5BT9A

Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
249
Chain Sequence
EARMVANCPVLVTGGARRIGKAIVEDLASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLEGDVRGLVKQASDRIGPIRLLVNNASLFQEDKVGALDMALWDRHFAVHLKTPVILAEDMRKALPEDQDGLVVNIIDQRVWKLNPQFFSYTLSKTALWNATRTLAQALAPRIRVNAIAPGPTLPSERQRPEDFERQVSKLPLQRAPELPEFGRTVRYFWENRSITGQMIALDGGQHLAWETPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of FolM Alternative dihydrofolate reductase 1 from Brucella canis complexed with NADP
rcsb
source organism Brucella canis (strain atcc 23365 / nctc 10854)
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
total genus 92
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bt9A00
4Y8VA 2ZJ1A 2O50A 3RBVA 4AJLA 1IHXA 1Y8QB 1O94A 4UVIA 1TB4A 4JN6B 3JD4A 2W2KA 4MVJI 1E5QA 3UW3A 4EUHA 2AG5A 2QRLA 5ITWA 4IDCA 1SAYA 1XU7A 2V6GA 2W90A 5ENVA 2BGKA 2PWZA 5AXAA 4Z9XA 1NHWA 4UVGA 1NPDA 4PVDA 2O3SA 1E92A 4B79A 3IDSA 3VH1A 5LC1A 5TT0A 5JC1A 3DFUA 3AW9A 1LSSA 3VH4A 5KWEA 2J8ZA 2UUPA 3CIFA 3I83A 1P1FA 4K6FA 1R4MB 4I1IA 1F12A 2DU8A 3NDJA 2Q49A 1P0FA 4W7IA 3H4VA 1I3LA 2JHGA 1EFLA 1U2DA 3H65A 5DBIA 4A26A 3GHHA 1W6UA 3E8XA 3OQ6A 3PIIA 5KVVA 1ID1A 3E6AA 4MVJF 4A7PA 2IXBA 1Q0LA 3A14A 3JQ8B 4BO4A 1ZBQA 3JV7A 4I9NA 3AI3A 1I10A 3KO8A 5T6BA 4DXHA 3T4XA 3UOGA 1KEPA 4EI2A 5LCXA 3VKVA 5JMWA 1E1MA 2VUTA 4FSHA 1XG5A 2D4AA 4TRJA 1YWGO 4DGSA 3NT2A 1GDHA 2YUTA 2HRBA 3DAGA 2ZB7A 1ISIA 4KWIA 1GQYA 1R0LA 1H6AA 3WGHA 3L4BC 5T64A 4J3FA 4CUJA 4RO0A 1YBAA 2BFOA 1K6JA 4TRNA 4OH1A 2HMTA 3E18A 4BB6A 1UH5A 1AGNA 4JBHA 4ALLA 1MC4A 2NTNA 3AOEC 1P1IA 5DZSA 1P1JA 1UP4A 2LDBA 1OOEA 5I7EA 4O1MA 1XLTA 3QW2A 2GRAA 1CETA 4CLRB 3WB9A 1DRWA 4ND1A 4XR9A 3U5TA 1GQQA 1RKXA 5DN9A 2Y1DA 2ZYDA 2NTJA 3Q2KA 2NM0A 4G65A 4PZCA 2FZWA 3GH3A 4O63O 2WWRA 3W4KA 1EE9A 1K6IA 2AA3A 5JAQA 3R1IA 1EFKA 3RCBA 2EKPA 1PZHA 3ZWWA 4NU5A 1PEDA 5AYVA 1RJWA 3SXPA 2JD0A 4YJHB 1IOLA 4IDFA 4BV8A 2A92A 1NFQA 1XCBA 3FWNA 1DO8A 1Y7TA 2POQX 5ICMA 1ZSYA 3TPCA 4IDBA 4E4YA 1KEWA 4ZU3A 2C7VA 1EUDA 1B15A 3PDUA 2DC1A 1A4IA 5L7WA 3IKVA 1UDAA 4FQ8A 5CDUA 4PG5A 3P2OA 3RIHA 4YRBA 1XA0A 3TF5A 3COSA 5G4KA 3CTMA 4LSMA 5ITVA 3I52A 2NVUB 1GYQA 4D3FA 1HT0A 1LA2A 2CVOA 2VZ0A 2G82A 1YL7A 5IDXA 1PX0A 1D7OA 4GX5A 4L4XA 4WCDA 4FOOA 1WVGA 1E3SA 4YVFA 1S7CA 1YL6A 1U28A 1VI2A 4CL8A 1YB5A 1YQDA 4IGFA 4ND3A 1LUAA 1LU9A 4IS3A 1NVTA 3RC1A 3KYCA 5CEFA 3PLNA 3S55A 1I33A 3PQFA 1ISHA 3AU9A 5F3RA 3JYLA 5IDQA 4MPDA 1V9LA 1UUFA 2DQ4A 3NJ8A 1MXHA 3P19A 5CHEA 2IEBA 4H3VA 4PZEA 3AJRA 4WE3A 3WGGA 3IC5A 1A9ZA 4F3YA 4ZGWA 3GGPA 1PWXA 4J4HA 4YT2A 2CD9A 3GGOA 1K6XA 3K2EA 2HK9A 3IKTA 4AJHA 2NWQA 3WLFA 2PD6A 3Q11A 3WGYA 3CINA 1J6UA 3NTOA 3U4CA 4AJ4A 4J9UE 4OQYA 3JQ6A 1DJNA 3HN7A 3H9UA 3K30A 1ENZA 4XGNA 4J1NA 5ER9A 2Y93A 4R5MA 1TLTA 1LLQA 5JPIA 2J3HA 3PJGA 4ZQBA 1M2WA 5F1PA 1HDOA 3O9ZA 5ENDA 1YO6A 4YJFB 1X7GA 2J5KA 4BKUA 5C7IO 4QFCA 3QWFA 4N18A 4IDDA 1F17A 1BDMA 1H6CA 4BNGA 1P45A 1Z6ZA 4PG7A 5L4LA 3LT2A 1C1DA 4N5LA 5IN5A 1YXMA 2NACA 3KV3O 3INGA 4AL4A 3T7CA 1HDRA 1UXJA 1CIVA 3K2BA 1DLIA 4XJTA 1B7GO 2D0IA 3P5SA 1DIRA 2I5PO 2RIRA 3DOJA 4DUPA 3ZNPA 2OOSA 5AVOA 4DIOA 1UAYA 2PD4A 4L8VA 4YRDA 4CMCA 3L9XA 3IQDB 2OZPA 3BMCB 4I5FA 4CR6A 2WD7B 2HAEA 3WYCA 4CM6A 1GZ3A 3ETEA 4GL4A 3I3OA 4NBRA 4J0FA 4J4TA 5TLSA 4R3WA 1PS0A 2R00A 4J91A 4EDFA 3EK2A 2XF8A 2FMUA 1DC5A 4R51A 1WMAA 4JCOA 4S1VA 4BNNA 1U1IA 4CPDA 4NK4A 5IFLA 2ZB8A 4Y67A 1NQ5A 3FWZA 1ADGA 3I6IA 3C7AA 3WQQA 2X7HA 2HK8A 3PXXA 4LISA 1C0LA 3DMTC 3GC6A 3WOHA 1ZUD1 5B1YA 4MOWA 3RU9A 3DTYA 2V6MA 1OZAA 1R66A 1ZKMA 2EP5A 2PGLA 4KDEA 2O48X 4GLOA 4PLGA 3HFGA 4MKZA 3ZGYA 4WLUA 1KETA 1UZNA 4BGIA 2XXJA 1Q7CA 2TMDA 2DPHA 1B2LA 1H2BA 3OBBA 3B1JA 1B8PA 1WPQA 1O89A 4C7KA 4D44A 3BMNA 3GZNB 4XR4A 2EKLA 2VT3A 5CP8A 1R0KA 3QWAA 4FJ2A 3JQCA 3CPSA 4RVFA 4CV3A 5C5IA 4RPGA 3ZH2A 4GWKA 1UP6A 2E49A 3KSUA 3R3SA 2Q2WA 3LC1O 1BVUA 4O0LA 1OI7A 2WJPA 5BSHA 3H9QA 3VDRA 1B16A 2WE7A 4DYDA 1LBEA 3LF1A 3H5RA 1OAAA 5I8ZA 3SJUA 4B8WA 3S2FA 5HS4A 1F8FA 1G6KA 3FR8A 1N1GA 3DZFA 2IYOA 2WE8A 3PI7A 2C82A 1YONA 3HSKA 1UZMA 2VHZA 4ILKA 1XGKA 1GYRA 4NMHA 3SX2A 1QV6A 4L4SA 4FGWA 2Y0DA 1P31A 1P77A 4OOEA 4RJTA 1E3WA 5K6AC 1D4FA 2GUGA 4B3HA 4MKXA 1E0DA 2GNAA 3UH1A 3ST7A 2OP1A 5DF1A 2D5CA 1U9JA 3DBLA 4QECA 3WWZA 5C7LO 2X23A 3A28A 2HLPA 1J5PA 1GZ4A 3IUSA 4J2OA 1MP0A 2YFHA 4RVGA 1Z7EA 4YJGA 4CQLB 1SO8A 1B8UA 2HUNA 3MJVA 5K9ZA 2OHXA 3NTRA 5DP2A 