5BT9A

Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
249
Chain Sequence
b'EARMVANCPVLVTGGARRIGKAIVEDLASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLEGDVRGLVKQASDRIGPIRLLVNNASLFQEDKVGALDMALWDRHFAVHLKTPVILAEDMRKALPEDQDGLVVNIIDQRVWKLNPQFFSYTLSKTALWNATRTLAQALAPRIRVNAIAPGPTLPSERQRPEDFERQVSKLPLQRAPELPEFGRTVRYFWENRSITGQMIALDGGQHLAWETPDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Crystal Structure of FolM Alternative dihydrofolate reductase 1 from Brucella canis complexed with NADP
rcsb
source organism Brucella canis (strain atcc 23365 / nctc 10854)
molecule tags Oxidoreductase
total genus 92
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bt9A00
3I9LA 3PHHA 1SCUA 5KKAA 1H6CA 2BF7A 2X5OA 1EQ2A 4Y8VA 4ZA2A 2FPIA 4OIMA 4E30A 4D41A 1ADGA 3DBRB 2B5WA 4CMCA 3AU8A 4DBVO 4CMGA 1B16A 3H9GA 4K6CA 2P9GA 4CR7A 1DOHA 1X0XA 1FJHA 3GPIA 4TRMA 4MINA 1X1EA 4DMMA 2NU8A 2YV2A 5IDQA 4QEDA 3GA0A 4CV0A 3O8QA 3QHAA 1R15A 3ZCXA 1YOVA 3ITDA 3WLEA 3DWFA 3MOGA 4B4OA 3Q0EA 3H9JA 1MX3A 3NUGA 3QA9A 4XYGA 4AVYA 2JHGA 2NLOA 2DKNA 3DDNA 4R68A 5HA5A 2YDXA 5B12A 3WGOA 3D5TA 3E48A 5CEFA 3HDYA 3LSYA 2J3IA 4JCOA 2DT5A 3KXDA 5T5QA 4B3JA 4UAGA 2EIHA 4AJOA 4LK3A 3A14A 4ESOA 3V1TC 3F9IA 3KSDO 2VYVA 4M54A 1YDEA 2BLLA 3KZVA 4EJMA 3ZU5A 2Q2VA 1BTOA 3DB2A 3QRWA 3GRPA 3ZWAA 1HL3A 1Y8RA 3OM9A 4I8XA 5DOZA 4FQ8A 1SEPA 1S7CA 2X7HA 3WGTA 5JBIA 4B8ZA 5LDGA 4LN1A 3IKTA 1UAGA 1GYQA 4WCFC 4EGFA 1ZNQO 4OAQA 3U0BA 2VZ0A 4WLEA 3W1VA 4BV9A 3ZWBA 2P4HX 1V3TA 1ZO8A 1GU7A 5TT0A 1CF2O 3SC4A 3MJVA 1JN0A 2HMTA 4UVHA 1WXDA 1DIRA 4BOYA 1GUFA 2VN8A 1F12A 2RCYA 3GOHA 2J3KA 1QP8A 2HK8A 1A4IA 5CFZA 2GRAA 4L8VA 2H5LA 5T8KC 1YQXA 3Q2KA 2B83A 4CMIA 4YXFA 1QV6A 1LRKA 2IE0A 3KYCA 8LDHA 3ENKA 3I9MA 1BWSA 4HY3A 1KEUA 3ONFA 4YAGA 1PJSA 3LQFA 3FNEA 3F6YA 1ZJYA 1P0FA 2Z1MA 5CHEA 4DQUA 2OHXA 5DZSA 4JX8A 4D44A 4JLWA 4O6VA 5DBGA 4BO6A 4WE3A 4HADA 1NFRA 4YAJA 2HMWA 5A9SB 4L4RA 4Y6RA 2YQ4A 2EHDA 3B1JA 4XD2A 4DC0A 2VTDA 1VC2A 4Y67A 3WFJA 4J7CA 3DAFA 5ENVA 4AJJA 1DC6A 4BNZA 2EJVA 4YACA 1T2DA 1HYGA 1RM0A 3A1NA 4B4VA 1HDYA 1ONPA 1F06A 4UUMA 3D3WB 4WGGA 3WFIA 1GZ4A 1O9BA 5A3JA 3RUFA 5K6AC 1PS8A 1OBFO 5L45A 1VJ1A 4XDZA 2D2IA 1E5QA 3Q2IA 3DOJA 3INTA 4MVJA 2QX7A 4LMPA 4BNTA 3BTUA 4E0BA 4DRYA 2P9CA 4J1SA 4CM9A 5DBIA 1YONA 1OI7A 2X0JA 1C3VA 2WYUA 3ETGA 4BO9A 2BKAA 1J49A 1BDMA 1N7GA 3ZU3A 9LDTA 4TQGA 1C1XB 5CPBA 4M86A 3LF1A 2V6GA 2BFPA 3ORFA 4FSHA 1EUZA 4JN6B 2EP5A 2G76A 2WD7A 3A4VA 4HBGA 3NX4A 4CMEC 1DRVA 3N7UA 2QIOA 1QLJA 1ENZA 3QQPA 4WK6A 5B4VA 3FSRA 2ZB3A 4WUVA 4H16A 5JO9A 1PIWA 3ZWOA 4GGOA 3CUKA 3TZHA 3BTOA 3GN1A 1ENYA 1R37A 2RAFA 3RBVA 4LISA 3QVSA 1JA9A 3NGXA 4WNIA 4MVJG 1EQUA 4W7IA 1ZZEA 1GZ6A 1ZK4A 4UEOA 1X7HA 2YFQA 3H5RA 4J4BA 2OZPA 1XR3A 1ZMOA 3TRIA 1UDCA 1YBAA 3NDIA 3R3JA 1YO6A 1A7AA 3X2FA 4KUHA 5IAAA 4NJMA 1LSUA 2GO1A 5ADHA 1EK5A 1HE5A 3CE6A 4K1LA 3NRCA 4AJIA 2Q50A 3OF2A 1O5IA 3GAZA 3BA1A 4M8SA 2PKRA 3CPSA 3K92A 1O89A 5KJFA 3X2EA 2UDPA 4CM8A 1MV8A 1U2DA 3IC5A 2OXIA 1WW8A 4B7XA 1Z74A 1DDOA 3ABIA 3WNQA 3KVOA 1QV7A 1NP3A 4IZHA 5EIOA 3ZV3A 4YPOA 1ADCA 1A9ZA 1DJQA 5JY1A 1YB4A 3C85A 1F0YA 2AG5A 1NR7A 5IN5A 2DPGA 1O6ZA 2UAGA 4IJUA 4NFYA 4BKRA 4ZU3A 3VPXA 2PZKA 3M2TA 4NHEA 4ZQHA 2GGSA 1XQ1A 2V6BA 4BNWA 4YVFA 4II2A 4CLOB 3JQ9A 2PD4A 1P1IA 9LDBA 4LW8A 1OC2A 4FC6A 1L7DA 4BGVA 4WPGA 1PJBA 3HUDA 1U5AA 4R01A 5I9NA 2Y66A 2DBVO 2Y0CA 4J0EA 4ZQGA 3TZKA 3HHPA 4RO0A 1HZZA 4XRGA 5TJ9A 3JYOA 3RFTA 3A9WA 3ZDFA 1SMKA 2PA3A 3DQPA 3UCFA 5FF9A 4OSPA 2O7SA 4XQGA 5TNXA 3D4OA 3WMWA 3RU7A 3WTBA 4OM8A 4FFPA 4QT0A 4LSMA 2Y1OA 5JY6A 3GGOA 3GN2A 4GMGA 4OSOA 1V0JA 1I01A 5IZCA 5AXCA 3S2EA 2DAPA 4BO3A 4ZGWA 3G3EA 1CWUA 3PYXA 4LVCA 5F21A 2DTXA 4U8GA 5MGBA 4MIYA 2C7GA 3JQAD 3AY3A 3L07A 1MUUA 3UKOA 3DTTA 3JQ8A 1I3LA 3W8FA 2XPCA 3ZNQA 4E4YA 1KY5A 1NHWA 2NVUA 1ORRA 3RKRA 5L7YA 3VVCA 4HFMA 4ZHSA 4RF3A 4EJ0A 5G4KB 3RC1A 4XQ9A 4J4HA 1PGOA 3FPLA 5JO0A 3H4VA 3IP1A 1L7EA 1Y5MA 1HDZA 3U4CA 3OHSX 4GBJA 3UH1A 3AUAA 2C2YA 7ADHA 4E5MA 4EBFA 3JQBA 3OQ1A 4Q9NA 4ALKA 3AM3A 2IXAA 2GYYA 2CF6A 5DCYA 2VWQA 1EVJA 1HLDA 1H2BA 3L6EA 4R54A 4WLOA 4DBZA 4P4GA 1B8UA 1KVRA 3IMFA 4C7KA 1PJLA 2X8LA 1O8CA 3ZV4A 5FI3A 1PJQA 4QO8A 2JAPA 2ET6A 3JD0A 4F6LA 3LT1A 2IRWA 1KC3A 1EBUA 3M6IA 3DFUA 3H5NA 5C37A 2OBYA 1P1JA 1WZIA 2O4CA 4CQLA 3PWSA 3GVHA 4YJHA 1M75A 5AOVA 3IL2A 1UJMA 5COQA 1QSGA 4E2WA 3WGHA 5CEJA 2BFMA 3BMQA 2OUIA 5AVOA 3GNQA 4YR9A 3FWZA 1SBYA 5BNTA 4PZEA 5KOIA 1WZEA 3JQGA 4A73A 3ETDA 3JD1A 1WLYA 2FMUA 4K9DA 1K3TA 3QW2A 4ALJA 1PZFA 3PHLA 4RPLA 3CIFA 1H9AA 1Q0HA 2P2SA 1SZJG 3I5MA 3K6JA 2NV6A 2NVWA 2FR8A 5JPIA 3U5TA 1I2ZA 3L77A 4DMLA 2RBEA 3H65A 4TZKA 3QE3A 1LSOA 4LGVA 3WWYA 3QY9A 4OXYA 2ZB8A 1ZVMA 1HLPA 3E6AA 1BXGA 4NQZA 4OJNA 3H2ZA 3IJPA 1LLDA 4ND3A 4FN4A 1E92A 1JKJA 1GV0A 3HWRA 3ZH2A 3MJEA 2GERA 1Z45A 5G4LA 3OJ0A 5DT9A 3K96A 1QKIA 4WCFB 2EG9A 3MJSA 3G79A 3G1UA 5TQVA 1S6YA 3IUSA 1ZXBA 3AU9A 1Y9EA 5GY7A 4Q3BA 4IXWA 1DHRA 3KUXA 2AMFA 4URFA 4RF2A 4KOAA 4E5NA 1IY8A 4K26A 5FFFA 1EMDA 1FDVA 1L1FA 2I5PO 1IL0A 4BNMA 1J0XO 3KEOA 3CXRA 3MJTA 1GDHA 4I5FA 5G2OA 4FJ0A 4YRAA 2HU2A 3L4BA 