5BS6A

Apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
NYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator AraR
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription
total genus 53
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5bs6A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5bs6A01
3QP5A 4UHTA 2ESHA 4L0ZB 3RJPA 1YQAA 2IVMA 3E6DA 3H3UA 4A5MA 1DPUA 3CUQC 1Q33A 2AZWA 1PUEE 3KP5A 2G7UA 2FMYA 4P5OA 3DXJF 1SU2A 2YPRA 4IVNA 4Q48A 1ON2A 2L01A 3P6YA 3IRRA 4U0YA 1K78A 1BBYA 4YPHA 3RKXA 2DO7A 4EJOA 2IRFG 1Z7UA 2PLYA 1MZBA 2I8UA 2Z5UA 2K4JA 3V7SA 3ID9A 1DPRA 1BC7C 5GHQA 2BBYA 3O6BB 1IRGA 2XSQA 3KLNA 2A3SA 3FMRA 3L9FA 3KFWX 1FP1D 3T8TA 4N9HA 1Z9CA 3HHGA 2WWYA 3Q1PA 4LG0A 2UZKA 3DUPA 2JPBA 2DU9A 1K79A 2FEZA 4JZTA 2IT0A 3F21A 5GHJA 1B59A 1B6AA 1MJAA 3F6OA 5FSOA 5D6EA 2FMLA 3HYIA 2GXGA 2B0LA 2L54A 3KLOA 4EGYA 4KDPA 1WWXA 1LEBA 1UHMA 1XMAA 1P6RA 5A2QZ 2HYGD 2W85A 4MNUA 1S3JA 1Z6RA 3S2WA 1X83A 3X0IA 5IT3A 1FBUA 4HW0A 1YW8A 2OBPA 1PP8F 4WCGA 2E1CA 4JZSA 2VT2A 3KEOA 1NFZA 1YIOA 2V1DA 2GT4A 3FFUA 5E1XA 2VODA 4DNCA 3DFGA 4G94A 2PBIA 2KJBA 1EH8A 2E7XA 1TQMA 5LGTA 1YYVA 1BI0A 3SZPA 1ZYRF 1GXQA 1XCVA 5KVRA 5HS8A 3FZVA 3M1EA 3KP3A 4U7BA 4HVYA 2PMUA 1SJYA 5JFRA 3HTUA 3LAPA 3U1DA 3OGAA 4AD9A 1HSTA 1ODDA 2IPQX 3TOBA 5E20A 4IPAA 3WODF 1KA8A 4PZJA 1S8NA 2PG4A 1O57A 1X3UA 2EB7A 2QYOA 3WTZA 2NAZA 2YX7A 1FT9A 3IHUA 3BAPA 4I2OA 2O0YA 4RAYA 1XCBA 5GHIA 3RYPA 2O5FA 3I7VA 1T38A 4ASNA 4ON0A 1S7OA 2AXLA 1BM9A 4Z2YA 2ZFWA 4M72A 1B9NA 2DW4A 2BEOA 3Q9VA 5DEQA 3V4GA 5LGUA 3L2CA 4ENJA 3WU0A 3FSPA 3R6SA 3T0YA 1LDKB 5AIQA 3EYIA 1TBXA 3K9TA 2WC2A 4HLXA 3ML6A 2RV8A 2DT5A 1DUXC 3MAJA 4HLYA 1OW2A 2W84A 3HOTA 1U8RA 4UVBA 4MEYF 4HX4A 2QENA 3RYRA 1VC8A 4PGHA 4K2EA 1XSXA 3WTSC 1BOAA 1YLFA 1MKMA 1XD7A 1PPWA 3DKWA 4R1HA 1L3LA 3V8LA 2Y48A 1B9MA 4NFXA 1J7KA 1V8LA 5E8GA 2A5YB 2EV0A 4OIOF 5A2QK 3N4MA 4KTBA 1IN8A 3GFIA 2HKOA 3K1PA 4U0VA 5EEHA 2DQLA 4IRGA 1ZRCA 3L7WA 2QBYA 2XAQA 3F8MA 1SAXA 1C0WA 1V8VA 1LEAA 2V1UA 3RI4A 4LB6B 4YIFA 3CNGA 5ERIA 2UXNA 1MJ9A 5GHNA 1T0FA 2YU3A 5ICFA 2BGCA 4CGZA 2PQVA 2M1BA 4EGZA 2NNYA 2LDUA 2RDPA 5L3GA 2L4AA 4GYIA 4I7HA 3VEPA 4CXFA 3F6VA 3I71A 4WF2A 2OQGA 2NYXA 1R22A 3LSTA 4S2YA 1K7AA 3NEUA 4ENMA 3ZR1A 3GWYA 1OYYA 3J7AO 3E5QA 3KE2A 2XAFA 4Y15A 2IW5A 4XSZF 3DQVC 1HXDA 2FVVA 1RUOA 2Q2EA 2XRNA 3MZYA 3F8NA 4I01A 4ZH4F 2DBBA 5L3FA 2V1XA 4G9YA 4CO8A 3ECOA 2MBFA 3WHWA 3GUDA 1QO0D 2A8TA 1JE8A 4L18B 1TNTA 2P5VA 1RI7A 2OZ6A 3IWFA 1VTNC 5BQTA 5BMZA 2FA5A 4L9TA 5JVTA 3RPUA 3P9IA 1IUYA 3JSOA 4WWCA 2M45A 4A0XA 4YG2F 3GEZA 1AWCA 2YVPA 3FHZA 4ILQA 2EFQA 2FNAA 1T39A 2B0VA 1VHGA 3TOAA 5CVRA 3QPTA 4KG3A 2FBKA 2YSRA 2KRFA 4DQ2A 5C7TA 4AIKA 1U5TA 1JHHA 5TJJA 4UXNA 2KIFA 1FSHA 1Q1HA 2XAHA 1SMTA 2K86A 3EESA 1P4XA 2A6TA 2NRAC 3KCCA 1VIUA 4RGXA 2CSOA 4KIBA 2XHKA 3OV8A 2B06A 3HYQA 2ZBKA 4OMZA 5F1RA 2KJCA 5FSNA 2Y0MA 2FBHA 3JAMZ 4I02A 3X0KA 5L3EA 1CF7B 1X84A 2QKMB 3O8SA 3DKUA 3FMSA 3L85A 3I9XA 2O5WA 1LDJA 5TRDA 2O03A 2HDCA 1KU7A 1V8SA 5BOXA 1XMKA 2ZCWA 1K26A 1S7AA 5AIPA 3Q5FA 1YTYA 5ANTA 2DPDA 3H92A 2V6CA 2ICJA 1PPXA 2MH2A 2Z99A 3TO7A 3ZPLA 1I5ZA 2ZNYA 3EETA 2FRHA 4C9XA 4XLPF 2Q8KA 3ZN1A 5HS7A 4TV7A 2KDWA 3ZN0A 1ULYA 5BONA 1K78B 3MQ0A 1IN7A 1KU3A 2OA4A 1VCDA 2A69F 5D5WB 5CVUA 1R58A 1ZARA 2O3FA 2A07F 2RNJA 3I0TA 3JTHA 3G73A 4EQQA 4IRIA 1D5VA 1ZLKA 2R7DA 2M5WA 4LJZF 3WGIA 2P4WA 1IXRC 4UUVA 2H27A 3SXYA 2JT1A 4RGUA 1V3FA 4HFQA 1KYZA 3I53A 2G9WA 6PAXA 5D4RA 2NNNA 1XN7A 3WTYC 1STZA 4I0AA 3DV8A 5KK1A 4RB3C 1ZG1A 3FM5A 5J8FA 2FF4A 4O6JA 4KA4A 1QZYA 5CVJA 2A8RA 2YVOA 3O69A 1QNTA 2R7FA 4Y17A 1QBJA 3T5XA 3R4KA 1R7JA 3COUA 2P6SA 3R60A 2GIVA 3NRVA 2CG4A 1HW1A 1O7FA 5DYMA 3G0QA 1R1UA 3N77A 1WKMA 2DSDA 1GVJA 2VBWA 2BYVE 1FWZA 1HZTA 4FX4A 3HRSA 5LBQA 5ICEA 4WXDA 4M6YA 3FM3A 1FPQA 1G3YA 1R00A 4KUMA 1HX3A 3P7NA 4JZUA 2PNYA 4ESJA 1XGNA 5DPKA 4ZYDA 4YFXF 2GA1A 2QJTA 4MEXF 3O52A 4NFWA 1SZ3A 1O3QA 4QLCU 4HYEA 1HBXG 3JAMK 5FD6A 2YVMA 1QGPA 1XSVA 3KP4A 2OQRA 1SD5A 4M74A 1ON1A 4HAMA 3K0LA 3SONA 2O61A 1G9QA 1LVAA 5BS6A 1BJAA 3RH7A 5CFJA 4HF1A 1R5HA 2HEOA 3QU6A 3ULQB 3NQOA 4CYDA 2CQKA 3U9GA 4A2UA 1IXCA 3V8JA 5ISYA 5FB2A 4HV5A 1MP2A 1UCRA 1ZRFA 2EA2A 1DP7P 2B2KA 4JBAA 1JRKA 1BI1A 1G4DA 1HKTA 4ESBA 5D5XB 4KICA 2ZKZA 4KYWA 2XROA 4U88A 3WU1B 4IJXA 3HSEA 3KZZA 1KT9A 1OYWA 3IRQA 4IRHA 2M30A 1YS7A 1YW9A 1V8UA 3GXOA 1W5TA 3QOPA 3JW4A 3W6KB 5HVQC 5FSLA 3ZMZA 2VXZA 3ISPA 4A5NA 3RKWA 5K5RA 4RAZA 4ETSA 1TNSA 1RIOH 1KYWA 2R3SA 4HOBA 1QZZA 1T6SA 5H6QA 1TQPA 5AONA 1H0MA 3GYHX 4M71A 2FKBA 2EK5A 1BI2A 3MDIA 3EDPA 2QBYB 3P9CA 5DD8A 1VK6A 2OU2A 4LB5A 2P8TA 5DV5A 4EMSA 3HSRA 1RRQA 1VHZA 3GRNA 4MTEA 4UV9A 3WTVC 2Q9PA 4H0EA 3W6JB 2O6GE 3E97A 2CWEA 2XV4S 1FBSA 4DYWA 3F3XA 2X0LA 3VFZA 1TUMA 1RUNA 1SD6A 5HZXA 4XRFA 1ZH5A 2STTA 2QLZA 1XSAA 3WG9A 4Q5SF 5D8LB 1PPVA 4WK8F 1W7PA 4YFKF 3C7JA 3ZMTA 3BPVA 2M8EA 4RS8A 2G73A 2VE8A 2EFWA 1VC9A 2ISZA 2PQ8A 5E1WA 3CUQA 5C8LA 3KEQA 1I1GA 1G0SA 1YS6A 2P5KA 4CZZA 2EFOA 1IAWA 3LAJA 2YVNA 1V8TA 5HS9A 2H6BA 1H9TA 2W57A 1IN4A 1TW2A 3X0RA 3AC9A 