1E1NA 4YACA 2LDXA 2X4GA 1U4SA 4JROA 3AUSA 2AQKA 3DAPA 3KOUA 4OQZA 4EJ0A 5L40A 1VJ0A 1XYGA 2VZ9A 1HTBA 4N54A 1GUFA 4IMPA 3L6DA 5L4SA 1A9YA 2BLLA 3ADOA 2B4RO 1HLPA 1N8KA 1DFIA 4D41A 3I9KA 2BKAA 1MFPA 4BKOA 4EGFA 2DFVA 1LC3A 2X5OA 4MVJM 5THQA 1LLUA 3ZDFA 4RF2A 3WGIA 5LDGA 2DM6A 3TNLA 1NVMB 5DT9A 4ZQGA 3BHMA 3KEOA 3K6JA 1NFFA 3ZCXA 1HDCA 3DHNA 1DB3A 4EITA 1JKJA 2V65A 1ZFNA 1PZEA 3KXDA 2QZZA 3BTSA 2DFDA 1E1LA 3K8ZA 1EBUA 2VHVA 4FFLA 2PKQP 4MVJH 4YQYA 4BO9A 2NSDA 4XYEA 3VPGA 4KQXA 5AQ1A 3RUEA 2DTEA 4BNHA 1R4NA 4KP7A 5IZCA 4XKJA 3CMMA 4JP2A 2BD0A 3I4FA 1H6DA 1MG0A 1PJBA 3DBHB 1BHSA 4I5EA 4XGKA 4CQMD 4EJ6A 3HN2A 4W6ZA 5JNLA 4YAEA 4BNMA 1IYZA 1Y9AA 5JAMA 6ADHA 5F21A 2FPIA 4Z0HO 1KVQA 1V8BA 2GCGA 4ZA2A 3HHPA 3L6EA 3GAFA 1JVBA 5DULA 1CQJA 4D46A 2Q1WA 4PLFA 1EVYA 3U4DA 3JQEA 1U2GA 2WEKA 9LDBA 3JYPA 4B4UA 4RORA 3UGKA 4QXMA 5IZCC 1WLYA 4DLLA 2PH3A 4YEDA 4ALKA 1ORRA 3I1JA 4CM4B 3V2HA 1VSVA 4RPLA 3PWZA 1JWBB 3ZWOA 3QA9A 4WEQA 1YQXA 2Q45A 3H9JA 5T57A 2PA3A 5GZ6A 2X1HA 5L7YA 1HE2A 4YWJA 3AM3A 4IJUA 3ZNQA 1X14A 2Q3EA 4M86A 4OJNA 3VPSA 3K92A 2VYVD 3ZWXA 3FNGA 4NJMB 1JLLA 3GY0A 3ZWMA 4DA9A 5IXSA 3FD8A 2P9GA 1YB1A 1EDZA 1CERA 3G0OA 1E3JA 1SC6A 3JQGB 4NH4A 3U49A 4E5YA 3I9MA 3NUGA 4IQ8A 4D0SA 2PR2A 1T4DA 4E2WA 5COQA 4C7JA 1J4AA 2VWHA 4O5OA 5JYDA 1VKNA 2ZYGA 1Q7BA 1QMGA 4NDNE 5JAIA 1NX6A 3GMDA 2PTGA 2I65A 4OHUA 1PGQA 2WSBA 3OJOA 5MDHA 4R5HA 1BRMA 4RZHA 1UXIA 1QYXA 4R69A 2NU7A 1KVUA 3UHAA 3JQBA 3SC6A 3DMTA 2O23A 3TRIA 4DTIA 1XHLA 1YBVA 4RVSA 3JYNA 1W73A 4NJMA 5C7OO 1JN0A 1F8GA 4NQZA 3WWYA 1ZW1A 1MGOA 4CM1A 1E7MA 3JQAD 3WIDA 3RSHA 3RASA 4LSWA 2GASA 1GCUA 3WR5A 1JWAB 2EF1A 3W4IA 4CM3A 5THKA 5JBIA 3NT5A 2WYUA 4XYMA 1FK8A 2H63A 4M89A 4AVYA 3OA0A 1R16A 1E3LA 1H9AA 2G76A 3NX4A 3OA2A 3WLEA 2H5LA 2HQ1A 2BGMA 4CV1A 1EBFA 3AI2A 3I6QA 3QVWA 1LDYA 1ADCA 1DJQA 1N1EA 1PWZA 2GZ1A 2YV3A 3R6DA 1FDUA 2YV2A 1DRUA 5L45A 3RJ9A 1LSUA 2UYYA 2VTEA 2WDZA 4E5NA 4CLOA 1UDBA 4WCFC 2GN9A 4AJKA 3CH6A 3KVOA 1GZ6A 3DQPA 4J4BA 5JAZA 3U4IA 1NYTA 2Y1GA 4MKRA 1BXGB 1A72A 2B35A 3DWFA 1ISMA 3CSDA 3ANMA 1LSJA 2C29D 2B4QA 3KYCB 4E6PA 4ITUA 1NFRA 1O9BA 3DOCA 2I3GA 1PZGA 1PZFA 3N74A 1AXGA 4INAA 1I30A 3QJ5A 4HFMA 4HNGA 3RUFA 3GUCA 1K0UA 3F3SA 5L51A 1F14A 4ROSA 3BA1A 4H7PA 3X2FA 3GPDG 3JQ7B 4Q3EA 3DZBA 1HDZA 2O7SA 2VNAA 1VM6A 3PQEA 2AQIA 3ZWPA 1HL3A 3KETA 2GN4A 5JXWA 3OJLA 3EHEA 2P91A 2BI8A 4P38A 4ONEA 4DIBA 2NVWA 3ROKA 1I2BA 3D0OA 4G2NA 2VUUA 4B4VA 4Q39A 1WMBA 1UXKA 1X1EA 1X13A 3BHIA 4B4WA 4DREA 5IDWA 2YDXA 3PYMA 4JJIA 1EUZA 5JCXA 2P68A 2IZ0A 3EUWA 2IRWA 2YHIB 4J7XA 3WBFA 4CR8A 1QYCA 2JD2A 4E32A 4BNFA 5GZ3A 3JQ8A 3RU7A 3IOYA 4W99A 2CF5A 5TRTA 1H94A 3ZN2A 1K5HA 1R15A 4CL3A 2NVUA 3D7LA 4BVAA 1L7DA 3CKYA 3E5RA 5A9SA 3UCEA 1T2FA 1NWHA 4IPTA 4AJJA 4CLOB 5KVQA 2EIHA 2Y05A 5JDCA 3V2UA 3H5AA 3MCVA 3B6ZA 4TSKA 4QEDA 2JAPA 4YDRA 4ALMA 5KNLA 1T2AA 4NPCA 2EJWA 3AOEA 4BO1A 3JQFA 4LRTB 4JNKA 4UREA 4Y9DA 4BO6A 1OC4A 1YQGA 1VE9A 5I9LA 1PJ2A 3V8BA 1GAEO 3CMCO 2B5VA 2C7GA 4QX6A 1Z74A 5JMPA 1YVEI 4I5DA 1J49A 4XYGA 4EW6A 3GAZA 5CEJA 4AJOA 3KYDA 3FHLA 1E7WA 4S3MA 3I4CA 3F4LA 3Q2IA 3PFFA 4J90A 4UUPA 1BXKA 2YQ4A 3GVPA 1QYDA 4J9VA 4U8GA 3VVBA 4NFSA 2P2SA 4GVLA 1LI4A 3OH8A 1J0XO 1QXSA 1V3VA 5KVSA 2Y1EA 1PR3A 3PHHA 2GR9A 5A4DA 1ZK1A 1UJMA 4KTVE 3JD0A 3JQ9C 3H3FA 2ZATA 3CZRA 1I3NA 1LX6A 1KEUA 3M1AA 5CG2A 2VHXA 5DDIP 1NBOA 4J16A 3OHSX 3BTVA 5A9TA 4LMRA 4QSMA 3QQPA 4LVUA 4PRLA 5GMOA 5IN4A 4DRYA 3BMQA 2C5EA 4WPGA 3TZHA 1M66A 4JXKA 1F0YA 4W9NC 3W6ZA 4Z9YA 1LTHR 2A9FA 2C0CA 2OP0A 4Z9FA 4CJXA 4II2A 4OO3A 2JAHA 1HDXA 2J6IA 3LZ6A 1XQ6A 4JLWA 4XB2A 1JKFA 3FBGA 4R9RA 3JQ9A 4PN3A 3LDHA 3PPIA 4B7UA 1OMOA 2YW9A 2X9VA 3JD3A 4M8SA 1MG5A 5I7FA 4DL9A 2BFAA 4AJNA 5KIAA 2YHUA 4XD2A 5CAEA 1ZK0A 3WGOA 2BGLA 3E5MA 3U09A 3P2YA 4KMSA 2FP4A 1PL6A 1M75A 2FSVA 3D3WA 3W1VA 2OGUA 3AI1A 4PFJA 4UVEA 1XU9A 3F4BA 1PJQA 2HMUA 3GDFA 4I8XA 1WNTA 3GVIA 5TQVA 4BNTA 1HF3A 3DHYA 4D7AA 3QWBA 3DB2A 3E1KA 3IMFA 1U5CA 1Y1PA 4YAJA 4A5OA 1G0NA 4K1LA 4DQUA 1I3MA 2GPTA 4FW8A 5L3ZA 4CM9A 2VCYA 3GA0A 2FZEA 4AICA 3PJEA 1FJHA 1ZZEA 3MWDB 2DPGA 3FNHA 4Q9NA 4ALJA 1KY4A 2HO5A 1JW9B 3GEDA 1Z7BA 1UP7A 5L95A 3IAHA 1T26A 3MEQA 1RM0A 3AU8A 3QIVA 1EVZA 3GT0A 4R1NA 1VL6A 3FSRA 3UKOA 1GCOA 2EJVA 4BKPA 4RF4A 4RF3A 4Y6RA 5JFOA 1ENYA 1ZEMA 2HMWA 5DBFA 1EEHA 4PRKA 4ALIA 3OQ1A 1QP8A 2Y66A 4FFPA 2AW5A 5FFFA 1YE3A 1LDMA 1LRLA 1EQ2A 1VKOA 2Q46A 4UULA 1E5LA 