3LU1A 5TC4A 2FHSA 4R3WA 1R4MA 2NWQA 3UCEA 2Y1GA 3BMOA 2FR0A 4CLHA 3C1OA 5TSDA 1HDXA 2IXBA 3PVZA 1XELA 4MKZA 1GQYA 3VZPA 1LC3A 1LLUA 1LRJA 4EITA 5BSHA 4FPXA 1C0IA 3GZNA 3KOUA 4F6CA 1HSZA 1HYEA 1RWBA 2YZ7A 1LU9A 3GF4A 1E1KA 5H81A 3COSA 1T1SA 4AL4A 3JSAA 2Y1CA 2DTDA 3QWFA 4BO5A 1MFPA 1EDOA 1OMOA 3RCBA 1ZBQA 4WCDA 4Q3AA 3R3SA 3WB9A 3JQ7B 1LA2A 2HUNA 4IQ8A 4BNHA 2VHXA 1R16A 4L76A 1X13A 1QR6A 1UDBA 1AGNA 2VT2A 4UVDA 1Z7EA 1LX6A 4GWGA 2DBQA 2DUUA 4UVGA 4XGNA 3FCOA 2Z5LA 3MJ4A 2GD1O 4R9SA 1RM4A 2AG8A 3OEWA 3TZCA 5A04A 1EEHA 1GFSA 1N92A 3FBTA 3MCVA 5EL0A 4M1QA 1CRWG 5DF1A 4YBZA 4PFJA 2W98A 4IQ0A 4PRLA 3UVEA 1P44A 1XEAA 1Q1NA 2CNBA 4YRDA 1YBVA 3QP9A 1ZK1A 4ND5A 1U8FO 1T1RA 1ZK0A 1C0PA 2P5YA 3OIDA 2RH4A 4DPLA 5AQ1A 2EGGA 2W90A 1EVZA 4Y6PA 5J23A 2VRCD 1IPEA 1KEVA 1BSVA 1YGYA 4PZCA 4DIOA 2UUPA 3DBRA 4FB5A 2G1UA 2EXXA 4FFLA 4PG6A 1DC5A 3M1LA 3PFFA 3I4FA 3L9XA 1E7YA 3NYWA 4N5NA 3GEDA 5I8ZA 4M49A 3JQAA 3VPFA 3S8MA 2EW8A 4RLHA 4J2HA 5TGDA 4XB2A 1SPXA 1EE2A 4W9NC 1NFFA 1N9GB 4FD3A 2H9IA 2NU9A 4B4WA 2PTGA 1U5CA 3HDQA 3L6OO 1ZIDA 4IZIA 4GSLA 5AXAA 4HP8A 4AJ2A 1PSDA 1I2CA 1C0LA 4MP3A 4YB8A 2H6EA 4QUKA 4YWJA 5JC1A 2RHCA 4DPKA 1DFHA 3WGZA 4MDHA 5DBFA 1PQPA 5A02A 4FW8A 5FEUA 4OKNA 5ILGA 5JCXA 2B5VA 3PDUA 1Z75A 2AEFA 2Q46A 1AHHA 3ZW9A 3EY4A 1PR3A 2PKQO 3ITKA 4ALIA 4KP7A 1N1EA 2OORA 4CV3A 1D4FA 3AJRA 3HNPA 1GPDG 3I9KA 4UVIA 1GEEA 1GQQA 2X5KO 4XIJA 3FR8A 4J91A 4D3SA 2RH8A 4K6FA 4CJXA 4CM4A 5IFLA 1UR5A 1TLTA 4RDIA 1BXZA 1R4NA 5FWNA 3HDHA 3V2UA 3BZUA 1U4SA 5F3RA 1ZSYA 6LDHA 1A72A 2NNLD 2ZYAA 5U4QA 2VRBA 5I9LA 3BHMA 5BQFA 2WTBA 2CDCA 2NTVA 4JBGA 1KC1A 4IS3A 4CLEA 1HDRA 4CMAA 1UZNA 2GZ1A 4LMRA 3PYMA 1PTJA 3GVXA 1U2GA 1WMAA 1YQGA 5T6BA 4CLDA 2O3JA 3ANLA 5TLSA 1IPFA 4DIBA 3K2BA 4XA8A 2O4UX 4GAEA 4S1VA 1P3DA 2J3HA 3ADOA 2C59A 5IN4A 2CVZA 1JVBA 1FDSA 1NQOA 2WDZA 2TMGA 3EHEA 1YB1A 4PG7A 4R1NA 4W6ZA 2V65A 5ER9A 5TF4A 2X5JO 5TRTA 4XR9A 1UZMA 1A7KA 3QVWA 3DBHB 3WLFA 4FOOA 4YJFA 5U9CA 4KQWA 3B6ZA 4PG4A 5ES3A 4NG5A 3F5SA 4E3ZA 3EYWA 2JD1A 2R6JA 5JCJD 3QJ5A 2DU8A 1UXGA 3AI1A 3CH6A 1O0SA 3OIGA 3GH3A 1SAYA 2A92A 2QZZA 3CSDA 4Z3DA 2HO5A 2OFPA 2E49A 4AJ1A 1KEPA 2BFOA 3U9LA 4BKPA 2HK7A 3IUPA 2DBZA 1IOLA 1E3IA 1FDWA 2ZJ0A 1E1LA 4DREA 3WIDA 5C7IO 1GUZA 5AXDA 3GT0A 5IDXA 1ZW1A 3WYBA 3MWDB 3FWNA 3OJLA 4RF5A 5KVSA 4O63O 3KYDB 4PN3A 1F17A 1BVUA 5DOVA 4YA6A 4IY1A 1B3RA 4OMUA 3T7EA 2O3RA 1PWZA 5KJEA 1YL6A 2YV1A 3DZFA 4BNLA 2OGUA 3PI7A 1UXKA 5A05A 3DR3A 3ZGYA 5JAIA 1JLLA 2O23A 3RUAA 3BMCB 3PHJA 4AFNA 5IG2A 1DLJA 1PZEA 2AQ8A 1B26A 3ST7A 3LF2A 3PK0A 2CF5A 4KWHA 2P91A 4IQGA 2CDBA 3QVOA 1CIVA 4A7PA 2O7QA 1E7QA 3V2GA 1I5RA 4HX5A 3PLRA 2YV3A 4BUCA 3GHYA 3AI2A 4XGIA 3N74A 3S2GA 1ML3A 3I9OA 3V8BA 1PZGA 1VL0A 2EF1A 3QLJA 4B79A 2XXJA 1P31A 2YDYA 4U0JA 3TL3A 4BNFA 3WXBA 4F45A 5JDIA 4E2ZA 4IJKA 4TRRA 3I9NA 1ZFNA 2OOSA 1AHIA 3KETA 3OJEA 4HNGA 3IKVA 5JS6A 1CDOA 3DAGA 3K73O 3H5AA 4Q3DA 5G0UA 3TPCA 5KVQA 5U1PA 1NR1A 7MDHA 3PJEA 2I3GA 4MOWA 2E48A 2LDXA 4ZQBA 4RV9A 2A35A 1TT5B 4UVEA 1E6EA 4QSMA 4L9RA 2GSDA 3MTGA 3H9EO 3GDGA 2VRCA 4RPHA 1B0AA 2WE8A 1DJNA 4CM3A 2X0IA 1DFGA 1DB3A 1PL7A 3DBLB 4YJGA 1VPDA 4R1TA 4Z3KA 1K5HA 4KUEA 5JLAA 4H7PA 4D7AA 1NYTA 4N18A 1CEQA 1JKFA 2C5AA 3K5PA 3I23A 4IDDA 4BO0A 5A5FA 8ADHA 1DLIA 3LC7O 4NBRA 1GUYA 1NWCA 4NNJA 4XQCA 2I67A 1E0DA 3FD8A 1Z82A 3K2EA 4BMVA 4DIFA 3ZWPA 5CDYA 3DBVO 1GY8A 2E82A 4CV2A 5GZ3A 3TFOA 3AY7A 4RPGA 2PKQP 3L4SO 2FZWA 2SCUA 3P19A 1MXHA 3EUWA 5JE8A 1HT0A 1QYVA 2E4AA 5BNIA 3DZGA 1P0CA 2IEBA 1H5QA 1T4DA 4KWIA 5THQA 3AOEA 3QWAA 4NK5A 3VTZA 3HN2A 1GPJA 1E3SA 1VSUA 2JCVA 3JQ9C 4J16A 5GMOA 1U7TA 2Q1TA 1ADFA 4OXNA 4RQTA 2VUSA 1MGOA 4J1QA 1HRDA 3GG2A 2WM3A 1TB4A 1NAHA 1NQTA 4A03A 4BHTA 1IZ9A 4FDAA 4PVCA 3DZJA 5L4NA 3ZWVA 3VPSA 4OYRA 4R1SA 5KCZA 3WR5A 3I9JA 4B4UA 5KNLA 3H3JA 1LEHA 5ENDA 1O94A 4GMFA 3RUCA 2D8AA 1HE2A 4EUHA 5JDCA 5DCUA 1NWHA 2YHIB 4G65A 2ZQYA 2B69A 2YHUA 3U4HA 4IPTA 1RYEA 4PLFA 4R4JA 1YBMA 4OXKA 4FCCA 1YDWA 5IZCC 4XIYA 2QHXA 2ZK7A 3SLGA 1PJTA 4TVOA 1LTHR 4D42A 4JBIA 4CPDA 3GEGA 4Z0PA 3ZWXA 4ZQFA 3PFWO 1V6AA 3HJAA 3QVXA 3G0OA 4CQMD 2PGLA 2ZJ1A 2E37A 1JVSA 3TDKA 1GTMA 4LRSB 5COAA 1NX6A 5KKCA 4I5EA 2Y67A 2FY8A 5GZ6A 2GPTA 3C7AA 1YRLA 4PGFA 2Q2WA 1BRMA 2AQIA 2NU7A 2PNFA 3S2FA 4BQPA 3LT2A 3G49A 1H94A 2C82A 2ZYGA 3OICA 1BDBA 1VJTA 3GGPA 5KTKA 1D3AA 2OL4A 2A4KA 2X1HA 3QIVA 1XSEA 2DVMA 3JQBC 3LC2O 3OA2A 3DAPA 3O26A 4NIMA 4BO2A 3GDFA 4O1MA 3PDJA 1LLCA 3K30A 2PH3A 5COBA 2HK9A 5JCJA 1EVIA 3VPHA 4BB5A 4G81A 4PLTA 3WMXA 4YRBA 1YS4A 1H93A 1U3UA 1LC0A 1D1TA 5JMWA 3JCZA 1E3WB 2EV9A 3KYBA 4CUZA 1DO8A 1CQIA 3DFZA 3V1UA 3PP8A 3MOIA 5TS3A 3SLKA 4XJSA 2EGHA 1XA0A 1B15A 1PJ4A 1MA0A 1HXHA 2B4TO 3W4IA 5MDHA 3TSCA 1F14A 2GZ2A 2LDBA 4J2OA 2WSBA 3OJOA 4CLRA 1AXEA 1XYGA 1Z7BA 3LLSA 2HMUA 4OOFA 3WQQA 3KSUA 1PZHA 4S3MA 1YKFA 2RHRA 4ILKA 5KVVA 5AYVA 4NFSA 3IQDB 2CFCA 2O3SA 3O8QB 4RVHA 4OQYA 4NPCA 4AICA 2W2KA 3F5QA 1LDGA 3ROPA 3JV7A 3RVDA 3W4JA 2OMEA 2V7PA 1I8TA 1BW9A 3FN4A 1DFIA 1YQDA 5JAZA 3ZV5A 5K9ZA 4J43A 1FF9A 4B7CA 3VTFA 4R9RA 3G17A 3P7MA 3U49A 5A5EA 3T4XA 3ASVA 1BVRA 1HTBA 4ND4A 4TSKA 4I5GA 