJ 1OPCA 3RYRA 4AVZA 4XQFA 1T33A 3IAM2 3MMYB 4CUGA 2XKOA 1G8XA 2R7OA 2FOKA 4M6XA 1B8IA 2LMDA 4NQWB 5K5RA 4A3EJ 2CW7A 1USTA 2J5PA 4CYCB 4IF4A 2WADA 1UG2A 5HDNA 2FKBA 4D1QA 1ZR4A 4A0XA 1JTXA 3J7AO 1KONA 2P7VB 4P55A 5ILSA 2X6XA 3DTIA 3QOPA 3HEFA 2XF5A 3L2QA 1V5GA 1R7JA 4QWQA 5IOZA 3HTSB 2X85A 1K61A 1YG2A 2GXAA 4ESBA 5B3SH 4PFPA 3S16J 1DP7P 3GMEA 4M3EA 4BQNA 4MEXF 1I6HJ 4NC7A 4HV5A 2ID6A 2K02A 4LIVA 2L9NA 2ZBKA 3TOBA 3EYIA 3BG9A 3KP7A 2L7ZA 1R9TJ 4V2FA 3PJRA 3FMSA 1D5YA 1VK6A 2JA7J 2LSOA 2A07F 4DYCA 2OU2A 1X4OA 4RB3C 4Q47A 1VQ4I 1J75A 3JTGA 1D1BA 2ZXWH 2ZNZA 3BTCA 3ASOH 2DHOA 1WJ5A 3K70D 4J01A 3CJRB 1FBSA 1LFUP 1I1SA 4XOTA 4D0PA 1I39A 2VT3A 1K6YA 4A5NA 1G0SA 2KDVA 3M9AA 3R60A 1TNSA 3KEYA 1K4TA 2IT0A 3UNGC 2V9KA 4U0WA 4R79A 2HVRA 3G73A 2HS5A 1S72I 2ZNYA 5FFXA 1PDNC 1ETOA 3HL2A 3QSJA 4F3QA 2DDBA 1JUSA 1R4NB 1A36A 1ZK8A 3RZOJ 3I0TA 2Y75A 2L0KA 3O8HA 3O2PE 2XGDA 4J19A 3TDUC 3RPUA 3TW6A 2QA4I 4HQMA 4UVBA 1MMSA 2HDDA 5J1UA 3EUKL 2JVGA 2LH9A 3BZ6A 4A3IJ 2L4AA 2ZC2A 4V2GA 3BTIA 3WU1B 3A01A 2LF8A 3IUOA 4JOMA 2XGEA 2ZMEA 1W0UA 3HBLA 2MC4A 2DODA 5B5EC 5IYDJ 4IPAA 3QWLA 1ZLKA 2G7UA 4CCNA 2VJ5A 4OU0A 1Z05A 2K9QA 3DEEA 5HS7A 2H09A 5FKOA 3X0LA 4OMYA 3MQ0A 1FOXA 2VQHA 3IKTA 5FRMA 3TP0A 5LGTA 3L1PA 2JA6J 3VYTB 2O5FA 4PUSA 1PPVA 4P96A 2E35A 2ELKA 4I0AA 1JT6A 5BPIA 3KLNA 1J9IA 1V8MA 1U8BA 3LQQA 2P7CB 4L5EA 5M5WJ 2YVMA 2VC0A 3A03A 4BKXA 4ZH4F 4CXFA 1VC8A 2OCEA 5AIPA 4AU7A 1FYKA 1MBGA 1A6QA 3AG2H 3SDGA 3CD6I 2HNHA 2MYSA 1YE9A 2E1MC 3EETA 4HZFA 3IH4A 1V8UA 2HPIA 1OLTA 4BY1J 1Y8RB 3GX4X 1IXRC 2R7DA 4JP0A 1DQUA 5D4RA 3DLAA 3OIOA 3EQLF 3CF5F 4ETSA 1BOBA 4EATA 3OR2C 1FP1D 3H3ZA 3IWFA 4N4OB 5D5WB 2CZRA 1JUMA 3CZ6A 4HEA2 2DYSH 5DCMA 2FNAA 1L0OC 3FKJA 2QQ9A 3FXUA 3S1MJ 1W0TA 4JZSA 4HRIA 4LITA 2VBXA 3L9FA 4O6JA 4IO9F 5BMZA 4EJOA 2DFEA 1JKRC 4PZJA 2O5WA 1YO5C 1LEAA 4L9VA 5CQGA 3HRUA 2O7OA 2CV2A 2RREA 3AKZA 4IHVA 4P5OA 4IQJA 3HSRA 2Y0SA 1FLIA 4ZDOA 5IYBJ 1H8AC 1O3SA 1P4AA 4EJVA 1S5LC 4KJZA 5DCFA 1OJLA 3WHCA 5JVGF 1ZELA 3OR1C 2OCCH 4NFWA 5BONA 1IAWA 2Z3YA 1NK3P 2CV0A 3TMOA 5CVUA 3EF5A 2LR8A 4AIHA 3CCSI 4E7IA 2QSHX 4MLOA 4JZTA 2E60A 3QPSA 4C2MJ 4I6ZA 1FEXA 1DUXC 2IW5A 5CVIA 3F3XA 2EZIA 1STZA 1D0YA 1W4MA 1NQYA 4XR6A 4BQOA 1YW8A 2IGOA 2R7UA 1S7EA 1YIJI 2P6SA 3TW7A 3MEXA 1F36A 1KU3A 1X3WB 1KGSA 3CF2A 1H89C 2VE8A 4M9ZA 3GTGJ 2W1OA 5BNGA 5GTIC 1R00A 1RRSA 4D7NA 3D1NI 2L7KA 3RKXA 2CQNA 3OIQA 1FX7A 2FBKA 3K4CA 3ZMDA 3DPUA 3LAPA 2HQ5A 3B73A 4EM2A 3H36A 3W2WA 3BG5A 3O3KA 1UFMA 1ZN2A 3FF5A 4I76A 2OQGA 3G1LA 3I71A 4LB5A 1FSHA 3K69A 1F1ZA 3BT9A 1VRLA 1ETKA 3RTRA 3X0OA 4BE1A 3HDDA 4IVNA 2CW8A 4JYKA 2LKSA 2W7NA 1ON2A 2EH3A 4HQEA 3T1BA 4XSZF 3TQNA 4RS8A 3EUAA 2F5CA 4BGDA 1OKRA 1G9QA 2DTZA 4PJMA 2QKLB 2MLKA 3KPHA 3Q3SA 3K4JA 1MBJA 4IHXA 3BR2A 3PIPF 4UVCA 1H9GA 3L2RA 2VQCA 4P9FA 1MSFC 2CS3A 4XRSA 1DDNA 2WA0A 1XSDA 3GLXA 4GO1A 1YHQI 2HTJA 4Y7NJ 3BQZA 3S15J 1SU2A 1Y56A 3E6CC 2X0LA 3Q2SA 4IRIA 3CUOA 1F43A 4JK1X 1BI0A 2G74A 2L7MP 4A3FJ 1B9MA 2DOEA 1PUQA 1VHZA 2CO5A 2Y2ZA 2XPWA 4QPQA 3ERED 2KKOA 4BNCA 3X0NA 4GYIA 3QAHA 