5BS7C

Structure of histone h3/h4 in complex with spt2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
69
structure length
69
Chain Sequence
QGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structure-function studies of histone H3/H4 tetramer maintenance during transcription by chaperone Spt2.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription regulator
total genus 25
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bs7C00
5GSUC 3UTAA 5GXQB 1KX3B 4H9SA 3AZHB 4G91C 5B1MB 4YS3D 4KGCC 2HIOC 3C1BC 3C1CB 1ZLAB 5G49B 4X23C 3AZLC 2HIOD 4XZQA 4J8VD 1M19B 3AFAC 4X23D 4J8XA 3KSYA 3AYWA 5AVCA 4H9QB 3KXBD 5B33A 2F8NH 5CPJC 4LD9A 1P34D 3AV2B 4WU9A 3VH6A 3V9RB 3W98B 1U35A 5GT0A 5CPJD 3WA9C 4H9OB 5JRGB 3W99A 5BO0A 2FJ7D 3LZ1B 1F66D 5GT3C 5E5AC 4R8PB 1JFIB 3AZKD 4YS3A 5B32D 3AN2D 3WTPD 1M1AC 4J8VA 5DNND 4X23A 3AZNC 1TAFB 1HQ3C 5B2JC 5BT1C 3UT9B 3AZJD 3B0CT 3AV1C 1P3BC 5AV6D 3LJAC 3KXBA 4UUZA 3UTBB 3AV1D 5GXQC 3A6ND 1P34A 3X1VD 3AZHC 3LJAD 4QLCC 2L5AA 5GXQD 3NQUB 1KX3D 4NFTA 2FJ7A 3C1CC 5B1MD 1F66A 4CSRB 5B0ZB 4WU8C 1ZLAD 4M6BA 3MGQB 3AZKA 5B32A 1M19D 5B1LB 3AN2A 3WTPA 5AV8B 5DNNA 3W98C 3W96B 2BYMA 4XUJA 5B31A 1S32B 1P3IB 3AZJA 3KWQC 3AV2D 3W98D 5KDMB 5AV6A 3MGPD 1TZYA 5AVBC 1EQZB 3AZGB 5JRGD 3A6NA 1P3GB 3X1VA 3LZ1D 5GSUB 1H3OB 4R8PC 4J8UC 3TU4D 1P3LC 1P3FC 4Z2MG 5GXQA 3AZMC 1KX3A 3X1UB 4Z66B 4R8PD 4G91B 5B1MA 4KGCB 2RVQC 1ZLAA 5G49A 3AZLB 1ID3C 1AOID 1HTAA 3REJD 3AFAB 1M19A 2CV5C 3UTBC 3LZ0D 3UT9D 3REIB 4H9QA 3AV2A 3V9RA 3MVDD 4NE5A 3MGPA 3B6FD 4H9OA 1P3OB 5JRGA 3R45B 3LZ1A 4Z5TC 3TU4A 5AV9D 3MGQC 5B0ZD 4CAYB 3AZED 5B1LC 4R8PA 3B6GC 5CPKB 2IO5B 3W96C 1AOIA 1S32C 1M1AB 5BS7C 1P3IC 3REJA 5AV8D 3AZNB 5B2JB 5CP6B 1TAFA 3X1SD 4YM6C 1S32D 3LZ0A 3UT9A 5BNVB 3AZFD 3AZGC 1P3ID 1EQZC 1B67A 1P3AC 5F99A 2F8NG 1P3GD 3X1UC 3KUYB 5GSUD 4Z66C 3MVDA 2PYOB 3B6FA 4QLCB 4WZSB 3MNNC 5B0YB 5FUGB 4KGCD 2CWEA 5AV9A 3C1BD 4H9NA 4CSRA 5B0ZA 4WU8B 3AZEA 3AZLD 4WV4B 3REIC 3AFAD 1R4VA 3W97B 1P3MC 4NE3A 1M18C 5B2IB 3X1TC 5AV8A 3VH5A 3X1SA 3B0DB 2YFWA 3KWQB 1P3IA 4KUDC 3AZFA 1P3OC 5KDMA 5B40C 5AVBB 3WA9D 1KX5B 1P3OD 1P3GA 1P3LB 4J8UB 1P3PC 1BH9B 5GSUA 1P3FB 3NQJB 5GT3D 3AZMB 5CPKC 5E5AD 2IO5C 3REHB 4ZUXB 4KGCA 2HIOA 3C1BA 5DNMC 3VH6W 1P3KB 1ID3B 3AZLA 5CP6C 3WAAC 1M1AD 3AFAA 3AZND 2CV5B 1HQ3D 5B2JD 5BT1D 5CP6D 3RELB 1P3BD 1BH8B 3KUYC 2PYOC 5CPJA 1KX4C 3AZHD 5C3IC 5B31G 3KUYD 2PYOD 2NQBB 3WA9A 4QLCD 5B0YC 4Z5TB 3R45A 3LELB 3C1CD 3AZIC 2NZDB 2BYKB 5GT3A 5E5AA 4WU8D 3WKJB 1N1JA 3B6GB 3MGRC 3W97C 5JA4A 1WWIA 4H9RB 5CPIC 5B2IC 3B0DC 1M1AA 3AZNA 1HQ3A 5B2JA 5CP6A 4YM6B 1KX5C 3AV1A 3KWQD 1P3BA 5BNVA 1P3AB 5AVBD 3LJAA 1KX5D 4J8WC 3AZHA 1P3LD 4J8UD 3REHC 2F8NB 2PYOA 1P3FD 5B24C 4ZUXC 4QLCA 3AZMD 3MNNB 3C1CA 4JJNB 1P3KC 4WU9B 5GT0B 3VH6T 2RVQD 4WU8A 1P3KD 3MGSB 1ID3D 5BO0B 3W99B 3RELC 2CV5D 3UTBD 4ZBJC 1P3MB 1M18B 3X1TB 3W98A 4YS3B 2AROC 2NQBC 1BFMA 4KUDB 3KWQA 5B40B 5AVBA 5AY8C 3LELC 2NQBD 2NZDC 1P3PB 1P3LA 4Z5TD 4J8UA 1KU5A 1BH9A 3LELD 1JFIA 1P3FA 3WKJC 2NZDD 3MGQD 3NQJA 3AZMA 3KXBB 4UUZB 5B1LD 3B6GD 4H9SC 3O62B 5DNMB 3W96D 4Z2MH 1ID3A 3WAAB 4WNNB 4G92B 2CV5A 4YM6D 3UTBA 4XZQC 1EQZD 3AZGD 4J8XC 1P3AD 1BH8A 3AYWC 5B32B 5AVCC 1KX4B 3REKB 3NQUA 3X1UD 5C3IB 5CHLB 4Z66D 5B33C 2F8ND 4KHAB 4LD9C 4JJNC 4WU9C 1U35C 2BYMB 5GT0C 5B31B 4XUJB 3MNND 4Z5TA 4JJND 3AZIB 3MGSC 3W99C 5AV6B 3MGQA 1TZYB 5AV5B 5B1LA 4EO5C 3MGSD 3MGRB 3A6NB 3B6GA 3X1VB 3REID 5CPIB 4H9RA 3W96A 4YS3C 1P3MD 1S32A 1M18D 5BS7A 3X1TD 1WWSA 4YM6A 1EQZA 4J8VC 4KUDD 3AZGA 1P3AA 5B40D 1H3OA 4J8WB 3X1UA 3KXBC 1P3PD 4Z66A 2F8NA 5B24B 2YFVB 1P34C 5CPKD 3O62C 4AWLC 3MNNA 4JJNA 3VH5W 3O62D 2FJ7C 5DNMD 3MGPB 1F1EA 1F66C 4G92C 3MGSA 3WAAD 5B32G 4H9PB 1ULYA 3REIA 3TU4B 3AZKC 4ZBJB 1A7WA 5B32C 1P3MA 3AN2C 1M18A 3WTPC 3REKC 3X1TA 2AROB 5BNXB 1KX4D 4KUDA 5DNNC 3REKD 1P3OA 1AOIB 5B31C 5B40A 5AY8B 4XUJC 5B0YD 3REJB 3AZJC 5AV6C 4XUJD 1TZYC 4CAYA 5B31D 1P3PA 5AV5C 3LZ0B 3AZID 2HUEC 3A6NC 5CPKA 3X1VC 5F99B 1TZYD 3UTAB 5AV5D 3B0BA 3MGRD 1KX3C 3O62A 3W97D 3MVDB 5CPID 5DNMA 3B6FB 5B2ID 4HGAB 5B1MC 3WAAA 4WNNA 1ZLAC 2JSSA 5AV9B 4H9NB 4XZQB 3AZEB 1M19C 4J8XB 3AYWB 3KUYA 5AVCB 4J8WD 1KX4A 3REKA 5B33B 3REHD 4LD9B 5B24D 4KHAA 4ZUXD 5B0YA 5FUGA 3AV2C 1U35B 3MGPC 3X1SB 2YFWB 3AZIA 3VH5T 3AZFB 5JRGC 3LZ1C 4E45A 4EO5B 5AV5A 3TU4C 3MGRA 3RELD 3W97A 4DRBA 1Q9CA 5CPIA 5B2IA 2HIOB 3C1BB 1AOIC 2AROD 1KX5A 4J8VB 3REJC 4X23B 4NE6A 5AY8D 3LZ0C 3UT9C 4J8WA 3WTPE 5F99C 3WKJD 3REHA 1B6WA 3UTAC 5B24A 4ZUXA 2YFVA 1P34B 4AWLB 5F99D 2LY8A 3MVDC 3UTAD 5CPJB 3B6FC 4HGAC 1P3KA 2FJ7B 3WA9B 1F66B 5AV9C 2F8NK 5B0ZC 3RELA 3AZEC 4H9PA 3AZKB 5GT3B 4XZQD 5E5AB 3AN2B 4DRAA 4J8XD 3WTPB 1N1JB 3AYWD 5JA4B 5AVCD 2AROA 2NQBA 5BNXA 5DNNB 5AV8C 5B33D 4E44A 3X1SC 4LD9D 5AY8A 3LELA 3AZJB 4WU9D 3B0CW 3AZFC 2BYKA 2NZDA 1U35D 5GT0D 1HQ3B 3WKJA 3AV1B 1P3BB 2HUEB 3W99D 1P3GC 3LJAB