3VH2A 4D0SA 2FR1A 3H2SA 3RROA 3OBBA 3OP4A 1P45A 4DPMA 3TZ6A 1N2SA 1GCOA 3ETEA 5CAEA 2IYPA 4IIVA 1NM5A 3VZQA 4NJOA 1NASA 2CUKA 3ZHYA 3LT0A 1D7OA 2Q49A 4PLCA 4XYBA 4Z0TA 4GH5A 4BO8A 4YT2A 5C7OO 1NFQA 4L73A 1B8VA 1E1MA 3JQ7A 2C29D 2C7VA 1T4BA 2B4QA 2XAAA 1OC4A 4R69A 3KSZO 1Z73A 5JXWA 4YQYA 2PGJA 4FGWA 1CJCA 1N5DA 5EINA 3SC6A 1Y8QA 4CMHA 3L4BC 4NMHA 4I1IA 4EEXA 3VPGA 1QORA 2VZ9A 3QWIA 2VOJA 3I4CA 1ARZA 1R0KA 3CMCO 4BV8A 4DGSA 3VDRA 3JQFA 4EYEA 3FR7A 4RVFA 5G0TA 2AHRA 4XR4A 2VNAA 3P2OA 3Q3CA 2DLDA 3SJUA 4NFHA 4FFOA 3C1AA 4D43A 1LNQA 3F1KA 1WDLA 4JJGA 5I7SA 2H63A 1H2HA 4R5MA 4WECA 5EQDA 1K89A 1LDBA 4CL8A 3QWHA 1IHYA 3EVTA 4JBHA 1I0ZA 2ZB4A 2D3TA 3BAZA 1Q0LA 4XRRA 1U3TA 4NR0A 3UAGA 2HAEA 4PLZA 2DTEA 1W0CA 4R3NA 4YT4A 3PIDA 1P9LA 2D5AA 1F8GA 3E5RA 2D5CA 4PRKA 3RJ5A 1E7MA 4XYLA 4WLFA 2Q1SA 4EEZA 1KVUA 3ICCA 4RPKA 2B37A 4TMFA 3RFXA 3TNLA 3E82A 1ZK2A 3HDJA 5T57A 1UAYA 3OEYA 5ER6A 1PS9A 3GUYA 1KEWA 2YUTA 2HRZA 2HJSA 4BNGA 4P4LA 1M6WA 4PG5A 3WSWA 5IDWA 3ZNOA 3NEPX 4H3VA 2WD7B 2ZATA 4DQVA 1DHTA 3GFGA 2RIRA 4BO4A 1PJ2A 1P1RA 1DXYA 3ONDA 1R0SA 2J5RA 3VZSA 3HADA 4XCVA 4B3IA 1LQTA 3CZMA 3ZWWA 3AM4A 4QX6A 4O0LA 5JAMA 2PH5A 1UP7A 4CUKA 5EQFA 1UUFA 2QZ9A 4TWRA 1FMCA 3TFQA 4U6QA 4R16A 2F00A 4YJDA 1GCUA 2W8ZA 4CQMA 4CMKA 2O3QA 4RVSA 1ISMA 5TJHA 1QXSA 4U6SA 4RJTA 1R66A 2NACA 1NXQA 3FTNA 5EPOA 3DMYA 4IDAA 2PGDA 1LRLA 1U3WA 3UFXA 4YYZA 3KLMX 4GX0A 3NAQA 4N5LA 2BFAA 1YL7A 2B35A 4Q3CA 4AJPA 4NU6A 1E7RA 1M66A 1Q7CA 3KEQA 4DUPA 2Y05A 4KTVE 2W2LD 4CM8B 3H9QA 1A5ZA 1GL3A 3ZV6A 1I24A 4AG3A 4DA9A 5B1YA 4NBTA 4A2CA 1MP0A 4ID9A 1KY4A 1T2CA 4CR6A 2BHLA 1EUDA 4BS9A 3B70A 1C1DA 2QRLA 5LCXA 5L9AA 3E8XA 3INRA 3F4BA 1E3JA 1ZUD1 1B2LA 2NU6A 2CVQA 2Q99A 4IDBA 5DP1A 2PD3A 2WYWA 1UZLA 3DXFA 1RM3A 4RCVA 4U5QA 5DCWA 4E6PA 3NJ4A 2HDHA 3DZBA 4R41A 3KM0A 3VH3A 1NQAO 2O3UA 4XYMA 4CM6A 4DLBA 1DPGA 2O2SA 4BIIA 3OQBA 3FI9A 4PLVA 2IODA 2ZQZA 2YQ5A 3GDOA 3UW3A 1ISIA 1EK6A 1YL5A 4WLNA 2PR2A 4FS3A 4GX5A 4Y98A 5HWSA 1PJCA 2PLAA 3RJ9A 3A28A 3IAHA 5HTOA 3PJFA 3E5MA 2X6TA 3I3OA 2EKQA 3DONA 3DZHA 1QYCA 2O50A 2VUTA 3ON5A 3P5SA 6ADHA 1AXGA 4BQRA 5KJ6A 1HE4A 1JKIA 2EKLA 4ZICA 1WAMA 1IYZA 5CEEA 2VZ8A 4UUOA 3ZWMA 4EI2A 1IULA 2AQKA 2BH9A 4QECA 4D3DA 1I36A 3C1TA 3BMNA 5IXYA 3Q1LA 4DLLA 2B36A 5GZ1A 5IZ4A 2DFVA 1VI2A 4GI2A 3HZZA 4PLYA 4FOSA 1G0OA 1WP4A 3GK3A 1Z6ZA 3KYDA 4MP6A 3BXXA 3BIOA 3MWEB 4DXHA 1JDJA 2CDAA 3ROQA 4E32A 4BKUA 1B3BA 1I33A 1XU7A 4J1NA 2NVUB 3RC9A 3Q11A 1M67A 3EZYA 1ULUA 1MFZA 4P22A 1NPDA 4J7XA 1U7HA 4CM5A 1QG6A 2JFFA 3GVPA 4AJEA 2IEDA 3AW9A 3BMCA 5ITWA 3PIIA 1CERA 1XHLA 2YJZA 1LDYA 1ZEMA 4LCEA 5HBRA 3AOGA 3RUEA 4EZBA 5L53A 2DQ4A 2P9EA 5JNLA 1JWAB 2O48X 1QYXA 3PGJA 1C14A 2NQ8A 5L51A 3JQ6A 4DC1A 1A71A 4IINA 3I6QA 3ZWCA 2GZ3A 4QFCA 4E5KA 4GL4A 1O95A 4D0RA 3SEFA 3IS3A 3JQDA 3VH1A 1DC4A 3VZRA 1UXJA 3WGQA 1VSVA 3WNVA 4BNJA 4GLLA 1UP4A 3ASUA 4Y9DA 3A06A 3ZWYA 3GLQA 4RQUA 3SBOA 4NH4A 4A0SA 5AXBA 3BYZA 3GC6A 1JU9A 1GR0A 4IUYA 4W99A 4BB6A 2DBRA 4W4TA 2Q3EA 1F8FA 4II3A 4BMNA 3NJ8A 3VC7A 4PLWA 4YJHB 3DHNA 3JQCA 4TROA 1TT5A 2VTEA 4DQXA 4OGWA 4MPDA 4WNCA 3TF5A 3BMQB 3Q6IA 2CD9A 3WYEA 2X22A 1Y5RA 3D4NA 1E77A 4WOJA 3JQGB 1DBVO 4PLPA 2J3JA 3ZNPA 4C7JA 2J8ZA 4M55A 3TQHA 3WBFA 3I6IA 2BRUA 2OP1A 4ZQEA 4AJLA 4E2YA 4FR5A 2I66A 2VYND 3DC2A 4Q39A 3Q9UA 1MG5A 5TIIA 2G0TA 5L95A 1T2EA 5JYDA 5FYDA 2CY0A 1P1KA 4BNKA 2D0IA 2FWMX 4D46A 1EVYA 3WJAA 4O5OA 4XYEA 3RC2A 4QXMA 1TI7A 1LSJA 4OL9A 3RUDA 1A9YA 3FHLA 1LDNA 1YWGO 4B3HA 1W73A 2GR9A 1XG5A 2FPPA 1ZH8A 1XLTA 4QQRA 3MEQA 2GDZA 3KTDA 3EW7A 1HDOA 4GQAA 4CMJA 1LBEA 1V9LA 3E9NA 2VCYA 1PWXA 4OH1A 5EN4A 1MC4A 3GVIA 4WJZA 1AE1A 1LLQA 3QVTA 4L75A 4DLAA 1P74A 1H9BA 3LLVA 2G17A 4QO7A 4E13A 1XWFA 3PEFA 3F1LA 4MVJM 1FXSA 1XKQA 5L4SA 5A9SA 3DL2A 2Q45A 4R51A 3IJRA 1N7HA 3DO5A 5A3VA 1ENPA 3RBXA 2TMDA 3FF4A 4EUEA 3PQFA 3PZBA 3WICA 1K6XA 1HE3A 2X4GA 3KHUA 1DSSG 2QW8A 2ZTUA 1GD1O 1T2FA 5F1KA 4D45A 3NTOA 3F47A 1DAOA 1JW9B 1TEHA 3EVNA 1R4MB 3D3WA 1GZ3A 3ENNA 3HB5X 3VDQA 3BMOB 5JW6A 2B4RO 2I76A 3WJ7A 1LDMA 2YHIA 2Y93A 4H15A 4BO1A 5JSFA 4KDFA 1V8BA 1J4AA 2ZTMA 3W6ZA 3AOEC 3CEAA 4J3FA 1J5PA 4JQCA 3RWBA 3GZNB 2W2LA 3KLPX 3U09A 1TXGA 4OQZA 5I7FA 1PX0A 4CUJA 2BI8A 4MVJH 1PS0A 5DNAA 2OO5A 3TOZA 5CG2A 4E5PA 1GADO 4G5HA 1C1XA 3BTVA 4RF4A 1SO8A 2ZCVA 4PLHA 2IZZA 2QRKA 1WDMA 1C0KA 2GUGA 3HFSA 3WG9A 3CTMA 2BGMA 4HFJA 1Y6JA 4L4SA 5F5NA 4XX0A 3AY6A 4MIOA 4IDFA 1E7WA 3JQEA 1G0NA 3HN7A 4J0FA 4P38A 4ALLA 4CM7A 3JTMA 5A06A 3UGKA 2PZMA 3RC7A 4Q3EA 4BNYA 1DIGA 3GG9A 1EE9A 4RVDA 2X9VA 5JDCC 3RD5A 1LDEA 4MVJF 2EWMA 3D7LA 3LYLA 4E12A 3PHGA 2O2YA 4UUPA 1VM6A 4GX2A 3GGGA 2JFHA 1UH5A 2J5QA 1PJ3A 4YCAA 2VWHA 1NBOA 4OO3A 1Q7GA 5C3MA 1IUKA 5HRUA 3KO8A 5ICMA 1E3WA 1GQ2A 1ZXLA 3W8EA 1RJWA 4IMPA 3AFMA 4LCJA 3DMTA 1OOEA 1PGJA 1PR9A 4ZN6A 1EFKA 1BGVA 2WYVA 4TKMA 4Z9FA 2JFGA 2C20A 3QV1A 4DVJA 1XGKA 3GRKA 1I32A 4FBGA 1E1NA 1FDUA 4NBWA 3K9QO 1W4ZA 4D3FA 4QTZA 3ZU2A 4GKBA 2VHYA 2W4QA 4ZRMA 4YT8A 4LVUA 3HB4X 1AN9A 3O03A 3HSKA 2HJRA 3PLNA 3G1TA 4J7UA 1Q2XA 1SB9A 4KQXA 4TZTA 3JQAB 5EMHA 3NTRA 2GF2A 5T67A 3NKLA 1LXCA 1YVEI 1PEDA 3AK4A 4CLOA 