3JSPA 1VQ5I 1T2KA 4RB1A 4KYWA 2HGCA 1K6OA 3QPLA 2W82A 4JBAA 2LF7A 2E19A 3F8BA 2IRFG 3HYQA 2HEOA 2WAQN 3DXJF 1V54H 1I6XA 4FCYA 4A3CJ 3U53A 1F4KA 1RETA 1T0FA 4RLFA 4ESJA 5K7ZA 2EQRA 3PM1A 4I01A 3G4SI 5M5YJ 2J5OA 3BP8A 3H0GJ 4RB2C 1YS6A 3OYCA 1ZTRA 4F52A 1CF7B 5CYVA 4HYEA 1MNEA 2ESHA 2Z1DA 4UY8I 1XB4A 5HOOA 2ZMEB 3SXYA 1J59A 1IN6A 2ECCA 1FTTA 4JZVA 4DZPA 5D4SA 2ZJPF 1FBUA 5K7FA 4ILQA 3SZPA 1NQZA 2E7XA 3NEUA 3F22A 2L54A 3CESA 3R0JA 5C8LA 1FOYA 3WTTC 2A8SA 1HW5A 3Q1PA 1SD4A 2GQQA 2MD5A 3BR5A 3F8NA 3EPZA 1XTAA 2R7RA 4YELA 2A61A 2NS8A 3RQIA 2TRTA 1SFXA 3VFZA 2QWWA 3CC2I 2XSDC 5BPDA 1G6NA 2DCEA 4M9SA 1GVJA 2NVUB 2CW0F 2VONA 1N77A 4FQGA 2RQPA 3KETA 1IRYA 1ITYA 4CICA 1MQWA 3S17J 1PUFA 1T0FC 3CP2A 1G2HA 3RPQA 1X83A 3AFHA 1BJAA 3L00A 4NHJA 1PVFA 1G4DA 3FISA 3X2QH 1OQYA 1TWAJ 1IUFA 2YSRA 4ON0A 1YTYA 4LFUA 1TLHB 4ZZDA 3S2WA 2R5YB 2JA8J 2VJJA 3M7GA 2QLZA 5FO5A 1XSXA 3GG6A 3DU6A 3O69A 1HW1A 3LSMA 2DA6A 5E18F 5C4JJ 1XSBA 5DEQA 2WB1A 1IF1A 2LVSA 4XLFA 3CCMI 3OL3A 1X4PA 2IS6A 1ZREA 3D5LA 4N9HA 1E3OC 1K7AA 2IGNA 1ZKGA 1IN7A 1IRXA 3DQVC 3FXOA 1JGSA 3H3VK 1K2EA 1MNDA 2DJIA 5GTHC 2W4SA 4M73A 3U21A 4ASNA 3S1QJ 4EGZA 3FHZA 2Y0SN 2C6YA 3CDHA 1ZRCA 4KA4A 3HRMA 4JQFA 1S8NA 3FMRA 3GTJJ 4IHTA 1B8IB 4NC8A 1D0XA 2GXGA 1LVKA 2X6YA 3BZKA 1OCTC 1SEUA 1IC8A 5KAFC 1MK1A 4WWCA 2RNJA 3ECOA 2IA2A 2ID3A 3ZCOA 3JRDA 1FJLA 2DI3A 2M0CA 4UV8A 4HG2A 5J1YA 1IRZA 3LSJA 4KNYA 1TQPA 2WAQA 5GPCA 3HGGA 2BY0A 4D7MA 3OS1A 2Q2EB 3H5NA 1RR8C 5L3DA 3I53A 4RAYA 3KE2A 5HDGA 3WGGA 5LHHA 3CC4I 2Q9PA 3VOEA 2FVVA 3OWTA 4OOIA 2DUKA 2O5RA 1AA7A 2CJJA 2QQ8A 1JKNA 3SONA 2KJCA 3HM5A 2EK5A 3ZMUA 1QU3A 3R03A 1KT9A 5IPAA 2HVQA 2VE9A 1ETYA 4Z2YA 2HZTA 5J8FA 4BAYA 3FK6A 2E71A 3PNYA 3O8SA 5D5XB 4U7BA 2L2OA 2A5WA 3FXMA 1CGPA 5FSOA 1BIAA 3LA7A 5TGTA 4E7JA 2HOTA 1C0WA 3OYHA 1ZG5A 4XN3A 1WH5A 4N1TA 1T08B 3ZR1A 3ZN1A 3BR6A 1T8IA 3KZYA 1ETVA 1CF7A 1VCDA 3ESWB 2E1MB 3AC9A 1B72A 4J7HA 4I02A 4S0HB 3BHOA 5AONA 1Z77A 1ONVA 2A69F 5GADJ 1ZH5A 3GVAA 2ESNA 3PSFA 5M3MJ 3AAFA 3U1KA 1SFOJ 5HLHA 3OYNA 2VPRA 2MFZA 2JTVA 2A6HF 2GOMA 3FM5A 4B09A 1KQ0A 4HNVA 1E17A 3J81K 5JLWA 1MJAA 2DPUA 3RZDJ 5IP7J 3QRFF 4QIWN 3ABUA 2ZO4A 2KIUA 3LSIA 3OYBA 2X4HA 2R93J 3W2AA 2DAOA 1FZPB 4JX5A 3M4OJ 3FCMA 1FYMA 1Q1HA 1BW6A 4CDGA 4MIMA 3CCUI 3ZQCA 4N9IA 3ZQ7A 2GT2A 4LJZF 3WODF 5ANWA 3FX3A 1OFCX 1ACIA 5CFIA 4L18B 4E7KA 4ZTJA 3ONQA 2E2IJ 2M5WA 1EJ9A 2QZ8A 3SDBA 2Y30A 3DUPA 3QYBA 2CFOA 4HW0A 1QRYA 4G7HF 2DXIA 2BV6A 2NOJB 4YIFA 1X3UA 3TBIA 4LMYA 1XPXA 3FXLA 4HA8A 4LGWA 2OTLI 4GRIA 3M07A 1WSUA 4NC6A 2I5UA 3QYFA 1QNTA 4BYYA 4UUSA 4IHSA 2XAHA 3LNQA 1JKPC 2QBYA 4KG3A 4RGRA 2CFXA 3BG3A 2A6EF 2DA5A 3CUQC 3JAMZ 5L3GA 2NVXJ 3DKYA 4D9JA 3V42A 3AG1H 2AQFA 2RNGA 4E7ZA 2I6KA 2FBHA 2BGCA 4PFOA 2LP0A 2DFFA 3ML6A 3H3UA 1TW3A 3O52A 1YI2I 2B0LA 3BAPA 3CTAA 3GTOJ 4G9YA 4CCMA 5A2QK 1FTZA 3TKYA 1ZRFA 5H20A 4DW6A 1MR2A 2D2WA 2KPMA 4YPRA 4IQ4A 2MG4A 3OOUA 3K10A 3WTSC 3MCFA 3LA2A 3LL7A 4L5IA 2HR3A 3DBLB 1Z7UA 2H8WA 5CKTA 2ISZA 1LDKB 3HOTA 2OF7A 2TCTA 2XPUA 3DPTA 3OS0A 4LG0B 1GDTA 4C9YA 1VQKI 3R61A 