3PZBA 1Y81A 1MC5A 1UXHA 4J1QA 5DCUA 2QRKA 5JW6A 4TRMA 3LC2O 3KRTA 4L73A 3IL2A 4GMGA 3ONDA 4FJ0A 1T2EA 1JQBA 3ULKA 1LDNA 4KUGA 2R00C 3HB4X 1Z73A 2B0JA 5JCJD 1K89A 4DPKA 1Q0HA 1T4BA 4B7CA 1BG6A 2C54A 4OSOA 5B37A 2JL1A 1ZSVA 2Y68A 3PLRA 4D3DA 4OAQA 1N7GA 2I3AA 2OBYA 3L4BA 1I32A 2FSSA 3MTJA 1WP4A 4JJFA 5KKCA 1ZK4A 2YZ7A 1C0PA 4LK3A 3KSZO 3ZWYA 2PH5A 4Z0PA 1NR1A 5CPFA 4XGIA 1TA4A 2VRBA 1LXCA 4YXFA 3LT0A 4JIGA 2TMGA 1Y9EA 3H6KA 2B37A 3GZ4A 3KEQA 4E5KA 4MP6A 1DIHA 3TZQA 2X0NA 1MA0A 4JP3A 4YYZA 4AJPA 1V3TA 1XWFA 4PG6A 4BO7A 2O4UX 3SC4A 3EGOA 3ZU2A 1NTOA 4RVHA 1P74A 2Q99A 1KBZA 2NTVA 4E13A 4XRRA 4CODB 1ULSA 4CMIA 4UUMA 1DOHA 1ZH8A 3QY9A 5FYDA 5DP1A 7ADHA 1DFHA 3HDHA 1YJQA 4GI2A 1NQAO 4PLYA 3DEYX 3ZWVA 5BR7A 4XIJA 5T8KA 3DZJA 3VDQA 2WTBA 3EDMA 1MV8A 5MGBA 3H5NA 1YH3A 2C2YA 3OECA 3ZZNA 2AXQA 1HE4A 3LT4A 1VPDA 3JQ7A 3BAZA 2PZMA 4PG4A 3PJDA 2RHCA 3PVZA 3IJRA 3GEGA 3GR6A 3D4OA 1AN9A 3RUAA 3AY6A 1U3VA 2P9CA 4NK5A 5F5NA 3RQSA 3OETA 1PL8A 3MJTA 4MP8A 3TOXA 4R41A 2PD3A 3Q3CA 3WGQA 3D4NA 2EW2A 3UCXA 2SCUA 3AUTA 4Z3KA 3L4SO 3LYLA 4IM7A 1EK5A 4TKLA 3H9EO 3SBOA 4MVJP 5TSDA 2ZIZA 4GBJA 3TN7A 3ETDA 3E48A 5FI3A 4BNXA 2UV8A 1CRWG 4Q3AA 1GEEA 4CLRA 2PK3A 5JO9A 3H3JA 1QR6A 4DMMA 5HWSA 1FDTA 4ND2A 2HK7A 1DEHA 2BI7A 2QHXA 2VNSA 1PJTA 5A02A 1S6YA 1A4UA 2VYVA 4MIYA 3W8FA 1DAPA 2IODA 2Y1CA 1E7YA 5B4TA 2CDCA 3OMLA 1IHYA 5IJZA 1PJ4A 5JY6A 1IY8A 3Q9UA 2FRDA 2OBNA 3K31A 1P33A 4BO0A 2W2LA 4MVJE 3ICCA 1GYPA 3R3JA 4I9UA 4D42A 4PLPA 1R0SA 4YTEA 5F1OA 3AOGA 1MLDA 2AE1A 5TJ9A 3DDNA 3F46A 2DBZA 4EBFA 3PIDA 2B83A 2ZQZA 3JQGA 3U62A 4FS3A 4RL6A 4CQMB 1SCUA 3FTNA 5IG2A 4BGEA 3HDQA 2HU2A 1ZJZA 2E48A 2IZ1A 4NBVA 1WXDA 1PS9A 3AM4A 1HKUA 3AK4A 1DHRA 4BMVA 2B4TO 2FY8A 3ONFA 3Q1LA 4XA8A 3B20A 2HCTA 1PJ3A 1QYVA 1TEHA 4KTTE 5EMHA 1X0XA 3WDSA 1Z82A 2DBRA 2I67A 3VPXA 1KY5A 3GUYA 3VZRA 2ZK7A 1I24A 1I3KA 2I6TA 1LDEA 4B7XA 4BGVA 1HXHA 4YJDA 4IINA 4WLFA 1GD1O 1N92A 5IZ4A 3RUIA 1QV7A 2CDBA 5G0TA 5IF3A 4JGBA 4GX2A 4PLHA 4XIYA 2C59A 3CUKA 3GQVA 3GF4A 3ASUA 3LC7O 1E3WB 3CZMA 5ES3A 2Z1MA 4CM5A 4RPJA 2IYPA 2E82A 2HKIA 4BNLA 2G5CA 3V2GA 3ANLA 2H9IA 4IBOA 4NIMA 5I9MA 3T4EA 2VWGA 2W2KB 4EZBA 2PKQO 1NPTO 4BKRA 4RGBA 2HSDA 1HE3A 5DNAA 5IAAA 3H2ZA 4BNKA 4E3ZA 2X5JO 2YJZA 3G1TA 5G0WA 4BKQA 3EMKA 1V3UA 5DBGA 3ROPA 4CMBA 4MJLA 2JCVA 4BNJA 1TXGA 2GF2A 2RH4A 3PGJA 4KQWA 2VRCA 2JKVA 3MOIA 5HRUA 2R6JA 4P4LA 3G3EA 1H0KA 4DPMA 5DCWA 4CMJA 3WS7A 3PGXA 1W8DA 1GUYA 2FR8A 2GZ3A 1N9GB 2FPGA 4FIZA 4A73A 4E5PA 2XXBA 3LLVA 3KTDA 1U8FO 1MX3A 4R9SA 3BHJA 3ZWAA 4LRSB 2J3JA 3V1TC 1HYEA 2Y67A 2EWMA 1WZEA 2CVQA 4Q3CA 4BNIA 4IJWA 1I2ZA 3OFSA 1UXGA 3X2EA 3HB5X 1QYWA 4YPOA 4E5MA 4R3NA 1M6HA 4IXTA 3PZRA 1DRVA 1PGJA 2QX7A 3GDGA 4YCAA 4WNIA 1LQTA 1L1FA 4ID9A 3FCOA 4K6CA 5K6AA 5EQFA 3O8QA 1R12A 2NLOA 1IZ9A 1UAGA 2NUAA 2X6TA 4FFMA 4I08A 5JDIC 1GFSA 1D3AA 1WWKA 1BDBA 5B12A 2JJYA 3SVTA 2XOXA 1ENPA 2X8LA 3Q9NA 4RLSA 5BT9A 2GN6A 5BQFA 5ICSA 1GL3A 2W98A 4XDYA 4Y98A 4UUNA 1B0AA 1HYHA 2A94A 1C0KA 1H5QA 2O7QA 3KB6A 5A5FA 1B3BA 2X9NA 3V5NA 4XQEA 4AJ1A 2B36A 1OFGA 4IDEA 4XB1A 4O59O 2QZ9A 4OL9A 2J3IA 4B3JA 3JD2A 4ZICA 1AHHA 1X7DA 1QLHA 1E6EA 1CYDA 3ASVA 1O5IA 5A03A 3F6YA 2F1KA 4PLVA 1BWSA 3DZHA 4G81A 2Z5LA 3S8MA 3HFSA 2EW8A 1VLLA 1XR3A 1CWUA 4KUHA 2C20A 4FN4A 1GR0A 2D8AA 3CEAA 1PL7A 1PSDA 3EAGA 2NVBA 1YKFA 4IUYA 2VOJA 5H82A 1NPYA 2NU9A 1WAMA 1E6WA 4GAEA 4FPXA 1ZK2A 4YAIA 1SBYA 3AWDA 5A05A 3A4VA 1U7TA 4P4NA 1DBVO 3DBRA 3HJAA 3EVTA 2H6EA 4IZHA 5EQDA 4FFRA 3GLQA 1QLJA 4CQMA 3C1AA 3V1YA 5L53A 1G0OA 4JX8A 5AXCA 3RBZA 1KEVA 3HQ4O 3HWRA 4CMGA 3RKUA 4TZKA 4BMNA 5DCYA 4MO2A 2I76A 2YHIA 3PQDA 4GWGA 1ADFA 2HMSA 1GEGA 3DZIA 1RM4A 1KYQA 2O4CA 3LQFA 4UEOA 2YFQA 2OORA 5FEUA 2DTXA 2ZCVA 3AUUA 3BMOA 3GRPA 3PHIA 4CM8B 1ZCJA 2VHWA 3EY4A 2HJRA 2ZB4A 2VZ8A 4WCFB 4GSKA 2BELA 2EG9A 2CDAA 1E3IA 8LDHA 5JSFA 5B4UA 2Y0EA 4J7CA 1T2DA 3RUHA 3KBOA 2F00A 5ILOA 1Q1NA 3D5TA 4NFYA 4YAGA 2HDHA 5A1TA 3VTFA 1EVJA 3ZHXA 2Q2QA 2DT5A 5KJEA 3M2TA 5I7SA 3HE3A 5U4QA 4NHEA 5EPOA 3ZHBA 3L6OO 3VZQA 3ZW9A 1P9LA 2V7PA 4YT8A 1FDSA 4IDGA 5A3JA 1GTMA 2DBQA 5CDSA 1U8XX 3IJPA 3OM9A 1ULUA 3NEPX 3L77A 2I66A 2G0TA 5EINA 2AEMA 3PHJA 2EHDA 2NU8A 4W4TA 4FCCA 1Y8RA 3NDRA 3FR7A 2J3KA 3GG9A 3VVCA 4TVBA 4IQGA 3RC2A 3RI3A 1MUUA 3I9NA 3PEFA 2Q50A 2W2LD 3TWOA 3GN2A 4BNZA 5EIOA 1QKIA 4JQCA 3RFVA 2GD1O 3LT1A 1GPJA 1CF2O 4Z0TA 4BO5A 2ZJ0A 3S1LA 1NAHA 2O3UA 2AEJA 2FHSA 4UEKA 