5BSEA 1KOLA 4MKRA 1BMDA 1PL6A 3GY0A 3LC1O 3RSHA 3NGLA 4Z9YA 4J4TA 4Z9XA 2Q4EA 3JD4A 1WMBA 3B20A 3I52A 1YJ8A 2DPHA 4WOKA 3IDSA 3ZHZA 1WVGA 1ISFA 2AA3A 4Y6SA 1AUPA 1NTOA 2HRBA 1H6BA 3GNTA 1EBFA 1NVGA 1ZSVA 1Y9AA 5L7TA 4YEDA 1I3KA 3DEYX 1NVMB 2X23A 1U1IA 2Y0DA 1WPQA 2D4AA 3GNSA 2P68A 2XXBA 4BVAA 2AE2A 1SOWA 3C3XA 4CM4B 1CQJA 4NBVA 2IZ0A 1HWYA 1R4NB 1V3VA 4BKQA 2FOIA 1UXIA 4NU5A 3DHYA 2BD0A 2VHVA 3FPCA 4JGBA 1RPNA 1GEGA 2HLPA 1MLDA 4CMBA 2NTJA 1E3LA 2IDZA 5B37A 1SC6A 2Q4BA 3K8ZA 4K28A 1G1AA 3LVFO 5BSGA 1MB4A 2PZLA 3RUHA 5G4KA 5EJ2A 4IDCA 1U4OA 4FGSA 4BKOA 4I08A 4ZRNA 1PU2A 2VYNA 4JK3A 1ULSA 2PZJA 5KVCA 4Z0HO 1E7SA 3AUSA 5IXSA 1KERA 3I83A 4R5HA 3E9MA 1P77A 1NAIA 4A26A 1A4UA 4TRNA 2PWZA 3TWOA 1ZSNA 3HE3A 2CZCA 5A1TA 3GEMA 2R00A 3ADPA 1ZKMA 3PQDA 4PVDA 4YJFB 5I7EA 5JYEA 4RLSA 1X0VA 4HUJA 4N5MA 2GN6A 3JD3A 4OOEA 4CLXA 1HYHA 4IDEA 4MVJI 3H7AA 4ND2A 1ZK3A 1DIHA 3JYNA 3PHIA 3NT4A 5DDIP 1A27A 3JYQA 3S1LA 1OFGA 3MTJA 4AJKA 1X15A 3L9WA 1R6DA 3JQFC 3OETA 4PG8A 3FNHA 3ZZNA 4XDYA 5IF3A 1UXHA 4UEKA 4GPD1 3ZHBA 2VOEA 4E33A 1I10A 5IDYA 5G0VA 4W82A 4J9VA 1PQUA 3EZLA 1YB5A 3OMLA 3OFSA 1VKNA 4MJLA 2NM0A 5C7LO 2BELA 3WQRA 1Q7BA 2CMDA 3GHHA 4IMRA 5F1PA 3OQ6A 4CV1A 5BR7A 5L40A 3CKYA 4RDHA 3NT5A 3F4LA 2EW2A 2CVOA 3MJCA 3UHAA 2ZYDA 4BNVA 2IYOA 4EJ6A 1DEHA 4BNIA 1JAYA 4U0KA 4XEHA 4NI5A 5THKA 2IZ1A 3F46A 1KS9A 1QYDA 4OKIA 4P4NA 3W4KA 3EC7A 4BGEA 4PLGA 1ONOA 3RIHA 1H6DA 1BG6A 4HNHA 3K31A 2XF8A 5HM8A 1EFLA 2D59A 1HZJA 3ROKA 4BNUA 1HSOA 4AJNA 3JYPA 2WE7A 2HMVA 4FJ2A 4GGPA 5A9TA 2C07A 5L4LA 2X0NA 3UF0A 1X14A 1GYRA 3IP3A 4WCFA 3D3EA 4X54A 1ISGA 3ROMA 5DULA 1U28A 1P1HA 2PY6A 3OA0A 2HQ1A 1YOVB 4EW6A 4JXKA 3EDMA 4HV4A 2ZTVA 1FK8A 5CP8A 4MO2A 4IXTA 4AJHA 2HKIA 3D0OA 3B1FA 3M2PA 2JCXA 3TOXA 4XWYA 3RASA 4CODB 3UN1A 4BO7A 3GUCA 5DP2A 4U7WA 4Z6KA 5ITVA 3AWDA 2I99A 5T8KA 1NVTA 2DUWA 1QMGA 3NDJA 2JKVA 3U62A 3ZW8A 4INAA 1ISHA 1DRWA 5LDHA 3WIEA 1Y8RB 3NDRA 3PWZA 4B7UA 4GSKA 4HWKA 3PWKA 1MXFA 1Y1PA 2B0JA 3EMKA 4YJGB 1K2WA 3RQSA 1VL6A 3WGGA 4J6FA 4HFNA 2ZCUA 3VH4A 1I3MA 4IIUA 4AJ4A 1P33A 2VWGA 2FPGA 1ENOA 4I9UA 2BMAA 3HFGA 4MP8A 2D1YA 4DWVA 3QSGA 1MC5A 2E6UX 2AE1A 2NVBA 1HEUA 3EK2A 3C8MA 3WGIA 1NNUA 1U8XX 5HS4A 2VWPA 3OJFA 3PGXA 5K6AA 1H0KA 4WASA 2AXQA 2YW9A 1DC3A 3INGA 3R6DA 1JQBA 5H82A 4WEQA 4CMIB 3OSUA 3KYCB 4E5YA 3JYLA 1Q0QA 2Y1FA 4HKTA 3LDHA 4NDNE 2PD6A 4W7HA 4J49A 1TVEA 3BHIA 2UUOA 4NBUA 3H6KA 3D1LA 4L0QA 3KRTA 3L0DA 4UREA 2XOXA 1XDWA 1YJQA 4O59O 1B14A 4RL6A 3AM5A 1DIAA 4M89A 4CMEA 2WWRA 3TJRA 5CPFA 3DZIA 5G0SA 1PGNA 3BHJA 3U4IA 1KYQA 2A94A 4HFRA 1HETA 4FIZA 1JTVA 2NTNA 3ZU4A 3GAFA 4A27A 2Q2QA 1YH3A 4BNNA 3B1KA 1HF3A 4YT5A 3ANNA 2F1KA 1M2WA 1T24A 5JC8A 3S55A 2YY7A 1XU9A 3AI3A 3RI3A 4RZHA 4TKLA 3W6UA 1ADBA 5EESA 2EKPA 3UXYA 2VHWA 2YYYA 1V35A 4IJVA 5LC1A 1D1SA 3WDSA 1N9GA 3GMSA 1I2BA 4N54A 1EDZA 3ZI0A 5CDSA 2PFGA 1K0UA 2PK3A 1ZJZA 5JFOA 1IB6A 3R1IA 5BNFA 4I9NA 4GVXA 2JD0A 3RU9A 2QYTA 4YQZA 3H9UA 2WD8A 4IGFA 3I1JA 3VOSA 2Y68A 1MG0A 5JMPA 3PRJA 1TA4A 2QQ5A 3ONEA 4ITUA 2Y99A 3ZWNA 1PGPA 2VNSA 3VKUA 2A9FA 1QYWA 2GN4A 3PJGA 2X86A 2NADA 3U3XA 1E6UA 4WKGA 1YXMA 1VKOA 3KB6A 5CG1A 2BGKA 3PTZA 5KIAA 4FJ1A 1B8PA 1PL8A 4JROA 3TZQA 1X7DA 3DOCA 3WBBA 3O38A 4NJMB 2ZKLA 5TX7A 1WDKA 4IDGA 1R12A 2NUAA 3RKUA 3T4EA 3GPDG 1E5LA 3DZKA 1YE3A 4LRTB 5B4UA 3O4RA 4EUFA 2R2GA 2YFHA 1BHSA 1NHGA 3E03A 3E18A 4TRJA 4MIEA 1I3NA 3DTYA 3W8DA 2WJPA 4DYDA 1VJ0A 2C5EA 4TVBA 3TL2A 1PGQA 2I3AA 2GLXA 4A10A 4CLRB 5K0ZA 2NQTA 1CETA 1ID1A 2WEKA 3NTQA 4ALMA 4D79A 1IE3A 3IOYA 4BGIA 1LUAA 4YDRA 4LSWA 5A03A 2HCTA 4FC7A 1QLHA 1DAPA 4DYVA 2W2KB 1X1TA 3VHRA 3SX2A 1I30A 2UVDA 4G2NA 1NPTO 4XKJA 1BW9B 1W6UA 4JP2A 4JJIA 3DBHA 1UDAA 3PZRA 1EZ4A 1FDTA 4FFRA 3GVCA 1DRUA 2Z1NA 4XB1A 1XCBA 4P8RA 3RAJA 3CINA 4FFMA 1HDGO 2VUUA 2C0CA 4JJFA 1WWKA 2DM6A 1TT7A 4R1UA 4E21A 3HG7A 3N58A 2X58A 3UUWA 3E9QA 5KWEA 4WEOA 2AW5A 3C24A 4JIGA 1T2AA 3P2YA 1GYPA 3ICPA 4FFNA 2I65A 4PZDA 4HXYA 1IHXA 4GWKA 2J6IA 2JD2A 5G0WA 4EDFA 3H8VA 1B7GO 2VQ3A 1SNYA 2JAHA 3WX0A 5FI5A 3ZN2A 5CDUA 3GMDA 3DHEA 4YAKA 2PV7A 3LT4A 3T7CA 4YAEA 3C7CB 2EJWA 3D4PA 3PQEA 2ZTLA 1VRWA 2OP0A 2V6MA 4F3YA 2BI7A 2J5KA 5HS6A 1Y8QB 4GKVA 3JQ8B 5TT1A 1K6JA 4ND1A 2JJYA 3PXXA 3GR6A 4RZIA 3SVTA 4RVGA 2X0RA 5KJCA 5F1OA 2UV8A 4KTTE 4BMSA 2VHZA 4XJTA 4IS2A 5BT9A 4BGUA 1ZCJA 5CDGA 1H6AA 2P5UA 4BL5A 3GFBA 2V6FA 2CSUA 4JP3A 3FRJA 2BGLA 1LSSA 5H83A 3WSVA 1XQ6A 4ONEA 4CL3A 4XZ3A 1EUCA 4QFDA 1E6WA 2VYVD 1JWBB 1ISJA 1SOVA 5CDTA 3V2HA 2QG4A 4E2XA 2P4QA 3C7DB 1NPYA 3WS7A 1VE9A 4M87A 2Q1WA 2OBNA 1R0LA 2GASA 2JCYA 3V1YA 1ZMTA 4ALNA 3NV9A 5I7VA 3ZHXA 3ANMA 1KVTA 4WLVA 1JAXA 1P1FA 4L74A 2HMSA 2ZB7A 3IIEA 3PPIA 2FRDA 4IM7A 4PCVA 3S2IA 4IJWA 1LI4A 3KV3O 3VAZA 4IGEA 3RBZA 4B8WA 1RM5A 1Y7TA 2AEJA 2GNAA 2EEZA 4CQLB 4ZD6A 2C54A 2FSSA 3RFVA 5ILOA 4GVLA 1Y81A 1G6KA 2HSDA 4L4XA 1QRRA 2WMDA 4MVJP 2Y1EA 1GV1A 2Y1DA 4WLUA 5A9RA 3PJDA 2DC1A 2G82A 4XQEA 3WOHA 1NQ5A 1D8AA 2I6TA 2JHFA 3WQSB 3CMMA 3JD2A 3DBLA 5JAQA 5I8WA 4NZ9A 3H3FA 1VL8A 4OHUA 3OIFA 5KJ1A 3DMTC 1M6HA 2ILTA 2DFDA 4DL9A 3CZRA 1WNTA 4XGKA 5A4DA 2Y0EA 4MKXA 3ZNNA 4ZVVA 3WYCA 