2PI0A 2M1BA 2WAEA 4AC0A 1Z3YA 2V4JC 2Y0MA 2PN6A 2MSYA 3OYAA 2F4MB 2RRKA 2DFIA 2V6CA 1KU7A 4M71A 2XUBA 3R4KA 1KA8A 3W6VA 2YYHA 5CVVA 4AYBA 5FB2A 2GXBA 3NAUA 4I99C 4YG2F 3J7YJ 1WH7A 4PSXA 4IHWA 4U7DA 2HXIA 3IRQA 2H8RA 5LPGA 4KYXA 1QA6A 1QQIA 2NYXA 3OYIA 5FLVA 1S3JA 1OYYA 2Z33A 1W36D 1VNDA 5E8GA 4EJUA 4OAZA 1ENHA 3NWSA 5E79C 2VBZA 4XLEA 1JJ8C 2K9NA 3M8EA 3GFIA 3FM3A 2E2JJ 3H5RA 3SEZA 4I2OA 1ODDA 2ISYA 2PMHA 3N9UA 4ZYHA 1U5TC 3WTWC 3X0SA 3ZXSA 3ZOBA 1V8WA 5JHFA 4GDFA 1GV2A 3E97A 3OMYA 3ROUA 2R7FA 2YVPA 5KNLA 3HYIA 1HKTA 4U87A 5HDKA 5H2FC 2YVOA 1AOYA 3OY9A 2VQGA 4BE0A 3GZNB 5GAEJ 5D5VB 2ICWG 4MQVA 5IP6A 1PVEA 2WY7Q 1R67A 4X1EA 3QPHA 2PNYA 3JCUC 4XRFA 4K2EA 3F21A 1A6IA 2LY1A 1TT5B 2RV8A 2XF7A 3WTUC 4Q4ZF 4FETA 3WTXC 4FX4A 3S8PA 1WCMJ 2HTSA 5JHUA 2H27A 3K4LA 4XOPA 3LA3A 3RQ4A 2WB1N 4B48A 2KRHA 3H9QA 3P5TA 2PQVA 2DSBA 3G1OA 1A5JA 2M45A 3HC7A 4UUTA 1WI9A 3L85A 2Y9ZA 2VODA 1WQ2A 2M8EA 4DNCA 2X1DA 3SFZA 2E34A 2M34A 3W6KB 3KYLA 3C7JA 1WJAA 3GZ8A 1AHDP 4U0VA 3V8LA 3W6JB 2F5DA 2XKPA 4YPHA 3ZRGA 2LY2A 2K5CA 3S1NJ 2LOOA 3HRTA 4MO7A 5EZGA 1R1TA 2O0YA 4S04A 2GT4A 1KU2A 2EFOA 4WXDA 3OSGA 5E1XA 2HZDA 5JI6A 1PJRA 3HOUJ 3P9CA 2XRNA 1TC3C 3Q9SA 4RMNA 1AKHB 2NOGA 3JR9A 1NFZA 3CCVI 2COBA 1G59A 4FE4A 2PMUA 2K86A 1E2XA 3N05A 3WTVC 2YX4A 1D1CA 1SFKA 4O5VA 2CSOA 4XSXF 2DN0A 1D0ZA 3HOSA 5ANSA 2MC3A 1Q1VA 2CYYA 4F55A 1IW7F 4G12A 4MQ9F 1GXPA 2KDWA 1LB2A 1F5TA 5DYMA 2BHZA 3I3LA 3VYSB 1BI2A 3M1CA 2XROA 3MKYB 1FOKA 3U1DA 2GB5A 1GLNA 1SFEA 4FT8A 1I1GA 4B4CA 2R7VA 4G6TB 4BS9A 2P5LC 1ZG3A 2H1LA 2JRTA 2ZJQF 3FBNB 1NH3A 1MUTA 5A2QZ 5EYRA 3C1DA 1TUMA 4PK4A 2MW8A 3TGNA 2JQ7A 3H9JA 3COUA 1V8YA 4BEHA 2M4GA 4BHCA 3C2GA 5EDNA 5FSNA 2DW4A 5ED4A 1TWCJ 1KZHA 2BW3B 2XB5A 2CL3A 5C44J 3OIPA 3GLLA 4MFDA 2VIXA 4PCQA 4PGHA 1SMTA 4RDUA 2BVLA 5ILVA 4C9XA 2KDOA 2DO7A 1VQPI 1OR7A 1HDPA 2VKVA 3ZMSA 2P6TA 1GUUA 3HIFA 1R71A 4ENMA 4NFXA 3EYYA 2OJED 3CLOA 3TO9A 1XGOA 4MEYF 3OL4A 3OYJA 4GCVA 1BIBA 3BR3A 2Y48A 2F5FA 5DCMB 2HQNA 4A2UA 1RUNA 1WRJA 2DA1A 3ACAA 4KIGA 1OCZH 5J4YA 2ME0A 5DUKA 3DV8A 4CYCA 2QKMB 2VT2A 3WG7H 5E1ZB 4QTRA 3CUQB 1WJEA 3HRSA 1MJ9A 4LD5A 4HDUA 3S2DJ 1GXQA 1W5TA 2R5YA 1WGXA 3X0MA 2B9SA 4ENNA 4XL9A 1UAAA 3OYMA 1I3QJ 1FSEA 4P9UA 4XORA 3SYTA 3E6BA 2ZMEC 3LFUA 2EPFA 3A6UA 4A12A 2DJNA 3OYGA 1ZR2A 1BR1A 1V8RA 3FJYA 5CVJA 2FXAA 2FEZA 3HKZN 1MZBA 2W57A 2CUFA 1R36A 2HKXA 3E7LA 4C3IJ 1YYVA 3JRBA 2O1CA 4ZYGA 3V7CA 1ZLJA 2DA3A 5D5UB 2DLLA 3VYRB 2OBPA 2L01A 4B44A 1IUYA 2G7HA 5FLMJ 1NTCA 2R7SA 1QZZA 2KFDA 4A0YA 4BE2A 1S6LA 2L9RA 5C7QA 4E7HA 3B02A 5IT3A 3IRRA 2YUSA 2ACJA 2J8QA 3ASNH 4IRHA 5H6QA 2EIMH 3M1EA 3VODA 1T95A 3GZ5A 1IV8A 2V1XA 4HX8A 4IL6C 5EEGA 5FRNA 4Q5SF 1W7PB 3E0JB 5CJ9A 3HOZJ 3A1YA 2PMZN 1N78A 2JUGA 1J09A 3ZR0A 3V8JA 1M1EB 4HNTA 2EFWA 2XF6A 1H0MA 2OPTA 4RM2A 2R92J 2FUG2 3H35A 1SVLA 1LDDA 3Q0UA 2KZVA 3R6SA 3CDLA 1O4XA 2IXSA 2VBWA 4MHGA 5FSMA 3P5JA 2ECBA 5E3LA 1YW9A 3BTJA 3I7UA 2E36A 4L9JA 2X9DA 1B59A 4ITVA 1UMQA 4M6YA 2BHYA 1DPRA 5IOYA 2ZXIA 5L3FA 2K9LA 1R1UA 4DBQA 1YJ9I 5AIQA 1RI7A 1HCRA 2QBYB 3MWMA 1U5TA 