chains in the Genus database with same CATH superfamily
5GSUC 3UTAA 5GXQB 1KX3B 4H9SA 3AZHB 4G91C 5B1MB 4YS3D 4KGCC 2HIOC 3C1BC 3C1CB 1ZLAB 5G49B 4X23C 3AZLC 2HIOD 4XZQA 4J8VD 1M19B 3AFAC 4X23D 4J8XA 2Y2MA 3KSYA 4WJ3C 3KFUG 3AYWA 5AVCA 4H9QB 3KXBD 5B33A 3F6TA 2F8NH 5CPJC 4LD9A 1P34D 2ZY5A 3AV2B 4WU9A 3VH6A 3V9RB 3W98B 1U35A 5GT0A 5CPJD 3WA9C 4H9OB 5JRGB 3W99A 5BO0A 2FJ7D 3LZ1B 1F66D 5GT3C 5E5AC 4R8PB 1JFIB 3AZKD 4YS3A 5B32D 3AN2D 3WTPD 2ZY2A 1M1AC 4J8VA 5DNND 4X23A 2DQNC 3AZNC 1TAFB 1HQ3C 5B2JC 2J8PA 5BT1C 3UT9B 3AZJD 3B0CT 2XD5A 3AV1C 1P3BC 5AV6D 3LJAC 3KXBA 4UUZA 3UTBB 3AV1D 3EPHA 5GXQC 3A6ND 1P34A 3X1VD 3AZHC 3LJAD 4QLCC 2L5AA 5GXQD 3NQUB 1KX3D 4NFTA 2FJ7A 3C1CC 5B1MD 1F66A 4CSRB 5B0ZB 4WU8C 1ZLAD 4M6BA 3MGQB 3AZKA 2DF4C 5B32A 1M19D 5B1LB 3AN2A 3WTPA 5AV8B 5DNNA 3W98C 3W96B 2BYMA 4XUJA 5B31A 1S32B 1P3IB 3AZJA 3KWQC 3AV2D 3W98D 5KDMB 5AV6A 3MGPD 1TZYA 2ZY4A 5AVBC 1EQZB 3AZGB 5JRGD 3A6NA 1P3GB 3X1VA 3LZ1D 5GSUB 1H3OB 4R8PC 4J8UC 3TU4D 1P3LC 1P3FC 4Z2MG 5GXQA 3AZMC 1KX3A 3X1UB 4Z66B 4R8PD 4G91B 5B1MA 4KGCB 2RVQC 1ZLAA 3P5JB 5G49A 3AZLB 1ID3C 1AOID 2XD1A 1HTAA 3REJD 3AFAB 1M19A 2CV5C 3UTBC 3LZ0D 3UT9D 3REIB 4H9QA 3AV2A 3V9RA 3MVDD 4NE5A 3H0RC 3MGPA 3B6FD 4H9OA 1P3OB 5JRGA 3R45B 3LZ1A 4Z5TC 3TU4A 5AV9D 3MGQC 5B0ZD 4CAYB 3AZED 5B1LC 4R8PA 3B6GC 5CPKB 3H0LC 2IO5B 3W96C 2JCHA 1AOIA 1S32C 1M1AB 5BS7C 1P3IC 3REJA 5AV8D 3AZNB 5B2JB 5CP6B 1TAFA 3X1SD 4YM6C 1S32D 3LZ0A 3UT9A 5BNVB 3AZFD 3AZGC 1P3ID 1EQZC 1B67A 1P3AC 5F99A 2F8NG 1P3GD 3X1UC 3KUYB 5GSUD 4Z66C 3H0MC 3IP4C 3MVDA 2PYOB 3B6FA 4QLCB 4WZSB 3MNNC 3EPLA 5B0YB 5FUGB 4KGCD 2CWEA 5AV9A 3C1BD 4H9NA 4CSRA 5B0ZA 4WU8B 3AZEA 3AZLD 4WV4B 2F2AC 3REIC 3AFAD 1R4VA 3W97B 1P3MC 4NE3A 1M18C 5B2IB 3X1TC 5AV8A 3VH5A 3X1SA 2ZY3A 3B0DB 2YFWA 3KWQB 1P3IA 2Y2HA 3AZFA 4KUDC 1P3OC 5KDMA 5B40C 5AVBB 3WA9D 1KX5B 3EPJA 1P3OD 1P3GA 1P3LB 4J8UB 2Y2KA 1P3PC 1BH9B 5GSUA 1P3FB 3NQJB 5GT3D 3AZMB 5CPKC 5E5AD 2IO5C 3REHB 4ZUXB 4KGCA 2HIOA 3C1BA 5DNMC 1Z2CB 3VH6W 1P3KB 1ID3B 3AZLA 5CP6C 3WAAC 1M1AD 3AFAA 3AZND 2CV5B 1HQ3D 5B2JD 5BT1D 5CP6D 3RELB 1P3BD 2Y2NA 1BH8B 3KUYC 2PYOC 5CPJA 1KX4C 3AZHD 2RIQA 5C3IC 5B31G 3KUYD 2PYOD 2NQBB 3WA9A 4QLCD 5B0YC 4Z5TB 3R45A 3LELB 3C1CD 3AZIC 2NZDB 2BYKB 5GT3A 5E5AA 4WU8D 3WKJB 2JE5A 1N1JA 3B6GB 3MGRC 3EG5B 3W97C 5JA4A 1WWIA 4H9RB 5CPIC 5B2IC 2W8SA 3B0DC 1M1AA 2Y2QA 3AZNA 1HQ3A 5B2JA 5CP6A 4YM6B 1KX5C 3AV1A 3KWQD 1P3BA 5BNVA 1P3AB 5AVBD 3LJAA 1KX5D 2G5IC 4J8WC 3AZHA 1P3LD 4J8UD 3REHC 2F8NB 2PYOA 1P3FD 5B24C 4ZUXC 4QLCA 3AZMD 3MNNB 3C1CA 4JJNB 1P3KC 4WU9B 5GT0B 3VH6T 2RVQD 4WU8A 1P3KD 3MGSB 1ID3D 5BO0B 3W99B 3RELC 2FFFB 2CV5D 3UTBD 4ZBJC 1P3MB 1M18B 3X1TB 3W98A 4YS3B 2AROC 2NQBC 1BFMA 3A1IA 4KUDB 3KWQA 5B40B 5AVBA 5AY8C 3LELC 2NQBD 2NZDC 2Y2PA 1P3PB 1P3LA 4Z5TD 4J8UA 1KU5A 1BH9A 3LELD 1JFIA 1P3FA 3WKJC 2NZDD 3MGQD 3NQJA 3AZMA 3KXBB 4UUZB 5B1LD 3B6GD 4H9SC 3O62B 5DNMB 3AL0C 3W96D 4Z2MH 1ID3A 3WAAB 4WNNB 2Y2IA 3A1KA 4G92B 2CV5A 4YM6D 3UTBA 4XZQC 1EQZD 3AZGD 4J8XC 1P3AD 1BH8A 3AYWC 5B32B 5AVCC 1KX4B 3REKB 3NQUA 3X1UD 5C3IB 5CHLB 4Z66D 5B33C 2F8ND 4KHAB 4LD9C 4JJNC 2Y2JA 4WU9C 1U35C 2BYMB 5GT0C 5B31B 4XUJB 3MNND 4Z5TA 4JJND 3AZIB 3MGSC 3W99C 5AV6B 3MGQA 1TZYB 5AV5B 5B1LA 4EO5C 3MGSD 3MGRB 3A6NB 3B6GA 3X1VB 3REID 5CPIB 4H9RA 3W96A 4YS3C 1P3MD 1S32A 1M18D 5BS7A 3X1TD 4UPKA 1WWSA 4YM6A 1EQZA 4J8VC 4KUDD 3AZGA 1P3AA 5B40D 1H3OA 4J8WB 3X1UA 3KXBC 1P3PD 4Z66A 2F8NA 5B24B 2YFVB 1P34C 5CPKD 3O62C 4AWLC 3MNNA 4JJNA 3VH5W 3O62D 2FJ7C 5DNMD 3MGPB 1F1EA 4DQYB 1F66C 4G92C 3MGSA 3WAAD 5B32G 4H9PB 1ULYA 3REIA 3TU4B 2BG1A 3AZKC 4ZBJB 1A7WA 5B32C 1P3MA 3AN2C 1M18A 3WTPC 3REKC 3X1TA 2AROB 5BNXB 1KX4D 4KUDA 5DNNC 3REKD 1P3OA 1AOIB 5B31C 5B40A 5AY8B 4XUJC 5B0YD 3REJB 3AZJC 3FDDA 5AV6C 4XUJD 1TZYC 4CAYA 5B31D 1P3PA 5AV5C 3LZ0B 3AZID 2HUEC 3A6NC 5CPKA 3X1VC 5F99B 1TZYD 3UTAB 5AV5D 3B0BA 3MGRD 1KX3C 3O62A 3W97D 3MVDB 5CPID 5DNMA 3B6FB 5B2ID 4HGAB 5B1MC 3WAAA 4WNNA 1ZLAC 2JSSA 5AV9B 4H9NB 4XZQB 3AZEB 1M19C 4J8XB 