1H93A 3K9QO 2CF6A 4EEXA 2JFFA 1XEAA 5CPBA 3KM0A 4OKIA 3H8VA 2D2IA 4AG3A 3WYEA 4ZVVA 4CUZA 4J7UA 1NWCA 3BZUA 4GVXA 3UVEA 1Q2XA 4WJZA 4DC1A 4BO2A 3UN1A 3F1LA 2CFCA 3B1FA 3BXXA 3MJEA 5I8WA 2I9PA 4CMEC 2EP7A 2W8ZA 4JJGA 2HJSA 1GY8A 1HSZA 4PLCA 1PJLA 1B8VA 3PJFA 5G0VA 3S2IA 3VC7A 3BYZA 4BGUA 4BIIA 4TRRA 5CG1A 4GMFA 3RWBA 4YT4A 3Q6IA 1V35A 1G1AA 3WBBA 2O2YA 4OGWA 1ZMTA 2Y99A 3NJ4A 3RUDA 2GYYA 4TROA 2JHFA 4B8ZA 3WXBA 4OYRA 1QG6A 1TT5B 4IMRA 4N7RA 5T67A 1OBFO 4FB5A 3WG9A 5K0ZA 4NFHA 2Q4BA 4XX0A 3GVXA 5AOVA 4F6LA 2I99A 5JO0A 1HRDA 2O3TA 3MJCA 5B4VA 2VTDA 3QVXA 4Y6SA 1KC3A 3E9QA 1EK6A 5U1PA 1DDOA 2ILTA 5BSEA 4YA6A 1ZSNA 4L0QA 1JDJA 4H16A 1RYEA 2B69A 3NGXA 4CLDA 1YJ8A 4I9HA 1ISFA 2GGSA 4DBZA 3TZKA 3BTOA 1B14A 1DIGA 3VHRA 1C0IA 1C1XB 4AJ2A 5F5LA 1VJTA 2IEDA 5BNTA 3NT4A 5KJFA 4RZIA 2EV9A 4IZIA 1N5DA 3ENKA 3D3WB 3D1LA 3OJFA 1DLJA 5CDYA 3F47A 3DO5A 4ND5A 4YRAA 4NNJA 3NV9A 4MDHA 3OP4A 2J5QA 3INTA 4ZQHA 3FNEA 4LMPA 3OJ0A 4J0EA 2ZKLA 4IQ0A 1ONOA 3W6UA 1EVIA 1ML3A 1YGYA 4IJVA 5DOZA 5BNIA 1C3VA 4XZ3A 1FDVA 1YL5A 4FD3A 4Q3BA 5KVCA 2Y1FA 4PLTA 2G17A 2RCYA 1ONPA 1SOVA 2YY7A 3K96A 4HXYA 3WNQA 1ADBA 2PGDA 3GK3A 3M2PA 1P1KA 4XQGA 4M87A 3STHA 4BNUA 1CQIA 1D1TA 2O2SA 2AQHA 1EDOA 1Y6JA 2O3JA 2RH8A 4B3IA 1VL8A 4EYEA 5KTKA 4ZJUA 3A9WA 5EJ2A 4OXYA 3GVCA 4U0JA 3RFTA 1GV1A 1LNQA 1JVSA 1LLCA 1KVRA 3PTZA 4NG5A 1WZIA 5TF4A 3TJRA 5EERA 4BO3A 3NKLA 3RUCA 2C5AA 3C85A 1Q0QA 1XQ1A 3MTGA 4P4GA 4QO8A 3IUPA 1E77A 1M6WA 1UR5A 1BXZA 1R6DA 3QVOA 1FDWA 1VRWA 4W82A 4DLBA 4ZQEA 2WMDA 4HKTA 3NAQA 3RC7A 1O95A 2PLAA 1HETA 4ZRMA 5ILGA 1PIWA 3MJSA 3ZI0A 1JAYA 2X22A 1PJCA 1L7EA 3JQAB 4RQUA 1KVSA 2VQ3A 5ADHA 2GDZA 1T24A 3F1KA 4BL5A 3GZNA 1Y8QA 3I9OA 1BW9A 2P4HX 3GGGA 4ZN6A 1Y8RB 3L07A 1C1DB 4BO8A 3ENNA 1E1KA 1HEUA 2RHRA 1BW9B 2EGHA 3VKUA 1X7HA 4WEOA 4PG8A 1MB4A 5G0UA 4KDFA 4OIMA 2ZQYA 1EE2A 2AG8A 4GSLA 4R1TA 2P5UA 2HRZA 2OL4A 3WMWA 3ZV4A 4FDAA 1ZIDA 4RDHA 4E12A 2QW8A 5EESA 3WNVA 2GLXA 2OFPA 4W9NA 1U4OA 2AEFA 5CEEA 3RROA 3AFMA 1SMKA 1JKIA 1SOWA 1NM5A 4A10A 4Y6PA 3JD1A 5TIIA 2DUUA 1PQUA 2EKQA 2O3RA 3IIEA 5U9CA 3GG2A 2CY0A 5L4NA 3DONA 3N7UA 3A1NA 1GPDG 2VN8A 2ZCUA 3KYDB 4XRGA 4W7HA 4FFNA 2ZTVA 3EVNA 3JTMA 1A71A 4MIOA 4II3A 1DHTA 1KS9A 1X15A 2BHLA 1VC2A 3HG7A 2WD7A 1NHGA 2VYND 3EZYA 4QFDA 3VPFA 3FTPA 4NBTA 1GUZA 4J1TA 3G49A 2ZTUA 3RVDA 1ENOA 1QORA 4P8RA 4NU6A 2JCXA 1BVRA 2BMAA 3SLKA 5HBRA 1SZJG 1FXSA 2AQ8A 3KYBA 4DC0A 1HDGO 3TZ6A 5G4LA 5TGDA 4OKNA 1U5AA 3MWEB 2PKRA 3QLJA 2VWQA 3KSDO 3TOZA 3F5QA 3RFXA 3PK0A 1ZVMA 4JBGA 3FI9A 3JYOA 5TNXA 4HP8A 1IPEA 3AFNA 1KIFA 3ZHZA 4ZQFA 1ZO8A 3D64A 2OXIA 4HUJA 3M6IA 4YJFA 3B1KA 1UDCA 3GFGA 4GLLA 1IUKA 3JQAA 3K73O 3QVSA 2Z1NA 5FF9A 1HLDA 2VRCD 1TT7A 4L9RA 4UVHA 5G4KB 4LW8A 5HS6A 3TZCA 3LVFO 1GQ2A 1AHIA 4Z6KA 3UICA 2NQTA 2O3QA 4J2HA 2CVZA 3HUDA 3E9MA 5COAA 4GH5A 3GDOA 1WDLA 1Q7GA 4ESOA 2B5WA 5A04A 9LDTA 4CMHA 1I36A 3MZ0A 5JC8A 5JE8A 1D8AA 4CUKA 1M76A 4FBGA 4IJKA 3TQHA 3PHLA 4XQCA 2FR1A 4RLHA 3ZWCA 4BNWA 4E30A 4QTZA 1PGOA 5KJ1A 3VH3A 4BHTA 3UFXA 1LLDA 4DPLA 3E9NA 2JD1A 1FMCA 6LDHA 4MVJD 1ZJYA 1P1RA 2QQ5A 1U3WA 3WICA 1Z45A 2AMFA 1QSGA 5EL0A 3DR3A 4E2YA 1YOVA 2E6UX 1WDMA 3WJ7A 4CLEA 4EUEA 4RV9A 1XELA 1I2CA 5ER6A 2H1SA 5TJHA 3BMCA 4CV0A 3L0DA 3L9WA 4KWHA 1SEVA 3ZWNA 5BSGA 1DC3A 4HX5A 5IDYA 4ZHSA 1A27A 3WYBA 3DZKA 4IDAA 5HA5A 3BMOB 4OXNA 1VL0A 1DAOA 3KUXA 3C24A 3GNQA 3MJ4A 3PP8A 1NAIA 3DL2A 3OF2A 3WX0A 2VT2A 4UUOA 2BF7A 4FJ1A 3C3XA 3EC7A 1GU7A 2DTDA 3Q0EA 4IS2A 4U5QA 1HYGA 4YJHA 2Y1OA 3VPHA 5JS6A 3C1OA 3HZZA 2GZ2A 3MOGA 1YRLA 1P3DA 3ZWBA 2BFPA 1Y5RA 2ZTLA 3WTCA 2CUKA 3DBHA 1EMDA 2A35A 3OIFA 4CM9D 4R1SA 4BOYA 2UDPA 1PGPA 5T8KC 3DBLB 4EEZA 5HTOA 4Z3DA 3QWHA 3QRWA 4M49A 4RQTA 2DUWA 3H7AA 1R37A 3HADA 1AE1A 2QYSA 4PLZA 4JK3A 4FR5A 3M1LA 3U3XA 3VH2A 4XYBA 3OQBA 1LDGA 5L7TA 1GADO 3GNTA 3AY7A 3DFZA 3HNPA 4HY3A 4L74A 4YR9A 1HZJA 5KOIA 2QIOA 1IPFA 2PGJA 4GKVA 2FWMX 4B4OA 3GVHA 3WGZA 5JDIA 2R2GA 1XSEA 1AXEA 3S2GA 1RPNA 3ICPA 2GSDA 1YDWA 3PWSA 3PWKA 1A5ZA 4NR0A 2DLDA 4MVJG 5KJ6A 1LDBA 3GOHA 4PIVA 4AJEA 1X0VA 1LSOA 2AHRA 3F9IA 4FC7A 3QSGA 1VSUA 3FRJA 4WLEA 2NADA 2RBEA 4XDZA 4I5GA 4PZDA 3ADPA 3DOOA 2P4QA 1RWBA 3A06A 4XQ9A 5H83A 4E2ZA 3W4JA 3JSAA 3FPLA 4M55A 3HDYA 1M67A 4ZD6A 4F46A 1XKQA 3KZVA 3TL2A 1LRKA 3GEMA 4TMFA 4HNHA 1QRRA 1PU2A 4DMLA 1E7SA 2FOIA 4QT0A 4ZRNA 1ONNA 4L76A 1IB6A 1DIBA 5JLAA 2E37A 4NJOA 5JYEA 3VAZA 3O38A 4QQRA 2UVDA 