3FXUA 4A0ZA 5DCMA 1P4WA 2A8SA 1O7LA 1IN5A 2O8XA 1E17A 5L3CA 3GVAA 5D6FA 2ZO4A 4N1TA 2OZUA 3TO6A 3F13A 5FSKA 3KP6A 1Q54A 2RQPA 2XIGA 4HBLA 3O61A 1WRJA 1PUQA 4IJAA 1J75A 2DQRA 3BY6A 2GWRA 2OAZA 2A61A 1OPCA 5LEKA 3SHDA 5CLSA 3RTRA 1IZ1A 2QVOA 1LQ1A 2GXBA 3F6AA 3I59A 4ENKA 2A6EF 2K02A 4WXHA 2M87A 1Q27A 1RNLA 3V8KA 4CICA 5LLQA 1O3SA 1J9IA 3WGGA 3ROUA 5FGMA 1UFMA 4KMFA 4YPRA 3DF8A 1ZGJA 1U5TB 1ZAOA 2HR3A 4N9IA 1D8JA 2HTJA 5BPIA 5FD5A 4A6EA 3EEUA 3QU3A 1YFHA 2K7LA 5FFZA 2F5CA 3FF5A 4KYXA 4UNOA 1TTYA 1SFUA 3QSJA 3FWEA 3RIRA 5FLXK 3GLXA 1U3EM 3MEXA 2F2EA 4OIRF 3JSPA 1KQ0A 1OR7A 4IXAA 3TDUC 2VC0A 2K27A 4OMYA 4A6DA 1NQYA 3DPTA 3E5UA 1IN6A 2W25A 1GA7A 1JGSA 4L0YB 3EQLF 4P9UA 2QUFA 3O3KA 5CVVA 4KMUX 3MDGA 2VC1A 3V7RA 4N1UA 3GZ6A 5LEJA 1F3YA 3E6MA 5ANUA 1NQZA 1FX7A 2XAGA 5HOOA 1JXSA 1BIBA 2P6TA 3FMQA 4ZZDA 2I8TA 3BJOA 1EV7A 3SQNA 1W4MA 3T8RA 4HF0A 4P96A 4L9JA 3X0NA 1Z6TA 1TW3A 2A6HF 1CGPA 5D5VB 1YO5C 3LA7A 5ILSA 2LNBA 3X0LA 4EM1A 2ESNA 3P5TA 3GW2A 1J2XA 4LFUA 2VNQA 4P55A 2AS5F 3RKYA 3I7UA 5HDNA 3F72A 4C9WA 3X0SA 2GT2A 3N9UA 3C3WA 5IT9Z 1OKRA 1XDSA 3K2ZA 4HX7A 3KP7A 1XSDA 4B09A 5F6FA 5J6XA 1JHFA 1SFEA 2RN7A 4ZYEA 2P7VB 2FQ3A 3MZHA 1BC8C 4F7ZA 3J7Ye 3R61A 2DSBA 4B8XA 4RB1A 3BWGA 2YR2A 3EXQA 5CYVA 1IRYA 3ZMVA 1ZG5A 2IA2A 3X0OA 4YOQA 3BPXA 4MQ9F 5GHMA 3LQRA 5K5OA 5DUKA 5LHIA 5HLHA 3Q4IA 3F8BA 1HW5A 5HLGA 3QPHA 2LF8A 4ESFA 2I6KA 1YG2A 4LK0F 5BPDA 4EJTA 2DPUA 2V9VA 2DSCA 3Q2SA 1J5YA 1HKQA 4ZZLA 5ILUA 4PDKA 4BXUA 3DPLC 2D1HA 2QJOA 1QVJA 3LQQA 1XGOA 4HF2A 4AIJA 4AVPA 2STWA 3EYYA 3J80K 2V79A 4UVCA 2A8PA 4RB0A 1R36A 1BIAA 5E1ZB 1PDNC 2MD5A 4L5IA 1O3TA 3LWFA 4L9NA 4IHSA 4RGRA 3WE2A 1Z1DA 3QP6A 2W24A 3Q91A 1G3TA 4EM2A 2PMHA 4KFCA 2ZMEA 5H6RA 5D5UB 5H20A 5DUIA 5IW4A 4KN7X 3ZQ7A 3U2RA 5FO5A 5FSIA 3RPQA 3A6SA 5DCFA 1P2FA 4U7DA 4XLNF 3O2PE 2VE9A 1EH6A 1OYIA 2PI0A 1T98A 5LPGA 1QQIA 5F64A 3L09A 4LG0B 3HOSA 4JQFA 1AOYA 3T1BA 5CVIA 2CGPA 1VIQA 2GQQA 5DD4A 4LK1F 2VBXA 3GWZA 5LHGA 4LD5A 4AWXB 2RVCA 4OOIA 3GFMA 1O3RA 1ZGAA 3OOPA 1KQ9A 1PVFA 1K2EA 3E6BA 3I58A 4Q4ZF 1REPC 2ETHA 3RDIA 2G7HA 2Q0OA 3ELKA 2HWVA 1JKNA 2WV0A 2QQ9A 3LFKA 4S2WA 2ZJ2A 5E8IA 4V14A 4G6QA 1KU9A 5E17F 3BZ6A 3QRFF 3CDHA 2QQBA 3F22A 4UV8A 1V8YA 1UHWA 1SMYF 4I0BA 4LMYA 3DEUA 2D45A 5IT9K 1MDMA 3IKTA 2FU4A 4ZYGA 2FXAA 4M6XA 1FP2A 1FYKA 3F8FA 4ICKA 2FOKA 1V8IA 4O3MA 2GAUA 3ACAA 1H9GA 1U6GA 3BP8A 3A6TA 4A12A 3CTAA 1P4AA 3GZ5A 1WI9A 4LLGF 2DUKA 1FC3A 2FSWA 3MCFA 4G7OF 3HUGA 1F5TA 3BROA 2ACJA 5LHHA 5HDKA 2CO5A 4KIGA 3N97A 1HQCA 1DDNA 4WXCA 3JTGA 3M9AA 1EH7A 1TQIA 5LRSA 4I98B 1KGSA 3PQJA 1NHAA 1ONVA 3WTTC 4OIQF 2NS0A 1R67A 3FCMA 1XB4A 4HQMA 1I9AA 1MR2A 4K6EA 2O1CA 1W7PB 2EJRA 3TGNA 3GFJA 1V4RA 3ABUA 3D0SA 2QM3A 5HLIA 3WGHA 5D4SA 3CUQB 1F9NA 4MPOA 1XGSA 5ICCA 4IF4A 1U78A 2HS5A 3X0MA 2WTEA 4EVIA 2ICKA 1FOKA 2FNPA 3F23A 2GZWA 4LLNA 2HOEA 3M8FA 4L5JA 1RYAA 1R5GA 3D5LA 5DCMB 1KTGA 4FX0A 3LA2A 1L0OC 4NQWA 4KNYA 3HIFA 3DP7A 5JR3A 1KU2A 2PN6A 4WX9A 2F5DA 3FXRA 3ZMSA 2RKHA 4G7HF 1K6OA 4OIPF 2DTRA 1V8WA 4OU0A 4XSXF 2A8QA 2QQAA 2DK8A 1MUTA 2KIMA 1IXSB 2VNPA 1GXPA 2HFHA 3ZP5A 1Z05A 2L3DA 2FBIA 1G6NA 5FLXZ 1LNWA 2HGCA 2MC3A 3BM4A 3KP2A 4GCVA 5DDGA 1WSUA 1HKSA 5IW5A 3I59B 3PQKA 2JSCA 1FY7A 3O6ZA 3A6UA 2YX4A 1LJ9A 3SZTA 2P5LC 2BV6A 2HQNA 1F4KA 1KHZA 4P9FA 4LGWA 3EF5A 4YFNF 2ZNZA 3X0JA 1D8KA 1S6LA 3U53A 4YIIA 2MA3A 3A6VA 4M9ZA 2FE3A 3EUHA 3CJNA 3KETA 3Q9SA 1LDDA 2HTSA 2BE5F 3P9KA 3QAHA 4I09A 5JHUA 1U20A 2XASA 2QZ8A 2JVBA 2H09A 1Z91A 2VBZA 4HZFA 2EFNA 2MLGA 2ELHA 3X0QA 1B4AA 1IF1A 3Q93A 5ED4A 3ZMDA 1LB2A 3CLOA 2A68F 2DI3A 4L9VA 4NB5A 4MQVA 4BQAA 2OD5A 4MHGA 3VODA 2DAOA 2ZXJA 3WTWC 2VOOA 4S04A 4FT8A 4G6DA 2H94A 2PEXA 3SFZA 5ANSA 4RGSA 2JPCA 4FHTA 3MFKA 1ZHFA 3ABTA 1U5TC 2KDVA 2IP2A 2F5FA 4R79A 3G3ZA 5FSMA 2L4MA 2E7WA 1ZRDA 1VRLA 1W7PD 4EM0B 3TQNA 4IHTA 1XSBA 2Y75A 4HDVA 4GYGA 4S05A 3ECHA 4BAYA 3WTUC 1U2WA 2HZTA 2D2WA 4ENNA 5FFXA 3R0JA 4HDUA 4M73A 3K1MA 2XAJA 3MWMA 4JK1X 2HKXA 3GG6A 5LGNA 4MTDA 3BJAA 2HQRA 3V7CA 2VBYA 2W4EA 2IJLA 4M9XA 2H6CA 1IW7F 2RGVA 3C1DA 5CJ9A 1X51A 2EA4A 3WE3A 4HV6A 4BH9A 2CL3A 1J0RA 3FX3A 2KIUA 1MQEA 1S29A 2DFIA 1OMIA 3MCZA 4S2VA 2UXXA 5LRRA 3GX4X 4HQEA 4G8XA 3BOQA 1SOIA 2EWNA 1QPMA 4EJUA 1MD0A 3J80Z 3ZR0A 3R0AA 1FYLA 1V8RA 4UVAA 1ZREA 2JTVA 3X0PA 1P92A 5D8KB 1V8NA 1YW7A 2LSOA 3FXQA 1SD7A 2XVCA 1T2KA 4EJWA 4RB2C 1HSJA 4PGGA 1MJBA 1XDUA 3MGMA 4S2XA 5HDGA 4R8HA 5EEGA 2DHOA 2Z9OA 4OINF 3HRMA 5ICGA 3GO5A 1J59A 1F1ZA 2IA0A 3I4PA 2VT3A 4BHCA 4HA8A 3CUOA 3HTSB 3E5XA 4Q47A 3COAC 3IWZA 4KG4A 1FSEA 3ERED 2VOPA 4CHUA 4BHBA 2JRTA 2XKOA 2P7CB 1SD4A 5K5QA 1R1VA 4EV0A 3CO6C 2PJPA 2YYHA 3SMDA 2LF7A 5I8UA 1ZG3A 1V8MA 2G74A 4D0PA 3KVHA 5C7QA 3E6CC 2ZMEB 2EFPA 4G7ZF 1FYMA 1E2XA 2X4HA 4A0YA 3IKVA 1BI3A 3VOEA 2EV6A 2GA2A 2C6YA 2L02A 1MK1A 4GO1A 5J8CA 4JZVA 2JZYA 2KKOA 5GHOA 1R1TA 3M7GA 3J81Z 4BYYA 3HRTA 2ISYA 2MH9A 3H95A 3E57A 4N0BA 4ZG0A 3I54A 4M9SA 3I5UA 3BDDA 1SFXA 1RRSA 3SHFA 3TDZC 3BHOA 3L00A 1FNNA 5GHPA 3TKYA 1RZ4A 1WQ2A 2J5PA 2MLKA 1FZPB 3WTXC 2J8QA 1Y0UA 3K69A 3CO7C 1KQ8A 4QWQA 1MQWA 1D3YA 