1H88C 3F6OA 3BJAA 1X1CA 2ZSHB 3BROA 2GWRA 3BOQA 1V55H 3LSHA 2EZKA 4MTEA 1KU9A 4XMYA 1R22A 3LMMA 3T8RA 1SD6A 5FKMA 5J47A 4HF1A 1QZEA 2CU7A 3BPVA 5EF6A 1Z7LA 3CMAI 2KMUA 3FZVA 5LD2C 3S3NA 1PUNA 3CO6C 5GHQA 1V5EA 1U9NA 2NS0A 2LLKA 1Y8QB 1XCBA 1MMNA 5F0CA 4MFEA 4AUXA 1IGNA 1Y6IA 3ABMH 1G3SA 4A3JJ 1SVOA 2V26A 2B06A 3A6TA 3NQOA 4XLCA 3Q5FA 4FASD 5FD6A 4N1UA 3ZMZA 2OQRA 1Z1DA 2IJLA 5GAHJ 1OW2A 4S2VA 1O7FA 3FHNA 5KAIC 2VJIA 4GGGA 2KL4A 2VI6A 1K26A 4M3FA 3V7SA 1U9OA 4BJ5C 3GWZA 4ENJA 4A3DJ 2VOPA 2PQ8A 3J81Z 3HXLA 2QCOA 1WPKA 1AU7A 2OV7A 1IN5A 1TTYA 4MGRA 2IBDA 1IXCA 2DOAA 3PUBA 1J7KA 4LLGF 2CUJA 3TP3A 2EV0A 2X51A 3S1RJ 3BR0A 1XMAA 1WJDA 3UR3C 2LFBA 1K83J 3QP6A 1Z0XA 3IKVA 2XRLA 4FX0A 3T0YA 3SZGA 4AM3A 2Z9OA 1WJBA 1OYWA 2LK2A 3CMMA 3PIOF 1YJNI 2N8GA 1AWCA 5L3BA 2JUCA 1UZCA 4RA2A 4S05A 1EV7A 3L2CA 3FDYA 2XPVA 2WAFA 4M72A 2O9LA 3L7WA 1BI1A 5D8KB 2X1CA 1ZHFA 3P9IA 2BBYA 5JR3A 4M9XA 2XB0X 4M3GA 1K4SA 1K79A 1MBFA 2VKEA 2GM4A 1ORKA 5HZXA 4C2UA 4EGYA 3M3YJ 2EZHA 2M0MA 2KLOA 3LSGA 3PSIA 2DPDA 2LY9A 4ZYAA 2PJRA 4G94A 5LEKA 3C3WA 1SD7A 2DMPA 4WK8F 1MNMC 3GW2A 5ERIA 4Y13A 4MTDA 2EFNA 1Q27A 3KP5A 2ZXJA 2A6TA 3G0QA 2FA5A 2VASA 4OINF 1T98A 3A0HC 1SAXA 3GTKJ 1JRKA 4KIBA 5ANVA 3Q2TA 3J7ZI 2JRMA 1Z21A 1A04A 1G3WA 4CCJA 4L9NA 4O3MA 1P2FA 3ELKA 4HOBA 4DJAA 4BUPA 3CCLI 1YFHA 4IJXA 2CUEA 3WU2C 2HOEA 2FMYA 1U6GA 5LBQA 2RN7A 2LKXA 1VQMI 1VQ8I 3BPXA 3AG3H 1FT9A 3J80K 4B1RA 1IXSB 3K9TA 2X48A 1WKMA 4IOAF 3HTUA 4DYQA 1JKQC 5C7TA 4XM3A 4E7LA 1IRFA 3ZR8X 2V7FA 3F8MA 2NRAC 1MQEA 3BDDA 3O8GA 4AWXB 4RLQA 4LLLA 2CQXA 5DM6F 4M3BA 4HX4A 1CQTA 4S2YA 2FF4A 5E1WA 1OCOH 1R1VA 1OMIA 2OUMA 4C30A 1FMVA 2W48A 2E1NA 1FPQA 4HNUA 4FHTA 4NQWA 3J7Ye 1XSCA 3JRIA 5LGNA 3CMEI 1S29A 3VPRA 5ISYA 1MBEA 2BE5F 5DV5A 3DP7A 4YIIA 4AD9A 1MW7A 2DK5A 1HKSA 2R7WA 3H95A 4DIQA 1W7PD 4RAGA 4ZZLA 1KHZA 2P5VA 1BW5A 2WV0A 4KICA 1X2NA 2IS4A 4KTBA 3COAC 4L9TA 4LIUA 2ZB9A 4A3GJ 3Q0VA 2BY3A 4BXUA 3O6BB 5E20A 3OYEA 2XAJA 1DGWY 3CJNA 2HU9A 3HSFA 2HPMA 3V7RA 2IS2A 3ABKH 3NRVA 4DBRA 5IYCJ 3NWTA 3WTYC 1ZRDA 2CWEA 2O3FA 3R0AA 2XAFA 3SMDA 4YRVA 4N4NB 2B2KA 4GYGA 1YQAA 1T38A 3K7AJ 3HB9A 3JTHA 4DYRA 2WTEA 4MPOA 3WE3A 4A3BJ 1ETWA 3E5UA 2M2EA 4RBOA 9ANTA 3DKUA 4Y4RA 4X0GA 2VXDA 4E70A 2XIGA 3SEQA 2NNYA 3K0LA 3MKZA 3JRGA 2JPBA 5E3MA 1V3FA 4LG0A 4G8XA 1OCCH 3HUGB 2OAZA 3PNTA 3GFJA 1UJ8A 4RGSA 2XC7A 5ICEA 3JRHA 1X84A 1I5ZA 2O8KA 2AQEA 1TWGJ 2FD5A 2DA2A 2K3FA 2YS9A 3KYCB 3PQKA 3K1NA 2ELJA 4TV7A 4CZCA 2JVHA 1APLC 3BCAA 1A35A 4ENKA 1R23A 3ZGKA 4DGWB 5D6FA 4ANJA 2FOWA 3KIOA 1U8RA 2E2HJ 1MH4A 1P6RA 2K40A 4IKFA 2VLAA 3WGHA 5HVQC 1U2WA 4RGXA 3VB2A 4ZG0A 2Z99A 5HODA 1DP3A 3FXRA 3PFYA 3UKGA 1BR2A 2AS5F 2K9SA 2O61A 3A6VA 3O6ZA 3B6AA 3DKXA 2BVMA 3ZQGA 2KZGA 2HOSA 1HOMA 1HKQA 3CC7I 2COMA 2JSCA 4HF0A 4BHPA 2GLOA 2DYRH 2IGKA 3L2VA 3WE2A 5CFJA 2DMQA 2FQ3A 5J8CA 4J00A 2V1DA 3RIRA 1HC8A 3GTMJ 4BY7J 3RDIA 5GHNA 4G6DA 3WHWA 2BXZA 2CQQA 2DU9A 3P7NA 5DDGA 1L3LA 3NARA 4XLPF 2R5ZA 4MNUA 5IW4A 2EFPA 5F08A 3KVHA 4EQQA 3A2KA 3FIWA 5J1RA 2HYGD 4WF2A 1MH3A 2W4EA 2CRGA 4Y17A 5LFAA 