5BS7A

Structure of histone h3/h4 in complex with spt2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
b'LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Transcription regulator
source organism Xenopus laevis
publication title Structure-function studies of histone H3/H4 tetramer maintenance during transcription by chaperone Spt2.
pubmed doi rcsb
total genus 25
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bs7A00
4Z2MG 1KX4C 1P3PB 5GXQC 3MNNA 3X1UA 3LJAD 3LELD 4H9RB 5B24D 3VH6A 3UTBC 2NZDB 3AZEC 5B33A 5B1LB 2CV5B 1P3IB 4J8VC 5BNXB 5AY8D 1TZYB 1M1AD 5CPIC 4CSRA 4WU9D 4XUJB 1AOIB 5B31C 4JJNC 4Z2MH 1S32C 2NQBC 3B6FC 1P3OB 5E5AB 3MVDB 3C1BC 4XZQB 5AVBC 3REKB 2F8NG 3AZNB 1P3FA 2FJ7C 3X1SB 5B40C 5AV6C 3X1TC 3C1CD 3W98C 4DRBA 3RELB 2AROB 3MNNB 2AROC 5B32C 1HQ3C 5CP6A 3WKJD 5AV9D 3REID 3NQUA 1F1EA 2NZDA 4YS3B 2PYOA 2FJ7B 3AZKD 1TZYA 4R8PD 3KWQC 3X1UB 5F99A 2LY8A 5CPJD 5CHLB 1F66D 4XZQA 3AZIA 4YS3C 4J8WA 5B32A 5B31D 5GT0D 1P3BA 5B1LC 3AZHB 5DNMA 1KX3B 5AV5C 4YM6D 1P3MA 4KUDD 3R45A 3W97A 3RELC 3REKA 5B0ZB 3V9RB 1P3FB 3W99A 1P3BC 3MGPC 5GXQD 5DNMC 3MGSA 1U35A 3AYWD 4YS3A 4JJNA 5B2JD 5E5AC 2HIOA 3B6FB 3AZLB 3TU4B 1P3GB 5F99B 1P3PA 5B33C 5DNNC 1WWIA 2PYOB 3MGRA 4UUZB 1P3KA 3REJB 3X1VA 4H9OB 3AV1D 3UT9D 3AV2C 5B31G 4CSRB 3WAAD 4H9NA 4WNNA 5AV9B 3REIB 3VH6T 4CAYA 3LJAB 5GSUB 3LELB 3B6GA 3AV1C 5GT3C 5CPKC 4J8UB 4WU8A 4E45A 4R8PB 3X1TA 3AZHA 5AVCD 2HUEC 1P34D 1KX5A 4XUJA 5GT0A 5AY8B 5DNND 3WA9A 3B6GC 3AZGD 1ULYA 4J8WC 4ZUXD 2HUEB 5E5AD 2BYMB 1KX3D 5CP6B 1KX5C 4HGAB 1ZLAA 4H9OA 3LZ1B 4NE3A 3MGRD 3WKJA 3O62B 5B40D 3AZJA 3W96D 3W96A 4CAYB 4EO5C 5B32G 3AYWB 3AZJD 1S32A 2NQBA 1U35C 2BYKA 3UTAB 3B6FD 2HIOD 4KUDC 4JJND 4YS3D 3MGSD 3REHB 1P3GC 1KX3A 5AY8C 3AZED 3KUYA 3WTPE 5CPID 3V9RA 5CPJB 3WTPB 3WA9D 3REHC 3MGPB 1P3BB 1WWSA 3LJAC 3LELC 5B1MD 3AV2A 3WAAB 5AV9C 3REIC 1P34A 5B0ZC 5B24C 1BFMA 3UTAC 3AZHD 3AZKC 5B32D 1KX4D 3AZEA 1KX3C 1P3AC 3AZHC 3O62C 2PYOC 5DNNB 3AV1A 4H9SA 5B33B 3UTAA 3AZFC 1P3KD 3AZGB 3B6FA 4DRAA 3B0CT 4LD9D 4Z66D 5CP6D 3W99C 1KU5A 3KXBA 3KWQB 1P3GD 3AZMD 5B40A 2CV5A 4KHAA 5GT3D 3X1VB 1P3AD 1U35D 4J8VD 5GT0B 1HQ3A 4X23A 4WV4B 5E5AA 5GSUC 3UTAD 3W98B 3W97D 3AFAD 1A7WA 5GSUD 3X1SA 3AV2B 3AZNC 5BS7A 5DNNA 5AVBB 5B2ID 5AY8A 5JRGD 5AVCA 3NQJB 3KXBC 4J8WD 1M19B 5B2JB 3LZ0C 1M18D 4H9PB 5B2JC 3LZ0B 5B1MB 4ZUXB 4H9RA 4Z66C 1P3KC 4NE5A 4M6BA 3KUYD 5CPIA 4KGCA 5B32B 4KHAB 4Z5TC 4X23D 2L5AA 2PYOD 3LZ1A 1P3MB 1AOIA 5AV5A 5AV6B 5GT3A 4J8XD 1P3MC 5B40B 4WZSB 3X1SC 5B1LD 3WTPC 2CV5D 5B1LA 3AZMA 3C1CA 1P3OC 3MGPA 1AOID 4Z66B 4NFTA 4J8UD 4JJNB 5AVCB 3R45B 1ZLAD 1Q9CA 1P3OD 5JA4B 3W98A 3MVDD 1EQZC 3REKD 3W99B 1R4VA 1P3IC 4H9PA 3AZEB 1U35B 4QLCA 4YM6A 1BH9A 4J8XC 1H3OA 1KX4A 3NQJA 1M1AA 1P3BD 5FUGA 2AROD 3AZJC 2AROA 5JRGA 4Z5TD 4H9NB 1F66A 5B1MA 3AV2D 3X1TD 3MGRB 3B0DC 3AFAA 4R8PA 4J8WB 2IO5C 3VH5W 3UT9A 4WNNB 5AV9A 3REIA 4XZQC 3A6NA 3KSYA 4H9QA 4R8PC 3KWQD 4J8UC 5B31B 1TAFB 5CPKB 3AZFB 4XUJC 1BH8A 1ZLAC 4YM6B 4KUDB 3WTPD 3WA9B 1P3AB 5AV8A 3REJC 2BYMA 4KGCD 5GXQB 5B24B 1H3OB 1KX4B 3WAAC 4ZUXA 4G92B 4HGAC 5B0YD 3AN2B 4WU9A 4AWLB 1M18A 1ZLAB 4LD9C 1JFIB 5AVBD 5B2IB 5B33D 4XUJD 5B0YC 1M19D 2BYKB 4WU8D 4AWLC 3LELA 3LJAA 5GSUA 3B6GB 4XZQD 5BO0B 1M1AC 5CPJA 3REJD 3AZMB 3MGQA 4QLCC 3UT9B 1HQ3D 3UTBD 4J8VA 3RELA 3W97C 3A6NB 5AV6A 5AV5B 5GT3B 3X1VD 1B67A 1P3AA 1ID3A 1P3LB 2CWEA 3AZNA 1BH8B 3MGQC 3C1BA 5BNVA 1P34B 3NQUB 4ZBJB 4Z66A 1JFIA 1N1JB 5JRGB 5F99C 2IO5B 3W99D 3AZLC 1M18B 1BH9B 3B0DB 2F8NB 2JSSA 5DNMB 5C3IC 5G49A 3AZJB 4X23B 3AZIB 5BO0A 1ID3D 5B0ZD 5AV6D 4J8XB 3REKC 1P3IA 3MVDC 3C1BB 1EQZD 1TAFA 5CPKA 3MGSB 5BT1C 4WU8C 4ZUXC 3WAAA 5B1MC 5B0ZA 4G91C 3TU4C 4H9SC 3MGSC 3LZ0A 3AZFA 3UTBB 1S32D 2NQBD 1P3PD 2F8NA 2YFVA 1P3LD 1P3FC 2FJ7A 3VH5T 5G49B 5GXQA 3MNNC 4Z5TB 3AN2A 3X1VC 4WU9B 1P3KB 3X1TB 3AZGA 5AV8C 4G91B 2RVQD 1B6WA 2F8NH 1M19C 1KX5D 3KXBB 3KWQA 3AZND 3X1UC 3AZGC 3C1CB 1P34C 3RELD 3B6GD 3MGQB 2YFVB 3MNND 4J8VB 5CPKD 5KDMA 5JA4A 1HQ3B 5C3IB 1ID3B 5GT0C 1N1JA 3WKJB 3W97B 3O62A 3AZLA 1M19A 2NZDD 4QLCB 3AZKB 3W96B 1P3PC 4Z5TA 5BNVB 1M1AB 5AVBA 4KGCB 2HIOB 5CPJC 4UUZA 3AN2D 3TU4A 1F66B 5B0YB 3REHD 5B2JA 3AYWA 1S32B 2NQBB 1AOIC 3MVDA 3VH6W 5BT1D 2RVQC 3KUYB 5CPIB 5AV8D 5BNXA 1TZYC 1HTAA 4J8UA 2CV5C 4WU8B 3MGPD 2F8ND 2NZDC 1P3MD 3A6NC 3AYWC 4KUDA 5KDMB 4EO5B 5DNMD 3AZIC 3WA9C 5B31A 4X23C 3A6ND 5AV5D 3B0BA 4YM6C 4J8XA 3AZID 3UTBA 3AZLD 2YFWB 1KX5B 3X1UD 5F99D 5BS7C 1EQZA 1F66C 1M18C 1P3ID 5B2IC 5FUGB 1TZYD 2HIOC 3AZKA 5JRGC 4G92C 3AN2C 4LD9B 3W96C 4E44A 2F8NK 5B2IA 3MGRC 3WKJC 3AFAC 4ZBJC 5B0YA 1ID3C 3B0CW 4QLCD 3X1SD 3LZ1C 1P3LC 1P3FD 3C1CC 1P3OA 3W98D 3AFAB 5CP6C 3WTPA 3UT9C 4NE6A 3AZMC 3REHA 3TU4D 3C1BD 1EQZB 1P3LA 2FJ7D 3KUYC 5AVCC 5AV8B 1P3GA 4H9QB 3KXBD 4WU9C 4LD9A 3AZFD 3LZ0D 2YFWA 5B24A 3LZ1D 3O62D 3AV1B 4KGCC 3MGQD 3VH5A 3REJA