2Y2OA 3AYWB 3KUYA 5AVCB 4J8WD 1KX4A 3REKA 5B33B 3REHD 4LD9B 5B24D 4KHAA 4ZUXD 5B0YA 5FUGA 3AV2C 1U35B 3MGPC 3X1SB 2YFWB 3AZIA 3VH5T 3AZFB 5JRGC 3LZ1C 4E45A 4EO5B 5AV5A 3TU4C 3MGRA 2UWXA 3RELD 3W97A 4DRBA 1Q9CA 5CPIA 5B2IA 2HIOB 3C1BB 1AOIC 2AROD 1KX5A 4J8VB 3REJC 4X23B 4NE6A 5AY8D 3LZ0C 3UT9C 4J8WA 3WTPE 5F99C 3EPKA 3WKJD 3REHA 2VQRA 1B6WA 3UTAC 5B24A 4ZUXA 2YFVA 1P34B 4AWLB 5F99D 2LY8A 3MVDC 3UTAD 5CPJB 3B6FC 4HGAC 1P3KA 2FJ7B 3WA9B 1F66B 5AV9C 1T3UA 2F8NK 5B0ZC 3RELA 3AZEC 4H9PA 3AZKB 5GT3B 4XZQD 5E5AB 3AN2B 4DRAA 4J8XD 3WTPB 1N1JB 3AYWD 2ZM5A 5JA4B 5AVCD 2AROA 1W2EA 2NQBA 5BNXA 5DNNB 5AV8C 5B33D 4E44A 2G5HC 3X1SC 4LD9D 5AY8A 3LELA 3AZJB 4WU9D 3B0CW 3AZFC 2BYKA 2NZDA 1U35D 5GT0D 1HQ3B 3WKJA 3AV1B 2Y2LA 1P3BB 1PZRA 2HUEB 2Y2GA 3W99D 1P3GC 3LJAB
chains in the Genus database with same CATH topology
5GSUC 3UTAA 5GXQB 1KX3B 4H9SA 3AZHB 4G91C 5B1MB 4YS3D 4KGCC 2HIOC 3C1BC 3C1CB 1ZLAB 5G49B 4X23C 3AZLC 2HIOD 4XZQA 4J8VD 1M19B 3AFAC 4X23D 4J8XA 2Y2MA 3KSYA 4WJ3C 3KFUG 3AYWA 5AVCA 4H9QB 3KXBD 5B33A 3F6TA 2F8NH 5CPJC 4LD9A 1P34D 2ZY5A 3AV2B 4WU9A 3VH6A 3V9RB 3W98B 1U35A 5GT0A 5CPJD 3WA9C 4H9OB 5JRGB 3W99A 5BO0A 2FJ7D 3LZ1B 1F66D 5GT3C 5E5AC 4R8PB 1JFIB 3AZKD 4YS3A 5B32D 3AN2D 3WTPD 2ZY2A 1M1AC 4J8VA 5DNND 4X23A 2DQNC 3AZNC 1TAFB 1HQ3C 5B2JC 2J8PA 5BT1C 3UT9B 3AZJD 3B0CT 2XD5A 3AV1C 1P3BC 5AV6D 3LJAC 3KXBA 4UUZA 3UTBB 3AV1D 3EPHA 5GXQC 3A6ND 1P34A 3X1VD 3AZHC 3LJAD 4QLCC 2L5AA 5GXQD 3NQUB 1KX3D 4NFTA 2FJ7A 3C1CC 5B1MD 1F66A 4CSRB 5B0ZB 4WU8C 1ZLAD 4M6BA 3MGQB 3AZKA 2DF4C 5B32A 1M19D 5B1LB 3AN2A 3WTPA 5AV8B 5DNNA 3W98C 3W96B 2BYMA 4XUJA 5B31A 1S32B 1P3IB 3AZJA 3KWQC 3AV2D 3W98D 5KDMB 5AV6A 3MGPD 1TZYA 2ZY4A 5AVBC 1EQZB 3AZGB 5JRGD 3A6NA 1P3GB 3X1VA 3LZ1D 5GSUB 1H3OB 4R8PC 4J8UC 3TU4D 1P3LC 1P3FC 4Z2MG 5GXQA 3AZMC 1KX3A 3X1UB 4Z66B 4R8PD 4G91B 5B1MA 4KGCB 2RVQC 1ZLAA 3P5JB 5G49A 3AZLB 1ID3C 1AOID 2XD1A 1HTAA 3REJD 3AFAB 1M19A 2CV5C 3UTBC 3LZ0D 3UT9D 3REIB 4H9QA 3AV2A 3V9RA 3MVDD 4NE5A 3H0RC 3MGPA 3B6FD 4H9OA 1P3OB 5JRGA 3R45B 3LZ1A 4Z5TC 3TU4A 5AV9D 3MGQC 5B0ZD 4CAYB 3AZED 5B1LC 4R8PA 3B6GC 5CPKB 3H0LC 2IO5B 3W96C 2JCHA 1AOIA 1S32C 1M1AB 5BS7C 1P3IC 3REJA 5AV8D 3AZNB 5B2JB 5CP6B 1TAFA 3X1SD 4YM6C 1S32D 3LZ0A 3UT9A 5BNVB 3AZFD 3AZGC 1P3ID 1EQZC 1B67A 1P3AC 5F99A 2F8NG 1P3GD 3X1UC 3KUYB 5GSUD 4Z66C 3H0MC 3IP4C 3MVDA 2PYOB 3B6FA 4QLCB 4WZSB 3MNNC 3EPLA 5B0YB 5FUGB 4KGCD 2CWEA 5AV9A 3C1BD 4H9NA 4CSRA 5B0ZA 4WU8B 3AZEA 3AZLD 4WV4B 2F2AC 3REIC 3AFAD 1R4VA 3W97B 1P3MC 4NE3A 1M18C 5B2IB 3X1TC 5AV8A 3VH5A 3X1SA 2ZY3A 3B0DB 2YFWA 3KWQB 1P3IA 2Y2HA 3AZFA 4KUDC 1P3OC 5KDMA 5B40C 5AVBB 3WA9D 1KX5B 3EPJA 1P3OD 1P3GA 1P3LB 4J8UB 2Y2KA 1P3PC 1BH9B 5GSUA 1P3FB 3NQJB 5GT3D 3AZMB 5CPKC 5E5AD 2IO5C 3REHB 4ZUXB 4KGCA 2HIOA 3C1BA 5DNMC 1Z2CB 3VH6W 1P3KB 1ID3B 3AZLA 5CP6C 3WAAC 1M1AD 3AFAA 3AZND 2CV5B 1HQ3D 5B2JD 5BT1D 5CP6D 3RELB 1P3BD 2Y2NA 1BH8B 3KUYC 2PYOC 5CPJA 1KX4C 3AZHD 2RIQA 5C3IC 5B31G 3KUYD 2PYOD 2NQBB 3WA9A 4QLCD 5B0YC 4Z5TB 3R45A 3LELB 3C1CD 3AZIC 2NZDB 2BYKB 5GT3A 5E5AA 4WU8D 3WKJB 2JE5A 1N1JA 3B6GB 3MGRC 3EG5B 3W97C 5JA4A 1WWIA 4H9RB 5CPIC 5B2IC 2W8SA 3B0DC 1M1AA 2Y2QA 3AZNA 1HQ3A 5B2JA 5CP6A 4YM6B 1KX5C 3AV1A 3KWQD 1P3BA 5BNVA 1P3AB 5AVBD 3LJAA 1KX5D 2G5IC 4J8WC 3AZHA 1P3LD 4J8UD 3REHC 2F8NB 2PYOA 1P3FD 5B24C 4ZUXC 4QLCA 3AZMD 3MNNB 3C1CA 4JJNB 1P3KC 4WU9B 5GT0B 3VH6T 2RVQD 4WU8A 1P3KD 3MGSB 1ID3D 5BO0B 3W99B 3RELC 2FFFB 2CV5D 3UTBD 4ZBJC 1P3MB 1M18B 3X1TB 3W98A 4YS3B 2AROC 2NQBC 1BFMA 3A1IA 4KUDB 3KWQA 5B40B 5AVBA 5AY8C 3LELC 2NQBD 2NZDC 2Y2PA 1P3PB 1P3LA 4Z5TD 4J8UA 1KU5A 1BH9A 3LELD 1JFIA 1P3FA 3WKJC 2NZDD 3MGQD 3NQJA 3AZMA 3KXBB 4UUZB 5B1LD 3B6GD 4H9SC 3O62B 5DNMB 3AL0C 3W96D 4Z2MH 1ID3A 3WAAB 4WNNB 2Y2IA 3A1KA 4G92B 2CV5A 4YM6D 3UTBA 4XZQC 1EQZD 3AZGD 4J8XC 1P3AD 1BH8A 3AYWC 5B32B 5AVCC 1KX4B 3REKB 3NQUA 3X1UD 5C3IB 5CHLB 4Z66D 5B33C 2F8ND 4KHAB 4LD9C 4JJNC 2Y2JA 4WU9C 1U35C 2BYMB 5GT0C 5B31B 4XUJB 3MNND 4Z5TA 4JJND 3AZIB 3MGSC 3W99C 5AV6B 3MGQA 1TZYB 5AV5B 5B1LA 4EO5C 3MGSD 3MGRB 3A6NB 3B6GA 3X1VB 3REID 5CPIB 4H9RA 3W96A 4YS3C 1P3MD 1S32A 1M18D 5BS7A 3X1TD 4UPKA 1WWSA 4YM6A 1EQZA 4J8VC 4KUDD 3AZGA 1P3AA 5B40D 1H3OA 4J8WB 3X1UA 3KXBC 1P3PD 4Z66A 2F8NA 5B24B 2YFVB 1P34C 5CPKD 3O62C 4AWLC 3MNNA 4JJNA 3VH5W 3O62D 2FJ7C 5DNMD 3MGPB 1F1EA 4DQYB 1F66C 4G92C 3MGSA 3WAAD 5B32G 4H9PB 1ULYA 3REIA 3TU4B 2BG1A 3AZKC 4ZBJB 1A7WA 5B32C 1P3MA 3AN2C 1M18A 3WTPC 