3AUUA 1CYDA 3FNGA 4YAIA 4ROSA 4GX1A 4C4OA 4F46A 1M76A 5JDIC 2FN7A 3LZ6A 2GCGA 2C2XA 2I9PA 1K6IA 3L6DA 4KDEA 4J1TA 4A5OA 1XIVA 1BXGB 3D5QA 1KBZA 4J90A 5L3ZA 1RYDA 4I9HA 1N1GA 3UICA 3Q9NA 4CQMB 1HDCA 3D64A 3VVBA 1LQUA 1KIFA 5BSFA 4CM1A 1PQWA 5EERA 1ONNA 2JL1A 1LJ8A 4IBOA 2O3TA 3DOOA 4DTIA 2QRJA 3M1AA 4J9UE 3WWZA 4GLOA 1T25A 2FZEA 3KBOA 4I5DA 3GQVA 4MVJD 4KUGA 5I9MA 4N7RA 3BTSA 5L7WA 4CM9D 1RKXA 2Q1UA 1OAAA 3OECA 2EP7A 2UYYA 3MZ0A 3SJ7A 3AUTA 4PIVA 1C1DB 4KZPA 1VLLA 1J6UA 3EAGA 1GAEO 2FP4A 2ZIZA 3TN7A 1V3UA 3V5NA 3RUIA 2VT3A 3HQ4O 5IJZA 4BNXA 1BXKA 5F5LA 3R0IA 5DN9A 3U4DA 3AFNA 3GZ4A 3ULKA 5T64A 3QWBA 1U3VA 4Q3NA 2G5CA 2FSVA 2GN8A 3FBGA 3FTPA 4RVUA 1SEVA 1T26A 2AEMA 5B4TA 4ZJUA 1OZAA 3LK7A 3FNFA 4RGBA 1IZ0A 2X9NA 4MVJE 3STHA 3UOGA 1UP6A 2X9GA 4CR8A 1HKUA 2QYSA 1U9JA 3EGOA 1W8DA 4RORA 3WGYA 4UUNA 2AQHA 3SXPA 3PYLA 4RPJA 1KVQA 2EERA 1X7GA 2H1SA 4YTEA 3OH8A 3BMNB 3F3SA 4KMSA 1KVSA 1SB8A 1ZEJA 3E1KA 1KETA 4NK4A 1E3EA 4W9NA 3O9ZA 3WTCA 2NSDA 4UULA 2R00C 1DIBA 2GN9A 2POQX 3VKVA 5ICSA 1N8KA 3UCXA 4E31A 3NT2A 4UEJA 4JNKA 5C5IA 2Z95A
chains in the Genus database with same CATH superfamily
4BKUA 4FZVA 2RC5A 2O8CB 1VSBA 3F73A 2O8DA 2P78A 1XEXA 5EZ6B 4GPEA 1UPCA 4B71A 1H4TA 4YJ3B 3DCYA 4ZA2A 2IEYA 5FUYA 2CXTA 2FPIA 4E30A 5JATA 3UYLA 3OY2A 4M46A 4MWTA 4CMGA 3G02A 4K6CA 1DOHA 2P62A 4HZGA 1OLOA 1TQ6A 1Y4AE 4AZTA 5IULC 4HHEA 2FZKA 4MINA 5F7JA 2WBLC 1EBBA 4BLTA 3U13A 1V16A 2GBCA 3C97A 4HEJA 1E9RA 5KYTA 2NU8A 4WCVA 1GRCA 5IT4A 2FSPA 4QEDA 1A4XA 1GL9B 3O84A 2DFKB 1PUXA 3RQIA 1GGEA 3ITDA 3MD9A 2NYUA 5DPMA 2PX0A 3DWFA 3Q0EA 3NUGA 3QA9A 4XYGA 1IBSA 4UCQA 3EXIA 4ATNA 1NDQA 3O4IA 1ZH4A 3BD9A 3DDNA 3G6KA 5FL7A 2GSWA 4FSDA 5B12A 1IM2A 3D5TA 3OZWA 3D2BA 3E9ZA 4B3JA 1MX1A 3L8FA 5HUJA 4UAGA 1OVGA 3REGA 4H7EA 3T9BA 1VHDA 3IMGA 2O2ZA 4UQPA 5LYJB 1G6Q1 2O2HA 2IW3A 5DX8A 5DSTA 2FZCA 3V32A 4OIFA 2ZSDA 4TYNA 3HEBA 1WV1A 4GXNA 1YDEA 1U4NA 2BLLA 1DRJA 1LWNA 1XZKA 3LPLA 2UVPB 1K92A 2H2AA 4ZCIA 1BE8A 4URWR 1IZZA 4FXOA 3LQ1A 4I8XA 3PNSA 3OM9A 3PNKA 3GELA 1MBZA 1T5DX 2BEUA 5DOZA 1SEPA 1W4BA 4AROA 2R8OA 3B1XA 4RGQA 5CXUA 5ES4B 1OGIA 5FOWA 3SQXA 5LDGA 3FF1A 4PIPA 3V97A 1CF4A 4L7VA 2XTAA 4GPTA 4LN1A 5EI5A 1UAGA 4WCFC 4C01A 4HXEB 1P17A 3W1VA 3QG1A 4GP6A 4REOA 4RS4A 3TQIA 1PEKE 4YUWA 5B57C 1FXWA 3FB4A 2CGEA 3QFSA 3ZD8A 2P4HX 2I34A 1ZUNB 1CXZA 1GU7A 4HWTA 5TT0A 3K20A 1T29A 3EXHB 4ZARA 3SKYA 5C52B 4WN9B 4EARA 1Z0SA 3CR7A 3DVAB 4EKIA 5F2KA 1ZD3A 5TF0A 3L0IB 4LBVA 5C1DA 1B43A 3W77A 1A4IA 2XA1A 1PNVA 4OJQA 3RSZA 2FPPB 3DE7X 3ENQA 5F64A 3TRHA 4G0MA 2XA9A 4WDQA 4GFDA 1LRKA 3QGMA 3IHWA 2NUPA 1NOJA 4KXVA 4Q1VA 1N4DA 3S27A 4A6DA 1CP2A 4IMJB 1BWSA 1X80B 1KEUA 2QRGA 4PO8A 4EG3A 1U3DA 3LQFA 1TAHA 2BSAA 1XI2A 1TJPB 2PRJA 1UIMA 4FQ7A 4GXQA 1G9SA 2CLDX 4RADA 3WFZA 4ETWA 1XL1A 3N8GA 5DMXA 3W5DA 3H42B 3SCZA 4YAJA 4HADA 1NFRA 4P3NA 1JU4A 2HMWA 1PK8A 2QXTA 4H35A 4PC6A 5IAJA 4L4RA 4Y6RA 4KLAA 2G1PA 4CT0A 3VGPA 4Y67A 2D1SA 1I7PA 4RFLA 3HNRA 4NLLA 5DHUA 2EJVA 1F2TB 4GPBA 4YACA 1ZLXA 3UW1A 1HYGA 5EHNA 4C0AC 4D74A 2IZ7A 1ZH0A 1X7YB 4J0DA 2W00A 1ACMA 4JR0A 3D3WB 5U4XA 1O9BA 1G2OA 3QKUA 1Z15A 2VL7A 2W6NA 1HOXA 3LVQE 1OU4A 4ZIRB 4XDZA 3MMPA 4EPRA 3A10A 5CNKA 3A2MA 1E5QA 2N75A 4KE6A 1EX6A 3FIJA 1OLUB 5JQGA 4LMPA 2XMQA 3CCCA 5IYZF 1X2EA 3OCUA 1NW9B 1V48A 3P0JA 3UWSA 3DAYA 4J1SA 4XTCS 5DBIA 1YONA 5EFZA 1Q7RA 5AKLA 4AKSA 1GQSA 1N7GA 1BDMA 2DULA 2OC4A 4KYIB 1EWTA 4LYYA 2G5GX 1A5SB 2PMDA 4FSHA 1CLEA 3PPYA 3CRZA 3Q5DA 1EWRA 2G76A 3G7NA 4JN6B 4DWWA 2GTHA 1P39A 2HWWA 3OZVA 2AWNA 4Q24A 3AVTA 4HC4A 4D1YA 1QLJA 3QQPA 4WK6A 5J1TB 6GPBA 3HSYA 3GT4A 3FSRA 4ZCMA 4AC9A 3K2IA 4MRPA 4H16A 5JO9A 4QJ5A 1DEAA 4R8KA 3ZWOA 4GGOA 3NYRA 4M2LA 3MBOA 3GN1A 3WL8A 4U7FA 4ERXA 1SC3A 2B6NA 1NJ5A 3GLKA 3HWSA 3WGJA 4TWBA 2YQZA 2PT7A 1FUEA 2XX3A 3RIGA 4LISA 3VNAA 4E14A 1JA9A 1Y3IA 5CJ2A 3T9EA 2XCLA 3D8NA 4MUBA 3EVDA 1XVVA 4MVJG 5DHFA 1EQUA 5CFQA 2QXUA 5JVDA 1ZZEA 2ZYVX 2QLLA 4PGMA 3OZ7A 2BPOA 2DX7A 1X7HA 1XTBA 2W2VA 2YFQA 2ZJ8A 3L1UA 4F6RA 5GTDA 2P9JA 2V7XA 2ZRAA 3CISA 3LS2A 1I94B 4WKNA 4KUHA 1LSUA 5LQJA 1JFSA 4R05A 2BLNA 1LTKA 2FRXA 3IILA 3IIJA 3ZBPA 5BN5A 2YFYA 4AJIA 1W8IA 4Y2RA 5TQ2B 3BA1A 3T41A 1M34E 1TO6A 3D6JA 4RVOA 4M36A 3CPSA 4ZAWA 2DE0X 2B3TA 1O89A 4RIFA 3E3MA 3OZRA 5CX4A 5FX2A 5KJFA 4CM8A 2OHJA 5CJJA 3E7DA 4MK4A 3VR5A 3V9PA 4OBEA 5ADUS 1QAOA 4XDHA 4B7XA 3ESBA 2AWOA 2Z5FA 3ABIA 4V0SA 4IZHA 2HF8A 3IPRA 1E4EB 5AD1A 1ADCA 1TJ5A 3FPBA 4HTFA 4OF4A 1N36B 5JXIA 5LSAA 4KV7A 1A2BA 4HRAA 4Z51A 4BPRA 1YB4A 3C85A 3IJEB 3E22B 3R40A 1OU0A 2HHAA 4TSFD 2DHCA 4IR7A 4DR6B 2UAGA 4IJUA 2OPHA 3KC2A 5AVKA 4BKRA 4PCUA 5DNWA 1SCJA 3C48A 3BXOA 3N59A 2QAIA 4HDSB 4NHEA 2W6IA 4ZQHA 5BOVA 1XQ1A 3WL3A 2V6BA 4UUAA 1Q1ZA 4II2A 4PEVA 1QTNA 2RI0A 2PD4A 2Q5LA 5H7XA 2C7QA 2G5PA 4AF7A 3TEMA 1N0VC 2HIMA 4TLDA 3Q3VA 4MQLA 2H4FA 3W3AD 3R76A 4RD0A 1L7DA 1XXHB 1PJBA 3QHQA 1U5AA 4R01A 1JHUA 3M70A 2I2BA 2Y66A 2JA2A 1W87A 3OZFA 3SIPA 1U98A 1CB0A 1YZNA 3TZKA 3QE9Y 1I4DD 1NC1A 3VKGA 3K0FB 5TJ9A 1M6YA 4YCSA 3DDWA 3HU3A 5J9FA 4XWYA 2M6SA 4G0ZA 5H59A 3WK6A 1KZ1A 4RLFA 1DKOA 2FSHA 5AKJA 5FF9A 1W9HA 