chains in the Genus database with same CATH superfamily
4Z2MG 1KX4C 2G5HC 1P3PB 5GXQC 3MNNA 3X1UA 3LJAD 3LELD 2ZY5A 4H9RB 5B24D 3VH6A 3UTBC 2NZDB 3AZEC 5B33A 5B1LB 2Y2MA 2CV5B 1P3IB 4J8VC 5BNXB 5AY8D 1TZYB 1M1AD 5CPIC 4CSRA 4WU9D 4XUJB 1AOIB 5B31C 4JJNC 4Z2MH 1S32C 2NQBC 3B6FC 1P3OB 5E5AB 3MVDB 3C1BC 4XZQB 5AVBC 3REKB 2F8NG 3AZNB 1P3FA 2FJ7C 3X1SB 5B40C 5AV6C 3X1TC 3C1CD 3W98C 4DRBA 3RELB 3KFUG 2AROB 2Y2JA 3MNNB 2AROC 5B32C 1HQ3C 5CP6A 3WKJD 5AV9D 3REID 3NQUA 1F1EA 2NZDA 4YS3B 2PYOA 2FJ7B 3AZKD 1TZYA 4R8PD 3KWQC 3X1UB 5F99A 2LY8A 5CPJD 5CHLB 1F66D 2XD1A 4XZQA 1T3UA 3AZIA 4YS3C 4J8WA 5B32A 5B31D 5GT0D 1P3BA 5B1LC 3AZHB 5DNMA 1KX3B 5AV5C 4YM6D 1P3MA 4KUDD 1PZRA 3R45A 3W97A 3RELC 3REKA 5B0ZB 3V9RB 1P3FB 3W99A 1P3BC 3MGPC 5GXQD 5DNMC 3MGSA 1U35A 3AYWD 4YS3A 4JJNA 5B2JD 5E5AC 2HIOA 3B6FB 3AZLB 3TU4B 1P3GB 5F99B 1P3PA 5B33C 5DNNC 1WWIA 2PYOB 3MGRA 2W8SA 4UUZB 1P3KA 3REJB 3X1VA 4H9OB 3AV1D 3UT9D 3AV2C 5B31G 4CSRB 3WAAD 4H9NA 4WNNA 5AV9B 3REIB 3VH6T 4CAYA 3LJAB 5GSUB 3LELB 3B6GA 3AV1C 5GT3C 5CPKC 4J8UB 4WU8A 4E45A 4R8PB 3X1TA 3AZHA 5AVCD 2HUEC 1P34D 1KX5A 4XUJA 5GT0A 5AY8B 5DNND 3WA9A 3B6GC 3AZGD 1ULYA 4J8WC 4ZUXD 2HUEB 5E5AD 2BYMB 1KX3D 5CP6B 2DF4C 1KX5C 1Z2CB 4HGAB 1ZLAA 4H9OA 3LZ1B 4NE3A 3MGRD 3WKJA 3O62B 5B40D 3AZJA 2VQRA 3W96D 3W96A 4CAYB 4EO5C 5B32G 3AYWB 3AZJD 1S32A 2NQBA 1U35C 2BYKA 3UTAB 3B6FD 2HIOD 4KUDC 4JJND 2G5IC 4YS3D 3MGSD 3REHB 1P3GC 1KX3A 5AY8C 3AZED 3KUYA 3WTPE 5CPID 3V9RA 5CPJB 3WTPB 3WA9D 3REHC 3MGPB 1P3BB 1WWSA 3LJAC 3LELC 5B1MD 3AV2A 3WAAB 5AV9C 3REIC 1P34A 5B0ZC 5B24C 1BFMA 2DQNC 3UTAC 3AZKC 3AZHD 5B32D 1KX4D 3AZEA 1KX3C 1P3AC 3AZHC 3O62C 2PYOC 5DNNB 3AV1A 4H9SA 5B33B 3EPLA 3UTAA 2ZY2A 3AZFC 1P3KD 3AZGB 3B6FA 4DRAA 3B0CT 4LD9D 4Z66D 5CP6D 3W99C 1KU5A 3KXBA 3KWQB 1P3GD 3AZMD 5B40A 2CV5A 4KHAA 5GT3D 3X1VB 1P3AD 1U35D 4J8VD 5GT0B 1HQ3A 4X23A 4WV4B 5E5AA 5GSUC 3UTAD 3W98B 1W2EA 3W97D 3AFAD 1A7WA 5GSUD 2Y2PA 3X1SA 3AV2B 3AZNC 5BS7A 5DNNA 5AVBB 5B2ID 5AY8A 5JRGD 5AVCA 3NQJB 3KXBC 4J8WD 3H0MC 1M19B 5B2JB 3LZ0C 1M18D 4H9PB 5B2JC 3LZ0B 5B1MB 4ZUXB 4H9RA 4Z66C 1P3KC 4NE5A 4M6BA 3KUYD 5CPIA 4KGCA 5B32B 4KHAB 4Z5TC 2ZM5A 2Y2KA 4X23D 2L5AA 2PYOD 3A1KA 3LZ1A 3P5JB 1P3MB 1AOIA 5AV5A 5AV6B 5GT3A 4J8XD 1P3MC 5B40B 4WZSB 3X1SC 5B1LD 3WTPC 2CV5D 5B1LA 3AZMA 3C1CA 2Y2IA 1P3OC 3MGPA 1AOID 4Z66B 4NFTA 4J8UD 4JJNB 5AVCB 2ZY4A 3R45B 1ZLAD 1Q9CA 1P3OD 5JA4B 3W98A 3MVDD 1EQZC 3REKD 3W99B 1R4VA 1P3IC 3AL0C 4H9PA 3AZEB 1U35B 4QLCA 2F2AC 3F6TA 4YM6A 1BH9A 4J8XC 1H3OA 1KX4A 3NQJA 1M1AA 1P3BD 5FUGA 2AROD 3AZJC 2AROA 5JRGA 4Z5TD 4H9NB 1F66A 5B1MA 3AV2D 3X1TD 3MGRB 3B0DC 2Y2GA 3AFAA 4R8PA 4J8WB 2IO5C 3VH5W 3UT9A 4WNNB 5AV9A 3REIA 4XZQC 3A6NA 3KSYA 3IP4C 4H9QA 4R8PC 3KWQD 4J8UC 5B31B 1TAFB 5CPKB 3AZFB 4XUJC 2JCHA 1BH8A 1ZLAC 4YM6B 4KUDB 3WTPD 3WA9B 3A1IA 1P3AB 5AV8A 3REJC 2BYMA 4KGCD 5GXQB 5B24B 1H3OB 1KX4B 3WAAC 4ZUXA 4G92B 4HGAC 5B0YD 3AN2B 4WU9A 4AWLB 1M18A 1ZLAB 4LD9C 1JFIB 5AVBD 5B2IB 5B33D 4XUJD 5B0YC 1M19D 2BYKB 4WU8D 4AWLC 3LELA 3LJAA 5GSUA 3B6GB 4XZQD 5BO0B 1M1AC 5CPJA 3REJD 3AZMB 3MGQA 4QLCC 3UT9B 1HQ3D 3UTBD 4J8VA 3RELA 3W97C 3A6NB 5AV6A 5AV5B 5GT3B 2Y2LA 1B67A 3X1VD 1P3AA 1ID3A 1P3LB 2CWEA 3AZNA 1BH8B 3MGQC 3C1BA 5BNVA 1P34B 3NQUB 4ZBJB 4Z66A 2Y2QA 1JFIA 1N1JB 5JRGB 5F99C 2IO5B 3W99D 2Y2HA 3AZLC 1M18B 4WJ3C 1BH9B 3B0DB 2F8NB 2JSSA 5DNMB 5C3IC 5G49A 3AZJB 4X23B 3AZIB 5BO0A 1ID3D 5B0ZD 5AV6D 4J8XB 3REKC 1P3IA 2Y2NA 3MVDC 3C1BB 1EQZD 1TAFA 5CPKA 3MGSB 5BT1C 4WU8C 4ZUXC 3WAAA 5B1MC 2ZY3A 5B0ZA 4G91C 3TU4C 3EPKA 4H9SC 3MGSC 3LZ0A 3AZFA 3UTBB 1S32D 2NQBD 1P3PD 2F8NA 2YFVA 1P3LD 1P3FC 2FJ7A 3VH5T 5G49B 5GXQA 3MNNC 4Z5TB 3AN2A 3X1VC 4WU9B 1P3KB 3X1TB 3AZGA 5AV8C 4G91B 2RVQD 1B6WA 2F8NH 1M19C 1KX5D 3KXBB 3KWQA 3AZND 3H0RC 3X1UC 3AZGC 3C1CB 1P34C 3RELD 3B6GD 3MGQB 2BG1A 2YFVB 3MNND 4J8VB 5CPKD 5KDMA 5JA4A 2XD5A 1HQ3B 5C3IB 1ID3B 5GT0C 1N1JA 3WKJB 3W97B 3O62A 3AZLA 2Y2OA 1M19A 2NZDD 4QLCB 3AZKB 3W96B 1P3PC 4Z5TA 5BNVB 1M1AB 5AVBA 4KGCB 2HIOB 5CPJC 4UUZA 3AN2D 3TU4A 