1IE3A 1CEQA 4WKGA 4RVDA 1BMDA 5TX7A 1LC0A 5F1KA 4D3SA 1TT5A 3DAFA 2VUSA 3ITKA 5LDHA 3C7CB 3O03A 1DC4A 4DBVO 4BUCA 3AM5A 2YYYA 1MFZA 1O0SA 4XEHA 3W8DA 5EN4A 4NBUA 4BB5A 4OXKA 3ITDA 3NGLA 3RC9A 2X9GA 2G1UA 4FOSA 3NYWA 4K9DA 4OMUA 3D3EA 1IULA 2PZLA 4HBGA 4HADA 4WNCA 4CV2A 3DZGA 3DBVO 2QG4A 4D0RA 2NNLD 1NP3A 3EYWA 1RYDA 3AY3A 1CJCA 1PQWA 1P1HA 1JA9A 7MDHA 2AE2A 1P0CA 1SB9A 1MXFA 2D1YA 3OIDA 4IXWA 5G2OA 4MVJA 4HFNA 3RAJA 4EJMA 4L75A 2EXXA 4CM8A 1VJ1A 3OICA 3ABIA 4GPD1 4U6SA 5CDTA 1GV0A 3DHEA 4Q3NA 3UCFA 4AFNA 4KOAA 3ZU3A 3DTTA 2P9EA 2PFGA 2OMEA 4GGPA 2EEZA 2JCYA 1U3TA 4TWRA 2V6BA 3UXYA 3IP1A 1WDKA 2WM3A 4WK6A 3SEFA 2PY6A 4CMAA 2GN8A 1BXGA 4DQXA 4CM7A 3RKRA 5A5EA 4U7WA 5L9AA 4WASA 4HFRA 3BMNB 3QV1A 3VTZA 4CQLA 1E3EA 3ONEA 4E21A 1N9GA 2WYWA 3K5PA 4LGVA 1NXQA 4UVDA 3R0IA 4CR7A 5HM8A 1R4NB 4R16A 4RCVA 2JFHA 1NVGA 3I5MA 4PCVA 4WUVA 5J23A 1E7QA 4BS9A 3LLSA 1ZMOA 3BMQB 5COBA 4AJIA 2ZB3A 3H9GA 5AXBA 2UUOA 3WSWA 3E82A 2C07A 4F45A 3WIEA 2EERA 1IL0A 3WTBA 4XCVA 4LN1A 3IS3A 2Q1TA 4P22A 4R68A 1W0CA 4R01A 1I01A 4R1UA 2ET6A 5TS3A 2P5YA 3WGTA 4BMSA 3TFOA 5GY7A 2CNBA 1DFGA 3EW7A 4ND4A 3RJ5A 5DOVA 3W8EA 3OSUA 4KZPA 1DPGA 2Q1UA 4RF5A 2FPPA 3C8MA 4J43A 2QYTA 3PYXA 4LVCA 2VYNA 2XPCA 4PGFA 1SB8A 2D3TA 1SPXA 1DC6A 1OC2A 1ZXLA 4Q3DA 4WLNA 4WLOA 3WFJA 1PR9A 1XDWA 2J5RA 1DIAA 3UF0A 4H15A 2X0JA 4JBIA 4K26A 3ZU4A 3JYQA 1ARZA 3O26A 2NV6A 2CZCA 3TSCA 2BRUA 4HV4A 4XJSA 4NI5A 5JY1A 4LCEA 1N2SA 1HSOA 5AXDA 4TKMA 3ZV6A 4G5HA 3D5QA 1W4ZA 4CMEA 3ZHYA 3KHUA 3GNSA 3QHAA 4C4OA 4F6CA 3JCZA 2Q1SA 4DIFA 4UAGA 2PNFA 4FFOA 2W4QA 2IXAA 3ON5A 4DQVA 3G17A 3FBTA 3I9JA 3NDIA 1HZZA 4CMKA 2D5AA 4BQPA 4QUKA 3ZNOA 3QP9A 3WQSB 1LRJA 1EZ4A 2IDZA 2GO1A 1X1TA 3ZNNA 3GPIA 1PTJA 4XWYA 5IXYA 1A7AA 2YDYA 1JAXA 3AUAA 3IP3A 5TC4A 3CE6A 3KLPX 1PJSA 2ZTMA 3ZU5A 4NBWA 1XIVA 4YT5A 1K3TA 4ALNA 4A03A 2PZJA 3DC2A 4HWKA 1NNUA 3ORFA 1FF9A 5H81A 3BIOA 4DYVA 3PFWO 1EUCA 3T7EA 3WMXA 1I0ZA 8ADHA 5T5QA 1YOVB 1YDEA 3OIGA 2BH9A 3GMSA 4FGSA 4GQAA 4UEJA 5KKAA 3FN4A 4E2XA 1C1XA 1YS4A 3VOSA 4WLVA 4CLXA 3LU1A 4D79A 4EUFA 3WJAA 3SJ7A 3G1UA 3I9LA 4A27A 1JU9A 3H2SA 4YAKA 1NQTA 3PDJA 2E4AA 4J1SA 2V6FA 5TT1A 1U7HA 4FC6A 4U0KA 2NU6A 3VZSA 1BTOA 1T1SA 1Z75A 4DLAA 2HMVA 5FWNA 3CXRA 4R4JA 3WSVA 3FF4A 4LCJA 3I23A 3P7MA 4E33A 4CLHA 3ZW8A 4A2CA 2NQ8A 1ZNQO 4RPKA 5C37A 1RM3A 1UZLA 2PZKA 3B70A 5I9NA 3RBXA 1E6UA 3U9LA 4YBZA 1ISGA 4XYLA 3S2EA 2Q2VA 1JTVA 1CDOA 1KVTA 2Y0CA 3INRA 5A3VA 1BSVA 4IY1A 5G0SA 3LSYA 3G79A 4M54A 3DBRB 1LQUA 2X5KO 2C2XA 3F5SA 4J49A 1DSSG 4IGEA 3SLGA 4OOFA 4PVCA 4E31A 3E03A 1KERA 3QWIA 4GX1A 2D59A 3WQRA 2JFGA 2RAFA 3N58A 4X54A 2FN7A 1LJ8A 3C7DB 3VZPA 1ZXBA 1RM5A 3EZLA 3HDJA 5A9RA 1TVEA 5JDCC 2WYVA 4E0BA 4OSPA 3TDKA 5C3MA 2QRJA 3GN1A 1C14A 3U4HA 1N7HA 4RPHA 4GGOA 1SNYA 1YB4A 4R54A 1KC1A 1I8TA 2A4KA 1KOLA 3FPCA 1IZ0A 1WW8A 2GERA 3JQFC 3ZV5A 2VOEA 5BNFA 3QVTA 4BQRA 1I5RA 2DAPA 3ZV3A 3C1TA 3GFBA 3GHYA 3OJEA 4WOJA 4WECA 2IZZA 2X0IA 1K2WA 4IIVA 1BGVA 3OEWA 2PV7A 1H2HA 4M1QA 3OEYA 4NZ9A 4N5NA 4URFA 1TI7A 1PQPA 5KJCA 1NASA 4BNYA 4J6FA 2VWPA 3KLMX 4DWVA 3ETGA 1B26A 4HFJA 4YQZA 5BSFA 3DXFA 2X0RA 2CSUA 4PLWA 1EQUA 1B3RA 2CMDA 2IE0A 4QO7A 2X58A 1O8CA 5KCZA 1H9BA 3O8QB 4BV9A 4D45A 4DVJA 3WFIA 3ROMA 2Z95A 1NR7A 3PRJA 1T25A 4MIEA 2FR0A 4WGGA 5CFZA 1AUPA 1H6BA 2ZYAA 1V6AA 1YBMA 2OUIA 5CDGA 1ZK3A 2UAGA 1HWYA 3JQDA 1PGNA 1T2CA 3U0BA 1U3UA 4YJGB 1LEHA 1DXYA 5A9SB 3GRKA 3V1UA 3JQBC 3QE3A 1PS8A 4TZTA 3NTQA 3TFQA 2VHYA 2DBVO 3O4RA 4U6QA 2OO5A 5A06A 1E7RA 4KUEA 3TL3A 1A7KA 3FNFA 4WOKA 2YQ5A 5JCJA 2DKNA 2DVMA 4IIUA 3RD5A 2YV1A 1ISJA 1P44A 4OM8A 4TQGA 3PHGA 4CMIB 3ROQA 2X86A 3UUWA 4O6VA 4CM4A 4K28A 1NQOA 2Q4EA 2BFMA 4RDIA 4RVUA 2XAAA 3PYLA 3UAGA 1O6ZA 4GX0A 4D43A 3DMYA 5FI5A 5I7VA 1Y5MA 3NRCA 4BNVA 2WD8A 3LF2A 4TVOA 4A0SA 3BTUA 1ZEJA 5GZ1A 1V0JA 1SEPA 4WCFA 4YB8A 1D1SA 4MINA 1HDYA 4GKBA 1R4MA 4N5MA 3LK7A 2EGGA 4MP3A 1T1RA 1F06A 3ANNA 3D4PA 4L4RA 1HE5A
chains in the Genus database with same CATH superfamily