3REKC 3X1TA 2AROB 5BNXB 1KX4D 4KUDA 5DNNC 3REKD 1P3OA 1AOIB 5B31C 5B40A 5AY8B 4XUJC 5B0YD 3REJB 3AZJC 3FDDA 5AV6C 4XUJD 1TZYC 4CAYA 5B31D 1P3PA 5AV5C 3LZ0B 3AZID 2HUEC 3A6NC 5CPKA 3X1VC 5F99B 1TZYD 3UTAB 5AV5D 3B0BA 3MGRD 1KX3C 3O62A 3W97D 3MVDB 5CPID 5DNMA 3B6FB 5B2ID 4HGAB 5B1MC 3WAAA 4WNNA 1ZLAC 2JSSA 5AV9B 4H9NB 4XZQB 3AZEB 1M19C 4J8XB 2Y2OA 3AYWB 3KUYA 5AVCB 4J8WD 1KX4A 3REKA 5B33B 3REHD 4LD9B 5B24D 4KHAA 4ZUXD 5B0YA 5FUGA 3AV2C 1U35B 3MGPC 3X1SB 2YFWB 3AZIA 3VH5T 3AZFB 5JRGC 3LZ1C 4E45A 4EO5B 5AV5A 3TU4C 3MGRA 2UWXA 3RELD 3W97A 4DRBA 1Q9CA 5CPIA 5B2IA 2HIOB 3C1BB 1AOIC 2AROD 1KX5A 4J8VB 3REJC 4X23B 4NE6A 5AY8D 3LZ0C 3UT9C 4J8WA 3WTPE 5F99C 3EPKA 3WKJD 3REHA 2VQRA 1B6WA 3UTAC 5B24A 4ZUXA 2YFVA 1P34B 4AWLB 5F99D 2LY8A 3MVDC 3UTAD 5CPJB 3B6FC 4HGAC 1P3KA 2FJ7B 3WA9B 1F66B 5AV9C 1T3UA 2F8NK 5B0ZC 3RELA 3AZEC 4H9PA 3AZKB 5GT3B 4XZQD 5E5AB 3AN2B 4DRAA 4J8XD 3WTPB 1N1JB 3AYWD 2ZM5A 5JA4B 5AVCD 2AROA 1W2EA 2NQBA 5BNXA 5DNNB 5AV8C 5B33D 4E44A 2G5HC 3X1SC 4LD9D 5AY8A 3LELA 3AZJB 4WU9D 3B0CW 3AZFC 2BYKA 2NZDA 1U35D 5GT0D 1HQ3B 3WKJA 3AV1B 2Y2LA 1P3BB 1PZRA 2HUEB 2Y2GA 3W99D 1P3GC 3LJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU C;  3UTA A;  5GXQ B;  1KX3 B;  4H9S A;  3AZH B;  4G91 C;  5B1M B;  4YS3 D;  4KGC C;  2HIO C;  3C1B C;  3C1C B;  1ZLA B;  5G49 B;  4X23 C;  3AZL C;  2HIO D;  4XZQ A;  4J8V D;  1M19 B;  3AFA C;  4X23 D;  4J8X A;  3KSY A;  3AYW A;  5AVC A;  4H9Q B;  3KXB D;  5B33 A;  2F8N H;  5CPJ C;  4LD9 A;  1P34 D;  3AV2 B;  4WU9 A;  3VH6 A;  3V9R B;  3W98 B;  1U35 A;  5GT0 A;  5CPJ D;  3WA9 C;  4H9O B;  5JRG B;  3W99 A;  5BO0 A;  2FJ7 D;  3LZ1 B;  1F66 D;  5GT3 C;  5E5A C;  4R8P B;  1JFI B;  3AZK D;  4YS3 A;  5B32 D;  3AN2 D;  3WTP D;  1M1A C;  4J8V A;  5DNN D;  4X23 A;  3AZN C;  1TAF B;  1HQ3 C;  5B2J C;  5BT1 C;  3UT9 B;  3AZJ D;  3B0C T;  3AV1 C;  1P3B C;  5AV6 D;  3LJA C;  3KXB A;  4UUZ A;  3UTB B;  3AV1 D;  5GXQ C;  3A6N D;  1P34 A;  3X1V D;  3AZH C;  3LJA D;  4QLC C;  2L5A A;  5GXQ D;  3NQU B;  1KX3 D;  4NFT A;  2FJ7 A;  3C1C C;  5B1M D;  1F66 A;  4CSR B;  5B0Z B;  4WU8 C;  1ZLA D;  4M6B A;  3MGQ B;  3AZK A;  5B32 A;  1M19 D;  5B1L B;  3AN2 A;  3WTP A;  5AV8 B;  5DNN A;  3W98 C;  3W96 B;  2BYM A;  4XUJ A;  5B31 A;  1S32 B;  1P3I B;  3AZJ A;  3KWQ C;  3AV2 D;  3W98 D;  5KDM B;  5AV6 A;  3MGP D;  1TZY A;  5AVB C;  1EQZ B;  3AZG B;  5JRG D;  3A6N A;  1P3G B;  3X1V A;  3LZ1 D;  5GSU B;  1H3O B;  4R8P C;  4J8U C;  3TU4 D;  1P3L C;  1P3F C;  4Z2M G;  5GXQ A;  3AZM C;  1KX3 A;  3X1U B;  4Z66 B;  4R8P D;  4G91 B;  5B1M A;  4KGC B;  2RVQ C;  1ZLA A;  5G49 A;  3AZL B;  1ID3 C;  1AOI D;  1HTA A;  3REJ D;  3AFA B;  1M19 A;  2CV5 C;  3UTB C;  3LZ0 D;  3UT9 D;  3REI B;  4H9Q A;  3AV2 A;  3V9R A;  3MVD D;  4NE5 A;  3MGP A;  3B6F D;  4H9O A;  1P3O B;  5JRG A;  3R45 B;  3LZ1 A;  4Z5T C;  3TU4 A;  5AV9 D;  3MGQ C;  5B0Z D;  4CAY B;  3AZE D;  5B1L C;  4R8P A;  3B6G C;  5CPK B;  2IO5 B;  3W96 C;  1AOI A;  1S32 C;  1M1A B;  5BS7 C;  1P3I C;  3REJ A;  5AV8 D;  3AZN B;  5B2J B;  5CP6 B;  1TAF A;  3X1S D;  4YM6 C;  1S32 D;  3LZ0 A;  3UT9 A;  5BNV B;  3AZF D;  3AZG C;  1P3I D;  1EQZ C;  1B67 A;  1P3A C;  5F99 A;  2F8N G;  1P3G D;  3X1U C;  3KUY B;  5GSU D;  4Z66 C;  3MVD A;  2PYO B;  3B6F A;  4QLC B;  4WZS B;  3MNN C;  5B0Y B;  5FUG B;  4KGC D;  2CWE A;  5AV9 A;  3C1B D;  4H9N A;  4CSR A;  5B0Z A;  4WU8 B;  3AZE A;  3AZL D;  4WV4 B;  3REI C;  3AFA D;  1R4V A;  3W97 B;  1P3M C;  4NE3 A;  1M18 C;  5B2I B;  3X1T C;  5AV8 A;  3VH5 A;  3X1S A;  3B0D B;  2YFW A;  3KWQ B;  1P3I A;  4KUD C;  3AZF A;  1P3O C;  5KDM A;  5B40 C;  5AVB B;  3WA9 D;  1KX5 B;  1P3O D;  1P3G A;  1P3L B;  4J8U B;  1P3P C;  1BH9 B;  5GSU A;  1P3F B;  3NQJ B;  5GT3 D;  3AZM B;  5CPK C;  5E5A D;  2IO5 C;  3REH B;  4ZUX B;  4KGC A;  2HIO A;  3C1B A;  5DNM C;  3VH6 W;  1P3K B;  1ID3 B;  3AZL A;  5CP6 C;  3WAA C;  1M1A D;  3AFA A;  3AZN D;  2CV5 B;  1HQ3 D;  5B2J D;  5BT1 D;  5CP6 D;  3REL B;  1P3B D;  1BH8 B;  3KUY C;  2PYO C;  5CPJ A;  1KX4 C;  3AZH D;  5C3I C;  5B31 G;  3KUY D;  2PYO D;  2NQB B;  3WA9 A;  4QLC D;  5B0Y C;  4Z5T B;  3R45 A;  3LEL B;  3C1C D;  3AZI C;  2NZD B;  2BYK B;  5GT3 A;  5E5A A;  4WU8 D;  3WKJ B;  1N1J A;  3B6G B;  3MGR C;  3W97 C;  5JA4 A;  1WWI A;  4H9R B;  5CPI C;  5B2I C;  3B0D C;  1M1A A;  3AZN A;  1HQ3 A;  5B2J A;  5CP6 A;  4YM6 B;  1KX5 C;  3AV1 A;  