1F66B 5B0YB 3REHD 5B2JA 3AYWA 1S32B 2NQBB 1AOIC 3MVDA 3VH6W 5BT1D 2RVQC 3KUYB 5CPIB 5AV8D 5BNXA 1TZYC 1HTAA 4J8UA 2CV5C 4WU8B 3MGPD 2F8ND 2NZDC 1P3MD 3FDDA 3A6NC 3AYWC 2FFFB 2RIQA 4EO5B 5KDMB 4KUDA 5DNMD 3AZIC 3WA9C 5B31A 4X23C 3A6ND 2J8PA 5AV5D 3B0BA 4YM6C 4J8XA 2UWXA 3AZID 3UTBA 3AZLD 2YFWB 1KX5B 3X1UD 5F99D 5BS7C 1EQZA 1F66C 1M18C 1P3ID 5B2IC 5FUGB 1TZYD 2JE5A 2HIOC 3AZKA 5JRGC 4G92C 3AN2C 4LD9B 3EPJA 3W96C 4E44A 2F8NK 3EG5B 4DQYB 3H0LC 5B2IA 3MGRC 3WKJC 3AFAC 4ZBJC 5B0YA 1ID3C 3B0CW 4QLCD 3X1SD 3LZ1C 1P3LC 1P3FD 3C1CC 1P3OA 3W98D 3AFAB 5CP6C 3WTPA 3UT9C 4NE6A 3AZMC 3REHA 3TU4D 3C1BD 1EQZB 1P3LA 2FJ7D 3KUYC 5AVCC 5AV8B 1P3GA 3EPHA 4H9QB 3KXBD 4WU9C 4LD9A 3AZFD 3LZ0D 2YFWA 5B24A 3LZ1D 3O62D 3AV1B 4KGCC 3MGQD 3VH5A 3REJA 4UPKA
chains in the Genus database with same CATH topology
4Z2MG 1KX4C 2G5HC 1P3PB 5GXQC 3MNNA 3X1UA 3LJAD 3LELD 2ZY5A 4H9RB 5B24D 3VH6A 3UTBC 2NZDB 3AZEC 5B33A 5B1LB 2Y2MA 2CV5B 1P3IB 4J8VC 5BNXB 5AY8D 1TZYB 1M1AD 5CPIC 4CSRA 4WU9D 4XUJB 1AOIB 5B31C 4JJNC 4Z2MH 1S32C 2NQBC 3B6FC 1P3OB 5E5AB 3MVDB 3C1BC 4XZQB 5AVBC 3REKB 2F8NG 3AZNB 1P3FA 2FJ7C 3X1SB 5B40C 5AV6C 3X1TC 3C1CD 3W98C 4DRBA 3RELB 3KFUG 2AROB 2Y2JA 3MNNB 2AROC 5B32C 1HQ3C 5CP6A 3WKJD 5AV9D 3REID 3NQUA 1F1EA 2NZDA 4YS3B 2PYOA 2FJ7B 3AZKD 1TZYA 4R8PD 3KWQC 3X1UB 5F99A 2LY8A 5CPJD 5CHLB 1F66D 2XD1A 4XZQA 1T3UA 3AZIA 4YS3C 4J8WA 5B32A 5B31D 5GT0D 1P3BA 5B1LC 3AZHB 5DNMA 1KX3B 5AV5C 4YM6D 1P3MA 4KUDD 1PZRA 3R45A 3W97A 3RELC 3REKA 5B0ZB 3V9RB 1P3FB 3W99A 1P3BC 3MGPC 5GXQD 5DNMC 3MGSA 1U35A 3AYWD 4YS3A 4JJNA 5B2JD 5E5AC 2HIOA 3B6FB 3AZLB 3TU4B 1P3GB 5F99B 1P3PA 5B33C 5DNNC 1WWIA 2PYOB 3MGRA 2W8SA 4UUZB 1P3KA 3REJB 3X1VA 4H9OB 3AV1D 3UT9D 3AV2C 5B31G 4CSRB 3WAAD 4H9NA 4WNNA 5AV9B 3REIB 3VH6T 4CAYA 3LJAB 5GSUB 3LELB 3B6GA 3AV1C 5GT3C 5CPKC 4J8UB 4WU8A 4E45A 4R8PB 3X1TA 3AZHA 5AVCD 2HUEC 1P34D 1KX5A 4XUJA 5GT0A 5AY8B 5DNND 3WA9A 3B6GC 3AZGD 1ULYA 4J8WC 4ZUXD 2HUEB 5E5AD 2BYMB 1KX3D 5CP6B 2DF4C 1KX5C 1Z2CB 4HGAB 1ZLAA 4H9OA 3LZ1B 4NE3A 3MGRD 3WKJA 3O62B 5B40D 3AZJA 2VQRA 3W96D 3W96A 4CAYB 4EO5C 5B32G 3AYWB 3AZJD 1S32A 2NQBA 1U35C 2BYKA 3UTAB 3B6FD 2HIOD 4KUDC 4JJND 2G5IC 4YS3D 3MGSD 3REHB 1P3GC 1KX3A 5AY8C 3AZED 3KUYA 3WTPE 5CPID 3V9RA 5CPJB 3WTPB 3WA9D 3REHC 3MGPB 1P3BB 1WWSA 3LJAC 3LELC 5B1MD 3AV2A 3WAAB 5AV9C 3REIC 1P34A 5B0ZC 5B24C 1BFMA 2DQNC 3UTAC 3AZKC 3AZHD 5B32D 1KX4D 3AZEA 1KX3C 1P3AC 3AZHC 3O62C 2PYOC 5DNNB 3AV1A 4H9SA 5B33B 3EPLA 3UTAA 2ZY2A 3AZFC 1P3KD 3AZGB 3B6FA 4DRAA 3B0CT 4LD9D 4Z66D 5CP6D 3W99C 1KU5A 3KXBA 3KWQB 1P3GD 3AZMD 5B40A 2CV5A 4KHAA 5GT3D 3X1VB 1P3AD 1U35D 4J8VD 5GT0B 1HQ3A 4X23A 4WV4B 5E5AA 5GSUC 3UTAD 3W98B 1W2EA 3W97D 3AFAD 1A7WA 5GSUD 2Y2PA 3X1SA 3AV2B 3AZNC 5BS7A 5DNNA 5AVBB 5B2ID 5AY8A 5JRGD 5AVCA 3NQJB 3KXBC 4J8WD 3H0MC 1M19B 5B2JB 3LZ0C 1M18D 4H9PB 5B2JC 3LZ0B 5B1MB 4ZUXB 4H9RA 4Z66C 1P3KC 4NE5A 4M6BA 3KUYD 5CPIA 4KGCA 5B32B 4KHAB 4Z5TC 2ZM5A 2Y2KA 4X23D 2L5AA 2PYOD 3A1KA 3LZ1A 3P5JB 1P3MB 1AOIA 5AV5A 5AV6B 5GT3A 4J8XD 1P3MC 5B40B 4WZSB 3X1SC 5B1LD 3WTPC 2CV5D 5B1LA 3AZMA 3C1CA 2Y2IA 1P3OC 3MGPA 1AOID 4Z66B 4NFTA 4J8UD 4JJNB 5AVCB 2ZY4A 3R45B 1ZLAD 1Q9CA 1P3OD 5JA4B 3W98A 3MVDD 1EQZC 3REKD 3W99B 1R4VA 1P3IC 3AL0C 4H9PA 3AZEB 1U35B 4QLCA 2F2AC 3F6TA 4YM6A 1BH9A 4J8XC 1H3OA 1KX4A 3NQJA 1M1AA 1P3BD 5FUGA 2AROD 3AZJC 2AROA 5JRGA 4Z5TD 4H9NB 1F66A 5B1MA 3AV2D 3X1TD 3MGRB 3B0DC 2Y2GA 3AFAA 4R8PA 4J8WB 2IO5C 3VH5W 3UT9A 4WNNB 5AV9A 3REIA 4XZQC 3A6NA 3KSYA 3IP4C 4H9QA 4R8PC 3KWQD 4J8UC 5B31B 1TAFB 5CPKB 3AZFB 4XUJC 2JCHA 1BH8A 1ZLAC 4YM6B 4KUDB 3WTPD 3WA9B 3A1IA 1P3AB 5AV8A 3REJC 2BYMA 4KGCD 5GXQB 5B24B 1H3OB 1KX4B 3WAAC 4ZUXA 4G92B 4HGAC 5B0YD 3AN2B 4WU9A 4AWLB 1M18A 1ZLAB 4LD9C 1JFIB 5AVBD 5B2IB 5B33D 4XUJD 5B0YC 1M19D 2BYKB 4WU8D 4AWLC 3LELA 3LJAA 5GSUA 3B6GB 4XZQD 5BO0B 1M1AC 5CPJA 3REJD 3AZMB 3MGQA 4QLCC 3UT9B 1HQ3D 3UTBD 4J8VA 3RELA 3W97C 3A6NB 5AV6A 5AV5B 5GT3B 2Y2LA 1B67A 3X1VD 1P3AA 1ID3A 1P3LB 2CWEA 3AZNA 1BH8B 3MGQC 3C1BA 5BNVA 1P34B 3NQUB 4ZBJB 4Z66A 2Y2QA 1JFIA 1N1JB 5JRGB 5F99C 2IO5B 3W99D 2Y2HA 3AZLC 1M18B 4WJ3C 1BH9B 3B0DB 2F8NB 2JSSA 5DNMB 5C3IC 5G49A 3AZJB 4X23B 3AZIB 5BO0A 1ID3D 5B0ZD 5AV6D 4J8XB 3REKC 1P3IA 2Y2NA 3MVDC 3C1BB 1EQZD 1TAFA 5CPKA 3MGSB 5BT1C 4WU8C 4ZUXC 3WAAA 5B1MC 2ZY3A 5B0ZA 4G91C 3TU4C 3EPKA 4H9SC 3MGSC 3LZ0A 3AZFA 3UTBB 1S32D 2NQBD 1P3PD 2F8NA 2YFVA 1P3LD 1P3FC 2FJ7A 3VH5T 5G49B 5GXQA 3MNNC 4Z5TB 