2E1NA 1G3WA 1NFSA 1PUSA 1XSCA 2Z33A 3GZ8A 3B73A 3IC7A 1MDMB 3K1NA 1MGTA 4NHJA 2XGXA 1BN5A 3HRUA 3E3VA 1ZN2A 3B02A 3PFIA 2TDXA 4EJVA 2K4BA 2CW0F 2CYYA 4ZYHA 1GHCA 2DLLA 1W5SA 1G3SA 4BHPA 2Z3YA 1USTA 5CFIA 1A04A 2VONA 1TLHB 3FJYA 2ADUA 1I6XA 5JI6A 1IRFA 2RC4A 3VB2A 5E18F 5ILVA 4E70A 2COMA 2RRKA 4U0WA 1FBQA 5L3BA 4PCQA 3Q2TA 5L3DA 3HSFA 2D1VA 5ANWA 2CFXA 3LA3A 3REOA 3HHHA 3HHJA 1R23A 2R5WA 3ZMUA 1XGMA 4O5VA 3IL2A 5K1YA 1PUNA 1HW2A 4KIFA 4GXOA 3C18A 2PFBA 2GB5A 2XUBA 5ANVA 3KZYA 1I1SA 2F5EA 2DK5A 4CDGA 4GGGA 4BNCA 4KT5C 2UWMA 3AAFA 4Y13A 2XKPA 3H3ZA 4AIHA 2VN2A 4MGRA 3I64A 4HX8A 4KN4X 3F8CA 3FK9A 2QWWA 1PP7U 1ZLJA 1USSA 4LLLA 1I27A 3GF2A 3BJ6A 3TO9A 2EV5A 4XBFA 1FLIA 3J81K 1CF7A 3R03A 1B1BA 2J5OA 3M8EA 1UB9A 2IA1A 2HYFA 2LKPA 3GFLA
chains in the Genus database with same CATH superfamily
1QHHD 3QP5A 4UHTA 4ANJA 5TGTA 2JN6A 3KIOA 2ESHA 5FLMJ 2LD5A 2DFEA 4L0ZB 2LG4A 3RJPA 1YJWI 4D5CA 3FXKA 1YQAA 2IVMA 3E6DA 3H3UA 3W2WA 4A5MA 1DPUA 1VQNI 1HF0A 3CUQC 1Q33A 3IH4A 2AZWA 3SYTA 1PUEE 3KP5A 2G7UA 2FMYA 3K4KA 4P5OA 3U1KA 1OCOH 1BR2A 3HG9A 3DXJF 1O4XA 1LFUP 2XGEA 3WHBA 1TC3C 2LYCA 3IUOA 1SU2A 3CLQA 2YPRA 3S1RJ 4IVNA 4Q48A 1ON2A 2L01A 3P6YA 3IRRA 5LD2C 3VYSB 2R7WA 4U0YA 1K78A 1BBYA 4YPHA 3RKXA 2DO7A 2Y31A 4EJOA 4Y7NJ 4HG2A 3OS1A 1Z7UA 2IRFG 2PLYA 1MZBA 2I8UA 2Z5UA 2K4JA 2M7AA 2DJNA 5EEAA 2AXTC 1NG6A 2EPFA 3CP8A 3V7SA 3ID9A 2DMPA 2OCEA 2FX0A 5C4XJ 1DPRA 1BC7C 2AQEA 1X1BA 3HBLA 1ZGWA 4JP0A 5EZGA 2E1OA 3CCMI 5GHQA 2BVMA 4JX5A 2KRHA 2BBYA 3O6BB 1IRGA 4UUSA 2XSQA 3KLNA 2A3SA 3FMRA 3L9FA 3KFWX 3S2DJ 1FP1D 1K61A 3T8TA 1GT0C 2BW3A 4N9HA 1Z9CA 4NC6A 3HHGA 2Y30A 2WWYA 3Q1PA 4LG0A 2UZKA 2A5WA 3DUPA 2JPBA 2DU9A 2LP0A 1K79A 3BCAA 3W2VA 4HPQA 2E5NA 2FEZA 4JZTA 2IT0A 3DEWA 1X3WB 3F21A 5GHJA 3FISA 1B59A 3KYCB 1B6AA 1MJAA 2RAEA 3F6OA 3I9V2 5D6EA 5FSOA 2OF7A 5IY5H 2FMLA 3HYIA 2LFBA 2GXGA 1WJDA 2B0LA 2BXZA 2L54A 3KLOA 3M4OJ 4EGYA 4KDPA 1WWXA 3ZQQA 4D7MA 1LEBA 1TWFJ 1UHMA 1XMAA 2HPMA 2DOFA 2DMNA 1P6RA 5A2QZ 2HYGD 1IDZA 2W85A 4MNUA 3RZOJ 3K4NA 4XOTA 1W5CC 1S3JA 4V2GA 4NDLA 1Z21A 1Z6RA 2V7FA 1Y56A 2XB5A 3S2WA 1X83A 3X0IA 5IT3A 2NVXJ 1FBUA 2F48A 4HW0A 1YW8A 4II3A 5GPCA 2OBPA 4PFOA 4WCGA 1PP8F 1VQ5I 2E1CA 2GXAA 4XLCA 4JZSA 3EUAA 3GTKJ 1I6HJ 2KT0A 2VT2A 1P9QC 3KEOA 1Z77A 1YIOA 1NFZA 2V1DA 2GT4A 3FFUA 2VKEA 2QKLB 5E1XA 2VODA 4BU2A 4DNCA 3DFGA 2DA3A 2PBIA 3AG1H 4G94A 2KJBA 3CMAI 1EH8A 2E7XA 1TQMA 2X1DA 5LGTA 2WADA 1YYVA 1BI0A 3SZPA 1ZYRF 1GXQA 1XCVA 2LKSA 5KVRA 3FK7A 5IYCJ 1OFCX 5HS8A 3FZVA 1RR8C 3M1EA 4M3BA 3KP3A 4U7BA 3SDGA 4XL9A 2PMUA 1OR7C 4HVYA 1SJYA 5JFRA 2DN0A 3RZDJ 3HTUA 3LAPA 3U1DA 3OGAA 2V26A 2DMQA 5GADJ 4AD9A 2K5CA 1TL8A 3BTIA 4BBRJ 9ANTA 1HSTA 1ODDA 2IPQX 3TOBA 5E20A 3HPGA 4IPAA 3A0HC 3CCYA 3OYLA 3WODF 3S3OA 1KA8A 3CQZJ 3BC8A 4PZJA 1S5LC 1S8NA 2PG4A 1O57A 1X3UA 2EB7A 2QYOA 2NS8A 3WTZA 2NAZA 2YX7A 1FT9A 4E7KA 3IHUA 5FKOA 3BAPA 4I2OA 4XICA 3A0BC 5FKNA 2L7ZA 2LREA 2O0YA 1Z0XA 1UZCA 4IOAF 4RAYA 1WZ2A 1XCBA 5GHIA 3RYPA 5KCMA 2O5FA 3I7VA 1T38A 2KMUA 4ASNA 4ON0A 3CCJI 1S7OA 2AXLA 5F1JA 3BCBA 2WA0A 1BM9A 4Z2YA 3G2BA 4NUBA 2ZFWA 3BG3A 4M72A 5KNLA 1B9NA 2DW4A 5F0CA 2BEOA 2K40A 3Q9VA 3C2BA 3A02A 5DEQA 4CA0A 1SVMA 3V4GA 5LGUA 3L2CA 4W1UA 4ENJA 3WU0A 3FSPA 2CV0A 2Y9ZA 3VPRA 5IOYA 3R6SA 3T0YA 1LDKB 3PL8A 1AHDP 3OYMA 5AIQA 3EYIA 3S16J 1TBXA 3K9TA 2RREA 1UG2A 2PJRB 2WC2A 4HLXA 1POGA 2L9VA 2CFOA 1X4PA 3ML6A 4XONA 2RV8A 3LSHA 2DT5A 4PUSA 1B8IA 4HEA2 1DUXC 3MAJA 4HLYA 2OTJI 1OW2A 4H4KC 1TWGJ 1R6RA 5FKMA 3P5JA 2W84A 3G1MA 2QSHX 3HOTA 1U8RA 4UVBA 4MEYF 1WJ5A 3I55I 3NWTA 4HX4A 3S93A 2QENA 3RYRA 5HODA 1VC8A 4PGHA 3MZ8A 4K2EA 1XSXA 3WTSC 1BOAA 1YLFA 1MKMA 4ZYAA 2LC2A 3MMYB 4KJZA 1Z7LA 3OYFA 3QPSA 3QOEA 1XD7A 2JSPA 4JYKA 1PPWA 3DKWA 4R1HA 1ENHA 1L3LA 2M2EA 5B5EC 3V8LA 5M5XJ 4X0GA 2Y48A 2QGUA 1B9MA 3CDLA 4NFXA 2NVTJ 1J7KA 4IHXA 1V8LA 5E8GA 2A5YB 1Y1WJ 2EV0A 1K4TA 4OIOF 3WHCA 3FIWA 5A2QK 3N4MA 4KTBA 1IN8A 3GFIA 2BY3A 2HKOA 2GOMA 3K1PA 4U0VA 3B6AA 5EEHA 1SC7A 2DQLA 4IRGA 3BG9A 1ZRCA 3L7WA 2QBYA 2EZKA 1XG1A 4RLQA 2XAQA 2FQ4A 3F8MA 5TISC 1SAXA 1D0XA 1C0WA 1V8VA 1LEAA 2V1UA 2LOOA 1IO2A 3ABLH 4C9YA 3RI4A 3OL4A 4LB6B 3ZOBA 4PSXA 4YIFA 3CNGA 1UELB 5J3LA 5ERIA 2UXNA 1MJ9A 2YU9J 5GHNA 1T0FA 1WJCA 2YU3A 2X1CA 5ICFA 3CCRI 2BGCA 1JGGA 3OYNA 4CGZA 2PQVA 1HDPA 1OISA 2M1BA 4EGZA 5JLXA 2UV1A 1QZEA 2NNYA 2WY8Q 2LDUA 3OS2A 2RDPA 2L4AA 5L3GA 4GYIA 2EINH 4UB6C 4I7HA 3VEPA 2JUGA 4CXFA 4XN3A 3F6VA 3I71A 4WF2A 1Z3YA 1ETQA 3F9KA 2OQGA 2NYXA 1SFKA 3G1OA 2ZMEC 1D0YA 4M6VA 1KZHA 1R22A 3LSTA 4S2YA 1MMNA 1K7AA 1UJ8A 3BT9A 3NEUA 3K4JA 4BE2A 4ENMA 2EQRA 3TP3A 1I3AA 4X6AJ 3ZR1A 2WB1A 4HNVA 3GWYA 1OYYA 4AUXA 3J7AO 3E5QA 3KE2A 2XAFA 1SAUA 3JRIA 3QODA 4Y15A 2IW5A 5K7HA 5IP6A 1MMDA 4XSZF 5EZHA 4F52A 3DQVC 4IX7A 1B72B 1HXDA 2F5VA 1EJ9A 4BJ6C 1ZK8A 3TP0A 2FVVA 1RUOA 2Q2EA 3JREA 2JRMA 2MFZA 2XRNA 3MZYA 2IGMA 4CCLA 5EGOB 3F8NA 4I01A 4ZH4F 2BHZA 2DBBA 1RETA 5L3FA 3VWBA 4V19K 3LMMA 1X19A 2CUJA 2V1XA 4G9YA 4CO8A 3CDIA 2NOGA 4RAGA 4CH7A 3JCUC 3ECOA 5GAGJ 3KYDB 2MBFA 2VIXA 1D5YA 3WHWA 1K6YA 3GUDA 1QO0D 