3KWQ D;  1P3B A;  5BNV A;  1P3A B;  5AVB D;  3LJA A;  1KX5 D;  4J8W C;  3AZH A;  1P3L D;  4J8U D;  3REH C;  2F8N B;  2PYO A;  1P3F D;  5B24 C;  4ZUX C;  4QLC A;  3AZM D;  3MNN B;  3C1C A;  4JJN B;  1P3K C;  4WU9 B;  5GT0 B;  3VH6 T;  2RVQ D;  4WU8 A;  1P3K D;  3MGS B;  1ID3 D;  5BO0 B;  3W99 B;  3REL C;  2CV5 D;  3UTB D;  4ZBJ C;  1P3M B;  1M18 B;  3X1T B;  3W98 A;  4YS3 B;  2ARO C;  2NQB C;  1BFM A;  4KUD B;  3KWQ A;  5B40 B;  5AVB A;  5AY8 C;  3LEL C;  2NQB D;  2NZD C;  1P3P B;  1P3L A;  4Z5T D;  4J8U A;  1KU5 A;  1BH9 A;  3LEL D;  1JFI A;  1P3F A;  3WKJ C;  2NZD D;  3MGQ D;  3NQJ A;  3AZM A;  3KXB B;  4UUZ B;  5B1L D;  3B6G D;  4H9S C;  3O62 B;  5DNM B;  3W96 D;  4Z2M H;  1ID3 A;  3WAA B;  4WNN B;  4G92 B;  2CV5 A;  4YM6 D;  3UTB A;  4XZQ C;  1EQZ D;  3AZG D;  4J8X C;  1P3A D;  1BH8 A;  3AYW C;  5B32 B;  5AVC C;  1KX4 B;  3REK B;  3NQU A;  3X1U D;  5C3I B;  5CHL B;  4Z66 D;  5B33 C;  2F8N D;  4KHA B;  4LD9 C;  4JJN C;  4WU9 C;  1U35 C;  2BYM B;  5GT0 C;  5B31 B;  4XUJ B;  3MNN D;  4Z5T A;  4JJN D;  3AZI B;  3MGS C;  3W99 C;  5AV6 B;  3MGQ A;  1TZY B;  5AV5 B;  5B1L A;  4EO5 C;  3MGS D;  3MGR B;  3A6N B;  3B6G A;  3X1V B;  3REI D;  5CPI B;  4H9R A;  3W96 A;  4YS3 C;  1P3M D;  1S32 A;  1M18 D;  5BS7 A;  3X1T D;  1WWS A;  4YM6 A;  1EQZ A;  4J8V C;  4KUD D;  3AZG A;  1P3A A;  5B40 D;  1H3O A;  4J8W B;  3X1U A;  3KXB C;  1P3P D;  4Z66 A;  2F8N A;  5B24 B;  2YFV B;  1P34 C;  5CPK D;  3O62 C;  4AWL C;  3MNN A;  4JJN A;  3VH5 W;  3O62 D;  2FJ7 C;  5DNM D;  3MGP B;  1F1E A;  1F66 C;  4G92 C;  3MGS A;  3WAA D;  5B32 G;  4H9P B;  1ULY A;  3REI A;  3TU4 B;  3AZK C;  4ZBJ B;  1A7W A;  5B32 C;  1P3M A;  3AN2 C;  1M18 A;  3WTP C;  3REK C;  3X1T A;  2ARO B;  5BNX B;  1KX4 D;  4KUD A;  5DNN C;  3REK D;  1P3O A;  1AOI B;  5B31 C;  5B40 A;  5AY8 B;  4XUJ C;  5B0Y D;  3REJ B;  3AZJ C;  5AV6 C;  4XUJ D;  1TZY C;  4CAY A;  5B31 D;  1P3P A;  5AV5 C;  3LZ0 B;  3AZI D;  2HUE C;  3A6N C;  5CPK A;  3X1V C;  5F99 B;  1TZY D;  3UTA B;  5AV5 D;  3B0B A;  3MGR D;  1KX3 C;  3O62 A;  3W97 D;  3MVD B;  5CPI D;  5DNM A;  3B6F B;  5B2I D;  4HGA B;  5B1M C;  3WAA A;  4WNN A;  1ZLA C;  2JSS A;  5AV9 B;  4H9N B;  4XZQ B;  3AZE B;  1M19 C;  4J8X B;  3AYW B;  3KUY A;  5AVC B;  4J8W D;  1KX4 A;  3REK A;  5B33 B;  3REH D;  4LD9 B;  5B24 D;  4KHA A;  4ZUX D;  5B0Y A;  5FUG A;  3AV2 C;  1U35 B;  3MGP C;  3X1S B;  2YFW B;  3AZI A;  3VH5 T;  3AZF B;  5JRG C;  3LZ1 C;  4E45 A;  4EO5 B;  5AV5 A;  3TU4 C;  3MGR A;  3REL D;  3W97 A;  4DRB A;  1Q9C A;  5CPI A;  5B2I A;  2HIO B;  3C1B B;  1AOI C;  2ARO D;  1KX5 A;  4J8V B;  3REJ C;  4X23 B;  4NE6 A;  5AY8 D;  3LZ0 C;  3UT9 C;  4J8W A;  3WTP E;  5F99 C;  3WKJ D;  3REH A;  1B6W A;  3UTA C;  5B24 A;  4ZUX A;  2YFV A;  1P34 B;  4AWL B;  5F99 D;  2LY8 A;  3MVD C;  3UTA D;  5CPJ B;  3B6F C;  4HGA C;  1P3K A;  2FJ7 B;  3WA9 B;  1F66 B;  5AV9 C;  2F8N K;  5B0Z C;  3REL A;  3AZE C;  4H9P A;  3AZK B;  5GT3 B;  4XZQ D;  5E5A B;  3AN2 B;  4DRA A;  4J8X D;  3WTP B;  1N1J B;  3AYW D;  5JA4 B;  5AVC D;  2ARO A;  2NQB A;  5BNX A;  5DNN B;  5AV8 C;  5B33 D;  4E44 A;  3X1S C;  4LD9 D;  5AY8 A;  3LEL A;  3AZJ B;  4WU9 D;  3B0C W;  3AZF C;  2BYK A;  2NZD A;  1U35 D;  5GT0 D;  1HQ3 B;  3WKJ A;  3AV1 B;  1P3B B;  2HUE B;  3W99 D;  1P3G C;  3LJA B; 
#chains in the Genus database with same CATH topology
 5GSU C;  3UTA A;  5GXQ B;  1KX3 B;  4H9S A;  3AZH B;  4G91 C;  5B1M B;  4YS3 D;  4KGC C;  2HIO C;  3C1B C;  3C1C B;  1ZLA B;  5G49 B;  4X23 C;  3AZL C;  2HIO D;  4XZQ A;  4J8V D;  1M19 B;  3AFA C;  4X23 D;  4J8X A;  2Y2M A;  3KSY A;  4WJ3 C;  3KFU G;  3AYW A;  5AVC A;  4H9Q B;  3KXB D;  5B33 A;  3F6T A;  2F8N H;  5CPJ C;  4LD9 A;  1P34 D;  2ZY5 A;  3AV2 B;  4WU9 A;  3VH6 A;  3V9R B;  3W98 B;  1U35 A;  5GT0 A;  5CPJ D;  3WA9 C;  4H9O B;  5JRG B;  3W99 A;  5BO0 A;  2FJ7 D;  3LZ1 B;  1F66 D;  5GT3 C;  5E5A C;  4R8P B;  1JFI B;  3AZK D;  4YS3 A;  5B32 D;  3AN2 D;  3WTP D;  2ZY2 A;  1M1A C;  4J8V A;  5DNN D;  4X23 A;  2DQN C;  3AZN C;  1TAF B;  1HQ3 C;  5B2J C;  2J8P A;  5BT1 C;  3UT9 B;  3AZJ D;  3B0C T;  2XD5 A;  3AV1 C;  1P3B C;  5AV6 D;  3LJA C;  3KXB A;  4UUZ A;  3UTB B;  3AV1 D;  3EPH A;  5GXQ C;  3A6N D;  1P34 A;  3X1V D;  3AZH C;  3LJA D;  4QLC C;  2L5A A;  5GXQ D;  3NQU B;  1KX3 D;  4NFT A;  2FJ7 A;  3C1C C;  5B1M D;  1F66 A;  4CSR B;  5B0Z B;  4WU8 C;  