3AN2A 3X1VC 4WU9B 1P3KB 3X1TB 3AZGA 5AV8C 4G91B 2RVQD 1B6WA 2F8NH 1M19C 1KX5D 3KXBB 3KWQA 3AZND 3H0RC 3X1UC 3AZGC 3C1CB 1P34C 3RELD 3B6GD 3MGQB 2BG1A 2YFVB 3MNND 4J8VB 5CPKD 5KDMA 5JA4A 2XD5A 1HQ3B 5C3IB 1ID3B 5GT0C 1N1JA 3WKJB 3W97B 3O62A 3AZLA 2Y2OA 1M19A 2NZDD 4QLCB 3AZKB 3W96B 1P3PC 4Z5TA 5BNVB 1M1AB 5AVBA 4KGCB 2HIOB 5CPJC 4UUZA 3AN2D 3TU4A 1F66B 5B0YB 3REHD 5B2JA 3AYWA 1S32B 2NQBB 1AOIC 3MVDA 3VH6W 5BT1D 2RVQC 3KUYB 5CPIB 5AV8D 5BNXA 1TZYC 1HTAA 4J8UA 2CV5C 4WU8B 3MGPD 2F8ND 2NZDC 1P3MD 3FDDA 3A6NC 3AYWC 2FFFB 2RIQA 4EO5B 5KDMB 4KUDA 5DNMD 3AZIC 3WA9C 5B31A 4X23C 3A6ND 2J8PA 5AV5D 3B0BA 4YM6C 4J8XA 2UWXA 3AZID 3UTBA 3AZLD 2YFWB 1KX5B 3X1UD 5F99D 5BS7C 1EQZA 1F66C 1M18C 1P3ID 5B2IC 5FUGB 1TZYD 2JE5A 2HIOC 3AZKA 5JRGC 4G92C 3AN2C 4LD9B 3EPJA 3W96C 4E44A 2F8NK 3EG5B 4DQYB 3H0LC 5B2IA 3MGRC 3WKJC 3AFAC 4ZBJC 5B0YA 1ID3C 3B0CW 4QLCD 3X1SD 3LZ1C 1P3LC 1P3FD 3C1CC 1P3OA 3W98D 3AFAB 5CP6C 3WTPA 3UT9C 4NE6A 3AZMC 3REHA 3TU4D 3C1BD 1EQZB 1P3LA 2FJ7D 3KUYC 5AVCC 5AV8B 1P3GA 3EPHA 4H9QB 3KXBD 4WU9C 4LD9A 3AZFD 3LZ0D 2YFWA 5B24A 3LZ1D 3O62D 3AV1B 4KGCC 3MGQD 3VH5A 3REJA 4UPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2M G;  1KX4 C;  1P3P B;  5GXQ C;  3MNN A;  3X1U A;  3LJA D;  3LEL D;  4H9R B;  5B24 D;  3VH6 A;  3UTB C;  2NZD B;  3AZE C;  5B33 A;  5B1L B;  2CV5 B;  1P3I B;  4J8V C;  5BNX B;  5AY8 D;  1TZY B;  1M1A D;  5CPI C;  4CSR A;  4WU9 D;  4XUJ B;  1AOI B;  5B31 C;  4JJN C;  4Z2M H;  1S32 C;  2NQB C;  3B6F C;  1P3O B;  5E5A B;  3MVD B;  3C1B C;  4XZQ B;  5AVB C;  3REK B;  2F8N G;  3AZN B;  1P3F A;  2FJ7 C;  3X1S B;  5B40 C;  5AV6 C;  3X1T C;  3C1C D;  3W98 C;  4DRB A;  3REL B;  2ARO B;  3MNN B;  2ARO C;  5B32 C;  1HQ3 C;  5CP6 A;  3WKJ D;  5AV9 D;  3REI D;  3NQU A;  1F1E A;  2NZD A;  4YS3 B;  2PYO A;  2FJ7 B;  3AZK D;  1TZY A;  4R8P D;  3KWQ C;  3X1U B;  5F99 A;  2LY8 A;  5CPJ D;  5CHL B;  1F66 D;  4XZQ A;  3AZI A;  4YS3 C;  4J8W A;  5B32 A;  5B31 D;  5GT0 D;  1P3B A;  5B1L C;  3AZH B;  5DNM A;  1KX3 B;  5AV5 C;  4YM6 D;  1P3M A;  4KUD D;  3R45 A;  3W97 A;  3REL C;  3REK A;  5B0Z B;  3V9R B;  1P3F B;  3W99 A;  1P3B C;  3MGP C;  5GXQ D;  5DNM C;  3MGS A;  1U35 A;  3AYW D;  4YS3 A;  4JJN A;  5B2J D;  5E5A C;  2HIO A;  3B6F B;  3AZL B;  3TU4 B;  1P3G B;  5F99 B;  1P3P A;  5B33 C;  5DNN C;  1WWI A;  2PYO B;  3MGR A;  4UUZ B;  1P3K A;  3REJ B;  3X1V A;  4H9O B;  3AV1 D;  3UT9 D;  3AV2 C;  5B31 G;  4CSR B;  3WAA D;  4H9N A;  4WNN A;  5AV9 B;  3REI B;  3VH6 T;  4CAY A;  3LJA B;  5GSU B;  3LEL B;  3B6G A;  3AV1 C;  5GT3 C;  5CPK C;  4J8U B;  4WU8 A;  4E45 A;  4R8P B;  3X1T A;  3AZH A;  5AVC D;  2HUE C;  1P34 D;  1KX5 A;  4XUJ A;  5GT0 A;  5AY8 B;  5DNN D;  3WA9 A;  3B6G C;  3AZG D;  1ULY A;  4J8W C;  4ZUX D;  2HUE B;  5E5A D;  2BYM B;  1KX3 D;  5CP6 B;  1KX5 C;  4HGA B;  1ZLA A;  4H9O A;  3LZ1 B;  4NE3 A;  3MGR D;  3WKJ A;  3O62 B;  5B40 D;  3AZJ A;  3W96 D;  3W96 A;  4CAY B;  4EO5 C;  5B32 G;  3AYW B;  3AZJ D;  1S32 A;  2NQB A;  1U35 C;  2BYK A;  3UTA B;  3B6F D;  2HIO D;  4KUD C;  4JJN D;  4YS3 D;  3MGS D;  3REH B;  1P3G C;  1KX3 A;  5AY8 C;  3AZE D;  3KUY A;  3WTP E;  5CPI D;  3V9R A;  5CPJ B;  3WTP B;  3WA9 D;  3REH C;  3MGP B;  1P3B B;  1WWS A;  3LJA C;  3LEL C;  5B1M D;  3AV2 A;  3WAA B;  5AV9 C;  3REI C;  1P34 A;  5B0Z C;  5B24 C;  1BFM A;  3UTA C;  3AZH D;  3AZK C;  5B32 D;  1KX4 D;  3AZE A;  1KX3 C;  1P3A C;  3AZH C;  3O62 C;  2PYO C;  5DNN B;  3AV1 A;  4H9S A;  5B33 B;  3UTA A;  3AZF C;  1P3K D;  3AZG B;  3B6F A;  4DRA A;  3B0C T;  4LD9 D;  4Z66 D;  5CP6 D;  3W99 C;  1KU5 A;  3KXB A;  3KWQ B;  1P3G D;  3AZM D;  5B40 A;  2CV5 A;  4KHA A;  5GT3 D;  3X1V B;  1P3A D;  1U35 D;  4J8V D;  5GT0 B;  1HQ3 A;  4X23 A;  4WV4 B;  5E5A A;  5GSU C;  3UTA D;  3W98 B;  3W97 D;  3AFA D;  1A7W A;  5GSU D;  3X1S A;  3AV2 B;  3AZN C;  5BS7 A;  5DNN A;  5AVB B;  5B2I D;  5AY8 A;  5JRG D;  5AVC A;  3NQJ B;  3KXB C;  4J8W D;  1M19 B;  5B2J B;  3LZ0 C;  1M18 D;  4H9P B;  5B2J C;  3LZ0 B;  5B1M B;  4ZUX B;  4H9R A;  4Z66 C;  1P3K C;  4NE5 A;  4M6B A;  3KUY D;  5CPI A;  4KGC A;  5B32 B;  4KHA B;  4Z5T C;  4X23 D;  2L5A A;  2PYO D;  3LZ1 A;  1P3M B;  1AOI A;  5AV5 A;  5AV6 B;  5GT3 A;  4J8X D;  1P3M C;  5B40 B;  4WZS B;  3X1S C;  5B1L D;  3WTP C;  2CV5 D;  5B1L A;  3AZM A;  3C1C A;  1P3O C;  3MGP A;  1AOI D;  4Z66 B;  4NFT A;  4J8U D;  4JJN B;  5AVC B;  