2A8TA 3HOUJ 2HDWA 4E7LA 4B48A 1JE8A 4CCKA 4L18B 1TNTA 3KZIC 2P5VA 2CS3A 1YX3A 1VQ7I 1X3ZB 5IPAA 1RI7A 2OZ6A 3DPUA 2DMTA 3IWFA 4JX4A 1VTNC 1ITYA 1D0ZA 5FLVA 5BQTA 5BMZA 2FA5A 4L9TA 1IUFA 2JVGA 5JVTA 3A4CA 3P9IA 3RPUA 1IUYA 3JSOA 4WWCA 2CUEA 2JWTA 2M45A 4A0XA 4YG2F 3S3MA 3GEZA 1AWCA 4HNTA 3FHZA 2YVPA 4ILQA 1G59A 2EFQA 2FNAA 1T39A 3FXOA 2B0VA 1VHGA 3TOAA 2MG4A 5BNGA 5CVRA 3QPTA 4KG3A 3K2AA 5GAEJ 2O5RA 3DLAA 2FBKA 3BR6A 1MMSA 2YSRA 2KRFA 4XKCA 5CQGA 1UG0A 4DQ2A 5C4JJ 5C7TA 4AIKA 3OYGA 1U5TA 1JHHA 2EBIA 5TJJA 1RESA 4NNJA 5F04A 1BW6A 3JRDA 4UXNA 5DTDA 1HOMA 2KIFA 1FSHA 1Q1HA 2XAHA 5J47A 1SMTA 2K86A 3EESA 1P4XA 2A6TA 4AM3A 1HA8A 1QPIA 2NRAC 4N4OB 3KCCA 3ZQHA 1VIUA 2DFHA 1QVTA 3MKYB 3PNTA 4RGXA 2CSOA 2R5ZA 4KIBA 2ME6A 2XHKA 3OV8A 5J1RA 2B06A 2HU9A 3PUBA 3HYQA 3E7LA 5JHFA 3S17J 2ZBKA 3RQIA 4OMZA 5F1RA 4A3DJ 2KJCA 5FSNA 5CKTA 1ETWA 2Y0MA 4AC0A 1E3HA 2PX9A 4BGDA 2FBHA 3JAMZ 4I02A 3GTLJ 3X0KA 5L3EA 1CF7B 3GTJJ 1X84A 2GLOA 4M3GA 2FUG2 2QKMB 3H1CA 4E7JA 3O8SA 3G6EI 4E6KG 2M4GA 3DKUA 2MGQA 2M3AA 3FMSA 3L85A 3K6GA 2M7BA 3I9XA 2O5WA 1LDJA 2BY1A 5TRDA 2VXDA 2O03A 2M8GX 2HDCA 3JRBA 1KU7A 1V8SA 1OLTA 4IZZA 1XMKA 5BOXA 2ZCWA 3ZGKA 1HC8A 1K26A 3OSFA 1S7AA 2ZC2A 1OCRH 5AIPA 3Q5FA 3U21A 1YTYA 1RRJA 5ANTA 3IAM2 3HUGB 2DPDA 3H92A 3O8GA 1LUJB 4A3EJ 2V6CA 1BR1A 2ICJA 2X48A 2MH2A 2Z99A 1PPXA 2V6EA 3TO7A 4KT6A 3ZPLA 1I5ZA 2ZNYA 3EETA 2FRHA 3HKZA 1YIJI 4C9XA 3MVPA 4XLPF 4CYCA 2Q8KA 4A3IJ 3ZN1A 5HS7A 2WAQN 4XRMA 2XPVA 4TV7A 2KDWA 3ZN0A 1ULYA 5BONA 4U87A 1K78B 1V5FA 3HL2A 1QVUA 3BG6A 1IN7A 1BJZA 3MQ0A 1QU3A 1RR7A 3HKZN 5M5WJ 1KU3A 2OA4A 1BW5A 2A69F 5D5WB 1VCDA 2E1MC 5CVUA 1VQLI 1EF4A 1R58A 1ZARA 2O3FA 2A07F 3S2HJ 2RNJA 3GTQJ 1YITI 1CQTA 2LRDA 3I0TA 3JTHA 3G73A 4EQQA 2EIJH 4IRIA 1D5VA 3LSIA 2ZB9A 1ZLKA 4F92B 2R7DA 4C2MJ 2M5WA 1JUSA 4LJZF 4IO9F 3WGIA 4UUSB 2P4WA 4A3LJ 3FHNA 3RSNA 3I3LA 1IXRC 1VQKI 2H27A 3FXJA 4UUVA 2X6XA 3SXYA 2JT1A 4RGUA 2BW3B 3JR9A 1UHSA 1V3FA 1K4SA 4HFQA 1KYZA 3I53A 3L2VA 2G9WA 2KP6A 2DCEA 6PAXA 1JKRC 5D4RA 1ETVA 2NNNA 4IQ4A 1XN7A 3WTYC 1STZA 4I0AA 3SEZA 4UB8C 3DV8A 4HSRA 5KK1A 4RB3C 3PJRA 2IXSA 1ZG1A 2WAFA 2ZXIA 2B7EA 3FM5A 3NAUA 5J8FA 2FF4A 4O6JA 5M3MJ 4A3KJ 2X6YA 4KA4A 1ETOA 1QZYA 4DYCA 5CVJA 2A8RA 2VQGA 1VQ6I 4NQWB 2YVOA 1QNTA 3O69A 2LVSA 4Y33A 2R7FA 4Y3OA 2Y69H 4Y17A 1QBJA 1VQ8I 1JTXA 1UAAA 3T5XA 3R4KA 1R7JA 2BOLA 1LE8A 4YEJA 2JJ7A 5JVGF 3COUA 2P6SA 3O8HA 3AG2H 4DYQA 2W7NA 3R60A 2GIVA 3MD2A 4IL6C 3WU2C 3NRVA 2CG4A 1HW1A 1O7FA 2KZVA 1MBGA 5DYMA 3G0QA 3Q0VA 1R1UA 1S72I 3EUHC 3N77A 1T8IA 1SANA 5J1YA 4XMYA 3ABMH 1WKMA 4MFDA 2DSDA 1GVJA 1U9OA 3OOUA 3VYUB 2VBWA 3S3NA 2BYVE 1FWZA 1HZTA 4FX4A 3HRSA 5LBQA 5ICEA 4WXDA 4M6YA 4RAFA 3FM3A 1BA5A 1FPQA 4ZJZA 1G3YA 1R00A 4KUMA 1OCPA 1HX3A 2XSJC 3P7NA 1WHUA 4JZUA 1G2HA 3L2WA 2PNYA 4ESJA 3K4CA 1XGNA 2X1EA 5DPKA 2IS2A 3HOWJ 4ZYDA 2WAEA 3IH3A 4YFXF 1IRZA 3MKZA 2GA1A 3LSJA 2QJTA 2XRLA 2MC4A 2DXIA 4MEXF 3O52A 4NFWA 1SZ3A 1O3QA 4QLCU 1PUFA 4HYEA 4HNUA 1HBXG 2CV1A 3D5SC 3PNYA 3JAMK 3JRGA 3ZQIA 2R7VA 5FD6A 2YVMA 3CD6I 4LG3A 1QGPA 4ZC3A 1XSVA 3KP4A 4G6TB 2OQRA 3BG7A 1SD5A 4M74A 1ON1A 4HAMA 3K0LA 3SONA 2R5YA 2O61A 1G9QA 1LVAA 1ZELA 1T95A 5H2FC 1Y8QB 5BS6A 1BJAA 5GTIC 3RH7A 5CFJA 4HF1A 4OAYA 1R5HA 2HEOA 3QU6A 3ULQB 3VYRB 2W1OA 3NQOA 4CYDA 1N78A 2LMDA 2KIQA 2CQKA 3U9GA 4ZTJA 4A2UA 1IXCA 3V8JA 5ISYA 5FB2A 4HV5A 3GCMA 2LR8A 1MP2A 2L9RA 5E79C 1UCRA 4BY7J 2EA2A 1ZRFA 2HOTA 1EA3A 4XKVA 2HVRA 5KAFC 2DYRH 1DP7P 4N4NB 4JBAA 3Q3SA 2B2KA 2XF7A 1JRKA 1BI1A 1GLNA 1R4NB 1G4DA 1N25A 3CCSI 1HKTA 3ZRGA 2QQ8A 4ESBA 3LSPA 5D5XB 4KICA 2ZKZA 3H5AA 2KISA 1IJWC 4KYWA 2KZGA 3HGGA 2XROA 3Q0UA 1B8IB 4U88A 3WU1B 4IJXA 2VJIA 2CH0A 2XPUA 2R7ZJ 3HSEA 2HXOA 3KZZA 1X1CA 1KT9A 1OYWA 3SFIA 3IRQA 3QPLA 4IRHA 2XF6A 4D1QA 4CSWA 2M30A 1YS7A 4PK4A 1YW9A 2JQ7A 2E5ZA 3GXOA 3CCVI 1V8UA 4DOZA 2DOAA 2RQQA 1RPWA 1W5TA 3QOPA 3L2UA 3JW4A 4I76A 3W6KB 2E71A 2QA4I 5HVQC 5FSLA 3ZMZA 2VXZA 1XC5A 3ISPA 4A5NA 2KPMA 3D1NI 1F43A 1FEXA 4P1WA 3RKWA 2IEKA 5K5RA 1JJ6C 1JKQC 1IV6A 4RAZA 4A93J 4ETSA 1I3QJ 2N8GA 1TNSA 4C3IJ 1RIOH 4XLAA 1ZQ3P 3AKZA 1KYWA 2R3SA 4HOBA 1QZZA 4XLHA 1T6SA 5H6QA 1TQPA 5AONA 1H0MA 3GYHX 2DA1A 4M71A 2FKBA 2EK5A 1BI2A 3MDIA 1XPXA 4BBSJ 1OJLA 2KL4A 3EDPA 2QBYB 3P9CA 1I50J 5DD8A 5EDNA 2HZDA 1VK6A 2OU2A 4LB5A 1VI0A 2EH3A 2RNGA 4UY8I 3CMMA 2P8TA 5DV5A 4EMSA 4A3JJ 2GIZA 3HSRA 1RRQA 1VHZA 4CCNA 3SEQA 2H1KA 3TMOA 3GRNA 4MTEA 2K9SA 4UV9A 3WTVC 2Q9PA 4H0EA 1QRYA 4YELA 3W6JB 3GZNB 2O6GE 3E97A 2CWEA 2DFFA 2XV4S 3LOCA 3CC4I 1FBSA 4DYWA 3F3XA 2X0LA 3VFZA 1TUMA 1RUNA 1SD6A 4XLEA 2K9QA 5HZXA 4GFBA 4XRFA 3AL0B 1ZH5A 5EJCA 2STTA 2QLZA 1XSAA 3H35A 3WG9A 2KFDA 4Q5SF 5D8LB 1PPVA 4WK8F 1W7PA 4YFKF 3C2HA 3C7JA 3ZMTA 2MABA 3BPVA 4FTHA 2M8EA 4RS8A 1APLC 2EILH 2G73A 2VE8A 2MD0A 2EFWA 5FRMA 1SVLA 1VC9A 4Y52J 2DDAA 3ZXSA 3H9QA 2ISZA 2PQ8A 3CJRB 5E1WA 2GOXB 3CUQA 5C8LA 3BTJA 3M1CA 2M4KA 1I1GA 3KEQA 4IQJA 1V55H 4BS9A 2WBMA 1YS6A 2P5KA 1G0SA 1JI8A 4MFEA 4CZZA 2EFOA 5IYBJ 1IAWA 3HZJA 3LAJA 3PM1A 2KRCA 3DTIA 5IP7J 4OWRB 2YVNA 1V8TA 5HS9A 2H6BA 1RKWA 2BXYA 1H9TA 