1ZLA D;  4M6B A;  3MGQ B;  3AZK A;  2DF4 C;  5B32 A;  1M19 D;  5B1L B;  3AN2 A;  3WTP A;  5AV8 B;  5DNN A;  3W98 C;  3W96 B;  2BYM A;  4XUJ A;  5B31 A;  1S32 B;  1P3I B;  3AZJ A;  3KWQ C;  3AV2 D;  3W98 D;  5KDM B;  5AV6 A;  3MGP D;  1TZY A;  2ZY4 A;  5AVB C;  1EQZ B;  3AZG B;  5JRG D;  3A6N A;  1P3G B;  3X1V A;  3LZ1 D;  5GSU B;  1H3O B;  4R8P C;  4J8U C;  3TU4 D;  1P3L C;  1P3F C;  4Z2M G;  5GXQ A;  3AZM C;  1KX3 A;  3X1U B;  4Z66 B;  4R8P D;  4G91 B;  5B1M A;  4KGC B;  2RVQ C;  1ZLA A;  3P5J B;  5G49 A;  3AZL B;  1ID3 C;  1AOI D;  2XD1 A;  1HTA A;  3REJ D;  3AFA B;  1M19 A;  2CV5 C;  3UTB C;  3LZ0 D;  3UT9 D;  3REI B;  4H9Q A;  3AV2 A;  3V9R A;  3MVD D;  4NE5 A;  3H0R C;  3MGP A;  3B6F D;  4H9O A;  1P3O B;  5JRG A;  3R45 B;  3LZ1 A;  4Z5T C;  3TU4 A;  5AV9 D;  3MGQ C;  5B0Z D;  4CAY B;  3AZE D;  5B1L C;  4R8P A;  3B6G C;  5CPK B;  3H0L C;  2IO5 B;  3W96 C;  2JCH A;  1AOI A;  1S32 C;  1M1A B;  5BS7 C;  1P3I C;  3REJ A;  5AV8 D;  3AZN B;  5B2J B;  5CP6 B;  1TAF A;  3X1S D;  4YM6 C;  1S32 D;  3LZ0 A;  3UT9 A;  5BNV B;  3AZF D;  3AZG C;  1P3I D;  1EQZ C;  1B67 A;  1P3A C;  5F99 A;  2F8N G;  1P3G D;  3X1U C;  3KUY B;  5GSU D;  4Z66 C;  3H0M C;  3IP4 C;  3MVD A;  2PYO B;  3B6F A;  4QLC B;  4WZS B;  3MNN C;  3EPL A;  5B0Y B;  5FUG B;  4KGC D;  2CWE A;  5AV9 A;  3C1B D;  4H9N A;  4CSR A;  5B0Z A;  4WU8 B;  3AZE A;  3AZL D;  4WV4 B;  2F2A C;  3REI C;  3AFA D;  1R4V A;  3W97 B;  1P3M C;  4NE3 A;  1M18 C;  5B2I B;  3X1T C;  5AV8 A;  3VH5 A;  3X1S A;  2ZY3 A;  3B0D B;  2YFW A;  3KWQ B;  1P3I A;  2Y2H A;  3AZF A;  4KUD C;  1P3O C;  5KDM A;  5B40 C;  5AVB B;  3WA9 D;  1KX5 B;  3EPJ A;  1P3O D;  1P3G A;  1P3L B;  4J8U B;  2Y2K A;  1P3P C;  1BH9 B;  5GSU A;  1P3F B;  3NQJ B;  5GT3 D;  3AZM B;  5CPK C;  5E5A D;  2IO5 C;  3REH B;  4ZUX B;  4KGC A;  2HIO A;  3C1B A;  5DNM C;  1Z2C B;  3VH6 W;  1P3K B;  1ID3 B;  3AZL A;  5CP6 C;  3WAA C;  1M1A D;  3AFA A;  3AZN D;  2CV5 B;  1HQ3 D;  5B2J D;  5BT1 D;  5CP6 D;  3REL B;  1P3B D;  2Y2N A;  1BH8 B;  3KUY C;  2PYO C;  5CPJ A;  1KX4 C;  3AZH D;  2RIQ A;  5C3I C;  5B31 G;  3KUY D;  2PYO D;  2NQB B;  3WA9 A;  4QLC D;  5B0Y C;  4Z5T B;  3R45 A;  3LEL B;  3C1C D;  3AZI C;  2NZD B;  2BYK B;  5GT3 A;  5E5A A;  4WU8 D;  3WKJ B;  2JE5 A;  1N1J A;  3B6G B;  3MGR C;  3EG5 B;  3W97 C;  5JA4 A;  1WWI A;  4H9R B;  5CPI C;  5B2I C;  2W8S A;  3B0D C;  1M1A A;  2Y2Q A;  3AZN A;  1HQ3 A;  5B2J A;  5CP6 A;  4YM6 B;  1KX5 C;  3AV1 A;  3KWQ D;  1P3B A;  5BNV A;  1P3A B;  5AVB D;  3LJA A;  1KX5 D;  2G5I C;  4J8W C;  3AZH A;  1P3L D;  4J8U D;  3REH C;  2F8N B;  2PYO A;  1P3F D;  5B24 C;  4ZUX C;  4QLC A;  3AZM D;  3MNN B;  3C1C A;  4JJN B;  1P3K C;  4WU9 B;  5GT0 B;  3VH6 T;  2RVQ D;  4WU8 A;  1P3K D;  3MGS B;  1ID3 D;  5BO0 B;  3W99 B;  3REL C;  2FFF B;  2CV5 D;  3UTB D;  4ZBJ C;  1P3M B;  1M18 B;  3X1T B;  3W98 A;  4YS3 B;  2ARO C;  2NQB C;  1BFM A;  3A1I A;  4KUD B;  3KWQ A;  5B40 B;  5AVB A;  5AY8 C;  3LEL C;  2NQB D;  2NZD C;  2Y2P A;  1P3P B;  1P3L A;  4Z5T D;  4J8U A;  1KU5 A;  1BH9 A;  3LEL D;  1JFI A;  1P3F A;  3WKJ C;  2NZD D;  3MGQ D;  3NQJ A;  3AZM A;  3KXB B;  4UUZ B;  5B1L D;  3B6G D;  4H9S C;  3O62 B;  5DNM B;  3AL0 C;  3W96 D;  4Z2M H;  1ID3 A;  3WAA B;  4WNN B;  2Y2I A;  3A1K A;  4G92 B;  2CV5 A;  4YM6 D;  3UTB A;  4XZQ C;  1EQZ D;  3AZG D;  4J8X C;  1P3A D;  1BH8 A;  3AYW C;  5B32 B;  5AVC C;  1KX4 B;  3REK B;  3NQU A;  3X1U D;  5C3I B;  5CHL B;  4Z66 D;  5B33 C;  2F8N D;  4KHA B;  4LD9 C;  4JJN C;  2Y2J A;  4WU9 C;  1U35 C;  2BYM B;  5GT0 C;  5B31 B;  4XUJ B;  3MNN D;  4Z5T A;  4JJN D;  3AZI B;  3MGS C;  3W99 C;  5AV6 B;  3MGQ A;  1TZY B;  5AV5 B;  5B1L A;  4EO5 C;  3MGS D;  3MGR B;  3A6N B;  3B6G A;  3X1V B;  3REI D;  5CPI B;  4H9R A;  3W96 A;  4YS3 C;  1P3M D;  1S32 A;  1M18 D;  5BS7 A;  3X1T D;  4UPK A;  1WWS A;  4YM6 A;  1EQZ A;  4J8V C;  4KUD D;  3AZG A;  1P3A A;  5B40 D;  1H3O A;  4J8W B;  3X1U A;  3KXB C;  1P3P D;  4Z66 A;  2F8N A;  5B24 B;  2YFV B;  1P34 C;  5CPK D;  3O62 C;  4AWL C;  3MNN A;  4JJN A;  3VH5 W;  3O62 D;  2FJ7 C;  5DNM D;  3MGP B;  1F1E A;  4DQY B;  1F66 C;  4G92 C;  3MGS A;  3WAA D;  5B32 G;  4H9P B;  1ULY A;  3REI A;  3TU4 B;  2BG1 A;  3AZK C;  4ZBJ B;  1A7W A;  5B32 C;  1P3M A;  3AN2 C;  1M18 A;  3WTP C;  3REK C;  3X1T A;  2ARO B;  5BNX B;  1KX4 D;  4KUD A;  5DNN C;  3REK D;  1P3O