3R45 B;  1ZLA D;  1Q9C A;  1P3O D;  5JA4 B;  3W98 A;  3MVD D;  1EQZ C;  3REK D;  3W99 B;  1R4V A;  1P3I C;  4H9P A;  3AZE B;  1U35 B;  4QLC A;  4YM6 A;  1BH9 A;  4J8X C;  1H3O A;  1KX4 A;  3NQJ A;  1M1A A;  1P3B D;  5FUG A;  2ARO D;  3AZJ C;  2ARO A;  5JRG A;  4Z5T D;  4H9N B;  1F66 A;  5B1M A;  3AV2 D;  3X1T D;  3MGR B;  3B0D C;  3AFA A;  4R8P A;  4J8W B;  2IO5 C;  3VH5 W;  3UT9 A;  4WNN B;  5AV9 A;  3REI A;  4XZQ C;  3A6N A;  3KSY A;  4H9Q A;  4R8P C;  3KWQ D;  4J8U C;  5B31 B;  1TAF B;  5CPK B;  3AZF B;  4XUJ C;  1BH8 A;  1ZLA C;  4YM6 B;  4KUD B;  3WTP D;  3WA9 B;  1P3A B;  5AV8 A;  3REJ C;  2BYM A;  4KGC D;  5GXQ B;  5B24 B;  1H3O B;  1KX4 B;  3WAA C;  4ZUX A;  4G92 B;  4HGA C;  5B0Y D;  3AN2 B;  4WU9 A;  4AWL B;  1M18 A;  1ZLA B;  4LD9 C;  1JFI B;  5AVB D;  5B2I B;  5B33 D;  4XUJ D;  5B0Y C;  1M19 D;  2BYK B;  4WU8 D;  4AWL C;  3LEL A;  3LJA A;  5GSU A;  3B6G B;  4XZQ D;  5BO0 B;  1M1A C;  5CPJ A;  3REJ D;  3AZM B;  3MGQ A;  4QLC C;  3UT9 B;  1HQ3 D;  3UTB D;  4J8V A;  3REL A;  3W97 C;  3A6N B;  5AV6 A;  5AV5 B;  5GT3 B;  3X1V D;  1B67 A;  1P3A A;  1ID3 A;  1P3L B;  2CWE A;  3AZN A;  1BH8 B;  3MGQ C;  3C1B A;  5BNV A;  1P34 B;  3NQU B;  4ZBJ B;  4Z66 A;  1JFI A;  1N1J B;  5JRG B;  5F99 C;  2IO5 B;  3W99 D;  3AZL C;  1M18 B;  1BH9 B;  3B0D B;  2F8N B;  2JSS A;  5DNM B;  5C3I C;  5G49 A;  3AZJ B;  4X23 B;  3AZI B;  5BO0 A;  1ID3 D;  5B0Z D;  5AV6 D;  4J8X B;  3REK C;  1P3I A;  3MVD C;  3C1B B;  1EQZ D;  1TAF A;  5CPK A;  3MGS B;  5BT1 C;  4WU8 C;  4ZUX C;  3WAA A;  5B1M C;  5B0Z A;  4G91 C;  3TU4 C;  4H9S C;  3MGS C;  3LZ0 A;  3AZF A;  3UTB B;  1S32 D;  2NQB D;  1P3P D;  2F8N A;  2YFV A;  1P3L D;  1P3F C;  2FJ7 A;  3VH5 T;  5G49 B;  5GXQ A;  3MNN C;  4Z5T B;  3AN2 A;  3X1V C;  4WU9 B;  1P3K B;  3X1T B;  3AZG A;  5AV8 C;  4G91 B;  2RVQ D;  1B6W A;  2F8N H;  1M19 C;  1KX5 D;  3KXB B;  3KWQ A;  3AZN D;  3X1U C;  3AZG C;  3C1C B;  1P34 C;  3REL D;  3B6G D;  3MGQ B;  2YFV B;  3MNN D;  4J8V B;  5CPK D;  5KDM A;  5JA4 A;  1HQ3 B;  5C3I B;  1ID3 B;  5GT0 C;  1N1J A;  3WKJ B;  3W97 B;  3O62 A;  3AZL A;  1M19 A;  2NZD D;  4QLC B;  3AZK B;  3W96 B;  1P3P C;  4Z5T A;  5BNV B;  1M1A B;  5AVB A;  4KGC B;  2HIO B;  5CPJ C;  4UUZ A;  3AN2 D;  3TU4 A;  1F66 B;  5B0Y B;  3REH D;  5B2J A;  3AYW A;  1S32 B;  2NQB B;  1AOI C;  3MVD A;  3VH6 W;  5BT1 D;  2RVQ C;  3KUY B;  5CPI B;  5AV8 D;  5BNX A;  1TZY C;  1HTA A;  4J8U A;  2CV5 C;  4WU8 B;  3MGP D;  2F8N D;  2NZD C;  1P3M D;  3A6N C;  3AYW C;  4KUD A;  5KDM B;  4EO5 B;  5DNM D;  3AZI C;  3WA9 C;  5B31 A;  4X23 C;  3A6N D;  5AV5 D;  3B0B A;  4YM6 C;  4J8X A;  3AZI D;  3UTB A;  3AZL D;  2YFW B;  1KX5 B;  3X1U D;  5F99 D;  5BS7 C;  1EQZ A;  1F66 C;  1M18 C;  1P3I D;  5B2I C;  5FUG B;  1TZY D;  2HIO C;  3AZK A;  5JRG C;  4G92 C;  3AN2 C;  4LD9 B;  3W96 C;  4E44 A;  2F8N K;  5B2I A;  3MGR C;  3WKJ C;  3AFA C;  4ZBJ C;  5B0Y A;  1ID3 C;  3B0C W;  4QLC D;  3X1S D;  3LZ1 C;  1P3L C;  1P3F D;  3C1C C;  1P3O A;  3W98 D;  3AFA B;  5CP6 C;  3WTP A;  3UT9 C;  4NE6 A;  3AZM C;  3REH A;  3TU4 D;  3C1B D;  1EQZ B;  1P3L A;  2FJ7 D;  3KUY C;  5AVC C;  5AV8 B;  1P3G A;  4H9Q B;  3KXB D;  4WU9 C;  4LD9 A;  3AZF D;  3LZ0 D;  2YFW A;  5B24 A;  3LZ1 D;  3O62 D;  3AV1 B;  4KGC C;  3MGQ D;  3VH5 A;  3REJ A; 
#chains in the Genus database with same CATH topology
 4Z2M G;  1KX4 C;  2G5H C;  1P3P B;  5GXQ C;  3MNN A;  3X1U A;  3LJA D;  3LEL D;  2ZY5 A;  4H9R B;  5B24 D;  3VH6 A;  3UTB C;  2NZD B;  3AZE C;  5B33 A;  5B1L B;  2Y2M A;  2CV5 B;  1P3I B;  4J8V C;  5BNX B;  5AY8 D;  1TZY B;  1M1A D;  5CPI C;  4CSR A;  4WU9 D;  4XUJ B;  1AOI B;  5B31 C;  4JJN C;  4Z2M H;  1S32 C;  2NQB C;  3B6F C;  1P3O B;  5E5A B;  3MVD B;  3C1B C;  4XZQ B;  5AVB C;  3REK B;  2F8N G;  3AZN B;  1P3F A;  2FJ7 C;  3X1S B;  5B40 C;  5AV6 C;  3X1T C;  3C1C D;  3W98 C;  4DRB A;  3REL B;  3KFU G;  2ARO B;  2Y2J A;  3MNN B;  2ARO C;  5B32 C;  1HQ3 C;  5CP6 A;  3WKJ D;  5AV9 D;  3REI D;  3NQU A;  1F1E A;  2NZD A;  4YS3 B;  2PYO A;  2FJ7 B;  3AZK D;  1TZY A;  4R8P D;  3KWQ C;  3X1U B;  5F99 A;  2LY8 A;  5CPJ D;  5CHL B;  1F66 D;  2XD1 A;  4XZQ A;  1T3U A;  3AZI A;  4YS3 C;  4J8W A;  5B32 A;  5B31 D;  5GT0 D;  1P3B A;  5B1L C;  3AZH B;  5DNM A;  1KX3 B;  5AV5 C;  4YM6 D;  1P3M A;  4KUD D;  1PZR A;  3R45 A;  3W97 A;  3REL C;  3REK A;  5B0Z B;  3V9R B;  1P3F