3UCFA 3M4XA 4QVGA 4LJLA 3ZDYB 2AVNA 4BLSA 1FNDA 4XQGA 1JTEA 5TNXA 3UMYA 5TPWB 2VDLB 3RSQA 3RU7A 3WAKA 4ZOCA 2BI4A 2VDKB 5FD8A 4JMPA 4LSMA 3R8FA 4F04A 1RMQA 2Y1OA 5IVPA 1Z33A 3K1TA 5JY6A 1V4NA 1XROA 4GMGA 5K0FA 5GJVC 4OSOA 1V0JA 2XMZA 4CT5A 2DBYA 2FWNA 2WWHA 3S2EA 4N5IX 1Y6QA 3GZTB 1CQXA 1Q21A 1T9CA 3WBJA 3ZLVA 4AX4A 2YKGA 1SHZA 3G3EA 3H5OA 1CWUA 4TL6A 1P2SA 4QPNA 4G4SO 2BFNA 1MDBA 1UJCA 4MTCA 2RDMA 3FYCA 5KOJA 2C7GA 2EYQA 2Y2VA 3VKHA 2VNJA 5J2UA 3AY3A 2R0QC 3RVOA 3DTTA 3QEMB 1P80A 3W8FA 3E5HA 3S55A 1J0CA 1PR4A 3ZNQA 4XSVA 1R64A 2AR7A 4LYJA 1SUEA 1E2KA 4QQNA 4S2EA 4ZOLB 1EHYA 3SQMA 3ESXA 3QM1A 3M49A 3U1BA 3OUUA 4EJ0A 5EKTA 4XQ9A 4IHJA 4PPYA 5LBUA 1PGOA 2W2NA 3FPLA 2D62A 4KQ1A 3U7EB 3OHSX 3CUYA 4UCWA 4ZEWA 3UH1A 2F9LA 4QFMA 4E5MA 4PSDA 2F62A 2IOQA 1S3FA 4BP8A 4YMHA 2IXAA 2K2QB 1OWOA 1EWVA 5HCIA 1SBZA 5ERGB 1F4PA 1EVJA 2WR8A 1H2BA 3KQTA 4R54A 4RMGA 4NEHB 2XRYA 4JH0A 4P4GA 5DLPA 3STXA 1XNQB 3LWDA 2PS1A 2C3MA 1FDIA 2V8OA 3WSTA 3NPMA 2XT6A 4WV3A 4MUIA 3UHFA 4UDNA 3R9XA 4BVGA 1WD7A 1NG1A 3G2QA 3KVVA 5JAHA 4QO8A 5JMOA 4LXHA 5FQNA 1UT6A 1L5HA 3OFKA 2H2IA 3NWEA 2XZPA 3TIVA 4R6XA 5K0JA 4M1YA 1E1RA 2IRWA 421PA 2FPMA 1OY1A 2WMYA 3DFUA 1C29B 4JQSA 4Z3OA 1VJDA 5C37A 4F84A 4KV9A 4ZT5A 4RF4A 3T1QA 2ZXFA 3PWSA 1Q84A 1QTRA 2ZAYA 4C5AA 3IL2A 5CUQA 5LOVF 2QT0A 1NV9A 1QSGA 1UEIA 1WCIB 1GAXA 2NVOA 2HEGA 2I80A 4I55A 4JLUA 4EY5A 5EVCA 2BFMA 5A4IS 3KR0A 5AVOA 3LYAA 4HNRA 5LR6A 5KC8A 5KOIA 5J3JA 1WPRA 3JQGA 3LG2A 2IY9A 5FKJA 5BN1A 3JD1A 4O8ZA 1KIMA 1I2DA 1TW2A 2FMUA 2AVDA 2GM5A 3FLBA 1K3TA 3IQWA 4IVQA 4MV5A 1I7NA 5FPHA 4ALJA 1Z47A 3P0FA 4UXHA 1Q0HA 2P2SA 1SZJG 3AJEA 3K6JA 1IAVA 1ZL0A 5FLYA 3NDBB 5CX1A 1E2EA 1SQ6A 4REQB 5JPIA 4NENB 4GEGA 4F9FA 3L77A 4Z1MD 4PW0A 1U0FA 2C3OA 3BJEA 3E1GA 3WWYA 1Z8HA 4WI1A 1YZGA 1V7ZA 1B6SA 2Q6TA 4IIGA 2C83A 3UH0A 2HWUA 2JFNA 1NXXA 3OZAA 4O4HA 1FVOA 1EJBA 4OJMX 3T7JA 4ZT6A 1W581 4HF7A 5D7BA 5TARA 2BFBB 3KSBC 1KYWA 1B1AA 3MJEA 2ZT6A 3RS4A 3D2CA 5DHTA 1EZZA 4BFYA 1WRBA 3CB2A 4WL0A 3WLTA 1FMFA 1JQKA 4WCFB 2QD3A 2VF8A 3G1UA 3G79A 2BFWA 1FLAA 1T1JA 2GVZC 4G5RA 3UAYA 4D9MA 2X5NA 4H17A 4Q3BA 4MB6A 4PNPA 3C6MA 2JZCA 3N86A 3KUXA 2AMFA 3VMFA 4RF2A 5SY6A 2XKKA 1CJBA 3HA3A 3LCMA 2AL7A 1G42A 2IYSA 4E5NA 3NUZA 5C8YB 1GN9A 4N6OA 3Q41A 3O75A 4HDMB 1L1FA 1UIRA 2VZLA 3KEOA 4I5FA 1X8KA 3MJTA 2PL9A 4JB3A 1KS2A 3D9QX 2HU2A 3KOXA 1P0PA 1OGJA 4DLXA 5I4IA 1YZFA 2R6R1 1DXHA 3TX2A 1IN4A 2FWAA 3UCEA 3VC3A 2FR0A 1SRRA 2J6CA 3JZMA 3VI4B 3JVIA 4K81B 4CIWA 4IUCS 2YJ4A 3AF4A 1GNSA 1XELA 3HL0A 1Y0BA 1AZWA 4EITA 4UM5A 4ZC1A 1T35A 4FPXA 2A9PA 4XWOA 3LCJA 4QUGA 1ZOLA 1ZM4A 1ZIYA 3GZNA 3I1YA 4F6CA 2BR3A 1HSZA 4NU8X 1RWBA 3RRXA 2YZ7A 4K40A 3V00A 3F2VA 3FOFC 5E7MA 3SD7A 1WDTA 1U3CA 3K0AB 2Y1CA 1QIKA 3LNTA 4GXTA 4OPMA 1MFPA 1W4RA 4KFRA 1CV2A 1Y6ZA 5LYYA 2QDXA 2YJ6A 1OMOA 4ESEA 1TYDE 4NECA 2GI4A 2WICA 3RYIA 1QE5A 3R3SA 4HL6A 4XWGA 3RK0A 4KITB 1LA2A 1DZ3A 1X3LA 2HUNA 3PC8A 1CUUA 3UAOA 1D9ZA 1JQ3A 2VHXA 3LVBA 3M89A 4BNHA 1R16A 2FLKA 4L76A 2R25B 2G09A 5H80A 1UDBA 4Q21A 1MC8A 1SBIA 4ZCRA 4C21A 4GWGA 4QZVA 1KI1A 3KX2A 2Z5LA 3MJ4A 4XSHA 2Q9UA 2RGWA 4R9SA 2IQ5A 4PU0A 5AW8A 3P9ZA 1SVNA 3LCRA 1JT2A 3B48A 4B46A 5JEDA 5DF1A 2IS1A 1L5ZA 4BLPA 5EEHA 5DGIA 3ZDRA 3A4YA 4L16A 1L4EA 1PYGA 4XD7D 1Q1NA 2CNBA 3AERA 4L57A 1YBVA 4YRDA 1ZK1A 3CKKA 1Z2AA 1CFZA 4DR2B 1U8FO 1CUYA 1O58A 1T1RA 1Z3IX 1IWOA 2GAFA 2UUBB 2OXCA 2RH4A 4G56A 1SULA 4PFSA 5I48A 2GLUA 2VPIA 2W90A 3WWEA 5L3SA 4YAWA 5BUQA 1GKYA 1H1TA 2JFVA 1NN5A 3SE0A 2VP6A 4J94A 4DIOA 3V4VB 5K0BA 5LXTA 4W1SA 3R5TA 4FB5A 2G1UA 2Y6VA 1JFFB 1NV8A 4BLWA 4PG6A 1KFJB 2H85A 4RQAA 1CUZA 1EJ0A 2ZTHA 2WSSD 1GQOA 3GEDA 4FM9A 3WGMA 2I6QA 4M49A 3JQAA 1GDTA 3A6DA 3GFTA 1FZTA 2K2WA 1BS9A 1VRCA 2WJ6A 3TPZA 4JJ7A 4YRZA 5B6IA 4XB2A 2YY6A 3FH0A 3GPBA 4DLTA 3MGAA 5JZ9A 5DU2A 5EZ5A 2G4LA 3GJYA 4OHZA 4QAQA 3GDWA 2WT4A 1OZFA 2PUJA 2JBAB 4RHTA 5SY9A 5E4TA 1E0AA 1PSDA 1M2JA 2B1QA 2F1HA 5KU7A 4KH1A 5IVIA 5B58C 2VRNA 4DR3B 1Q74A 1YZYA 4DCTA 4QUKA 3BICA 2BFCB 2RHCA 1UPTA 2FTKE 4FZ3A 1W34A 4DJJA 3O8RA 1DAKA 3CJRA 1DX4A 1PQPA 1W4LA 3HPQA 4UXJA 1S02A 1HFJA 2JHAA 4FW8A 4V0MA 4YRQA 1C9YA 2WSLA 3R5KA 4HBZA 5ILGA 2QM8A 2VJLA 4F91B 1PX2A 2B5VA 2GQ0A 3BIWA 1XXLA 4PICA 5AJYA 5G02A 5LA6B 1SVKA 3M3DA 3WB1A 1ECFA 1PP4A 1QDLB 1AHHA 3F5DA 3L1HA 3R3ZA 4KACA 3ZW9A 1PR3A 1XXHE 2C2MA 4PHCA 4ALIA 3SSNA 4KP7A 2UXDB 4GGMX 3M4ZA 3KTOA 2RKWA 3GIDA 3IO5A 1WMSA 4PBTA 1GPDG 2O1WA 1J1UA 2REQB 1CUVA 3I39X 3S3TA 4AMZA 5CVCA 2CK3D 1B0ZA 1ODJA 2X5KO 3QKRA 4XIJA 5SY4A 2OILA 3FR8A 4Q00A 3E9EA 5EJIA 4ZT7A 5IFLA 2WWVD 4CM4A 4MGKR 2QD5A 1TLTA 1WMFA 3L7MA 4R8SA 1M2OB 3BZUA 1U4SA 5F3RA 1GCGA 4P3PA 3TW6A 4CQJA 1TK2A 3AMVA 4BTVA 3HJRA 5JASA 3MT8A 2CKDA 4ZI7A 1T0UA 1PW7A 3CLVA 3VOBA 3I2JA 1NRIA 3PT5A 1KY3A 1OILA 4M0PA 3QX8A 1SUCA 1S9DA 1J2YA 3DEJA 5B64A 3TCXB 3QLEA 1E9VA 1OZ0A 1QHIA 4QATA 3EZNA 4ML3A 1HDRA 3UWPA 4ARZB 2YW2A 1N2CE 4CMAA 1RAIA 1DO0A 5DRYA 3V7NA 1EUDB 2Z9DA 3PYMA 1ZA2A 2IY7A 4NG4A 4IIDA 5A3RA 1AZSC 1U2GA 2O2JA 3DUFB 1MJGA 4KIUA 5T6BA 3U9SA 4YONB 2ZBEA 3K2BA 1PFQA 3P4YA 3RVSA 4HPWA 3RV4A 2XIJA 2ZT5A 3EBOA 2VP0A 