4RESA 4BASA 2HXYA 2W2MA 1NVEA 3L0OA 4RHUA 3RBVA 4B5KA 3SQWA 3ZGZA 5LYJF 1Y8QB 2H7VA 4B35A 1NUTA 3IT0A 1SU8A 2C57A 3RLFA 1XU7A 2Z09A 1MIOB 3KWFA 5AXAA 1EB8A 1M0TA 1LK7A 1XO1A 4W1SA 1PUXA 1TCBA 1ZY2A 4GP9A 4PVDA 5F7ZA 5KWIA 4P0PB 4Q48A 4X60A 4HVAA 4R1PA 2J33A 3GZJA 1F2TA 3IDSA 2ZKIA 4M53A 3VR5D 5TT0A 1ZD4A 4ZDIA 2EWVA 3B1WA 4L6AA 1N5RA 2GDJA 4X65B 1PJRA 3V8NA 1NY6A 1BFDA 4WJKB 5KWEA 1CS0A 3CIFA 1ISRA 1P5ZB 3BJEA 1TVCA 2INGX 2VPXA 3DBOB 4RACA 3HL0A 3NDJA 3MBIA 4RFLA 3O0TA 3RHSA 1U3DA 4MGZR 1HT2E 3H4VA 3AINA 4W7IA 3GGDA 1U8CB 2H8GA 3L40A 5EP1A 3HB7A 3USCS 3L5KA 3VU1A 2RKBA 2XQIA 3T41A 4A26A 4A23A 3A36A 4D4LA 1L7AA 1ND6A 4JCCA 1ICEA 3ITNA 2DG2A 1ID1A 4CGYA 3GGCA 3HY3A 4JSYA 3D6FA 4AKSA 5AKZA 4MRRA 2V7GA 3JQ8B 1O03A 2A9PA 3HKBA 4OHMA 1ZBQA 4IRXA 1L7QA 4JQOA 3DE4X 4ZOLB 5J2UB 4O4JF 2BISA 4DCOA 1XRSB 1XTJA 1UEXC 2B9VA 2R8PA 2Y1WA 3AI3A 3BCUA 4RYDA 121PA 3R7AA 3VNVA 4JLAA 2BFDA 5FNZA 2RE8A 1S96A 5LCXA 1JG6A 4NDAA 4QGSA 3EA4A 4FSHA 4B6OA 3W2HA 3IKJA 4PTYA 2ZZMA 4DGSA 3NT2A 1QQTA 2YUTA 3DAGA 3QJYA 3M8KA 4YRPA 1FFBA 1H6AA 1R0LA 4CUJA 4J3FA 5BP7A 2DCUA 4F7WA 3GJ8A 3IAUA 2I7XA 4TSRA 1IN1A 2OC4A 1BIFA 3RVSA 2PMBA 1FQWA 1UH5A 4OGKA 4QG7A 1ZIPA 2G71A 5DZSA 1P1JA 2XT6A 2JCGA 4J76A 3GMTA 4PAWA 4F71A 1OOEA 5FUMA 4AQYB 4COKA 1N25A 3E61A 3KV1A 1FUEA 1XLTA 3D2AA 3I9V1 2QW1A 1GZUA 1UMKA 3HACA 3QK7A 4R2HA 3V9PA 1DTSA 3ESXA 4V02A 1GLVA 1P4HA 1UWCA 3EIEA 3NUZA 3Q2KA 5DN9A 1TQDA 4PZCA 5DHFA 5JS7A 1KPHA 3LFUA 4M1WA 3UWDA 4RXMA 3W4KA 1HV8A 1XZDA 2AK2A 2HC9A 3H17A 4K6HA 4RK1A 4DLXA 2EZ9A 3C3MA 2ONYA 1GG2A 1WUIS 1TK2A 1UM8A 3LBYA 2BWJA 4QFBA 1SU7A 3VR2D 1TEZA 4MV5A 5LA6B 2BFBA 4RD0A 1PEDA 4KXXA 4M46A 5AYVA 3M89A 3G82C 4YJHB 3LY9A 4IDFA 2I9KA 2OCGA 5B53A 4PS1A 4RVNA 5BRAA 1XZCA 3NHWA 4H6WA 5KNDA 1NFQA 4I1YA 1KYVA 3FWNA 5IKPA 1B0UA 1Q0SA 1ZSYA 4IDBA 3TPCA 4G0XA 3P9RA 4HQLA 1EUDA 1B15A 3QUTA 2ATIA 3IPXA 4REQB 3PDUA 2I4LA 2DC1A 4V0SA 1RLJA 1A4IA 2H8KA 2QVLA 4RLFA 3LIPA 3UIEA 1P29A 4YRBA 3NIDB 2G07A 5IVIA 2V5AA 3RIHA 4E09A 3LWNA 3TF5A 2J9ZB 3I52A 4H6PA 5TPWA 3QQ5A 3HVUA 5F3WB 4I8IA 1HT0A 1LA2A 1EGHA 1YC5A 1T4CA 4TUYF 3ZH9B 4BQSA 1ZRHA 4EPWA 4DRXB 1G5QA 1ZN9A 4GSYA 1E8NA 2D1QA 3MPOA 2RGNC 4L4XA 3UOWA 3C3DA 5FWDA 1KMHA 1E3SA 1R8JA 1ECLA 2VQ6A 3AJ8A 4Q3KA 1SUWA 2Q4RA 1LUAA 2IYSA 1LU9A 1NVTA 3ZBTA 5CEFA 1VJDA 3PLNA 2G9RA 4Q1AA 1T13A 1I33A 3PQFA 4E15A 2P6RA 4BTVA 4MPDA 1W75A 4M37A 1BKSB 4MMZB 3RHZA 1U3CA 1XAJA 3ZBQA 2DQ4A 3DPSA 3NJ8A 2X8AA 1JAHA 1MXHA 2CGEA 1Y4DE 3BRSA 4TLCA 3VU9B 3WNCA 3ER8A 4X1IB 4EHJA 2IEBA 4TZ6A 5BXYA 1YU9A 3GEHA 1A9ZA 3SZOA 3L7LA 4ZGWA 1PWXA 2AMLA 4CCYB 3IKTA 4M0FA 2ALJA 4Y1GA 2VZLA 4J9UE 1JUDA 1U90A 2QG6A 4FOTA 2VHJA 4NAHA 4XH9B 4KC0A 1DJNA 1Z0UA 3MBOA 3DVRX 3HN7A 3LPMA 3S28A 4C14A 1EXMA 1S8OA 3K30A 3G2QA 3QEOA 4J1NA 3L6BA 1XPJA 3MNFA 1RS0A 2Y93A 5A4IS 2A6PA 2CFIA 1Q83A 3DMGA 3VAYA 1ZLXA 5JPIA 1GUBA 3F8SA 2F62A 4GUAA 3WBKA 4ZQBA 1KJJA 3O9ZA 4Q00A 5ENDA 3BK7A 1MIOA 1FVXA 3HGTA 4IOMA 4RFSB 5ICEA 2CSXA 2H1HA 3QWFA 2VP4A 1N2CB 2WFMA 4GNKA 3PQCA 4IDDA 1BDMA 4JB8A 4JWKA 4U2GA 1P45A 3SN6A 3W3ZB 4P6VF 2RONA 3WRYA 1P6UA 5CCEA 1J1UA 1C1DA 5IN5A 1I0IA 2WVJA 2NACA 4L9WA 3LUBA 3INGA 5D5HA 1KK0A 5JD4A 5LP6F 3RVKA 1CIVA 3K2BA 1X1AA 5B3AA 3IUMA 1SUBA 3ZWDA 1NOIA 2I5PO 2PLNA 3ITEA 4HS9A 4JFRA 4MCAA 2XIQA 4DUPA 1R6BX 5CX1A 1E9DA 5AVOA 4DC9A 4YRDA 2EX1A 3Q3JB 5IC6A 3TBFA 4CF5A 3AVWA 1QP7A 1Q7EA 2OZPA 1SKMA 1TMGE 2P9QA 1UZUA 3FMPB 4G85A 5DBOA 3LKDA 1PUJA 4MCIA 3RS9A 5TLSA 3BGOS 1KI3A 4MQ6A 3MINB 5F9HA 4EDFA 5BQOA 5H16A 1Y7LA 1BWQA 2YJNA 1DC5A 1NVAA 1WMAA 1P4JA 3DJYA 3E4DA 1U1IA 2IYNA 4JCOA 4PTLA 4LNUB 1YKGA 5A3SA 1X70A 1NQ5A 2HLDD 2P5SA 4HQOA 4GI5A 5IYZB 1TQ2A 4PQEA 1EVEA 2DLCX 1RT9A 2DHQA 1GIAA 2X7HA 4US1R 2HK8A 3UFBA 4NE7A 4BQNA 2PIDA 2QGZA 3DMTC 3WOHA 2XD9A 3DTYA 3HXLA 3L8HA 3WGKA 3R6LA 1OZAA 4ISCA 4KDEA 2WF8A 3LVRE 3HEAA 2FN8A 3HFGA 4GLOA 4PAMA 1L1RA 1V9CA 4U9IS 2CHEA 3P9ZA 3UJBA 3VGPA 1RJFA 4DR2B 2L42A 1Q7CA 1YR8A 3VZCA 1H2BA 1ODIA 3B1JA 1WPQA 3LW8A 2AEEA 3N9IA 4C7KA 2JRLA 1QRTA 1NVUQ 1B42A 4IGIA 4RQAA 4FJ2A 5BN5A 3WP0A 3CPSA 4TV9A 1EDDA 1YHNA 3TTUA 5IM5A 3CX3A 5AICA 4DJEC 3CLUD 3F3MA 2Q0HA 1BHQ1 1F4VA 1UP6A 4U2CA 3KSUA 3HXQA 2FA9A 3QXXA 4NDZA 3KJIA 4P92A 5K4AA 4ZK6A 2X0DA 3KQUA 4ZAGA 3LO5A 3LC1O 4JP1A 4QM7A 3E7DA 5I5GA 1BU5A 1SXJA 3OE1A 1CR2A 2UZIR 2JLQA 3VDRA 3WWEA 2WE7A 1ZCBA 3VR6D 1X92A 4B8WA 3RRZA 5CH5A 2P2CA 1KGSA 4G89A 4J7AA 3JTEA 2V7XA 1S2DA 3FR8A 3DZFA 1EGQA 2IYOA 1EQAA 1YONA 1KYXA 3HSKA 2VHZA 1ESEA 2Q0QA 3L01A 3RVNA 3RR2A 1G8KA 2W93A 3I5UA 1GYRA 2FSFA 2ATXA 2JJ2D 3M4XA 3TTTA 4JI7B 3D7KA 1FMTA 3BE6A 3HR4A 3G8AA 1N5LA 2A1UB 3PPVA 1SG9A 3C2QA 3KZXA 4OOEA 5CR9A 5K6AC 3CZ9A 3BH6A 3DUWA 1C3OB 1D4FA 3N3AC 1IXZA 3F2IA 4IWNA 1RXUA 4P7JA 3RIMA 4AKTA 2JGEA 2PUVA 2ADFA 3UH1A 4P81A 4TL6A 2JG3A 2AN4A 3NAGA 1GPUA 1M1YB 