B;  3W99 A;  1P3B C;  3MGP C;  5GXQ D;  5DNM C;  3MGS A;  1U35 A;  3AYW D;  4YS3 A;  4JJN A;  5B2J D;  5E5A C;  2HIO A;  3B6F B;  3AZL B;  3TU4 B;  1P3G B;  5F99 B;  1P3P A;  5B33 C;  5DNN C;  1WWI A;  2PYO B;  3MGR A;  2W8S A;  4UUZ B;  1P3K A;  3REJ B;  3X1V A;  4H9O B;  3AV1 D;  3UT9 D;  3AV2 C;  5B31 G;  4CSR B;  3WAA D;  4H9N A;  4WNN A;  5AV9 B;  3REI B;  3VH6 T;  4CAY A;  3LJA B;  5GSU B;  3LEL B;  3B6G A;  3AV1 C;  5GT3 C;  5CPK C;  4J8U B;  4WU8 A;  4E45 A;  4R8P B;  3X1T A;  3AZH A;  5AVC D;  2HUE C;  1P34 D;  1KX5 A;  4XUJ A;  5GT0 A;  5AY8 B;  5DNN D;  3WA9 A;  3B6G C;  3AZG D;  1ULY A;  4J8W C;  4ZUX D;  2HUE B;  5E5A D;  2BYM B;  1KX3 D;  5CP6 B;  2DF4 C;  1KX5 C;  1Z2C B;  4HGA B;  1ZLA A;  4H9O A;  3LZ1 B;  4NE3 A;  3MGR D;  3WKJ A;  3O62 B;  5B40 D;  3AZJ A;  2VQR A;  3W96 D;  3W96 A;  4CAY B;  4EO5 C;  5B32 G;  3AYW B;  3AZJ D;  1S32 A;  2NQB A;  1U35 C;  2BYK A;  3UTA B;  3B6F D;  2HIO D;  4KUD C;  4JJN D;  2G5I C;  4YS3 D;  3MGS D;  3REH B;  1P3G C;  1KX3 A;  5AY8 C;  3AZE D;  3KUY A;  3WTP E;  5CPI D;  3V9R A;  5CPJ B;  3WTP B;  3WA9 D;  3REH C;  3MGP B;  1P3B B;  1WWS A;  3LJA C;  3LEL C;  5B1M D;  3AV2 A;  3WAA B;  5AV9 C;  3REI C;  1P34 A;  5B0Z C;  5B24 C;  1BFM A;  2DQN C;  3UTA C;  3AZK C;  3AZH D;  5B32 D;  1KX4 D;  3AZE A;  1KX3 C;  1P3A C;  3AZH C;  3O62 C;  2PYO C;  5DNN B;  3AV1 A;  4H9S A;  5B33 B;  3EPL A;  3UTA A;  2ZY2 A;  3AZF C;  1P3K D;  3AZG B;  3B6F A;  4DRA A;  3B0C T;  4LD9 D;  4Z66 D;  5CP6 D;  3W99 C;  1KU5 A;  3KXB A;  3KWQ B;  1P3G D;  3AZM D;  5B40 A;  2CV5 A;  4KHA A;  5GT3 D;  3X1V B;  1P3A D;  1U35 D;  4J8V D;  5GT0 B;  1HQ3 A;  4X23 A;  4WV4 B;  5E5A A;  5GSU C;  3UTA D;  3W98 B;  1W2E A;  3W97 D;  3AFA D;  1A7W A;  5GSU D;  2Y2P A;  3X1S A;  3AV2 B;  3AZN C;  5BS7 A;  5DNN A;  5AVB B;  5B2I D;  5AY8 A;  5JRG D;  5AVC A;  3NQJ B;  3KXB C;  4J8W D;  3H0M C;  1M19 B;  5B2J B;  3LZ0 C;  1M18 D;  4H9P B;  5B2J C;  3LZ0 B;  5B1M B;  4ZUX B;  4H9R A;  4Z66 C;  1P3K C;  4NE5 A;  4M6B A;  3KUY D;  5CPI A;  4KGC A;  5B32 B;  4KHA B;  4Z5T C;  2ZM5 A;  2Y2K A;  4X23 D;  2L5A A;  2PYO D;  3A1K A;  3LZ1 A;  3P5J B;  1P3M B;  1AOI A;  5AV5 A;  5AV6 B;  5GT3 A;  4J8X D;  1P3M C;  5B40 B;  4WZS B;  3X1S C;  5B1L D;  3WTP C;  2CV5 D;  5B1L A;  3AZM A;  3C1C A;  2Y2I A;  1P3O C;  3MGP A;  1AOI D;  4Z66 B;  4NFT A;  4J8U D;  4JJN B;  5AVC B;  2ZY4 A;  3R45 B;  1ZLA D;  1Q9C A;  1P3O D;  5JA4 B;  3W98 A;  3MVD D;  1EQZ C;  3REK D;  3W99 B;  1R4V A;  1P3I C;  3AL0 C;  4H9P A;  3AZE B;  1U35 B;  4QLC A;  2F2A C;  3F6T A;  4YM6 A;  1BH9 A;  4J8X C;  1H3O A;  1KX4 A;  3NQJ A;  1M1A A;  1P3B D;  5FUG A;  2ARO D;  3AZJ C;  2ARO A;  5JRG A;  4Z5T D;  4H9N B;  1F66 A;  5B1M A;  3AV2 D;  3X1T D;  3MGR B;  3B0D C;  2Y2G A;  3AFA A;  4R8P A;  4J8W B;  2IO5 C;  3VH5 W;  3UT9 A;  4WNN B;  5AV9 A;  3REI A;  4XZQ C;  3A6N A;  3KSY A;  3IP4 C;  4H9Q A;  4R8P C;  3KWQ D;  4J8U C;  5B31 B;  1TAF B;  5CPK B;  3AZF B;  4XUJ C;  2JCH A;  1BH8 A;  1ZLA C;  4YM6 B;  4KUD B;  3WTP D;  3WA9 B;  3A1I A;  1P3A B;  5AV8 A;  3REJ C;  2BYM A;  4KGC D;  5GXQ B;  5B24 B;  1H3O B;  1KX4 B;  3WAA C;  4ZUX A;  4G92 B;  4HGA C;  5B0Y D;  3AN2 B;  4WU9 A;  4AWL B;  1M18 A;  1ZLA B;  4LD9 C;  1JFI B;  5AVB D;  5B2I B;  5B33 D;  4XUJ D;  5B0Y C;  1M19 D;  2BYK B;  4WU8 D;  4AWL C;  3LEL A;  3LJA A;  5GSU A;  3B6G B;  4XZQ D;  5BO0 B;  1M1A C;  5CPJ A;  3REJ D;  3AZM B;  3MGQ A;  4QLC C;  3UT9 B;  1HQ3 D;  3UTB D;  4J8V A;  3REL A;  3W97 C;  3A6N B;  5AV6 A;  5AV5 B;  5GT3 B;  2Y2L A;  1B67 A;  3X1V D;  1P3A A;  1ID3 A;  1P3L B;  2CWE A;  3AZN A;  1BH8 B;  3MGQ C;  3C1B A;  5BNV A;  1P34 B;  3NQU B;  4ZBJ B;  4Z66 A;  2Y2Q A;  1JFI A;  1N1J B;  5JRG B;  5F99 C;  2IO5 B;  3W99 D;  2Y2H A;  3AZL C;  1M18 B;  4WJ3 C;  1BH9 B;  3B0D B;  2F8N B;  2JSS A;  5DNM B;  5C3I C;  5G49 A;  3AZJ B;  4X23 B;  3AZI B;  5BO0 A;  1ID3 D;  5B0Z D;  5AV6 D;  4J8X B;  3REK C;  1P3I A;  2Y2N A;  3MVD C;  3C1B B;  1EQZ D;  1TAF A;  5CPK A;  3MGS B;  5BT1 C;  4WU8 C;  4ZUX C;  3WAA A;  5B1M C;  2ZY3 A;  5B0Z A;  4G91 C;  3TU4 C;  3EPK A;  4H9S C;  3MGS C;  3LZ0 A;  3AZF A;  3UTB B;  1S32 D;  2NQB D;  1P3P D;  2F8N A;  2YFV A;  1P3L D;  1P3F C;  2FJ7 A;  3VH5 T;  5G49 B;  5GXQ A;  3MNN C;  4Z5T B;  3AN2 A;  3X1V C;  4WU9 B;  1P3K B;  3X1T B;  3AZG A;  5AV8 C;  