1PVEA 2W57A 1IN4A 1TW2A 3BTCA 4C3HJ 4RBOA 3CZ6A 3AC9A 3X0RA 1YRNA 3FXUA 4UUTA 4A0ZA 5DCMA 1P4WA 4W97A 2A8SA 1O7LA 1IN5A 2Q2EB 2O8XA 3A2KA 3L1PA 1E17A 3TL4X 5L3CA 2OCCH 1MIJA 3RCOA 4PJLA 3GVAA 5D6FA 3FKIJ 2ZO4A 3K70D 3FXLA 3GTGJ 4N1TA 2PMZA 2OZUA 3TO6A 3F13A 5FSKA 4C2UA 1FJLA 3CC7I 3KP6A 1Q54A 2QSFX 2YUSA 2RQPA 2XIGA 1MH3A 4HBLA 4PJMA 3O61A 4E4HA 1BL0A 1WRJA 1QA6A 3QYFA 3J7YJ 1X58A 1DQUA 3LSGA 1PUQA 4IJAA 1J75A 3AG4H 2DQRA 3BY6A 4QIWN 2PMZN 1W1WE 1F36A 1Y0NA 3DTKA 4CCOA 2GWRA 2OAZA 3L2QA 2A61A 2E34A 4PJ0C 1VQOI 4J00A 1OPCA 5LEKA 3SHDA 5IYDJ 5CLSA 2DT7B 3LSKA 1YHQI 4F91B 2JA8J 3RTRA 1MW7A 1IZ1A 2QVOA 1LQ1A 2CW8A 2GXBA 4JX6A 2XF5A 2MW8A 1D1AA 3PSIA 3F6AA 3I59A 4ENKA 1MBJA 2A6EF 5B66C 4ZTFA 1AA7A 1FMVA 1TZLA 2K02A 1HLVA 4WXHA 1H8AC 2M87A 1Q27A 1RNLA 3V8KA 4CICA 5LLQA 1O3SA 1FOWA 3DKYA 1J9IA 3WGGA 3ROUA 5FGMA 3TEDA 1KONA 4MO7A 1UFMA 4E7IA 2QSGX 4KMFA 4YPRA 1Y8RB 3DF8A 1ZGJA 2DA4A 1U5TB 1ZAOA 2HR3A 3ZQCA 4BXXJ 2XDVA 4N9IA 3IV5A 2HNHA 1D8JA 2HTJA 1I39A 2HQAA 5BPIA 1A6QA 5FD5A 4A6EA 3EEUA 2B63J 3QU3A 1YFHA 2K7LA 3N05A 4M3DA 5FFZA 2F5CA 3FF5A 1ORKA 4KYXA 4UNOA 1TTYA 1SFUA 3QSJA 2R5ZB 3FWEA 4AU7A 4B3AA 3HOVJ 2VJ4A 5JLWA 1FTZA 4XNFA 2R7UA 5HNHA 1TP4A 3RIRA 4DBRA 5FLXK 1OCZH 3GLXA 4RM3A 3TBIA 3HEFA 1U3EM 3MEXA 2F2EA 4OIRF 3JSPA 1KQ0A 1OR7A 4B4CA 2HQ5A 4IXAA 4I99C 2DA7A 3MN2A 3TDUC 2VC0A 2K27A 1FOYA 4OMYA 1W0TA 4A6DA 1NQYA 3DPTA 3E5UA 2PJRA 1IN6A 2W25A 1GA7A 1JGSA 5M3FJ 4L0YB 1S9HA 3EQLF 1X1PA 4P9UA 2QUFA 4RM2A 3O3KA 5CVVA 3IP4B 3HDDA 4KMUX 5CQEA 1A31A 3AG3H 2G0EA 4C2TA 3MDGA 4AVZA 2VC1A 2R4GA 3V7RA 4N1UA 1X4OA 3GZ6A 5LEJA 1F3YA 4ZDLA 2NVYJ 3E6MA 3OWTA 1AKHA 3OYKA 3K10A 4S0HB 5ANUA 2JA7J 1XTAA 1JUPA 3ZQGA 1NQZA 1HDDC 1FX7A 2Q1ZB 2XAGA 5HOOA 3UR3C 2VUMJ 2JK3A 1VF9A 1JXSA 4YIRX 1BIBA 2P6TA 4M3FA 3FMQA 1ACIA 4ZZDA 3OYCA 3BJOA 1EV7A 2I8TA 3SQNA 3DU6A 1W4MA 3T8RA 2GBYA 4HF0A 4P96A 4PSWA 4L9JA 3X0NA 1Z6TA 1TW3A 1VFCA 2A6HF 1CGPA 2DOEA 5D5VB 1YO5C 3K4BA 4KISA 3HB9A 3LA7A 5ILSA 3OSGA 2OC6A 3LSMA 4NC7A 2LNBA 3X0LA 4EM1A 4C30A 2VQCA 4D9JA 3OIOA 1MBEA 2CW7A 2ESNA 3QQAA 4GDFA 3P5TA 3GW2A 3HM5A 1J2XA 4LFUA 2VNQA 2LKXA 1V5GA 2VQLA 4P55A 2AS5F 3RKYA 3I7UA 4DGWB 5HDNA 1ZR2A 3F72A 4C9WA 2HXIA 4E7HA 3X0SA 2VASA 2GT2A 3N9UA 3DKXA 3UKGA 3C3WA 5IT9Z 1OKRA 1XDSA 3K2ZA 1A35A 3QYBA 3FBNB 4HX7A 3KP7A 1XSDA 1P7JA 4B09A 1LFBA 5F6FA 5HLTA 3OYBA 5J6XA 3SZGA 1JHFA 1SFEA 2CRGA 2ID3A 3GTOJ 2RN7A 4ZYEA 2P7VB 2FQ3A 3MZHA 3J7AY 1BC8C 4XM3A 3W3CA 2XB0X 4F7ZA 3J7Ye 3R61A 2DSBA 1VZ0A 1WGXA 3CJQB 4B8XA 4RB1A 3BWGA 2CUFA 2YR2A 3EXQA 5CYVA 1IRYA 3ZMVA 1ZG5A 4RA2A 2HDDA 2IA2A 2V1NA 3X0OA 4YOQA 3BPXA 4MQ9F 5GHMA 3LQRA 5K5OA 5DUKA 5LHIA 1MH4A 5HLHA 3Q4IA 3CMEI 3F8BA 1HW5A 3RPUD 4D5FA 3DWLE 5E3LA 1UMQA 5HLGA 3JRAA 3QPHA 2LF8A 4ESFA 2I6KA 1YG2A 4LK0F 5K7ZA 5BPDA 3DBLB 4EJTA 4QPQA 4J7HA 3MKLA 2DPUA 2XGCA 2A05A 4FE4A 2V9VA 4II2A 1WVRA 2DSCA 3Q2SA 1J5YA 1HKQA 2KDZA 2DTZA 1DU6A 3GLLA 1WJBA 5B3SH 4ZZLA 5ILUA 4PDKA 4BXUA 2DA6A 3DPLC 2D1HA 2QJOA 1QVJA 3LQQA 4IHWA 2M9HA 2WAQA 2XC7A 3VYTB 5HNFA 1XGOA 2BY0A 2H1LA 4AVPA 3PIPF 4AIJA 2STWA 4HF2A 1MMAA 1AU7A 2JA6J 3OYDA 2NXNB 3EYYA 2NVQJ 3J80K 2L5QA 2E2JJ 4QSHA 2V79A 4UVCA 2A8PA 4M3EA 1SVOA 1R36A 1BIAA 1YOVB 2IGNA 4RB0A 5E1ZB 2MD5A 1PDNC 4L5IA 1YJ9I 1O3TA 5E3MA 4CCJA 3LWFA 3EPZA 1PUFB 5C3EJ 4L9NA 4IHSA 3HOXJ 1VQMI 2ZFUA 1FTTA 4RGRA 1R5ID 1Z1DA 2ICWG 3WE2A 2ZJRF 3QP6A 2W24A 2DA2A 2MYSA 1G3TA 3Q91A 4JOMA 3CCQI 4XIDA 3PO2J 4EM2A 2PMHA 4BKXA 4KFCA 2ZMEA 5H6RA 1NTCA 5D5UB 2ZSHB 3SDBA 5H20A 5DUIA 2COBA 1T08B 4BJ5C 3OS0A 5IW4A 5J40A 2F4IA 4AIDA 2R5YB 4KN7X 3ZQ7A 3U2RA 5FO5A 4FCYA 5FSIA 3RPQA 3HXLA 3A6SA 5DCFA 2KLOA 1P2FA 5EG0A 5IOZA 3ASNH 1JKPC 4U7DA 3S14J 4XLNF 1ETXA 3O2PE 2VE9A 1EH6A 1E3OC 1OYIA 3DBRB 2PI0A 1T98A 5LPGA 1QQIA 5F64A 1VQPI 3L09A 4LG0B 3HOSA 4JQFA 1AOYA 1SEUA 3ABKH 3T1BA 5CVIA 1X1DA 2CMPA 2KQRA 2CGPA 1VIQA 2X85A 2GQQA 5DD4A 4LK1F 3S1QJ 2VBXA 3GWZA 2IS4A 3KPHA 5LHGA 5DM6F 1NK2P 4LD5A 2QF7A 2RVCA 1GUUA 2Y0SA 1MNEA 4AWXB 1MBKA 3GFMA 3EUKL 4OOIA 1ZGAA 1O3RA 3OOPA 1KQ9A 1YX5A 1EKEA 1PVFA 3DBHB 4FETA 1K2EA 3E6BA 3I58A 4Q4ZF 2HOAA 2ETHA 2E19A 1REPC 4A3GJ 3LSRA 3RDIA 1MBFA 2G7HA 2Q0OA 3ELKA 3DLLF 3BR3A 3ZQFA 4BDZA 2ZJPF 2HWVA 4EEFG 2TRTA 2WV0A 4NBQA 2QQ9A 3LFKA 1JKNA 4S2WA 3MKWB 2E2IJ 2ZJ2A 4XORA 2Y0SN 4B3XA 5E8IA 5E3OA 4G6QA 4V14A 1KU9A 5B1AH 3CCUI 2JMWA 3BZ6A 2B9SA 2TCTA 3QRFF 3CDHA 5E17F 3OIQA 2ZXWH 2QQBA 1X2NA 5C44J 2K3PA 3F22A 2R7TA 4UV8A 1V8YA 1UHWA 1SMYF 4I0BA 4LMYA 2IS1A 2Z1DA 3DEUA 5GTHC 1XX5A 1NH3A 2D45A 5IT9K 1MDMA 2O9LA 3IKTA 2FU4A 1R49A 3QWLA 2X6OA 3CESA 1NG7A 3I4MJ 4ZYGA 1IV8A 5B1BH 2LBFA 5FRNA 1LKXA 2FXAA 1W36D 4M6XA 4ZDOA 1FP2A 1LFPA 3K70C 1FYKA 3HOZJ 3F8FA 3ASOH 2VKHA 4ICKA 2FOKA 1V8IA 4O3MA 3GMEA 1G8XA 4RDUA 1DGRM 2GAUA 3ACAA 1H9GA 1U6GA 2E35A 3BP8A 3H36A 2NVUB 3CP2A 4DJAA 3A6TA 3H3VK 4A12A 3CTAA 3ZR8X 1P4AA 3GZ5A 1WI9A 3FBIB 4LLGF 3OYHA 1FC3A 4PFPA 3A01A 1ETYA 2DUKA 3VSKA 1D1CA 2FSWA 4KITB 3MCFA 4G7OF 3HUGA 1F5TA 4FASD 3BROA 2ACJA 5LHHA 5HDKA 4BEHA 2L7MP 2CO5A 4KIGA 1MMGA 1X2MA 3N97A 1HQCA 1DDNA 5K7FA 