2PL3A 1G19A 2R9VA 1X9IA 3R5HA 4Y1EA 2CVZA 3RYTC 3N53A 1FDSA 3EHEA 2TMGA 1RT9A 3A4IA 1YMUA 2V65A 5HK8A 4RU1A 4W5QA 3DFKA 1AURA 4X1YB 4DCCA 4XR9A 1BFDA 3BXEA 1UZMA 2FN3A 4M1WA 3DBHB 3TLJA 1MEJA 1IAQA 3B3GA 3LOPA 3ZCTA 4D81A 3OO0A 4KQWA 5ES3A 3ZXXA 1R9JA 1RP7A 3DGEC 1SVMA 1KBQA 4U7HA 4RXUA 3KCNA 1PBTA 3T4PA 3AL2A 4TT3D 3OJCA 521PA 2FK8A 3OLYA 4D9IA 1KTIA 5JCJD 4XGRA 3ZQKA 2XWBF 4F60A 4P7JA 3PRKE 2CSXA 1Z4NA 1K88A 2DU8A 3DT9A 3BRSA 3T3HA 4HLUA 3DNMA 2YVQA 3GJXC 4C30A 3GH3A 5C46F 2A92A 3BE4A 2XQKA 3BF7A 3EFHA 4R1MA 4Z3DA 1K3UB 3RODA 2HO5A 2FQXA 5TMBA 1TJNA 2LBPA 4DRZA 4KO1S 5A2GA 2E49A 3FCCA 2GBLA 2KM1A 3IERA 3U9LA 4QYIB 4LHYA 1U5BA 4DJTA 1E3IA 4B85A 4MV8A 2ZPAA 4DREA 5IABA 4YWHA 1OWNA 1WCXA 1Y3DE 2JHPA 3P2MA 3V2IA 1BVHA 3SU8A 5AXDA 5IDXA 1T9KA 2R68A 2RGUA 3FWNA 3S2ZA 1IUOA 4LJ9A 1I5OA 3H13A 3BE8A 4OQPA 1F17A 2R7LA 4UW9A 3KQWA 4F1KA 1BVUA 3O4GA 4WAUA 4GKJB 2D5BA 4GBMA 5DE3A 3MS7A 1LS1A 4QBKA 3ZOZA 4BN5A 4OMUA 2JNWA 3T7EA 5LMNB 3HY6A 3IAS6 1SOUA 2WJIA 3ESRA 1M6EX 2RG7A 1FVXA 2JIOA 3GCGA 3OOSA 1YL6A 1P4AA 3C1UA 4M22A 4LRUA 3DZFA 2V7EA 3RS9A 3SQWA 3L7IA 1JSCA 1Y4ZA 2OGUA 3RT9A 2FAXA 4H0NA 3ZLUA 3FHCB 3PE3A 2FX2A 3G8YA 3BMCB 4X63A 3RUAA 2Z3WA 1NVKA 1U7DA 4GZ3A 3WE7A 4A6EA 3K3PA 1Y80A 4MDYA 1PT5A 5J58A 4PAOA 5KQSA 5F9HA 3PLAE 3Q4GA 4IJ5A 3T3DA 2J4DA 3QU4A 3AVUA 1FRNA 1QU2A 5EPUA 2WUGA 2P91A 1TIPA 2ID8A 4H3KB 3LHSA 3T35A 1QDUA 4UMEA 1CRQA 3ICOA 4BFLA 1OYYA 3QVVA 1I5RA 3PLRA 3VU3A 4WBNB 5L6MB 1W30A 1CSEE 4TUYB 3ORYA 3S2GA 3N74A 4PF1A 1F8UA 2CEKA 2PWYA 3CNQS 3QLJA 4H7HA 5HRAA 3ILSA 5EHXA 1MN6A 1T6XA 1ECLA 2J7PD 2YDYA 4AKIA 1SD5A 3TGWA 2GJ9A 4E2ZA 3IUJA 1YR7A 3I9NA 2DSNA 3TX6A 1LJLA 2COKA 1CZRA 2ZRGA 4HNGA 4LV5B 3TYXA 2XA2A 3JPWA 1YUBA 2ZIEA 5FIUA 3VI3B 3WMEA 3ES9A 1WMDA 2F4VB 1YE8A 1NXPA 1X1BA 1AKWA 3WDKA 2LDXA 4ZQBA 4QJ3A 5BORA 1TT5B 2K6GA 4B2YA 1U0HC 1EVQA 3GDGA 1H5NA 4GNRA 1ABFA 2Q5HA 2YWDA 3TQFA 3S8EA 1NZJA 1OIXA 3MBKA 4AMUA 1SPBS 4CM3A 1QPZA 1DFGA 2AF4C 1DB3A 3C8DA 4KIFA 2RHGB 4UJ5A 4OBWA 1VPDA 2A1UA 4Z3KA 4KUEA 2CDNA 4AF8A 1NYTA 1T0IA 1XRLA 5FTLA 5F77A 3KOOA 3TFWA 3K0EA 4ZAFA 2IU0A 4BO0A 4NBRA 1XDGA 3QTLA 1Q1EA 1OWPA 2NXNA 1B4DA 4XQCA 5EOVA 4ZK6A 2PVSA 1LPPA 3K2EA 3ZWPA 2YNMD 3EVGA 1RXVA 4AZ3B 1ZVQA 1H65A 3TLMA 4IHAA 5GZ3A 3PRYA 5EJMA 5I9SA 3DTVB 4D4KA 4FUTA 4QOEA 3AONB 3CVWA 1RVDA 4P82A 1QZ3A 5BNIA 3TW8A 4ZI2A 2IEBA 3KE9A 1H5QA 1CDZA 5A5GA 3PXEA 4M1TA 3B3QA 1XCGB 3I6BA 4P36A 1CVIA 1YR3A 3DLCA 4KN6A 3QX3A 4OXNA 4RQTA 1BA3A 2CCJA 3FY4A 1J2RA 3I9V1 4JT4A 4Y9RA 3ZE9A 4EY8A 2FPWA 4XIIA 3UC5A 1U9IA 3LCUA 1HRDA 3D6HA 4U7TB 1A9SA 2NAPA 2HHHB 4ZO4A 1IZ9A 4TTVA 4DCGA 1I6LA 2FN4A 3WL5A 1U99A 2IU6A 5L4NA 4OYRA 1MB3A 5LNK1 1T0PA 1SKYB 2I4NA 3N6RA 5SYMA 2HA3A 2ZUWA 3H3JA 4M37A 4OXRA 4D8WA 2FP4B 4FNGA 4GMFA 1HE2A 3S44A 3T1HB 2V7QD 5JDCA 2FG5A 5DCUA 1NWHA 1F4VA 1RLOA 2O8BA 1WQ3A 2ZQYA 3K1ZA 2YHUA 3JWIA 2QNIA 4K6OA 3U4HA 1RYEA 5LMZA 2WWYA 2DFTA 4R4JA 1H3FA 3EB9A 3PDHA 2GYWA 5HJ2A 1E2LA 3IA2A 3V8RA 1PJTA 1ZITA 3U1VA 5E4FA 4QG7A 5JS7A 3NBMA 4AZ0A 1RLIA 4ESVA 4NF2A 2ZZNA 2C5GA 1EFUA 2ACKA 3ZWXA 4DDMA 3PFWO 2PGLA 2HBQA 2BN4A 1MVOA 3HNOA 3M6MD 4QU0A 3FDZA 1XT6A 3CQ9A 1XJQA 4YLYA 6CHYA 2HK6A 1PG0A 1NX6A 1SUWA 5KKCA 3PE6A 3C7AA 4XX0B 4YYEA 3ZWQA 1GTJ1 2Q2WA 3SHWA 2QTCA 2AQIA 2GDJA 3H8WA 2PNFA 1QZUA 1TNDA 1H3NA 3FWYA 3PFBA 4JL8A 5AT1A 1JYSA 5C1PA 4JD5A 3G49A 3HLYA 3MWGA 3N2GB 3LJKA 1P4GA 1ZD8A 1IQ0A 3OTGA 1VJTA 1CG6A 2OR3A 3QIVA 2H3EA 3LXRA 1LGYA 1T0HB 3H84A 3OZCA 3LBYA 5ERYA 3W1WA 3OIYA 3GDFA 4O1MA 1LLCA 3K30A 3IT3A 2PH3A 5COBA 3VU1A 2G40A 4UHDA 2HK9A 3VPHA 4BB5A 3WMXA 4I8DA 5D51S 2RE8A 2A4MA 2NO0A 3PGA1 5JZVA 2IDJA 1E3WB 5CD1A 3HUFA 3MC1A 3FFWA 3ANYB 2EV9A 3KYBA 3M1AA 4EG1A 3G82C 2DKFA 1DO8A 1ZL2A 2VR1A 1X77A 3A6EA 3NVMB 4R1PA 2Z0MA 2I0FA 4H7FA 4MVCA 1AQ6A 3UT5B 2W58A 4EYKA 1SH7A 3JVUA 4JEHA 2EGHA 3G23A 2IH4A 3KSRA 1HM5A 1XEXB 2FETA 3EEYA 4LZZA 1FNCA 1NJ2A 1MA0A 2EKZA 2FPIB 5MDHA 1TVMA 4F4UA 1S8NA 4KEAA 4PYIA 2LDBA 3KQVA 1IH8A 4LZLA 2WSBA 4CLRA 3E4CA 3UHJA 4IAOA 4ZZ0A 4U7JA 3CW9A 2HMUA 5E2BA 1GRVA 2PMWB 4KGVA 1MAWA 3KPWA 4MRNA 3V9AA 3WQQA 1V16B 4ILKA 1G8PA 2JRCA 5AYVA 4NFSA 4X94A 2NU8B 3ZVLA 2QQFA 2CFCA 3IP8A 1F1JA 4RVHA 2OV4A 4ZT2A 5LIPA 4G2TA 2DJ5A 2W2KA 3PX2A 2FXVA 1LDGA 4LDJA 3SS7X 3USES 4NESA 1XHFA 4JBXA 4RCYA 4PZPA 3N8KA 3EXIB 2GBFA 4QXAA 4A9AA 2RK6A 1KJNA 2IKSA 3PIRA 4I1UA 4I4TF 1DFIA 2FZ5A 3WYFA 4YV7A 3L8EA 4RTKA 4OHPA 3W7VA 4W5RA 3U0VA 1P0QA 1QF6A 3CNOA 3PCRB 1V1JA 5EKUA 2QAJA 1GAQA 3LKBA 5GOTA 5B58T 3SBXA 1SXPA 3T4XA 5JJ5A 2W71A 1JDVA 3MAAC 4KXMA 2F67A 4C20A 1OXMA 3JRXA 3N6VA 3GDHA 3BEOA 2ODEA 3QLTA 1H05A 4K9LA 4PQYA 4QPCA 4UTOA 3ZTTA 3BERA 4DEYA 3H2SA 2H1RA 2FB9A 3IE0A 1OF1A 2QVCA 1ORDA 1A9PA 1B6TA 1XLWA 1FRZA 2A5FA 1R0YA 1D07A 2BEUB 2AK2A 3CT4A 3LD9A 4MXDA 4UQOA 5EIWA 1KMCA 1E1CB 2IYPA 5EWLA 3FRHA 3K6RA 3TS1A 2ZYWX 4NJOA 4POOA 4ZKEA 2QU7A 4P5PA 2CUKA 3Q7SA 1NATA 4KDCA 1JHYA 1U8UA 2PS0A 3PR2B 4RIEA 4X92A 4UTRA 3RSGA 4ARAA 4NCAA 1JILA 1QCZA 3AEKA 2ZWVA 4FGJA 3WISA 1QC5B 3JQ7A 5IWAB 1XDSA 1X70A 1CNFA 1Z73A 1EGAA 2VNKA 5ADWA 4QKQA 3N28A 1CJCA 1RXIA 3NAMA 4WVFA 4RWZA 