A;  1AOI B;  5B31 C;  5B40 A;  5AY8 B;  4XUJ C;  5B0Y D;  3REJ B;  3AZJ C;  3FDD A;  5AV6 C;  4XUJ D;  1TZY C;  4CAY A;  5B31 D;  1P3P A;  5AV5 C;  3LZ0 B;  3AZI D;  2HUE C;  3A6N C;  5CPK A;  3X1V C;  5F99 B;  1TZY D;  3UTA B;  5AV5 D;  3B0B A;  3MGR D;  1KX3 C;  3O62 A;  3W97 D;  3MVD B;  5CPI D;  5DNM A;  3B6F B;  5B2I D;  4HGA B;  5B1M C;  3WAA A;  4WNN A;  1ZLA C;  2JSS A;  5AV9 B;  4H9N B;  4XZQ B;  3AZE B;  1M19 C;  4J8X B;  2Y2O A;  3AYW B;  3KUY A;  5AVC B;  4J8W D;  1KX4 A;  3REK A;  5B33 B;  3REH D;  4LD9 B;  5B24 D;  4KHA A;  4ZUX D;  5B0Y A;  5FUG A;  3AV2 C;  1U35 B;  3MGP C;  3X1S B;  2YFW B;  3AZI A;  3VH5 T;  3AZF B;  5JRG C;  3LZ1 C;  4E45 A;  4EO5 B;  5AV5 A;  3TU4 C;  3MGR A;  2UWX A;  3REL D;  3W97 A;  4DRB A;  1Q9C A;  5CPI A;  5B2I A;  2HIO B;  3C1B B;  1AOI C;  2ARO D;  1KX5 A;  4J8V B;  3REJ C;  4X23 B;  4NE6 A;  5AY8 D;  3LZ0 C;  3UT9 C;  4J8W A;  3WTP E;  5F99 C;  3EPK A;  3WKJ D;  3REH A;  2VQR A;  1B6W A;  3UTA C;  5B24 A;  4ZUX A;  2YFV A;  1P34 B;  4AWL B;  5F99 D;  2LY8 A;  3MVD C;  3UTA D;  5CPJ B;  3B6F C;  4HGA C;  1P3K A;  2FJ7 B;  3WA9 B;  1F66 B;  5AV9 C;  1T3U A;  2F8N K;  5B0Z C;  3REL A;  3AZE C;  4H9P A;  3AZK B;  5GT3 B;  4XZQ D;  5E5A B;  3AN2 B;  4DRA A;  4J8X D;  3WTP B;  1N1J B;  3AYW D;  2ZM5 A;  5JA4 B;  5AVC D;  2ARO A;  1W2E A;  2NQB A;  5BNX A;  5DNN B;  5AV8 C;  5B33 D;  4E44 A;  2G5H C;  3X1S C;  4LD9 D;  5AY8 A;  3LEL A;  3AZJ B;  4WU9 D;  3B0C W;  3AZF C;  2BYK A;  2NZD A;  1U35 D;  5GT0 D;  1HQ3 B;  3WKJ A;  3AV1 B;  2Y2L A;  1P3B B;  1PZR A;  2HUE B;  2Y2G A;  3W99 D;  1P3G C;  3LJA B; 
#chains in the Genus database with same CATH homology
 5GSU C;  3UTA A;  5GXQ B;  1KX3 B;  4H9S A;  3AZH B;  4G91 C;  5B1M B;  4YS3 D;  4KGC C;  2HIO C;  3C1B C;  3C1C B;  1ZLA B;  5G49 B;  4X23 C;  3AZL C;  2HIO D;  4XZQ A;  4J8V D;  1M19 B;  3AFA C;  4X23 D;  4J8X A;  2Y2M A;  3KSY A;  4WJ3 C;  3KFU G;  3AYW A;  5AVC A;  4H9Q B;  3KXB D;  5B33 A;  3F6T A;  2F8N H;  5CPJ C;  4LD9 A;  1P34 D;  2ZY5 A;  3AV2 B;  4WU9 A;  3VH6 A;  3V9R B;  3W98 B;  1U35 A;  5GT0 A;  5CPJ D;  3WA9 C;  4H9O B;  5JRG B;  3W99 A;  5BO0 A;  2FJ7 D;  3LZ1 B;  1F66 D;  5GT3 C;  5E5A C;  4R8P B;  1JFI B;  3AZK D;  4YS3 A;  5B32 D;  3AN2 D;  3WTP D;  2ZY2 A;  1M1A C;  4J8V A;  5DNN D;  4X23 A;  2DQN C;  3AZN C;  1TAF B;  1HQ3 C;  5B2J C;  2J8P A;  5BT1 C;  3UT9 B;  3AZJ D;  3B0C T;  2XD5 A;  3AV1 C;  1P3B C;  5AV6 D;  3LJA C;  3KXB A;  4UUZ A;  3UTB B;  3AV1 D;  3EPH A;  5GXQ C;  3A6N D;  1P34 A;  3X1V D;  3AZH C;  3LJA D;  4QLC C;  2L5A A;  5GXQ D;  3NQU B;  1KX3 D;  4NFT A;  2FJ7 A;  3C1C C;  5B1M D;  1F66 A;  4CSR B;  5B0Z B;  4WU8 C;  1ZLA D;  4M6B A;  3MGQ B;  3AZK A;  2DF4 C;  5B32 A;  1M19 D;  5B1L B;  3AN2 A;  3WTP A;  5AV8 B;  5DNN A;  3W98 C;  3W96 B;  2BYM A;  4XUJ A;  5B31 A;  1S32 B;  1P3I B;  3AZJ A;  3KWQ C;  3AV2 D;  3W98 D;  5KDM B;  5AV6 A;  3MGP D;  1TZY A;  2ZY4 A;  5AVB C;  1EQZ B;  3AZG B;  5JRG D;  3A6N A;  1P3G B;  3X1V A;  3LZ1 D;  5GSU B;  1H3O B;  4R8P C;  4J8U C;  3TU4 D;  1P3L C;  1P3F C;  4Z2M G;  5GXQ A;  3AZM C;  1KX3 A;  3X1U B;  4Z66 B;  4R8P D;  4G91 B;  5B1M A;  4KGC B;  2RVQ C;  1ZLA A;  3P5J B;  5G49 A;  3AZL B;  1ID3 C;  1AOI D;  2XD1 A;  1HTA A;  3REJ D;  3AFA B;  1M19 A;  2CV5 C;  3UTB C;  3LZ0 D;  3UT9 D;  3REI B;  4H9Q A;  3AV2 A;  3V9R A;  3MVD D;  4NE5 A;  3H0R C;  3MGP A;  3B6F D;  4H9O A;  1P3O B;  5JRG A;  3R45 B;  3LZ1 A;  4Z5T C;  3TU4 A;  5AV9 D;  3MGQ C;  5B0Z D;  4CAY B;  3AZE D;  5B1L C;  4R8P A;  3B6G C;  5CPK B;  3H0L C;  2IO5 B;  3W96 C;  2JCH A;  1AOI A;  1S32 C;  1M1A B;  5BS7 C;  1P3I C;  3REJ A;  5AV8 D;  3AZN B;  5B2J B;  5CP6 B;  1TAF A;  3X1S D;  4YM6 C;  1S32 D;  3LZ0 A;  3UT9 A;  5BNV B;  3AZF D;  3AZG C;  1P3I D;  1EQZ C;  1B67 A;  1P3A C;  5F99 A;  2F8N G;  1P3G D;  3X1U C;  3KUY B;  5GSU D;  4Z66 C;  3H0M C;  3IP4 C;  3MVD A;  2PYO B;  3B6F A;  4QLC B;  4WZS B;  3MNN C;  3EPL A;  5B0Y B;  5FUG B;  4KGC D;  2CWE A;  5AV9 A;  3C1B D;  4H9N A;  4CSR A;  5B0Z A;  4WU8 B;  3AZE A;  3AZL D;  4WV4 B;  2F2A C;  3REI C;  3AFA D;  1R4V A;  3W97 B;  1P3M C;  4NE3 A;  1M18 C;  5B2I B;  3X1T C;  5AV8 A;  3VH5 A;  3X1S A;  2ZY3 A;  3B0D B;  2YFW A;  3KWQ B;  1P3I A;  2Y2H A;  3AZF A;  4KUD C;  1P3O C;  5KDM A;  5B40 C;  5AVB B;  3WA9 D;  1KX5 B;  3EPJ A;  1P3O D;  1P3G