4G91 B;  2RVQ D;  1B6W A;  2F8N H;  1M19 C;  1KX5 D;  3KXB B;  3KWQ A;  3AZN D;  3H0R C;  3X1U C;  3AZG C;  3C1C B;  1P34 C;  3REL D;  3B6G D;  3MGQ B;  2BG1 A;  2YFV B;  3MNN D;  4J8V B;  5CPK D;  5KDM A;  5JA4 A;  2XD5 A;  1HQ3 B;  5C3I B;  1ID3 B;  5GT0 C;  1N1J A;  3WKJ B;  3W97 B;  3O62 A;  3AZL A;  2Y2O A;  1M19 A;  2NZD D;  4QLC B;  3AZK B;  3W96 B;  1P3P C;  4Z5T A;  5BNV B;  1M1A B;  5AVB A;  4KGC B;  2HIO B;  5CPJ C;  4UUZ A;  3AN2 D;  3TU4 A;  1F66 B;  5B0Y B;  3REH D;  5B2J A;  3AYW A;  1S32 B;  2NQB B;  1AOI C;  3MVD A;  3VH6 W;  5BT1 D;  2RVQ C;  3KUY B;  5CPI B;  5AV8 D;  5BNX A;  1TZY C;  1HTA A;  4J8U A;  2CV5 C;  4WU8 B;  3MGP D;  2F8N D;  2NZD C;  1P3M D;  3FDD A;  3A6N C;  3AYW C;  2FFF B;  2RIQ A;  4EO5 B;  5KDM B;  4KUD A;  5DNM D;  3AZI C;  3WA9 C;  5B31 A;  4X23 C;  3A6N D;  2J8P A;  5AV5 D;  3B0B A;  4YM6 C;  4J8X A;  2UWX A;  3AZI D;  3UTB A;  3AZL D;  2YFW B;  1KX5 B;  3X1U D;  5F99 D;  5BS7 C;  1EQZ A;  1F66 C;  1M18 C;  1P3I D;  5B2I C;  5FUG B;  1TZY D;  2JE5 A;  2HIO C;  3AZK A;  5JRG C;  4G92 C;  3AN2 C;  4LD9 B;  3EPJ A;  3W96 C;  4E44 A;  2F8N K;  3EG5 B;  4DQY B;  3H0L C;  5B2I A;  3MGR C;  3WKJ C;  3AFA C;  4ZBJ C;  5B0Y A;  1ID3 C;  3B0C W;  4QLC D;  3X1S D;  3LZ1 C;  1P3L C;  1P3F D;  3C1C C;  1P3O A;  3W98 D;  3AFA B;  5CP6 C;  3WTP A;  3UT9 C;  4NE6 A;  3AZM C;  3REH A;  3TU4 D;  3C1B D;  1EQZ B;  1P3L A;  2FJ7 D;  3KUY C;  5AVC C;  5AV8 B;  1P3G A;  3EPH A;  4H9Q B;  3KXB D;  4WU9 C;  4LD9 A;  3AZF D;  3LZ0 D;  2YFW A;  5B24 A;  3LZ1 D;  3O62 D;  3AV1 B;  4KGC C;  3MGQ D;  3VH5 A;  3REJ A;  4UPK A; 
#chains in the Genus database with same CATH homology
 4Z2M G;  1KX4 C;  2G5H C;  1P3P B;  5GXQ C;  3MNN A;  3X1U A;  3LJA D;  3LEL D;  2ZY5 A;  4H9R B;  5B24 D;  3VH6 A;  3UTB C;  2NZD B;  3AZE C;  5B33 A;  5B1L B;  2Y2M A;  2CV5 B;  1P3I B;  4J8V C;  5BNX B;  5AY8 D;  1TZY B;  1M1A D;  5CPI C;  4CSR A;  4WU9 D;  4XUJ B;  1AOI B;  5B31 C;  4JJN C;  4Z2M H;  1S32 C;  2NQB C;  3B6F C;  1P3O B;  5E5A B;  3MVD B;  3C1B C;  4XZQ B;  5AVB C;  3REK B;  2F8N G;  3AZN B;  1P3F A;  2FJ7 C;  3X1S B;  5B40 C;  5AV6 C;  3X1T C;  3C1C D;  3W98 C;  4DRB A;  3REL B;  3KFU G;  2ARO B;  2Y2J A;  3MNN B;  2ARO C;  5B32 C;  1HQ3 C;  5CP6 A;  3WKJ D;  5AV9 D;  3REI D;  3NQU A;  1F1E A;  2NZD A;  4YS3 B;  2PYO A;  2FJ7 B;  3AZK D;  1TZY A;  4R8P D;  3KWQ C;  3X1U B;  5F99 A;  2LY8 A;  5CPJ D;  5CHL B;  1F66 D;  2XD1 A;  4XZQ A;  1T3U A;  3AZI A;  4YS3 C;  4J8W A;  5B32 A;  5B31 D;  5GT0 D;  1P3B A;  5B1L C;  3AZH B;  5DNM A;  1KX3 B;  5AV5 C;  4YM6 D;  1P3M A;  4KUD D;  1PZR A;  3R45 A;  3W97 A;  3REL C;  3REK A;  5B0Z B;  3V9R B;  1P3F B;  3W99 A;  1P3B C;  3MGP C;  5GXQ D;  5DNM C;  3MGS A;  1U35 A;  3AYW D;  4YS3 A;  4JJN A;  5B2J D;  5E5A C;  2HIO A;  3B6F B;  3AZL B;  3TU4 B;  1P3G B;  5F99 B;  1P3P A;  5B33 C;  5DNN C;  1WWI A;  2PYO B;  3MGR A;  2W8S A;  4UUZ B;  1P3K A;  3REJ B;  3X1V A;  4H9O B;  3AV1 D;  3UT9 D;  3AV2 C;  5B31 G;  4CSR B;  3WAA D;  4H9N A;  4WNN A;  5AV9 B;  3REI B;  3VH6 T;  4CAY A;  3LJA B;  5GSU B;  3LEL B;  3B6G A;  3AV1 C;  5GT3 C;  5CPK C;  4J8U B;  4WU8 A;  4E45 A;  4R8P B;  3X1T A;  3AZH A;  5AVC D;  2HUE C;  1P34 D;  1KX5 A;  4XUJ A;  5GT0 A;  5AY8 B;  5DNN D;  3WA9 A;  3B6G C;  3AZG D;  1ULY A;  4J8W C;  4ZUX D;  2HUE B;  5E5A D;  2BYM B;  1KX3 D;  5CP6 B;  2DF4 C;  1KX5 C;  1Z2C B;  4HGA B;  1ZLA A;  4H9O A;  3LZ1 B;  4NE3 A;  3MGR D;  3WKJ A;  3O62 B;  5B40 D;  3AZJ A;  2VQR A;  3W96 D;  3W96 A;  4CAY B;  4EO5 C;  5B32 G;  3AYW B;  3AZJ D;  1S32 A;  2NQB A;  1U35 C;  2BYK A;  3UTA B;  3B6F D;  2HIO D;  4KUD C;  4JJN D;  2G5I C;  4YS3 D;  3MGS D;  3REH B;  1P3G C;  1KX3 A;  5AY8 C;  3AZE D;  3KUY A;  3WTP E;  5CPI D;  3V9R A;  5CPJ B;  3WTP B;  3WA9 D;  3REH C;  3MGP B;  1P3B B;  1WWS A;  3LJA C;  3LEL C;  5B1M D;  3AV2 A;  3WAA B;  5AV9 C;  3REI C;  1P34 A;  5B0Z C;  5B24 C;  1BFM A;  2DQN C;  3UTA C;  3AZK C;  3AZH D;  5B32 D;  1KX4 D;  3AZE A;  1KX3 C;  1P3A C;  3AZH C;  3O62 C;  2PYO C;  5DNN B;  3AV1 A;  4H9S A;  5B33 B;  3EPL A;  3UTA A;  2ZY2 A;  3AZF C;  1P3K D;  3AZG B;  3B6F A;  4DRA A;  3B0C T;  4LD9 D;  4Z66 D;  5CP6 D;  3W99 C;  1KU5 A;  3KXB A;  3KWQ B;  1P3G D;  3AZM D;  5B40 A;  2CV5 A;  4KHA A;  5GT3 D;  3X1V B;  1P3A D;  1U35 D;  4J8V D;  5GT0 B;  1HQ3 A;  4X23 A;  