1AQLA 4N49A 2JCBA 4HI0E 1HEIA 4TTJA 1T1EA 4GL2A 2HLPA 2QV7A 3D6VA 4R2LA 1UDWA 1BHJA 2YFHA 4IVQA 4Q5IA 3M5WA 4RVGA 4YJGA 3U7FB 2D62A 2HUNA 2WMNB 1Z6QA 2ZTHA 3MJVA 4IOKA 3OEEA 2OHXA 3NTRA 3TG8A 1M34B 2DJ5A 4MKHA 3QPCA 5JQGA 3S5JA 1ZUIA 3T5AA 1E64A 1TU0A 3G9TA 3MBKA 2V9ZA 4IDQA 1H1TA 2LDXA 4NZYA 4JROA 2AQKA 3DAPA 3KOUA 5L40A 3WYAA 1XYGA 2EHJA 3I5XA 2AH5A 4N54A 1C4OA 2HA2A 2R6ZA 4OBEA 1Z88A 2AX4A 4V0KA 4G5GA 2CLOB 2WHQA 1V26A 2KHZA 2FPKA 3I9KA 3ZS9A 2FSIA 3RSZA 2QUAA 5FPKA 4EVQA 1A1VA 3OT5A 2JANA 4V0OA 1EA7A 1DGQA 4OBWA 4EKDA 5A7FA 2BMVA 4O2AF 2OEPA 3GJ4A 5DNVA 4BMZA 4I4TA 1JFRA 4BX0A 3FFTA 4ENRA 1DB3A 3AP2A 3G7UA 2V65A 3AO0B 3BB1A 3AFOA 4BQFA 1F7UA 3OQIA 4FFLA 3H5VA 2PKQP 4H6VA 5D5QA 4BO9A 2NSDA 2IV7A 1VBNA 3AEKA 3VPGA 2H07A 1QBGA 1IG3A 4HDNB 3IOMA 4ERNA 2WJHA 4BNHA 1S0UA 4JMLA 4IJ5A 1G59A 4RHFA 2JIZD 3CMMA 1QCDA 1H6DA 3EDCA 3L8FA 3LRTA 4UHHA 4C76A 4MULA 1BHSA 4I5EA 1SUSA 2PGAA 1NG9A 4MGKR 3D6UA 1WCV1 3ZHTA 4W8GA 2HUPA 2RKWA 1EA5A 1ZD3A 3DYIA 4F06A 3NU1A 1J2UA 2FZ4A 4D4GA 5HKAA 5JNLA 2IELA 3DOUA 4YAEA 3AL0C 2QMEA 3PTLA 1L1QA 4K9PA 4DV4B 6ADHA 1PR0A 3IRUA 4B34A 2PFKA 4LRWA 1V8BA 1SHTX 4Q15A 3E53A 4Z0HO 3H4TA 3SJBA 4AO8A 1N8SA 5DH9A 1DKRA 4D46A 2NP6A 1ZNZA 3CNQS 1QHYA 1EVYA 3AERA 1WY7A 2BFEB 3U4DA 2ZIXA 5REQA 4GNRA 4CTKA 4QXMA 1WLYA 4DLLA 3CLSC 4JFAA 4DR6B 3F7OA 4ALKA 4W5TA 4CNBA 3L6UA 4UPEA 1RI3A 1IONA 4RK7A 5CDFA 1JWBB 1P9NA 5HGXA 4MARA 3QA9A 4F97A 2O8EA 1RAFA 2B61A 5CVVA 1TF2A 4H27A 4DVGA 1L3IA 2FWPA 1PWEA 3CEHA 5GZ6A 3STTA 1BMQA 5CFNA 1U9IC 1U9CA 3K3PA 2J87A 3BSSA 4IJUA 3MCAA 5LMZA 4MQFA 3BWVA 3GZTB 3BEDA 3ECAA 1KSJA 7ABPA 3FNGA 4NJMB 4US0R 4ZOBA 3OZ7A 4I3GA 4DA9A 4HNTA 3OUUA 2I8CA 4NYIQ 2XXAA 1PJ8A 1EDZA 1Q11A 2UXCB 4HNVA 5DE3A 4XARA 3PUHA 1A69A 1DX6A 1R3DA 3EBOA 4IQ8A 4EJFA 1T4DA 2ZETA 3KUCA 1VIDA 3P0HA 1J4AA 1EYZA 4O5OA 3ILSA 2ZYGA 3R7NA 2P9ZA 2XJ4A 1QMGA 1IQUA 2AFHE 4CF3A 1NX6A 1ZESA 1AH2A 2EBHX 5B7NA 4YALA 3O7WA 1PGQA 4OHUA 4M7OA 3GT3A 3W6OA 1YASA 2I4MA 2O2HA 8ABPA 3IPYA 5EJ6A 2H5IA 4YMGA 4RZHA 5IDXA 4EPVA 4MWOA 4C3UA 1DPFA 1Z63A 4R2WA 1QYXA 4H31A 4FN5A 4NQRA 2EG5A 4OFWA 3T7IA 1K5DA 5SYAA 3CRNA 3R5TA 1L8LA 6REQA 3WLJA 1T5TA 1KU6A 2FSVC 2PKWA 4TWIA 1EWRA 4N0EA 1AMUA 2IXEA 5L3RA 1ZOLA 3W9BA 4OSEA 5A0TA 3CC8A 4MKIA 3C14C 1JIUA 2V7QD 1G9TA 1IBRA 1ZW1A 2GH1A 1DTWB 1MGOA 4PWZA 3VSDA 1PVOA 4R31A 2OT3B 2RAUA 3OUTA 1YCHA 4H6XA 1EP1B 4S0XA 1P4GA 2GASA 1VIAA 4WY2A 3W7AA 4CM3A 5JBIA 2GT1A 1OI3A 2IPLA 1EFAA 4M89A 1QUFA 1PR2A 3UMYA 3FSJX 1M1UA 1R16A 3UAOA 2G76A 2R6CA 3NX4A 1GPBA 3WLEA 3A05A 5B7GA 1UOPA 2H00A 1EBFA 1L0BA 2QWXA 2Z83A 5C31A 3U13A 4B45A 4EFKA 1LDYA 1DJQA 1E9BA 2XYQA 4CKBB 1QHFA 2K87A 4LQ4A 5JI3E 1P39A 4PC7A 2YKGA 1DG9A 2ONZA 3LUFA 4QBGB 5JAUA 3Q4GA 4GE3A 2VTEA 4U7GA 4E5NA 1UQRA 3FCAA 4QHSA 2ANBA 4WCFC 3RT9A 1SZCA 2GN9A 4BFZA 3CH6A 4DUGD 1X87A 2DFKB 5F98A 3VO8A 3B9PA 3SC3A 2ZPTX 2AGVA 1DS6A 1W9MA 2Q6LA 2Y1GA 3PGMA 4B3TB 3GD7A 3T5TA 4OJMX 4JBLA 1Q1EA 3GRZA 4Z8YA 4YAUA 4MEAA 3R6WA 4P98A 2OXRA 4IZOA 2W2XA 2YXPX 5EYPA 3EMBA 2PMFA 4PC6A 4X7BA 1JS1X 1ZGGA 2HHAA 3K35A 4MUMA 4D4KA 1O77A 2ZRAA 3MWJA 4D02A 2IXFA 3IDFA 3IVAA 5FV4A 3T5PA 3N74A 2WZBA 1XNGA 4Q7JB 4DCVA 4G1UC 3NKVA 2PMWB 1CJSA 4DR1B 5E0KB 2PVSA 3GUCA 5L51A 1F14A 1SQ0A 3BA1A 4H7PA 1U8TA 3UUEA 4C1NA 2PH7A 4K6GA 1KI7A 2ZWVA 4Q3EA 3WISA 1KRWA 3M70A 3GLHE 4P3PA 2HFKA 1HL3A 1KJIA 4N4AA 3NV7A 3UKDA 1FRQA 1NV9A 2EAUA 2GYWA 4P38A 1SXIA 4ONEA 5E1OA 3PEYA 3MUOA 3MS2A 2PMEA 5LKAA 3SM3A 4IJMA 4B4VA 1LBIA 3KLBA 4FEGA 3STXA 3VC3A 4JNCA 1X13A 4RZUA 2HA5A 3SJCA 3OHPA 1IBSA 4NS1A 2WVAA 2QTAA 1KFKB 4A2QA 2J0QA 2YDXA 4LBWA 4ZVOA 1M2GA 1XTUA 2FH5B 2GUWA 2PPLA 2ZRHA 5BSRA 3JAWB 5A62A 2M32A 1E79D 4QX6A 5G1OA 1NONA 2A59A 1F51E 2H1IA 2JD2A 1JLRA 4IIXA 4E32A 5A2GA 3WAGA 4PAOA 4BNFA 3RU7A 4W99A 3CUVA 1MO5A 1JU4A 3U7EB 1FDIA 5BWBA 3Q5EA 2ZR9A 2Q7OE 1FTQA 1ZVJA 2ISCA 3D7LA 4DUYB 1X8KA 3E5RA 4TKUB 1T2FA 1NWHA 2XODA 3FKQA 1A2QA 4IPTA 2Z3WA 4AJJA 5AW7A 5KINB 3SKXA 4TSKA 5AKJA 3SD7A 1P91A 4R8VA 2QN7A 1XXHA 1WEHA 3LA8A 1T2AA 3L3BA 3O3CA 3HM2A 4OG2A 3V8QA 4B9EA 3AOEA 1IN6A 1VI5A 3R0VA 4OA8A 4P53A 2G4VA 1OXUA 2HRRA 5A5VA 5JECA 4EAAA 4LHXA 4BO6A 3SNHA 4D3ZA 4WOCA 1YQGA 2HBQA 1VE9A 2J3LA 1E2KA 1DV2A 2XLCA 3IUEA 5CFRA 2BIFA 2RKOA 3IE2A 5GINE 2FSUA 3CMCO 2DR3A 1COWD 4DIUA 2XQFA 5DJ5A 4RK4A 1YVEI 4I5DA 1O5OA 5UKDA 3SFTA 3GAZA 1SULA 4R81A 5SY9A 3ZQJA 5BWOA 1VCMA 1M8JA 4ZYZA 3UYLA 