1Q54A 2O03A 4EEFG 3KLOA 4DQ2A 2R7TA 1BBYA 1T56A 1R4MB 5LRRA 3RH7A 1X58A 4A69C 4FISA 3AL0C 4RAZA 4Z6YA 1LFPA 5GHMA 1F3YA 1UG0A 2DOFA 3KX2A 4YFNF 1REPC 1EH7A 4PJJA 1JI8A 3VSKA 3CMYA 4JZUA 2V9VA 1Z6RA 4RM3A 4CHUA 3QODA 2DQLA 2P0WA 2WY8Q 1V8LA 1LFBA 2M3AA 2DSCA 2RGVA 1PUEE 1HSTA 3CCQI 1TWFJ 4NB5A 1Z67A 3E6MA 2MD0A 3OYLA 2EBIA 3AG4H 4A3MJ 3KP2A 3W2VA 1P7IA 2VC1A 4XK4A 3G71I 4OWRB 3MDGA 3N4MA 2MGQA 3E1SA 4HBLA 4A5MA 3HJEA 1Z6TA 2XSQA 2B7EA 2XGCA 1GA7A 2RVCA 2QJTA 3LAJA 3LOCA 4BACA 5F1RA 1HLVA 3I56I 2GA2A 4CH7A 2AXTC 2F5VA 1MBKA 1NFSA 3VEPA 5C4XJ 1JE8A 4I98B 5D6EA 3RI4A 3RKQA 3BWGA 1OCRH 5DD8A 1VQOI 4AYBN 3HOYJ 1IZ1A 4EVIA 2I8UA 2OD5A 4LB6B 1LUJB 1UELB 1Q33A 3C2BA 4S2XA 5F64A 3ABTA 2GIZA 4UB6C 4XBFA 4YFKF 4F7ZA 2Q1ZB 4FE7A 2K7LA 4A93J 1BA5A 2V9PA 4LK0F 1HX3A 3EUHC 4CA0A 4LG3A 3I58A 2LBFB 2R5ZB 1OYIA 1XMKA 3GFLA 5F1JA 2JA5J 3CUQA 3D5RC 5KK1A 3A6SA 4CCKA 4Y52J 1HF0A 2XASA 3X0JA 4IX7A 1IN4A 1JJ6C 2LDUA 3GF2A 3SZTA 1BJZA 1HBXG 3E5XA 4ICKA 3I4MJ 2H1KA 4OAYA 1V5FA 3QP5A 1T39A 3VDXA 2QQAA 2AO9A 5K7HA 2YU9J 1VQNI 4F92B 1WWXA 1XGNA 2VBYA 3PNVA 2ZSIB 1P9QC 1S7OA 2I8DA 2XDVA 4WX9A 1U5TB 4NBQA 5DS9A 5D8LB 1ETXA 3I4PA 2HYFA 1OCPA 4CYDA 1GV5A 1X1DA 4W97A 4B3XA 5B66C 2B0VA 5ANTA 3TO7A 3KZZA 2M30A 1QPMA 3HOXJ 5ANUA 3X0KA 1RNLA 5IT9K 3BR1A 1I3AA 3G1MA 2LNBA 1I27A 4ESFA 3MFKA 2G73A 2DQRA 1X1BA 3E6DA 2UWMA 3B6CA 3RCOA 5K1YA 1ON1A 3KYDB 5BQTA 1Y0UA 3PL8A 3RJPA 2FU4A 5E3OA 2V6EA 1MP2A 3A4CA 4PJLA 1XDSA 5KHDA 2PJRB 1SANA 1X2MA 2QJOA 2BOLA 3WU0A 5ILUA 3BQYA 1POGA 2RDPA 2K4JA 5LHGA 5EEAA 3X0PA 4AIKA 3JREA 4WXHA 5LEJA 4KT5C 4CSWA 4C3JJ 2O6GE 5FSLA 2L4MA 1I50J 3QPTA 2KISA 2DDAA 3LSRA 2FE3A 1YLFA 1R6RA 2Y69H 5F0HA 2LC2A 5DD4A 3F72A 1MMGA 4UHTA 5ICFA 2ZJRF 3IL2A 3BY6A 1MJBA 2UXXA 4ZDLA 1R5ID 3RPUD 2ZCWA 2JZYA 4EM0B 1QPIA 4DOZA 4E4HA 3TEDA 4R1HA 1TBXA 1U78A 1WZ2A 5LLQA 2K27A 2DT6A 4B47A 3FXJA 4OIRF 1SD5A 2M87A 2D1VA 3FBIB 1PYVA 2FBIA 4XRSG 1R58A 2ZFWA 3Q9VA 3KP6A 5FLXZ 2R0QC 3CJQB 3ZQQA 5ICCA 1LNWA 5GHIA 4A6DA 5J6XA 1EA3A 5EJCA 4B3AA 2F4IA 2XAQA 4XNFA 2A8PA 1LKXA 4IOCF 1QVJA 3M8FA 3CO7C 2KT0A 2JK3A 3F8CA 4UV9A 1LE8B 4XICA 3CDIA 5IT9Z 3SJMA 4CGZA 1VQ9I 4YFXF 3CCJI 2D1HA 3I9V2 2K3PA 3WGIA 4IZZA 4D5FA 4UUSB 2ETHA 4KMFA 2ZJ2A 1KTGA 4IEJA 4YEJA 3JRCA 4KMUX 2WC2A 3ZQLA 2E5ZA 5E8IA 2LYCA 3KEQA 2WBMA 4ZC3A 3PO3J 2EIKH 4XONA 5IY5H 3QU6A 2G9WA 3VYUB 1P7JA 4BJ6C 3L2WA 5IW5A 2KIQA 1IDZA 2NS7A 2PX9A 3T5XA 3I59A 4UB8C 1MGTA 2V1UA 1TNTA 1ZQ3P 2QVOA 5FKLA 1FIAA 1D3YA 3DCFA 3LSPA 2OZ6A 1D8KA 1O7LA 1MMAA 4KFCA 4L5JA 1EF4A 2BW3A 3GUDA 5DTDA 2VOOA 3DBRB 1RRJA 5EGOB 1O3TA 4XKBA 2M9HA 4J7GA 1JHHA 2QYOA 4BEHB 1NG6A 2CH0A 2IVMA 1IG7A 2L5QA 1RRQA 2VXZA 2BY1A 2STWA 5KCMA 1YITI 1TQIA 4CCLA 2OZUA 2VB6A 1SJYA 1PUSA 2W00A 2ELHA 1Z3XA 3GCMA 5GHOA 1RIOH 3F8FA 3HUGA 3S14J 3DPLC 3MKWB 3EXQA 1NG7A 2VUMJ 3U2RA 4HV6A 1GT0C 2FSWA 4KT6A 3MZ8A 1RKWA 2VKDA 4CZZA 3HOWJ 4AVPA 3IHUA 1VFCA 3H1CA 2IA1A 1T6SA 2ZXHA 2QM3A 2XAGA 1TL8A 4BHBA 5GHPA 3ZPLA 1W36C 4KUMA 1Y1VJ 2DBBA 3TDZC 4LLNA 1FBQA 2RQQA 3LFKA 1PP8F 4BQAA 2JMWA 1F9NA 3P6YA 3MGMA 4PJ0C 3G2BA 4RB0A 5FSKA 3SHDA 3CQZJ 5DPKA 3K4MA 3TO6A 3F9KA 1WI3A 3S3MA 2D45A 2A05A 1UHSA 1B9NA 4N0BA 1FP2A 1VIQA 3OGAA 4BXFA 2VNPA 4BL0B 3N97A 4KN7X 4A3KJ 1H9TA 1JTYA 2QUFA 3J7AY 4Y33A 5GP9A 1FMWA 1IN8A 3KP3A 3X0RA 1G3TA 3SFIA 1S9HA 1MDMA 4EMSA 3L09A 2IAIA 2A8QA 2OC6A 5BS6A 2A68F 5EGOA 5LGUA 1JXSA 2RAEA 5TISC 4D5CA 2ZFUA 3FK9A 4G7ZF 2H6BA 3PUFA 1QVTA 1WJCA 5KVRA 2R5WA 2VPLA 2QQBA 2VNQA 4S2WA 1VTNC 2JT1A 2R4GA 1VZ0A 3KFWX 1XS9A