2DMUA 3B6CA 4WXCA 2R7OA 3JTGA 3H0DA 3M9AA 1EH7A 1TQIA 5J1UA 3IAS2 4XK4A 5LRSA 4I98B 1KGSA 3CF2A 2ELJA 1TT5B 2I5UA 3PQJA 2XSDC 1WH5A 1GVDA 1NHAA 1ONVA 1A6IA 4X1EA 3WTTC 2OUMA 4OIQF 2NS0A 3BR0A 1WCMJ 1R67A 4LIVA 3FCMA 1XB4A 4HQMA 1GV5A 1I9AA 5J4YA 1TWHJ 1P7IA 3OR2C 1MR2A 4J7GA 2VQHA 3PUFA 2CV2A 4K6EA 3M3YJ 3HJEA 3UNGC 2O1CA 1W7PB 4FISA 2EJRA 1XMXA 3TGNA 3GFJA 1V4RA 3ABUA 3D0SA 2QM3A 5HLIA 1MSEC 3WG7H 3WGHA 3K4MA 5D4SA 3I56I 2E60A 3CUQB 1K83J 1F9NA 3FK6A 4MPOA 1XGSA 2ID6A 5ICCA 4IF4A 3BQYA 3PIOF 1U78A 1MSFC 2HS5A 3PSFA 3X0MA 2WTEA 1OCTC 4EVIA 2ICKA 1FOKA 3NWSA 3NARA 4BQQA 2FNPA 3F23A 1FIPA 2GZWA 3LL7A 4LLNA 4IKFA 2HOEA 3M8FA 4L5JA 1RYAA 2OJED 1YRNB 2D5VA 1R5GA 3D5LA 4OAZA 5DCMB 2Y2ZA 1KTGA 2IGKA 4FX0A 3LA2A 1T0FC 1L0OC 4NQWA 2K9MA 4EATA 4KNYA 3BR5A 1OQYA 3HIFA 2VI6A 3DP7A 5JR3A 2QCOA 4XKWA 5KHDA 4J19A 3DU5A 1KU2A 1NK3P 2PN6A 4WX9A 2BZTA 3ZQLA 2F5DA 3FXRA 2O7OA 2EZLA 3ZMSA 2RKHA 4G7HF 1K6OA 3AL0C 4OIPF 2DTRA 1V8WA 3SJMA 1TWAJ 4OU0A 2JVHA 2XGDA 2L7FP 4XSXF 1RC9A 2DJIA 3S32A 3HOYJ 2A8QA 2QQAA 2DK8A 3BR2A 3CCLI 1MUTA 3GBGA 3H5RA 2KIMA 1IXSB 2VNPA 2HYJA 2R0QC 1GXPA 3D5RC 2HFHA 1D1BA 3ZP5A 1Z05A 2L3DA 1IRXA 2LY9A 2FBIA 1G6NA 5FLXZ 4RMNA 1LNWA 2HGCA 2MC3A 1X1AA 3KP2A 4V2FA 5M5YJ 3BM4A 2LH9A 2FOWA 4BQNA 2R7RA 4GCVA 2CQQA 4D7NA 5DDGA 1WSUA 1HKSA 5IW5A 3I59B 3PQKA 2JSCA 1FY7A 3O6ZA 2H8RA 2VJ5A 4I6ZA 3A6UA 2LY2A 2YX4A 4IEJA 2P81A 3TW7A 5FKLA 1LJ9A 3SZTA 2P5LC 2BV6A 2HQNA 1F4KA 1KHZA 4P9FA 4B44A 5GAHJ 4LGWA 2M34A 3EF5A 4BQOA 4YFNF 2ZNZA 3X0JA 1D8KA 2QEXI 1S6LA 2VJJA 3U53A 4YIIA 2MA3A 1JT6A 3TW6A 4PJNA 3A6VA 4BE0A 4M9ZA 2FE3A 3EUHA 3CJNA 4F93B 3Q9SA 3VSLA 3KETA 1LDDA 2HTSA 1E0EA 3CMYA 4Z6YA 4HSTA 3BZCA 4A3CJ 2BE5F 3P9KA 5GP9A 2VKVA 3QAHA 4I09A 5JHUA 1U20A 2DA5A 2V4JC 2XASA 3BLYA 2QZ8A 4J01A 2JVBA 2H09A 1Z91A 2VBZA 1WJEA 3OYAA 4HZFA 2EFNA 2MLGA 2OTLI 5DS9A 1Y39A 5FROA 2ELHA 5EYRA 3OYJA 3X0QA 2EZHA 1B4AA 1IF1A 3Q93A 5ED4A 3ZMDA 1LB2A 3BR1A 2V9KA 1JT0A 3CLOA 1T56A 4B47A 2R93J 2A68F 2DI3A 4L9VA 4NB5A 3KYLA 3W2AA 4MQVA 1IC8A 4BQAA 4YRVA 2OD5A 2IS6A 2WY7Q 4MHGA 3VODA 2DAOA 2ZXJA 2JA2A 4QTRA 2ZSIB 4MIMA 3WTWC 1WI3A 4ITVA 2VOOA 2OV7A 4FT8A 4G6DA 4S04A 1GDTA 4XRSA 2H94A 2PEXA 3SFZA 5ANSA 1LPQA 4RGSA 2JPCA 3AFHA 4XOPA 1AKHB 4FHTA 5IP9J 3MFKA 1ZHFA 3ABTA 1U5TC 1YE9A 2KDVA 2IP2A 2F5FA 1Z67A 4R79A 3G3ZA 2O8KA 5FSMA 2L4MA 2E7WA 4DZJA 1ZRDA 1VRLA 1W7PD 2W00A 4EM0B 3TQNA 4IHTA 1XSBA 2Y75A 4XKBA 2W82A 2DODA 2NOJB 1FIAA 5DM7F 4HDVA 2F4OB 4GYGA 4S05A 3ECHA 4BAYA 3ESWB 2AO9A 3WTUC 1WFXA 1U2WA 2HZTA 4DIQA 1HCRA 2D2WA 2LTPA 4ENNA 5FFXA 2ELKA 1IG7A 2K3FA 2CU7A 3R0JA 2Y9YA 4HDUA 4M73A 1RKTA 3K1MA 3E1SA 3K4LA 1FMWA 2XAJA 3MWMA 4Y4RA 4JK1X 2HKXA 3GG6A 5LGNA 4MTDA 1T33A 3BJAA 1BR4A 2HQRA 3V7CA 4F3QA 2VBYA 2W4EA 2IJLA 4M9XA 2H6CA 1IW7F 2RGVA 3S15J 4A69C 3C1DA 2LY1A 5CJ9A 1X51A 2EA4A 3S1MJ 1ERDA 3LFUA 4BACA 3WE3A 2F6CA 4HV6A 4XN0A 4BH9A 1J0RA 1H88C 3M07A 2CL3A 3FX3A 2VL8A 1IDYA 2KIUA 1MQEA 2E36A 1S29A 2DFIA 1OMIA 3MCZA 4G12A 4BXFA 4DBQA 2UXXA 3OYIA 2L7KA 3ERMA 4S2VA 5LRRA 5F08A 3GX4X 2DYSH 4HQEA 2HI3A 4G8XA 3FKJA 3H5NA 1LVKA 3BOQA 1SOIA 2EWNA 2R7QA 1QPMA 4EJUA 1MD0A 3G1LA 3J80Z 3V42A 2CUZA 3R0AA 1FYLA 3ZR0A 3OY9A 1V8RA 3DCFA 1A5JA 4UVAA 1ZREA 2XPWA 2UUZA 3DEEA 2JTVA 2R92J 3X0PA 1P92A 2AQFA 2EZIA 5D8KB 2L0KA 1V8NA 1YW7A 2LSOA 3FXQA 1SD7A 2XVCA 4RLFA 1T2KA 4EJWA 4RB2C 2FD5A 4LOCA 1HSJA 1SFOJ 4PGGA 3PO3J 2CQ7A 1MJBA 5GPAA 1XDUA 3MGMA 4S2XA 5HDGA 2I10A 4R8HA 3CF5F 5EEGA 2DHOA 2Z9OA 4OINF 4CCMA 2YS9A 1MNMC 3HRMA 5ICGA 3CC2I 2CQXA 3GO5A 4AYBA 2KHMA 1J59A 1F1ZA 2VLAA 3BQZA 2IA0A 3I4PA 3PFYA 2VT3A 3E0JB 3JRCA 4BUPA 4BHCA 4HA8A 3CUOA 2HPIA 3HTSB 3E5XA 4Q47A 1W36C 3COAC 3H9GA 4CZCA 2CZRA 3PNVA 1R4MB 3IWZA 4XQFA 4KG4A 1FSEA 2WB1N 3ERED 4ABZA 4AYBN 2K85A 3BZKA 5E3NA 2VOPA 4CHUA 4BHBA 2JRTA 1WPKA 3CJTB 2X6WA 4DYRA 2XKOA 4CYCB 2P7CB 4F55A 1SD4A 3FDYA 5K5QA 1R1VA 4EV0A 3CO6C 2PJPA 2YYHA 2LK2A 2ECCA 3SMDA 1TT0A 2WV1A 5EF6A 1H89C 4A3FJ 2LF7A 4DW6A 1U0JA 3VDXA 5LFAA 1ZG3A 5I8UA 1V8MA 2G74A 2Z16A 1ZKGA 4D0PA 4XLFA 3JRFA 1DU0A 4LIUA 3KVHA 5C7QA 1VQ4I 1ETKA 2EIMH 2ZXHA 3E6CC 2ZMEB 2EFPA 2L9NA 3KX2A 5CPRB 4GRIA 2DT6A 4G7ZF 1VQ9I 1FYMA 1W0UA 4IHVA 1E2XA 1N77A 2X4HA 4A0YA 3IKVA 2JA5J 1BI3A 3VOEA 2EV6A 2GA2A 2C6YA 2L02A 1Q1VA 5EG0B 1MK1A 1ZR4A 4BJTA 1QHGA 4GO1A 5F27A 5J8CA 1WJAA 1YI2I 1FOXA 4JZVA 2VB6A 2JZYA 3ONQA 2KKOA 5GHOA 1M1EB 1R1TA 3M7GA 3J81Z 1N75A 4BYYA 3HRTA 2BY2A 2ISYA 2MH9A 3H95A 3E57A 1DP3A 2OPTA 4N0BA 4ZG0A 2V9PA 2H8WA 3G4SI 4BDYA 3I54A 4M9SA 4C3JJ 3I5UA 3BDDA 1U9NA 4XRSG 1SFXA 3I4NJ 4BY1J 1RRSA 1OCCH 3SHFA 3TDZC 3FXMA 2FJ1A 3BHOA 3L00A 3GTPJ 1FNNA 2X9DA 3TKYA 1Y1VJ 4XR6A 5GHPA 2JUCA 2NS7A 1DGWY 1RZ4A 1WQ2A 4L5EA 2J5PA 2MLKA 3KEYA 1FZPB 3WTXC 4PJJA 3S1NJ 2J8QA 4B1RA 1LE8B 1Y0UA 3K69A 3CO7C 3OIPA 4A3MJ 2HVSA 2MSYA 1KQ8A 4QWQA 1MQWA 1D3YA 1V54H 3BG5A 2E1NA 3BTLA 1G3WA 1NFSA 1PUSA 1XSCA 1VNDA 1TWCJ 3HGYA 2Z33A 3GZ8A 3B73A 2XAUA 3IC7A 2VKDA 1MDMB 3K1NA 1MGTA 4FE7A 4NHJA 2XGXA 3M8JA 2K9NA 3X2QH 1BN5A 1R9TJ 3HRUA 3E3VA 2LBFB 1ZN2A 3B02A 3PFIA 2VPLA 2TDXA 4EJVA 1JJ8C 