4WV4 B;  5E5A A;  5GSU C;  3UTA D;  3W98 B;  1W2E A;  3W97 D;  3AFA D;  1A7W A;  5GSU D;  2Y2P A;  3X1S A;  3AV2 B;  3AZN C;  5BS7 A;  5DNN A;  5AVB B;  5B2I D;  5AY8 A;  5JRG D;  5AVC A;  3NQJ B;  3KXB C;  4J8W D;  3H0M C;  1M19 B;  5B2J B;  3LZ0 C;  1M18 D;  4H9P B;  5B2J C;  3LZ0 B;  5B1M B;  4ZUX B;  4H9R A;  4Z66 C;  1P3K C;  4NE5 A;  4M6B A;  3KUY D;  5CPI A;  4KGC A;  5B32 B;  4KHA B;  4Z5T C;  2ZM5 A;  2Y2K A;  4X23 D;  2L5A A;  2PYO D;  3A1K A;  3LZ1 A;  3P5J B;  1P3M B;  1AOI A;  5AV5 A;  5AV6 B;  5GT3 A;  4J8X D;  1P3M C;  5B40 B;  4WZS B;  3X1S C;  5B1L D;  3WTP C;  2CV5 D;  5B1L A;  3AZM A;  3C1C A;  2Y2I A;  1P3O C;  3MGP A;  1AOI D;  4Z66 B;  4NFT A;  4J8U D;  4JJN B;  5AVC B;  2ZY4 A;  3R45 B;  1ZLA D;  1Q9C A;  1P3O D;  5JA4 B;  3W98 A;  3MVD D;  1EQZ C;  3REK D;  3W99 B;  1R4V A;  1P3I C;  3AL0 C;  4H9P A;  3AZE B;  1U35 B;  4QLC A;  2F2A C;  3F6T A;  4YM6 A;  1BH9 A;  4J8X C;  1H3O A;  1KX4 A;  3NQJ A;  1M1A A;  1P3B D;  5FUG A;  2ARO D;  3AZJ C;  2ARO A;  5JRG A;  4Z5T D;  4H9N B;  1F66 A;  5B1M A;  3AV2 D;  3X1T D;  3MGR B;  3B0D C;  2Y2G A;  3AFA A;  4R8P A;  4J8W B;  2IO5 C;  3VH5 W;  3UT9 A;  4WNN B;  5AV9 A;  3REI A;  4XZQ C;  3A6N A;  3KSY A;  3IP4 C;  4H9Q A;  4R8P C;  3KWQ D;  4J8U C;  5B31 B;  1TAF B;  5CPK B;  3AZF B;  4XUJ C;  2JCH A;  1BH8 A;  1ZLA C;  4YM6 B;  4KUD B;  3WTP D;  3WA9 B;  3A1I A;  1P3A B;  5AV8 A;  3REJ C;  2BYM A;  4KGC D;  5GXQ B;  5B24 B;  1H3O B;  1KX4 B;  3WAA C;  4ZUX A;  4G92 B;  4HGA C;  5B0Y D;  3AN2 B;  4WU9 A;  4AWL B;  1M18 A;  1ZLA B;  4LD9 C;  1JFI B;  5AVB D;  5B2I B;  5B33 D;  4XUJ D;  5B0Y C;  1M19 D;  2BYK B;  4WU8 D;  4AWL C;  3LEL A;  3LJA A;  5GSU A;  3B6G B;  4XZQ D;  5BO0 B;  1M1A C;  5CPJ A;  3REJ D;  3AZM B;  3MGQ A;  4QLC C;  3UT9 B;  1HQ3 D;  3UTB D;  4J8V A;  3REL A;  3W97 C;  3A6N B;  5AV6 A;  5AV5 B;  5GT3 B;  2Y2L A;  1B67 A;  3X1V D;  1P3A A;  1ID3 A;  1P3L B;  2CWE A;  3AZN A;  1BH8 B;  3MGQ C;  3C1B A;  5BNV A;  1P34 B;  3NQU B;  4ZBJ B;  4Z66 A;  2Y2Q A;  1JFI A;  1N1J B;  5JRG B;  5F99 C;  2IO5 B;  3W99 D;  2Y2H A;  3AZL C;  1M18 B;  4WJ3 C;  1BH9 B;  3B0D B;  2F8N B;  2JSS A;  5DNM B;  5C3I C;  5G49 A;  3AZJ B;  4X23 B;  3AZI B;  5BO0 A;  1ID3 D;  5B0Z D;  5AV6 D;  4J8X B;  3REK C;  1P3I A;  2Y2N A;  3MVD C;  3C1B B;  1EQZ D;  1TAF A;  5CPK A;  3MGS B;  5BT1 C;  4WU8 C;  4ZUX C;  3WAA A;  5B1M C;  2ZY3 A;  5B0Z A;  4G91 C;  3TU4 C;  3EPK A;  4H9S C;  3MGS C;  3LZ0 A;  3AZF A;  3UTB B;  1S32 D;  2NQB D;  1P3P D;  2F8N A;  2YFV A;  1P3L D;  1P3F C;  2FJ7 A;  3VH5 T;  5G49 B;  5GXQ A;  3MNN C;  4Z5T B;  3AN2 A;  3X1V C;  4WU9 B;  1P3K B;  3X1T B;  3AZG A;  5AV8 C;  4G91 B;  2RVQ D;  1B6W A;  2F8N H;  1M19 C;  1KX5 D;  3KXB B;  3KWQ A;  3AZN D;  3H0R C;  3X1U C;  3AZG C;  3C1C B;  1P34 C;  3REL D;  3B6G D;  3MGQ B;  2BG1 A;  2YFV B;  3MNN D;  4J8V B;  5CPK D;  5KDM A;  5JA4 A;  2XD5 A;  1HQ3 B;  5C3I B;  1ID3 B;  5GT0 C;  1N1J A;  3WKJ B;  3W97 B;  3O62 A;  3AZL A;  2Y2O A;  1M19 A;  2NZD D;  4QLC B;  3AZK B;  3W96 B;  1P3P C;  4Z5T A;  5BNV B;  1M1A B;  5AVB A;  4KGC B;  2HIO B;  5CPJ C;  4UUZ A;  3AN2 D;  3TU4 A;  1F66 B;  5B0Y B;  3REH D;  5B2J A;  3AYW A;  1S32 B;  2NQB B;  1AOI C;  3MVD A;  3VH6 W;  5BT1 D;  2RVQ C;  3KUY B;  5CPI B;  5AV8 D;  5BNX A;  1TZY C;  1HTA A;  4J8U A;  2CV5 C;  4WU8 B;  3MGP D;  2F8N D;  2NZD C;  1P3M D;  3FDD A;  3A6N C;  3AYW C;  2FFF B;  2RIQ A;  4EO5 B;  5KDM B;  4KUD A;  5DNM D;  3AZI C;  3WA9 C;  5B31 A;  4X23 C;  3A6N D;  2J8P A;  5AV5 D;  3B0B A;  4YM6 C;  4J8X A;  2UWX A;  3AZI D;  3UTB A;  3AZL D;  2YFW B;  1KX5 B;  3X1U D;  5F99 D;  5BS7 C;  1EQZ A;  1F66 C;  1M18 C;  1P3I D;  5B2I C;  5FUG B;  1TZY D;  2JE5 A;  2HIO C;  3AZK A;  5JRG C;  4G92 C;  3AN2 C;  4LD9 B;  3EPJ A;  3W96 C;  4E44 A;  2F8N K;  3EG5 B;  4DQY B;  3H0L C;  5B2I A;  3MGR C;  3WKJ C;  3AFA C;  4ZBJ C;  5B0Y A;  1ID3 C;  3B0C W;  4QLC D;  3X1S D;  3LZ1 C;  1P3L C;  1P3F D;  3C1C C;  1P3O A;  3W98 D;  3AFA B;  5CP6 C;  3WTP A;  3UT9 C;  4NE6 A;  3AZM C;  3REH A;  3TU4 D;  3C1B D;  1EQZ B;  1P3L A;  2FJ7 D;  3KUY C;  5AVC C;  5AV8 B;  1P3G A;  3EPH A;  4H9Q B;  3KXB D;  4WU9 C;  4LD9 A;  3AZF D;  3LZ0 D;  2YFW A;  5B24 A;  3LZ1 D;  3O62 D;  3AV1 B;  4KGC C;  3MGQ D;  3VH5 A;  3REJ A;  4UPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...