chains in the Genus database with same CATH topology
2F5EA 5DUIA 5E17F 1Z91A 3GRNA 2AXLA 1XN7A 3F6VA 2H6CA 2VN2A 1D8JA 1TW2A 3H92A 4PDKA 3QU3A 5TJJA 1B1BA 1HSJA 1TQMA 3I5UA 3ZP5A 1ULYA 1V4RA 4C9WA 3F6AA 1LVAA 4KDPA 2I8TA 2OA4A 3K1MA 4RGUA 1MD0A 4HFQA 3EESA 4HAMA 4GXOA 3MCZA 2IPQX 2R3SA 2Q8KA 3BJ6A 1ZAOA 3E57A 3Q93A 3KP4A 4KIFA 3JAMK 4L0YB 3MZHA 5ICGA 5FD5A 3ID9A 3E3VA 2MLGA 1LDJA 2FMLA 1W5SA 1B6AA 1J0RA 3U9GA 2W25A 1FYLA 2EA4A 2H94A 4EM1A 1FC3A 2PLYA 3DKWA 1O3RA 1ZYRF 1XDUA 2HWVA 2KIFA 1GHCA 1NHAA 2UXNA 3J80Z 2KIMA 1RYAA 4A6EA 3G3ZA 5JVTA 1LJ9A 4ZYDA 2P5KA 1HXDA 3MDIA 1YW7A 4OMZA 4QLCU 3LSTA 2MH9A 2A8TA 3PQJA 2RC4A 2A3SA 3E5QA 1D5VA 2IA0A 4IXAA 4OIPF 1BM9A 4R8HA 2HDCA 2BEOA 2HQRA 1XCVA 3HHHA 1UCRA 1XD7A 3HHJA 3ZMVA 2HFHA 1QBJA 1B4AA 2JPCA 1P4XA 4CO8A 4LK1F 1ZGAA 2V79A 5HS8A 3ULQB 2CGPA 1BI3A 4KN4X 2F2EA 1FY7A 1VIUA 4I0BA 4EJWA 4I09A 2CQKA 1VHGA 1HW2A 1USSA 4Q48A 1RUOA 1JHFA 2KJBA 1MDMB 2EWNA 1KYWA 5L3CA 2W84A 1PP7U 2YPRA 2XGXA 1RZ4A 3DF8A 2MH2A 2EA2A 5HLIA 2E1CA 3I7VA 2UZKA 3ZMTA 5H6RA 4M74A 2MBFA 1LEBA 4HDVA 4HLYA 1EH8A 4OIQF 2DSDA 3EDPA 4H0EA 2K4BA 3RYPA 1O3QA 3K2ZA 4BH9A 2GAUA 2YU3A 3BJOA 2ADUA 1PPWA 1HQCA 2ICKA 2YX7A 3KCCA 1KQ8A 2FRHA 2CG4A 3LQRA 1YS7A 1K78B 1J5YA 3V8KA 4PGGA 1IRGA 1XGSA 3X0QA 4HLXA 3WTZA 4K6EA 5CLSA 2TDXA 3JW4A 2P8TA 1DPUA 4YOQA 2P4WA 3JSOA 1PPXA 3X0IA 4L0ZB 4DYWA 2GZWA 2PBIA 3HSEA 2PJPA 3REOA 3GZ6A 4WXCA 1R5HA 1Z9CA 1SOIA 2XVCA 3OV8A 3GFMA 4IJAA 1SZ3A 3FFUA 1FNNA 4IRGA 2YVNA 2NNNA 2MA3A 1LQ1A 2W85A 5K5OA 4KG4A 3HHGA 2PFBA 1U20A 4HF2A 3FSPA 2STTA 4EV0A 2RKHA 4HX7A 3SQNA 1UB9A 3ECHA 1ZG1A 1V8TA 3V4GA 3GYHX 2L02A 5BOXA 4B8XA 4UVAA 2EB7A 4Y15A 1U3EM 5CVRA 1ZARA 3KEOA 1MKMA 3OOPA 1K78A 2IP2A 5I8UA 1SMYF 3GO5A 1W7PA 1ZGJA 3T8TA 2WWYA 3SHFA 1X51A 5HLGA 2FNPA 2HKOA 3O61A 3N77A 2EJRA 2XV4S 1BC8C 1BN5A 3P9KA 5GHJA 3D0SA 2E7WA 4G6QA 3I64A 4XLNF 3GXOA 1V8NA 4ZYEA 1VC9A 2KRFA 3EUHA 5FFZA 2PEXA 1I9AA 2DK8A 5LRSA 2JVBA 2ZKZA 1XSAA 1XSVA 2ICJA 2Q0OA 3IC7A 1P92A 3MAJA 2EFQA 2BYVE 3EEUA 1V8SA 4UNOA 3IWZA 5FGMA 3FMQA 3GEZA 5EEHA 3I59B 3FWEA 4V14A 1HZTA 4HVYA 5TRDA 3I54A 3WG9A 5FSIA 3PFIA 3K1PA 3LWFA 3I9XA 3DEUA 2EV5A 4UUVA 1S7AA 4G7OF 4U0YA 3F23A 2EV6A 2NAZA 1UHMA 4A0ZA 5K5QA 2DT5A 5JFRA 2YR2A 1BOAA 3RKYA 1YIOA 1G3YA 5FLXK 2QENA 3Q91A 4OIOF 2DTRA 2L3DA 3DFGA 2A5YB 1KYZA 5LHIA 1EH6A 1R5GA 2LKPA 3TOAA 3F13A 2XHKA 1QO0D 5HS9A 3GWYA 3CNGA 4AIJA 1SFUA 2AZWA 6PAXA 1FWZA 5F6FA 1QZYA 1XGMA 3ZN0A 2A8RA 1P4WA 3MZYA 3C18A 1KQ9A 4UXNA 1V8VA 1QGPA 4I7HA 4EJTA 3BM4A 5L3EA 1J2XA 1O57A 1V8IA 3FXQA 2W24A 1BC7C 3ISPA 2PG4A 1UHWA 2Q2EA 3Q4IA 2O8XA 