4E7SA 2K4BA 2CW0F 2CYYA 4ZYHA 1GHCA 2DLLA 1W5SA 1G3SA 1B72A 3OYEA 3H9JA 4BHPA 1Y6IA 2Z3YA 1USTA 4BE1A 1R71A 5CFIA 2P0WA 4QPOA 5EGOA 5FKKA 1J09A 3DTEA 3G71I 1V5EA 2ZJQF 1A04A 2VONA 2VPRA 1TLHB 4BL0B 3A01B 2M0CA 4LITA 3FJYA 4MLOA 2ADUA 2IAIA 4DZPA 1YJNI 4IHYA 1I6XA 5JI6A 3Q0WA 1IRFA 2RC4A 3GTMJ 3VB2A 1MBHA 5E18F 5ILVA 4E70A 2COMA 1A36A 2RRKA 3K7AJ 4U0WA 1FBQA 4BEHB 2X51A 4PCQA 2K9LA 2BHYA 4CUGA 2LLKA 2AHQA 5L3BA 3Q2TA 3QYEA 3OL3A 5L3DA 2ECBA 3HSFA 3RKQA 2IBDA 2D1VA 5ANWA 1E3PA 3CCEI 2CFXA 2I8DA 1WH7A 2KDOA 3LA3A 1PYVA 3REOA 2W48A 3W6VA 3HHHA 3HHJA 1R23A 2E2HJ 2R7SA 1Z3XA 2R5WA 4ZDPA 3ZMUA 1XGMA 4O5VA 2M0MA 3IL2A 4A3BJ 2EIKH 2IGOA 1JKOC 4IOCF 5K1YA 1PJRA 2W4SA 1PUNA 2ME0A 5KAIC 2GM4A 1HW2A 3HPHA 4KIFA 4GXOA 3C18A 2PFBA 3OMYA 1S7EA 1XS9A 2GB5A 2XUBA 2HVQA 5F0HA 1ZTRA 5ANVA 2CQNA 3IH2A 3KZYA 1I1SA 2F5EA 2DK5A 3A03A 3RQ4A 4CDGA 2DDBA 2L9SA 4GGGA 4NC8A 3S8PA 4KT5C 4BNCA 2UWMA 2HOSA 3A1YA 3JRHA 4HRIA 3AAFA 1MNDA 4Y13A 2XKPA 2Z2SB 3H3ZA 2L2OA 5F0FA 5J4VA 2R7XA 1GV2A 4AIHA 2VN2A 1WJFA 1JUMA 3I64A 4HX8A 4MGRA 3ZCOA 4KN4X 4E7ZA 3F8CA 3FK9A 4FQGA 3F0CA 2QWWA 1PP7U 1ZLJA 2F4MB 1USSA 2CJJA 3H0GJ 4LLLA 3LNQA 1IGNA 1I27A 3C2GA 3OR1C 2E1MB 3GF2A 3BJ6A 3TO9A 2EV5A 4XBFA 5FJ8J 3L2RA 2BVLA 1FLIA 3J81K 1U8BA 1CF7A 1BOBA 1JTYA 3R03A 1B1BA 2J5OA 3HC7A 3M8EA 1UB9A 2IA1A 3J7ZI 2HYFA 4B43A 2LKPA 3GFLA
chains in the Genus database with same CATH topology
3QP5A 4UHTA 2ESHA 4L0ZB 3RJPA 1YQAA 2IVMA 3E6DA 3H3UA 4A5MA 1DPUA 3CUQC 1Q33A 2AZWA 1PUEE 3KP5A 2G7UA 2FMYA 4P5OA 3DXJF 1SU2A 2YPRA 4IVNA 4Q48A 1ON2A 2L01A 3P6YA 3IRRA 4U0YA 1K78A 1BBYA 4YPHA 3RKXA 2DO7A 4EJOA 2IRFG 1Z7UA 2PLYA 1MZBA 2I8UA 2Z5UA 2K4JA 3V7SA 3ID9A 1DPRA 1BC7C 5GHQA 2BBYA 3O6BB 1IRGA 2XSQA 3KLNA 2A3SA 3FMRA 3L9FA 3KFWX 1FP1D 3T8TA 4N9HA 1Z9CA 3HHGA 2WWYA 3Q1PA 4LG0A 2UZKA 3DUPA 2JPBA 2DU9A 1K79A 2FEZA 4JZTA 2IT0A 3F21A 5GHJA 1B59A 1B6AA 1MJAA 3F6OA 5FSOA 5D6EA 2FMLA 3HYIA 2GXGA 2B0LA 2L54A 3KLOA 4EGYA 4KDPA 1WWXA 1LEBA 1UHMA 1XMAA 1P6RA 5A2QZ 2HYGD 2W85A 4MNUA 1S3JA 1Z6RA 3S2WA 1X83A 3X0IA 5IT3A 1FBUA 4HW0A 1YW8A 2OBPA 1PP8F 4WCGA 2E1CA 4JZSA 2VT2A 3KEOA 1NFZA 1YIOA 2V1DA 2GT4A 3FFUA 5E1XA 2VODA 4DNCA 3DFGA 4G94A 2PBIA 2KJBA 1EH8A 2E7XA 1TQMA 5LGTA 1YYVA 1BI0A 3SZPA 1ZYRF 1GXQA 1XCVA 5KVRA 5HS8A 3FZVA 3M1EA 3KP3A 4U7BA 4HVYA 2PMUA 1SJYA 5JFRA 3HTUA 3LAPA 3U1DA 3OGAA 4AD9A 1HSTA 1ODDA 2IPQX 3TOBA 5E20A 4IPAA 3WODF 1KA8A 4PZJA 1S8NA 2PG4A 1O57A 1X3UA 2EB7A 2QYOA 3WTZA 2NAZA 2YX7A 1FT9A 3IHUA 3BAPA 4I2OA 2O0YA 4RAYA 1XCBA 5GHIA 3RYPA 2O5FA 3I7VA 1T38A 4ASNA 4ON0A 1S7OA 2AXLA 1BM9A 4Z2YA 2ZFWA 4M72A 1B9NA 2DW4A 2BEOA 3Q9VA 5DEQA 3V4GA 5LGUA 3L2CA 4ENJA 3WU0A 3FSPA 3R6SA 3T0YA 1LDKB 5AIQA 3EYIA 1TBXA 3K9TA 2WC2A 4HLXA 3ML6A 2RV8A 2DT5A 1DUXC 3MAJA 4HLYA 1OW2A 2W84A 3HOTA 1U8RA 4UVBA 4MEYF 4HX4A 2QENA 3RYRA 1VC8A 4PGHA 4K2EA 1XSXA 3WTSC 1BOAA 1YLFA 1MKMA 1XD7A 1PPWA 3DKWA 4R1HA 1L3LA 3V8LA 2Y48A 1B9MA 4NFXA 1J7KA 1V8LA 5E8GA 2A5YB 2EV0A 4OIOF 5A2QK 3N4MA 4KTBA 1IN8A 3GFIA 2HKOA 3K1PA 4U0VA 5EEHA 2DQLA 4IRGA 1ZRCA 3L7WA 2QBYA 2XAQA 3F8MA 1SAXA 1C0WA 1V8VA 1LEAA 2V1UA 3RI4A 4LB6B 4YIFA 3CNGA 5ERIA 2UXNA 1MJ9A 5GHNA 1T0FA 2YU3A 5ICFA 2BGCA 4CGZA 2PQVA 2M1BA 4EGZA 2NNYA 2LDUA 2RDPA 5L3GA 2L4AA 4GYIA 4I7HA 3VEPA 4CXFA 3F6VA 3I71A 4WF2A 2OQGA 2NYXA 1R22A 3LSTA 4S2YA 1K7AA 3NEUA 4ENMA 3ZR1A 3GWYA 1OYYA 3J7AO 3E5QA 3KE2A 2XAFA 4Y15A 2IW5A 4XSZF 3DQVC 1HXDA 2FVVA 1RUOA 2Q2EA 2XRNA 3MZYA 3F8NA 4I01A 4ZH4F 2DBBA 5L3FA 2V1XA 4G9YA 4CO8A 3ECOA 2MBFA 3WHWA 3GUDA 1QO0D 2A8TA 1JE8A 4L18B 1TNTA 2P5VA 1RI7A 2OZ6A 3IWFA 1VTNC 5BQTA 5BMZA 2FA5A 4L9TA 5JVTA 3RPUA 3P9IA 1IUYA 3JSOA 4WWCA 2M45A 4A0XA 4YG2F 3GEZA 1AWCA 2YVPA 3FHZA 4ILQA 2EFQA 2FNAA 1T39A 2B0VA 1VHGA 3TOAA 5CVRA 3QPTA 4KG3A 2FBKA 2YSRA 2KRFA 4DQ2A 5C7TA 4AIKA 1U5TA 1JHHA 5TJJA 4UXNA 2KIFA 1FSHA 1Q1HA 2XAHA 1SMTA 2K86A 3EESA 1P4XA 2A6TA 2NRAC 3KCCA 1VIUA 4RGXA 2CSOA 4KIBA 2XHKA 3OV8A 2B06A 3HYQA 2ZBKA 4OMZA 5F1RA 2KJCA 5FSNA 2Y0MA 2FBHA 3JAMZ 4I02A 3X0KA 5L3EA 1CF7B 1X84A 2QKMB 3O8SA 3DKUA 3FMSA 3L85A 3I9XA 2O5WA 1LDJA 5TRDA 2O03A 2HDCA 1KU7A 1V8SA 5BOXA 1XMKA 2ZCWA 1K26A 1S7AA 5AIPA 3Q5FA 1YTYA 5ANTA 2DPDA 3H92A 2V6CA 2ICJA 1PPXA 2MH2A 2Z99A 3TO7A 3ZPLA 1I5ZA 2ZNYA 3EETA 2FRHA 4C9XA 4XLPF 2Q8KA 3ZN1A 5HS7A 4TV7A 2KDWA 3ZN0A 1ULYA 5BONA 1K78B 3MQ0A 1IN7A 1KU3A 2OA4A 1VCDA 2A69F 5D5WB 5CVUA 1R58A 1ZARA 2O3FA 2A07F 2RNJA 3I0TA 3JTHA 3G73A 4EQQA 4IRIA 1D5VA 1ZLKA 2R7DA 2M5WA 4LJZF 3WGIA 2P4WA 1IXRC 4UUVA 2H27A 3SXYA 2JT1A 4RGUA 1V3FA 4HFQA 1KYZA 3I53A 2G9WA 6PAXA 5D4RA 2NNNA 1XN7A 3WTYC 1STZA 4I0AA 3DV8A 5KK1A 4RB3C 1ZG1A 3FM5A 5J8FA 2FF4A 4O6JA 4KA4A 1QZYA 5CVJA 2A8RA 2YVOA 3O69A 1QNTA 2R7FA 4Y17A 1QBJA 3T5XA 3R4KA 1R7JA 3COUA 2P6SA 3R60A 2GIVA 3NRVA 2CG4A 1HW1A 1O7FA 5DYMA 3G0QA 1R1UA 3N77A 1WKMA 2DSDA 1GVJA 2VBWA 2BYVE 1FWZA 1HZTA 4FX4A 3HRSA 5LBQA 5ICEA 4WXDA 4M6YA 3FM3A 1FPQA 1G3YA 1R00A 4KUMA 1HX3A 3P7NA 4JZUA 2PNYA 4ESJA 1XGNA 5DPKA 4ZYDA 4YFXF 2GA1A 2QJTA 4MEXF 3O52A 4NFWA 1SZ3A 1O3QA 4QLCU 4HYEA 1HBXG 3JAMK 5FD6A 2YVMA 1QGPA 