A;  1P3L B;  4J8U B;  2Y2K A;  1P3P C;  1BH9 B;  5GSU A;  1P3F B;  3NQJ B;  5GT3 D;  3AZM B;  5CPK C;  5E5A D;  2IO5 C;  3REH B;  4ZUX B;  4KGC A;  2HIO A;  3C1B A;  5DNM C;  1Z2C B;  3VH6 W;  1P3K B;  1ID3 B;  3AZL A;  5CP6 C;  3WAA C;  1M1A D;  3AFA A;  3AZN D;  2CV5 B;  1HQ3 D;  5B2J D;  5BT1 D;  5CP6 D;  3REL B;  1P3B D;  2Y2N A;  1BH8 B;  3KUY C;  2PYO C;  5CPJ A;  1KX4 C;  3AZH D;  2RIQ A;  5C3I C;  5B31 G;  3KUY D;  2PYO D;  2NQB B;  3WA9 A;  4QLC D;  5B0Y C;  4Z5T B;  3R45 A;  3LEL B;  3C1C D;  3AZI C;  2NZD B;  2BYK B;  5GT3 A;  5E5A A;  4WU8 D;  3WKJ B;  2JE5 A;  1N1J A;  3B6G B;  3MGR C;  3EG5 B;  3W97 C;  5JA4 A;  1WWI A;  4H9R B;  5CPI C;  5B2I C;  2W8S A;  3B0D C;  1M1A A;  2Y2Q A;  3AZN A;  1HQ3 A;  5B2J A;  5CP6 A;  4YM6 B;  1KX5 C;  3AV1 A;  3KWQ D;  1P3B A;  5BNV A;  1P3A B;  5AVB D;  3LJA A;  1KX5 D;  2G5I C;  4J8W C;  3AZH A;  1P3L D;  4J8U D;  3REH C;  2F8N B;  2PYO A;  1P3F D;  5B24 C;  4ZUX C;  4QLC A;  3AZM D;  3MNN B;  3C1C A;  4JJN B;  1P3K C;  4WU9 B;  5GT0 B;  3VH6 T;  2RVQ D;  4WU8 A;  1P3K D;  3MGS B;  1ID3 D;  5BO0 B;  3W99 B;  3REL C;  2FFF B;  2CV5 D;  3UTB D;  4ZBJ C;  1P3M B;  1M18 B;  3X1T B;  3W98 A;  4YS3 B;  2ARO C;  2NQB C;  1BFM A;  3A1I A;  4KUD B;  3KWQ A;  5B40 B;  5AVB A;  5AY8 C;  3LEL C;  2NQB D;  2NZD C;  2Y2P A;  1P3P B;  1P3L A;  4Z5T D;  4J8U A;  1KU5 A;  1BH9 A;  3LEL D;  1JFI A;  1P3F A;  3WKJ C;  2NZD D;  3MGQ D;  3NQJ A;  3AZM A;  3KXB B;  4UUZ B;  5B1L D;  3B6G D;  4H9S C;  3O62 B;  5DNM B;  3AL0 C;  3W96 D;  4Z2M H;  1ID3 A;  3WAA B;  4WNN B;  2Y2I A;  3A1K A;  4G92 B;  2CV5 A;  4YM6 D;  3UTB A;  4XZQ C;  1EQZ D;  3AZG D;  4J8X C;  1P3A D;  1BH8 A;  3AYW C;  5B32 B;  5AVC C;  1KX4 B;  3REK B;  3NQU A;  3X1U D;  5C3I B;  5CHL B;  4Z66 D;  5B33 C;  2F8N D;  4KHA B;  4LD9 C;  4JJN C;  2Y2J A;  4WU9 C;  1U35 C;  2BYM B;  5GT0 C;  5B31 B;  4XUJ B;  3MNN D;  4Z5T A;  4JJN D;  3AZI B;  3MGS C;  3W99 C;  5AV6 B;  3MGQ A;  1TZY B;  5AV5 B;  5B1L A;  4EO5 C;  3MGS D;  3MGR B;  3A6N B;  3B6G A;  3X1V B;  3REI D;  5CPI B;  4H9R A;  3W96 A;  4YS3 C;  1P3M D;  1S32 A;  1M18 D;  5BS7 A;  3X1T D;  4UPK A;  1WWS A;  4YM6 A;  1EQZ A;  4J8V C;  4KUD D;  3AZG A;  1P3A A;  5B40 D;  1H3O A;  4J8W B;  3X1U A;  3KXB C;  1P3P D;  4Z66 A;  2F8N A;  5B24 B;  2YFV B;  1P34 C;  5CPK D;  3O62 C;  4AWL C;  3MNN A;  4JJN A;  3VH5 W;  3O62 D;  2FJ7 C;  5DNM D;  3MGP B;  1F1E A;  4DQY B;  1F66 C;  4G92 C;  3MGS A;  3WAA D;  5B32 G;  4H9P B;  1ULY A;  3REI A;  3TU4 B;  2BG1 A;  3AZK C;  4ZBJ B;  1A7W A;  5B32 C;  1P3M A;  3AN2 C;  1M18 A;  3WTP C;  3REK C;  3X1T A;  2ARO B;  5BNX B;  1KX4 D;  4KUD A;  5DNN C;  3REK D;  1P3O A;  1AOI B;  5B31 C;  5B40 A;  5AY8 B;  4XUJ C;  5B0Y D;  3REJ B;  3AZJ C;  3FDD A;  5AV6 C;  4XUJ D;  1TZY C;  4CAY A;  5B31 D;  1P3P A;  5AV5 C;  3LZ0 B;  3AZI D;  2HUE C;  3A6N C;  5CPK A;  3X1V C;  5F99 B;  1TZY D;  3UTA B;  5AV5 D;  3B0B A;  3MGR D;  1KX3 C;  3O62 A;  3W97 D;  3MVD B;  5CPI D;  5DNM A;  3B6F B;  5B2I D;  4HGA B;  5B1M C;  3WAA A;  4WNN A;  1ZLA C;  2JSS A;  5AV9 B;  4H9N B;  4XZQ B;  3AZE B;  1M19 C;  4J8X B;  2Y2O A;  3AYW B;  3KUY A;  5AVC B;  4J8W D;  1KX4 A;  3REK A;  5B33 B;  3REH D;  4LD9 B;  5B24 D;  4KHA A;  4ZUX D;  5B0Y A;  5FUG A;  3AV2 C;  1U35 B;  3MGP C;  3X1S B;  2YFW B;  3AZI A;  3VH5 T;  3AZF B;  5JRG C;  3LZ1 C;  4E45 A;  4EO5 B;  5AV5 A;  3TU4 C;  3MGR A;  2UWX A;  3REL D;  3W97 A;  4DRB A;  1Q9C A;  5CPI A;  5B2I A;  2HIO B;  3C1B B;  1AOI C;  2ARO D;  1KX5 A;  4J8V B;  3REJ C;  4X23 B;  4NE6 A;  5AY8 D;  3LZ0 C;  3UT9 C;  4J8W A;  3WTP E;  5F99 C;  3EPK A;  3WKJ D;  3REH A;  2VQR A;  1B6W A;  3UTA C;  5B24 A;  4ZUX A;  2YFV A;  1P34 B;  4AWL B;  5F99 D;  2LY8 A;  3MVD C;  3UTA D;  5CPJ B;  3B6F C;  4HGA C;  1P3K A;  2FJ7 B;  3WA9 B;  1F66 B;  5AV9 C;  1T3U A;  2F8N K;  5B0Z C;  3REL A;  3AZE C;  4H9P A;  3AZK B;  5GT3 B;  4XZQ D;  5E5A B;  3AN2 B;  4DRA A;  4J8X D;  3WTP B;  1N1J B;  3AYW D;  2ZM5 A;  5JA4 B;  5AVC D;  2ARO A;  1W2E A;  2NQB A;  5BNX A;  5DNN B;  5AV8 C;  5B33 D;  4E44 A;  2G5H C;  3X1S C;  4LD9 D;  5AY8 A;  3LEL A;  3AZJ B;  4WU9 D;  3B0C W;  3AZF C;  2BYK A;  2NZD A;  1U35 D;  5GT0 D;  1HQ3 B;  3WKJ A;  3AV1 B;  2Y2L A;  1P3B B;  1PZR A;  2HUE B;  2Y2G A;  3W99 D;  1P3G C;  3LJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...