3RKWA 4WCGA 4U88A 2GA1A 2GIVA 2Z5UA 1OPCA 3RYRA 2XKOA 2FOKA 4M6XA 5K5RA 1USTA 2J5PA 4IF4A 5HDNA 2FKBA 4A0XA 3J7AO 2P7VB 4P55A 5ILSA 3QOPA 1R7JA 4QWQA 3HTSB 1YG2A 4ESBA 1DP7P 4MEXF 4HV5A 2K02A 2ZBKA 3TOBA 3EYIA 3KP7A 3FMSA 1VK6A 2LSOA 2A07F 2OU2A 4RB3C 4Q47A 1J75A 3JTGA 2ZNZA 2DHOA 1I1SA 1FBSA 4D0PA 2VT3A 4A5NA 1G0SA 2KDVA 3M9AA 3R60A 1TNSA 2IT0A 4U0WA 4R79A 3G73A 2HS5A 2ZNYA 5FFXA 1PDNC 3QSJA 3I0TA 2Y75A 3O2PE 3TDUC 3RPUA 4HQMA 4UVBA 3BZ6A 2L4AA 3WU1B 2LF8A 2ZMEA 4IPAA 1ZLKA 2G7UA 4OU0A 1Z05A 3X0LA 5HS7A 2H09A 4OMYA 3MQ0A 3IKTA 5LGTA 2O5FA 1PPVA 4P96A 5BPIA 4I0AA 1V8MA 3KLNA 1J9IA 3LQQA 2P7CB 2YVMA 2VC0A 4ZH4F 4CXFA 1VC8A 5AIPA 1FYKA 3EETA 4HZFA 1V8UA 3GX4X 1IXRC 2R7DA 5D4RA 3EQLF 4ETSA 1FP1D 3H3ZA 3IWFA 5D5WB 2CZRA 5DCMA 2FNAA 1L0OC 3FXUA 2QQ9A 4JZSA 2VBXA 3L9FA 4O6JA 5BMZA 4EJOA 4PZJA 2O5WA 1YO5C 1LEAA 4L9VA 3HRUA 4P5OA 3HSRA 1FLIA 1O3SA 1P4AA 4EJVA 5DCFA 4NFWA 5BONA 1IAWA 2Z3YA 5CVUA 3EF5A 4AIHA 4JZTA 1DUXC 2IW5A 5CVIA 3F3XA 1STZA 1W4MA 1NQYA 1YW8A 2P6SA 3MEXA 1KU3A 1KGSA 2VE8A 4M9ZA 1R00A 1RRSA 3RKXA 1FX7A 2FBKA 3ZMDA 3LAPA 3B73A 4EM2A 3O3KA 1UFMA 1ZN2A 3FF5A 2OQGA 3I71A 4LB5A 1FSHA 3K69A 1F1ZA 1VRLA 3RTRA 3X0OA 4IVNA 1ON2A 4HQEA 3T1BA 4XSZF 3TQNA 4RS8A 2F5CA 1OKRA 1G9QA 2MLKA 4UVCA 1H9GA 4P9FA 1DDNA 1XSDA 3GLXA 4GO1A 2HTJA 1SU2A 3E6CC 2X0LA 3Q2SA 4IRIA 3CUOA 4JK1X 1BI0A 2G74A 1B9MA 1PUQA 1VHZA 2CO5A 3ERED 2KKOA 4BNCA 3X0NA 4GYIA 3QAHA 3JSPA 1T2KA 4RB1A 4KYWA 2HGCA 1K6OA 4JBAA 2LF7A 3F8BA 2IRFG 3HYQA 2HEOA 3DXJF 1I6XA 3U53A 1F4KA 1T0FA 4ESJA 4I01A 2J5OA 3BP8A 4RB2C 1YS6A 1CF7B 5CYVA 4HYEA 2ESHA 1XB4A 5HOOA 2ZMEB 3SXYA 1J59A 1IN6A 4JZVA 5D4SA 1FBUA 4ILQA 3SZPA 1NQZA 2E7XA 3NEUA 3F22A 2L54A 3R0JA 5C8LA 3WTTC 2A8SA 1HW5A 3Q1PA 1SD4A 2GQQA 2MD5A 3F8NA 2A61A 1SFXA 3VFZA 2QWWA 5BPDA 1G6NA 4M9SA 1GVJA 2CW0F 2VONA 2RQPA 3KETA 1IRYA 1MQWA 4CICA 3RPQA 1X83A 1BJAA 3L00A 4NHJA 1PVFA 1G4DA 2YSRA 4ON0A 1YTYA 4LFUA 1TLHB 4ZZDA 3S2WA 3M7GA 2QLZA 5FO5A 1XSXA 3GG6A 3O69A 1HW1A 1XSBA 5E18F 5DEQA 1IF1A 1ZREA 3D5LA 4N9HA 1K7AA 1IN7A 3DQVC 1JGSA 1K2EA 4M73A 4ASNA 4EGZA 3FHZA 2C6YA 3CDHA 1ZRCA 4KA4A 3HRMA 4JQFA 1S8NA 3FMRA 4IHTA 2GXGA 1MK1A 4WWCA 2RNJA 3ECOA 2IA2A 2DI3A 4UV8A 4KNYA 1TQPA 5L3DA 3I53A 4RAYA 3KE2A 5HDGA 3WGGA 5LHHA 2Q9PA 3VOEA 2FVVA 4OOIA 2DUKA 1JKNA 3SONA 2KJCA 2EK5A 3ZMUA 3R03A 1KT9A 2VE9A 4Z2YA 5J8FA 2HZTA 4BAYA 3O8SA 5D5XB 4U7BA 1CGPA 5FSOA 1BIAA 3LA7A 1C0WA 1ZG5A 4N1TA 3ZR1A 3ZN1A 3KZYA 1CF7A 1VCDA 3AC9A 4J7HA 4I02A 3BHOA 5AONA 1ONVA 2A69F 1ZH5A 3GVAA 2ESNA 3AAFA 5HLHA 2JTVA 2A6HF 3FM5A 4B09A 1KQ0A 1E17A 3J81K 1MJAA 2DPUA 3QRFF 3ABUA 2ZO4A 2KIUA 2X4HA 2DAOA 1FZPB 3FCMA 1FYMA 1Q1HA 4CDGA 4N9IA 3ZQ7A 2GT2A 4LJZF 3WODF 5ANWA 3FX3A 5CFIA 4L18B 2M5WA 2QZ8A 3DUPA 4HW0A 4G7HF 2BV6A 4YIFA 1X3UA 4LMYA 4HA8A 4LGWA 1WSUA 1QNTA 4BYYA 4IHSA 2XAHA 2QBYA 4KG3A 4RGRA 2CFXA 3CUQC 2A6EF 5L3GA 3JAMZ 2FBHA 2BGCA 3ML6A 3H3UA 1TW3A 3O52A 2B0LA 3BAPA 3CTAA 4G9YA 5A2QK 3TKYA 1ZRFA 5H20A 1MR2A 2D2WA 4YPRA 3WTSC 3MCFA 3LA2A 4L5IA 2HR3A 1Z7UA 2ISZA 1LDKB 3HOTA 3DPTA 4LG0B 3R61A 2PI0A 