1O95D 1XRRA 1P5FA 3GA5A 2XLBA 3KAKA 3N07A 4U02A 4TWZA 4GPIB 1DZIA 1N6OA 5BSMA 5C4IA 4EEXA 4Z9AA 3D1JA 2ID9A 4NATA 1O2DA 4LOAA 2VOJA 5GIPE 3AV3A 4FDLA 2E4ZA 4HWOA 4M8NE 3N3AC 3DVQX 1J8QA 1KJZA 1X7XA 2XVXA 3NI2A 2VNAA 3QVLA 2QMZA 5LZ9A 4FYKA 4FWIB 5BSTA 3SJUA 4Z9BA 1JJ7A 1MB9A 2B34A 3REFA 2OCBA 4JOCA 4JJGA 1E6CA 1XEWX 2H63A 1G7CA 4R5MA 3TUZC 1K89A 1AQNA 2J9RA 2YHAA 2EKDA 3DKKA 3S5JA 2R6ZA 4Z53A 1IHYA 3SQNA 2NZXA 4LY0A 1H85A 1I0ZA 1KU6A 2D3TA 2A5GA 3G8DA 3H05A 1A50B 2PYZA 2QL5A 1Q0LA 4XRRA 4GP7A 1N6PA 5C8XA 1DKQA 3PC8C 3UIEA 3LUHA 3LXUX 1VI6A 3QLVA 3UB3A 3UQZA 3C15C 1H2EA 3O73A 2TYSB 3UAGA 1O5OA 1U7UA 2UZ4A 3OMXA 2JIZA 4PLZA 4RFVA 1PWHA 2Q5IA 4YT4A 1R0BA 3NWJA 4KPFC 1JSLA 2HRRA 2HPZA 1QQAA 1P9LA 3E5RA 1F8GA 3U4QA 1SK9A 4BUZA 1A2QA 4XYLA 4TMKA 1QQBA 3IDAA 3ZQUA 4KR3A 5JQGB 3ICCA 3V4PB 2AB0A 4O29A 3E82A 4G4IA 1ZK2A 3HDJA 5T57A 1UAYA 3OEYA 3NHPA 5ER6A 2H7VA 3GUYA 2WV9A 2YUTA 3KQYA 5EUQB 2HRZA 3U17A 3CB4A 5IDWA 2ZT8A 4U9UA 3ZNOA 2RB5A 3UGJA 2HU5A 1WOMA 3KUCA 3K35A 4H3VA 5EIXA 3MNFA 4X45A 1W36C 1WCV1 3LX8A 2AYXA 3BH0A 4L72A 4EF4A 1NF8A 3UA4A 1QRSA 3HA7A 1PFGA 3HWX1 3PQ5A 3HADA 4XCVA 3TTYA 2LD4A 1LQTA 3CF6R 4IV0A 2X0FA 3ZWWA 1LTQA 2WHPA 2XMBA 1DJPA 2YN0A 3I3SR 3R3UA 4QX6A 2V96A 4RKWA 1XRPA 4K9NA 3DQQA 2H48A 1W1UA 4H6PA 3W78A 2QZ9A 1K86A 1FMCA 4QQFA 4U6QA 4R16A 3NQ41 5JVDB 1GPBA 2F00A 1POWA 1J9GA 2ANBA 4PPNA 4PWZA 3IP7A 1NXTA 5CVDA 3TRKA 5TJHA 4F6RB 1TC2A 1ZHHA 5B6JA 1F7VA 2R85A 5B3AA 3MLEA 5IUJC 4BVFA 4HMOA 4DLZA 4JC8A 1R66A 2NACA 3LLMA 3A6JA 3UK6A 8ATCA 5EPOA 2G6TA 3L7LA 1LRLA 3Q12A 3F3YA 3H5TA 2JI7A 3UFXA 4GX0A 4YYZA 5LD2C 8MHTA 2P9QA 3P9RA 4S12A 1CKEA 3E0XA 1G20E 1I1OA 2DRIA 2B35A 4Q3CA 1AKTA 3KFXA 3ZCUA 3RS8A 1Q7CA 3PKJA 1RU3A 4CM8B 1JDNA 2EBHX 2PA0A 3RF6A 2P6MA 3VNBA 3MINA 1GL3A 1DC7A 2C7BA 4MWGA 4AG3A 4QRHA 5B1YA 1L4KA 4IIXA 2VDQB 1D2HA 1TVKA 4HTFB 5CB4F 4BS9A 1RS0A 5LCXA 3SF8A 1SKQA 4P81A 3INRA 5TDHA 1B2LA 1TQHA 4YIHA 2GN1A 2QU8A 1RYNA 3KTFA 1ABBA 2JH3A 1Q20A 2C00A 3BFKA 4OHXA 3SZUA 3V7FA 4FTWA 2P90A 3NVDA 1URPA 1D4ZA 5LBTA 5AP9A 1U8ZA 3BWEA 2XUZA 2OD2A 4MLPA 4PR0A 5DCWA 4CNBA 2EBUA 4RXMA 3UFBA 5AVRA 2ZLBA 2E2WA 1NUAA 4R41A 2FOXA 4Z4FA 1VBMA 3BWXA 3CZCA 3VH3A 5CRIA 4YRRA 2YCBA 1Q3HA 3DE2X 2QLFA 4CM6A 1DPGA 3PGLA 2WFMA 1E8MA 3U56A 3LP8A 4EIWA 3FI9A 4FLFA 2G5TA 3MWKA 4RQBA 4BFUA 2NZ2A 3UTCA 4PLVA 1W5BA 4M88A 5HM6A 2ZQZA 1YTLA 2GUWA 2PWPA 2C8LA 1YL5A 2PR2A 4FS3A 4GX5A 1IOVA 1C8KA 1RHKA 2MJLA 2NYRA 1PJCA 4J0HA 1P29A 1QQ5A 3JW8A 2ONZA 5FJJA 3SZOA 3A28A 4CDMA 3IIKA 2IPOA 2X6TA 4NEGA 3DONA 4KE7A 4ZOBA 1QYCA 3GXBA 1BN6A 1IOWA 4YI3A 3HXPA 3O3MB 2QL7A 1KSJA 3S7TA 2FVXA 3WBKA 2C31A 4BQRA 1D2NA 1U2GC 2C5BA 1HE4A 2C92A 5KJ6A 1KZHA 4YDQA 5IJAA 2PWBA 1IDOA 3IRVA 5E8JA 3PTAA 1CUIA 1K27A 4DLUA 4DV0B 3HKDB 1IYZA 3EIOA 1ZA1A 1IULA 2WOOA 3D3KA 5HDQA 2FX5A 5CCBA 5EP4A 3Q1LA 4QBFA 1V47A 2Q2NA 2AKYA 4RJJA 3JZFA 3OOWA 3WI7A 3ND5A 4GI2A 3ZI4A 4TVSA 3HM9A 1CU1A 3HJGA 3EW9A 1G0OA 1WP4A 3A1UA 5KSPA 3KZMA 4GYJA 1V6CA 2QGNA 5KOJB 2QK4A 1BJRE 3HKCA 1JQAA 3LRXA 4BVEA 4DXHA 1DTWA 4Y0NA 4BMOB 4EVQA 5J2UB 4KRYA 1J70A 2HLDA 2C9CA 1DQPA 3E27A 2W83A 4FMCF 1K98A 4FUQA 1I33A 1XU7A 4J1NA 3RC9A 4EFDA 3DLPX 1UFRA 3EZYA 3NOXA 1U7HA 4HLUC 1MJFA 1L1QA 3AW9A 4IHJB 1C7EA 1M1YA 1CERA 4LCEA 5HBRA 2OT3B 1ZX1A 3RUEA 3AOGA 2PN1A 5IHPA 2GBLC 1VE5A 5JNLA 1UBJS 1D04A 2H31A 4UHKA 1OZGA 4HOYA 4JI2B 5L51A 3H2HA 2NMVA 2ZSKA 1C41A 2OAQ1 1A71A 1RBYA 2PBLA 3ECSA 3ZWCA 1K5PA 1OFUX 1OXXK 2ZQ5A 2GZ3A 4KAAA 2Q4RA 3U40A 2HV9A 16PKA 1HEYA 3R7WA 5IMSA 1UXJA 3O6VA 1VSVA 5DGDA 3BDAA 3VVLA 4GLLA 4OD0A 1XJCA 3GCXA 4GICA 3R9XB 4LX0A 3EH2A 4E03A 1L5HB 3RFFA 2VH5R 1MX5A 2B98A 1YIOA 1S2GA 2KQUA 2WWTA 4D8VA 4NH4A 4A0SA 4FMBB 2XMRA 1OH5A 1NYQA 1TD9A 2V59A 4G8DA 3D0RA 3GC6A 3Q3JB 4X7BA 1GR0A 3UG6A 1FOEB 1NI4A 4II3A 2AXEA 2JVIA 3FPSA 4JMLA 3VC7A 3EUEA 4YDHB 2OZEA 2ZIWB 1R10A 3QENA 4N7MA 3RTGA 4CIDA 3BREA 2HREA 3G89A 4QHYA 4D6YA 4IFTA 1IHUA 1ZUIA 3QVKA 5ISMA 2IY8A 2CBZA 5HVNA 4UU0A 4I55B 4MYUA 4Q15A 3L6RA 3Q6IA 2DY1A 4IX1A 2Y1LA 1Y5RA 2FPRA 4XUGB 3JQGB 3OTWA 2W6MA 4XFJA 3HS3A 3VYUB 4JYAB 4WXHA 1R2QA 3BUSA 3WBFA 1M8PA 4OHCA 1WXGA 3P94A 4A5SA 3O1LA 1TK9A 1QZZA 1S1CA 5DIZA 5I7AA 4EECA 3IPCA 1H1DA 5CX1B 4PZ0A 4EW2A 2A9QA 5CLIA 5TIIA 4JV5B 5JYDA 1K4YA 3PNPA 1PD0A 2D0IA 5CFPA 3OFNA 3M1IA 3MMZA 1XQWA 4XYEA 1TI7A 3A8TA 4B17A 1CY8A 2J5XA 1A9YA 1C8VB 1TUGA 1JHRA 1KO8A 3FHLA 2QE6A 3RJMA 5DCLA 1L3BA 1RAHA 2MYPA 1NY6A 2PUTA 1W73A 4RVCA 1J9ZA 2ZE5A 3HC7A 2AYYA 4O4HB 3OZTA 4AY2A 1QANA 3AEZA 2GDZA 4AQYB 1NVEA 3KXKA 1ZMRA 3HBFA 4OM7A 4GQAA 1SC1A 2XE4A 5K8UA 3SBDA 4EZEA 2VCYA 2CZGA 1B23P 5EN4A 1IBRA 5I01A 3GLHA 3ZJYA 3UUGA 2DR3A 5HFJA 5HZKA 4K6MA 4RX1A 2VK8A 4NV0A 4DHEA 1F5SA 4GYKA 1H9BA 2Z4SA 5JWOA 4QO7A 5GWXA 1XWFA 2BR5A 4EB8A 4DDVA 2KMLA 1DBPA 2WMNB 1TUIA 2G83A 5ALTA 3T0FA 4DHWA 1SKAA 3BGIA 1IXSB 3EQ2A 3GCWA 3KP1A 1IU9A 4LE0A 2WIKA 4PHFA 3IJRA 1OSNA 1PI3A 4R51A 4W63A 5A3VA 1FLVA 1S3SA 2XH8A 1JHZA 2WYIA 4JGIA 4N39A 5DLEA 1RQPA 3IVRA 3EG9A 4BGDA 4WZZA 5AVTA 3J81k 4F4CA 4JAVC 2B3DA 4ZT3A 4YUXA 4JOBA 4OAPA 1VLHA 2NG1A 4UHHA 2JFZA 2N1MA 8OHMA 5CTAA