1XSVA 3KP4A 2OQRA 1SD5A 4M74A 1ON1A 4HAMA 3K0LA 3SONA 2O61A 1G9QA 1LVAA 5BS6A 1BJAA 3RH7A 5CFJA 4HF1A 1R5HA 2HEOA 3QU6A 3ULQB 3NQOA 4CYDA 2CQKA 3U9GA 4A2UA 1IXCA 3V8JA 5ISYA 5FB2A 4HV5A 1MP2A 1UCRA 1ZRFA 2EA2A 1DP7P 2B2KA 4JBAA 1JRKA 1BI1A 1G4DA 1HKTA 4ESBA 5D5XB 4KICA 2ZKZA 4KYWA 2XROA 4U88A 3WU1B 4IJXA 3HSEA 3KZZA 1KT9A 1OYWA 3IRQA 4IRHA 2M30A 1YS7A 1YW9A 1V8UA 3GXOA 1W5TA 3QOPA 3JW4A 3W6KB 5HVQC 5FSLA 3ZMZA 2VXZA 3ISPA 4A5NA 3RKWA 5K5RA 4RAZA 4ETSA 1TNSA 1RIOH 1KYWA 2R3SA 4HOBA 1QZZA 1T6SA 5H6QA 1TQPA 5AONA 1H0MA 3GYHX 4M71A 2FKBA 2EK5A 1BI2A 3MDIA 3EDPA 2QBYB 3P9CA 5DD8A 1VK6A 2OU2A 4LB5A 2P8TA 5DV5A 4EMSA 3HSRA 1RRQA 1VHZA 3GRNA 4MTEA 4UV9A 3WTVC 2Q9PA 4H0EA 3W6JB 2O6GE 3E97A 2CWEA 2XV4S 1FBSA 4DYWA 3F3XA 2X0LA 3VFZA 1TUMA 1RUNA 1SD6A 5HZXA 4XRFA 1ZH5A 2STTA 2QLZA 1XSAA 3WG9A 4Q5SF 5D8LB 1PPVA 4WK8F 1W7PA 4YFKF 3C7JA 3ZMTA 3BPVA 2M8EA 4RS8A 2G73A 2VE8A 2EFWA 1VC9A 2ISZA 2PQ8A 5E1WA 3CUQA 5C8LA 3KEQA 1I1GA 1G0SA 1YS6A 2P5KA 4CZZA 2EFOA 1IAWA 3LAJA 2YVNA 1V8TA 5HS9A 2H6BA 1H9TA 2W57A 1IN4A 1TW2A 3X0RA 3AC9A 3FXUA 4A0ZA 5DCMA 1P4WA 2A8SA 1O7LA 1IN5A 2O8XA 1E17A 5L3CA 3GVAA 5D6FA 2ZO4A 4N1TA 2OZUA 3TO6A 3F13A 5FSKA 3KP6A 1Q54A 2RQPA 2XIGA 4HBLA 3O61A 1WRJA 1PUQA 4IJAA 1J75A 2DQRA 3BY6A 2GWRA 2OAZA 2A61A 1OPCA 5LEKA 3SHDA 5CLSA 3RTRA 1IZ1A 2QVOA 1LQ1A 2GXBA 3F6AA 3I59A 4ENKA 2A6EF 2K02A 4WXHA 2M87A 1Q27A 1RNLA 3V8KA 4CICA 5LLQA 1O3SA 1J9IA 3WGGA 3ROUA 5FGMA 1UFMA 4KMFA 4YPRA 3DF8A 1ZGJA 1U5TB 1ZAOA 2HR3A 4N9IA 1D8JA 2HTJA 5BPIA 5FD5A 4A6EA 3EEUA 3QU3A 1YFHA 2K7LA 5FFZA 2F5CA 3FF5A 4KYXA 4UNOA 1TTYA 1SFUA 3QSJA 3FWEA 3RIRA 5FLXK 3GLXA 1U3EM 3MEXA 2F2EA 4OIRF 3JSPA 1KQ0A 1OR7A 4IXAA 3TDUC 2VC0A 2K27A 4OMYA 4A6DA 1NQYA 3DPTA 3E5UA 1IN6A 2W25A 1GA7A 1JGSA 4L0YB 3EQLF 4P9UA 2QUFA 3O3KA 5CVVA 4KMUX 3MDGA 2VC1A 3V7RA 4N1UA 3GZ6A 5LEJA 1F3YA 3E6MA 5ANUA 1NQZA 1FX7A 2XAGA 5HOOA 1JXSA 1BIBA 2P6TA 3FMQA 4ZZDA 2I8TA 3BJOA 1EV7A 3SQNA 1W4MA 3T8RA 4HF0A 4P96A 4L9JA 3X0NA 1Z6TA 1TW3A 2A6HF 1CGPA 5D5VB 1YO5C 3LA7A 5ILSA 2LNBA 3X0LA 4EM1A 2ESNA 3P5TA 3GW2A 1J2XA 4LFUA 2VNQA 4P55A 2AS5F 3RKYA 3I7UA 5HDNA 3F72A 4C9WA 3X0SA 2GT2A 3N9UA 3C3WA 5IT9Z 1OKRA 1XDSA 3K2ZA 4HX7A 3KP7A 1XSDA 4B09A 5F6FA 5J6XA 1JHFA 1SFEA 2RN7A 4ZYEA 2P7VB 2FQ3A 3MZHA 1BC8C 4F7ZA 3J7Ye 3R61A 2DSBA 4B8XA 4RB1A 3BWGA 2YR2A 3EXQA 5CYVA 1IRYA 3ZMVA 1ZG5A 2IA2A 3X0OA 4YOQA 3BPXA 4MQ9F 5GHMA 3LQRA 5K5OA 5DUKA 5LHIA 5HLHA 3Q4IA 3F8BA 1HW5A 5HLGA 3QPHA 2LF8A 4ESFA 2I6KA 1YG2A 4LK0F 5BPDA 4EJTA 4J7HA 2DPUA 2V9VA 2DSCA 3Q2SA 1J5YA 1HKQA 4ZZLA 5ILUA 4PDKA 4BXUA 3DPLC 2D1HA 2QJOA 1QVJA 3LQQA 1XGOA 4HF2A 4AIJA 4AVPA 2STWA 3EYYA 3J80K 2V79A 4UVCA 2A8PA 4RB0A 1R36A 1BIAA 5E1ZB 1PDNC 2MD5A 4L5IA 1O3TA 3LWFA 4L9NA 4IHSA 4RGRA 3WE2A 1Z1DA 3QP6A 2W24A 3Q91A 1G3TA 4EM2A 2PMHA 4KFCA 2ZMEA 5H6RA 5D5UB 5H20A 5DUIA 5IW4A 4KN7X 3ZQ7A 3U2RA 5FO5A 5FSIA 3RPQA 3A6SA 5DCFA 1P2FA 4U7DA 4XLNF 3O2PE 2VE9A 1EH6A 1OYIA 2PI0A 1T98A 5LPGA 1QQIA 5F64A 3L09A 4LG0B 3HOSA 4JQFA 1AOYA 3T1BA 5CVIA 2CGPA 1VIQA 2GQQA 5DD4A 4LK1F 2VBXA 3GWZA 5LHGA 4LD5A 4AWXB 2RVCA 4OOIA 3GFMA 1O3RA 1ZGAA 3OOPA 1KQ9A 1PVFA 1K2EA 3E6BA 3I58A 4Q4ZF 1REPC 2ETHA 3RDIA 2G7HA 2Q0OA 3ELKA 2HWVA 1JKNA 2WV0A 2QQ9A 3LFKA 4S2WA 2ZJ2A 5E8IA 4V14A 4G6QA 1KU9A 5E17F 3BZ6A 3QRFF 3CDHA 2QQBA 3F22A 4UV8A 1V8YA 1UHWA 1SMYF 4I0BA 4LMYA 3DEUA 2D45A 5IT9K 1MDMA 3IKTA 2FU4A 4ZYGA 2FXAA 4M6XA 1FP2A 1FYKA 3F8FA 4ICKA 2FOKA 1V8IA 4O3MA 2GAUA 3ACAA 1H9GA 1U6GA 3BP8A 3A6TA 4A12A 3CTAA 1P4AA 3GZ5A 1WI9A 4LLGF 2DUKA 1FC3A 2FSWA 3MCFA 4G7OF 3HUGA 1F5TA 3BROA 2ACJA 5LHHA 5HDKA 2CO5A 4KIGA 3N97A 1HQCA 1DDNA 4WXCA 3JTGA 3M9AA 1EH7A 1TQIA 5LRSA 4I98B 1KGSA 3PQJA 1NHAA 1ONVA 3WTTC 4OIQF 2NS0A 1R67A 3FCMA 1XB4A 4HQMA 1I9AA 1MR2A 4J7GA 4K6EA 2O1CA 1W7PB 2EJRA 3TGNA 3GFJA 1V4RA 3ABUA 3D0SA 2QM3A 5HLIA 3WGHA 5D4SA 3CUQB 1F9NA 4MPOA 1XGSA 5ICCA 4IF4A 1U78A 2HS5A 3X0MA 2WTEA 4EVIA 2ICKA 1FOKA 2FNPA 3F23A 2GZWA 4LLNA 2HOEA 3M8FA 4L5JA 1RYAA 1R5GA 3D5LA 5DCMB 1KTGA 4FX0A 3LA2A 1L0OC 4NQWA 4KNYA 3HIFA 3DP7A 5JR3A 1KU2A 2PN6A 4WX9A 2F5DA 3FXRA 3ZMSA 2RKHA 4G7HF 1K6OA 4OIPF 2DTRA 1V8WA 4OU0A 4XSXF 2A8QA 2QQAA 2DK8A 1MUTA 2KIMA 1IXSB 2VNPA 1GXPA 2HFHA 3ZP5A 1Z05A 2L3DA 2FBIA 1G6NA 5FLXZ 1LNWA 2HGCA 2MC3A 3BM4A 3KP2A 4GCVA 5DDGA 1WSUA 1HKSA 5IW5A 3I59B 3PQKA 2JSCA 1FY7A 3O6ZA 3A6UA 2YX4A 1LJ9A 3SZTA 2P5LC 2BV6A 2HQNA 1F4KA 1KHZA 4P9FA 4LGWA 3EF5A 4YFNF 2ZNZA 3X0JA 1D8KA 1S6LA 3U53A 4YIIA 2MA3A 3A6VA 4M9ZA 2FE3A 3EUHA 3CJNA 3KETA 3Q9SA 1LDDA 2HTSA 2BE5F 3P9KA 3QAHA 4I09A 5JHUA 1U20A 2XASA 2QZ8A 2JVBA 2H09A 1Z91A 2VBZA 4HZFA 2EFNA 2MLGA 2ELHA 3X0QA 1B4AA 1IF1A 3Q93A 5ED4A 3ZMDA 1LB2A 3CLOA 2A68F 2DI3A 4L9VA 4NB5A 4MQVA 4BQAA 2OD5A 4MHGA 3VODA 2DAOA 2ZXJA 3WTWC 2VOOA 4S04A 4FT8A 4G6DA 2H94A 2PEXA 3SFZA 5ANSA 4RGSA 2JPCA 4FHTA 3MFKA 1ZHFA 3ABTA 1U5TC 2KDVA 2IP2A 2F5FA 4R79A 3G3ZA 5FSMA 2L4MA 2E7WA 1ZRDA 1VRLA 1W7PD 4EM0B 3TQNA 4IHTA 1XSBA 2Y75A 4HDVA 4GYGA 4S05A 3ECHA 4BAYA 3WTUC 1U2WA 2HZTA 2D2WA 4ENNA 5FFXA 3R0JA 4HDUA 4M73A 3K1MA 2XAJA 3MWMA 4JK1X 2HKXA 3GG6A