2M1BA 2Y0MA 2PN6A 2RRKA 2DFIA 2V6CA 1KU7A 4M71A 2XUBA 3R4KA 1KA8A 2YYHA 5CVVA 5FB2A 2GXBA 4YG2F 4U7DA 3IRQA 5LPGA 4KYXA 1QQIA 2NYXA 1S3JA 1OYYA 2Z33A 5E8GA 4EJUA 2VBZA 3M8EA 3GFIA 3FM3A 4I2OA 1ODDA 2ISYA 2PMHA 3N9UA 4ZYHA 1U5TC 3WTWC 3X0SA 1V8WA 3E97A 3ROUA 2R7FA 2YVPA 3HYIA 1HKTA 5HDKA 2YVOA 1AOYA 5D5VB 4MQVA 1R67A 3QPHA 2PNYA 4XRFA 4K2EA 3F21A 2RV8A 3WTUC 4Q4ZF 3WTXC 4FX4A 2HTSA 5JHUA 2H27A 3LA3A 3P5TA 2PQVA 2DSBA 2M45A 1WI9A 3L85A 2VODA 1WQ2A 2M8EA 4DNCA 3SFZA 3W6KB 3C7JA 3GZ8A 4U0VA 3V8LA 3W6JB 2F5DA 2XKPA 4YPHA 3HRTA 1R1TA 2O0YA 4S04A 2GT4A 1KU2A 2EFOA 4WXDA 5E1XA 5JI6A 3P9CA 2XRNA 3Q9SA 1NFZA 2PMUA 2K86A 1E2XA 3WTVC 2YX4A 4XSXF 4O5VA 2CSOA 3HOSA 5ANSA 2MC3A 2CYYA 1IW7F 2KDWA 4MQ9F 1GXPA 1LB2A 1F5TA 5DYMA 1BI2A 2XROA 1FOKA 2GB5A 3U1DA 1SFEA 4FT8A 1I1GA 2P5LC 1ZG3A 1MUTA 2JRTA 5A2QZ 3C1DA 1TUMA 3TGNA 3COUA 1V8YA 4BHCA 5FSNA 2DW4A 5ED4A 2CL3A 4PGHA 4PCQA 1SMTA 5ILVA 4C9XA 2DO7A 1OR7A 3ZMSA 2P6TA 3HIFA 4ENMA 4NFXA 3EYYA 3CLOA 3TO9A 1XGOA 4MEYF 4GCVA 1BIBA 2Y48A 2F5FA 5DCMB 2HQNA 4A2UA 1RUNA 1WRJA 3ACAA 4KIGA 5DUKA 3DV8A 2QKMB 2VT2A 5E1ZB 3CUQB 3HRSA 1MJ9A 4LD5A 4HDUA 1GXQA 1W5TA 3X0MA 4ENNA 1FSEA 4P9UA 3E6BA 3A6UA 4A12A 1V8RA 3FJYA 5CVJA 2FXAA 2FEZA 1MZBA 2W57A 2HKXA 1R36A 1YYVA 2O1CA 4ZYGA 3V7CA 1ZLJA 5D5UB 2DLLA 2OBPA 2L01A 1IUYA 2G7HA 1QZZA 4A0YA 1S6LA 5C7QA 3B02A 5IT3A 3IRRA 2ACJA 2J8QA 4IRHA 5H6QA 3M1EA 3VODA 3GZ5A 2V1XA 4HX8A 5EEGA 4Q5SF 1W7PB 5CJ9A 3ZR0A 3V8JA 2EFWA 1H0MA 1LDDA 3R6SA 2VBWA 4MHGA 5FSMA 1YW9A 3I7UA 4L9JA 1B59A 4M6YA 1DPRA 5L3FA 1R1UA 5AIQA 1RI7A 2QBYB 3MWMA 1U5TA 3F6OA 3BJAA 3BROA 2GWRA 3BOQA 4MTEA 1KU9A 1R22A 3T8RA 1SD6A 4HF1A 3BPVA 2I6KA 1PUNA 5GHQA 3FZVA 3CO6C 2NS0A 1XCBA 1G3SA 2B06A 3A6TA 3NQOA 3Q5FA 5FD6A 4N1UA 3ZMZA 2OQRA 1Z1DA 2IJLA 4S2VA 1OW2A 1O7FA 4GGGA 1K26A 3V7SA 4ENJA 3GWZA 2VOPA 2PQ8A 3J81Z 1IN5A 1TTYA 4MGRA 1IXCA 4LLGF 1J7KA 2EV0A 1XMAA 3QP6A 3IKVA 4FX0A 3T0YA 2Z9OA 1OYWA 1AWCA 5L3BA 4S05A 1EV7A 3L2CA 4M72A 3L7WA 1BI1A 5D8KB 1ZHFA 3P9IA 2BBYA 5JR3A 4M9XA 1K79A 5HZXA 4EGYA 2DPDA 4G94A 5LEKA 3C3WA 1SD7A 4WK8F 3GW2A 5ERIA 4Y13A 4MTDA 2EFNA 1Q27A 3KP5A 2ZXJA 2A6TA 3G0QA 2FA5A 4OINF 1T98A 1SAXA 1JRKA 3Q2TA 4KIBA 5ANVA 1A04A 1G3WA 4L9NA 4O3MA 1P2FA 3ELKA 4HOBA 1YFHA 4IJXA 2HOEA 2FMYA 1U6GA 5LBQA 2RN7A 3BPXA 3J80K 1FT9A 1IXSB 3K9TA 1WKMA 3HTUA 5C7TA 1IRFA 3F8MA 2NRAC 1MQEA 3BDDA 4AWXB 4LLLA 4HX4A 4S2YA 2FF4A 5E1WA 1R1VA 1OMIA 2E1NA 1FPQA 4FHTA 4NQWA 3J7Ye 1XSCA 5LGNA 1S29A 5ISYA 2BE5F 5DV5A 3DP7A 4YIIA 4AD9A 2DK5A 1HKSA 3H95A 1W7PD 1KHZA 4ZZLA 2P5VA 2WV0A 4KICA 4KTBA 3COAC 4L9TA 4BXUA 3O6BB 5E20A 2XAJA 3CJNA 3HSFA 3V7RA 1ZRDA 3NRVA 3WTYC 2CWEA 2O3FA 3R0AA 2XAFA 3SMDA 2B2KA 4GYGA 1YQAA 1T38A 3JTHA 2WTEA 4MPOA 3WE3A 3DKUA 3E5UA 4E70A 2XIGA 2NNYA 3K0LA 2JPBA 1V3FA 4LG0A 4G8XA 2OAZA 3GFJA 4RGSA 5ICEA 1X84A 1I5ZA 3PQKA 4TV7A 3K1NA 4ENKA 1R23A 5D6FA 1U8RA 1P6RA 3WGHA 5HVQC 1U2WA 4RGXA 3VB2A 4ZG0A 2Z99A 3FXRA 2AS5F 2O61A 3O6ZA 3A6VA 1HKQA 2COMA 2JSCA 4HF0A 4BHPA 3WE2A 5CFJA 2FQ3A 5J8CA 2V1DA 3RIRA 3RDIA 5GHNA 4G6DA 3WHWA 2DU9A 3P7N<