1CBUA 3F4LA 5FPYA 2AYYA 4UE3S 5CJ2A 4RNDB 5BW6B 2PRSA 2AW3A 2YQ4A 1S3SA 4MYRA 4U5XA 2L17A 2G70A 1PDVA 4YCDA 5EVCA 3VVBA 2P2SA 1DJOA 4GVLA 4XTRA 3CUYA 1FW8A 1K7FB 1PT6A 4KVFA 4KN8A 2ZJ4A 4WBXC 5AVTA 1J0XO 1QXSA 2HO4A 1NJ8A 4AI6A 3HS3A 3FCYA 2Y1EA 4M4SA 2YVLA 3O6VA 2GR9A 3PHHA 4P3XA 5JZOA 1ZK1A 3NM5A 3FJOA 2EJUA 3JD0A 3QU5A 3JQ9C 1Q20A 2C4HA 2WNHA 3FRHA 3H3FA 4OHFA 1I3NA 1XJ5A 3M1AA 4EBBA 2HRQA 3O84A 2WP0A 5KTRA 4WZ6A 1GITA 5AK6A 1PZMA 3TAXA 3W6PA 3SICE 3RT1A 2IKQA 3PIRA 5A9TA 3X1ZA 4PF1A 2RH5A 4ZVQA 5IN4A 3FDIA 4G09A 3BMQA 1OFHA 2VBIA 2AB0A 4DWOA 1II8B 3CRRA 4JXKA 3TZHA 3W6ZA 3IOBA 1LTHR 2C61A 2OP0A 4EW3A 4U7DA 3BB3A 5LXTF 3SVZA 3TKYA 3VNQA 5FNVA 3A6DA 3Q1KA 1XQ6A 2TMYA 2DY0A 1C3JA 1YQ9A 2A0FA 3C6QA 5ALJA 1KE1A 2QL6A 4AP5A 1JKFA 1L4FA 1YQTA 2WSYB 4QDOA 1RFLA 2X40A 1Z5OA 4RHEA 4PN3A 1WXGA 4L5IA 3ZWQA 5C5CA 3EXHA 4BP3A 3K94A 2LXNA 1BD4A 3JD3A 1JMVA 2YW9A 4TSFA 3D3NA 3TDNA 4P0TA 3THRA 4O4HF 1ONSA 1DWQA 5KIAA 2YHUA 2HU7A 1G63A 2REQA 4UHCA 3AFHA 1U0JA 2HBYA 2XDYA 1II9A 3H16A 4G4SO 3VSBA 2Z8YA 1E4EA 1NZJA 4KMSA 2W0SA 4B7ZA 2ZI7A 2OD9A 1QPZA 4LX0A 5AVYA 3L1KA 2C2OA 2QSZA 1NVVR 2GFHA 2GTHA 2JHPA 2OGUA 1MAHA 3L7NA 4FGUA 3H1TA 4KLZA 3CR3C 1CRZA 5JQGF 2IE8A 4V3BA 4A8JA 4BBPA 4C5CA 1UKAA 1STOA 3WP1B 1FP2A 4BNTA 4JXZA 3R3XA 1HF3A 1ZC3A 3LXUX 3HC7A 1GU0A 3DB2A 4Z3OA 3P0RA 1A5AB 4I66A 4A5OA 5SYNA 1UBMS 3B52X 2WJ3A 2R85A 3CIOA 1OSNA 1E2QA 5JCOA 2MINB 3FYHA 2FZEA 1FZQA 5JSZA 1SQFA 1ZZEA 2YIDA 4KO1S 3RS0A 1YK1A 3BRCA 2WB4A 1MPXA 1YJCA 1YNSA 3AC0A 3GT7A 2FJPA 3FNHA 2C9OA 3HVIA 1KY4A 4D3XA 1B1CA 1XI2A 4F5WA 5HG0A 5K8TA 2C5HA 3GEDA 1Z7BA 2ZTSA 5L3SB 4B2IA 2GPSA 4C30A 3MEQA 4F21A 4WWHA 2XB2A 2F7SA 3J7TA 4ZC1A 1GG8A 4R1NA 2V55B 1A3CA 1ZN2A 2IIBA 5KOJA 2I3DA 4PE5B 2XUOA 1Y3IA 1GCOA 4UBLA 4QM6A 4BKPA 4QDUA 1WUHS 4I14A 5FWXB 4FVTA 4Y6RA 5JFOA 3K1ZA 4OI4A 1B6SA 3ABRB 2QL7A 3EVBA 1MOQA 2AFHA 4L72A 3E3AA 3GIWA 5DBFA 3R8CA 4Z9AA 1OT5A 1KQNA 4AWXA 4ALIA 3OOHA 1CYEA 2HF2A 1E1CA 3EPRA 2Y66A 2FLKA 3K0BA 2CL5A 3LBFA 3MGCA 3A27A 2Z4RA 4FWIB 4WTOA 2XHEA 4JZKA 1LRLA 1G20A 4J0IA 1F9AA 2Z3ZA 1NSYA 1M9NA 1IWPB 4RD1A 1S1MA 5DU2A 2O7VA 1E5LA 3KSMA 3L5OA 4JQSA 1QQAA 3HP7A 1E5TA 1VJGA 2TS1A 4PRYA 1JDZA 1U5BA 4R2KA 4GC9A 3SIPA 1U94A 4L73A 5AUNB 1KAQA 1OU0A 3NHJA 2A0KA 1TECE 3FPAA 1ETHA 3LYUA 4O29A 5CA0A 1D2NA 4MQFB 1VJCA 1UANA 2B0JA 2BY4A 5JCJD 4DPKA 4Q93A 3ZKWA 1T4BA 2X77A 1BG6A 2ZYWX 3BCHA 1SG0A 3C3CA 4GXRA 2ZBRA 4B4OA 4A0FA 5B37A 3WMGA 1L5ZA 2V4MA 1U0OC 2CBGA 1N7GA 2E4VA 2OBYA 4B3XA 2OM2A 4OI1A 3MTJA 1I32A 1S8FA 4JJFA 1VXRA 4KQ9A 2ZRNA 1Q0ZA 2H2FA 3K53A 4LYHA 4G1BA 5FAXA 3OY7A 1YQQA 4Z0PA 5LMUB 1NR1A 5JCPA 4XGIA 3UK7A 2VRBA 3ICVA 3V46A 4UTPA 4YXFA 1HOTA 4JIGA 3KWJA 1J06A 1YIAA 1Y9EA 1TEVA 3QTBA 2B37A 4HWTA 3TZLA 1TM4E 5M3BA 4AC9A 4TYMA 1UIMA 3IT1A 3SZ3A 2QN1A 4DNQA 5FLXA 1V95A 1JLMA 2A1UA 5SV2A 4AX4A 5ALXA 2B6NA 1PW5A 5I7AA 5BN4A 3HYSA 1QVWA 5DRYA 2AL7A 3I2GA 3B6KA 3K0AA 2PE5A 2FX3A 4TT8A 3ZU2A 1NTOA 1Z0FA 1P74A 2B99A 4RVHA 2I33A 4PAGA 3C6KA 4CMIA 4RE5A 3N53A 1ZH8A 3UXHA 5KNBA 3DEHA 5AOBA 4UU1A 5FYDA 3DLIA 1JJFA 1YRBA 5HIAA 5HIKA 1WRBA 1DFHA 2YCLA 3A9VA 3E3LA 4GI2A 4ZODA 1SUCA 5C8VA 4OA5A 3U19A 3ZK7A 4XIJA 5T8KA 1SIWA 2Y2UA 3VDQA 5ESXA 1M2NA 2WTBA 1MV8A 4UNIA 3H5NA 2DHCA 3K0FA 1ZIOA 1YH3A 1V2HE 2PPVA 1T5SA 2BOVA 3PD1A 2L2QA 5F3DA 1RABA 4HLDA 2H2GA 4KDCA 5AVJA 4J3NA 4ARSA 4ZFNA 2ZXEA 1JT2A 2PZMA 4GFDA 3FVTA 1THGA 4RGYA 4OJTA 4R6XA 1FTWA 4CIVA 3MFYA 2I3ZA 1K97A 5FUQA 2XW6A 3GBVA 4KCGA 4YMWA 4IXNA 5E7QA 5LFAA 5IFKA 1JB1A 2ZI5A 4NK5A 2P9CA 3EWIA 1JDSA 4HGNA 4UAJA 4M9UA 1FXWF 5B5SA 4MAFA 3EW9A 5DHQA 4DHEA 1KMQA 3DWEX 1RYFA 3VDMA 4YFVA 1XPRA 3EODA 4R41A 5LVAA 1A0OA 2VVTA 3UWPA 2QJFA 2TSYB 1QG0A 3FLBA 2SCUA 3NHBA 2VBFA 1GTG1 3UCXA 4PIMA 1JLKA 3L4SO 3GLRA 3SDBA 2QX4A 3CLRD 3IBSA 4KI7A 4KL8S 5B1IA 1EK5A 4PNHA 2IGTA 4MVJP 3PUJA 1TTHA 3DKRA 3HJUA 4R8LA 1OX4A 1XRQA 3AUXA 4WBNF 1BA3A 2OC9A 3U3OA 2WVGA 4U4AA 5K45A 3N2YA 4CLRA 5ADWA 3QVMA 1IY1A 3SGLA 5BURA 3GQBA 1E3DA 1LF5A 4FQ5A 4UJ3A 2B2CA 2VSOA 3KKPA 2OHOA 5ERGB 1ZQ9A 1O9GA 2HB6A 2VJLA 1Y7IA 2GBPA 2OLKA 4CGZA 3B36A 2ZUTA 1BU8A 1A4UA 2WLTA 3BFPA 1JR3D 4MIYA 1G60A 1GGHA 2MSNA 1XN1A 2Q4DA 3AQIA 2VAVA 3OHMA 4Q4JB 3W8FA 3DVAA 5SZHB 3MERA 3I6BA 4MUAA 4QAJA 5IJZA 2R6DA 2PRJA 3K5IA 1SC3A 2LZ0A 2PG3A 3FG9A 3Q9UA 4PYNA 4HAUA 2F8LA 2HX1A 4BO0A 4Q4HA 1RJ9B 5LQJA 1PE0A 3CYFA 1ZOPA 2Q1XA 3RSLA 3BWMA 4EB3A 1TGYA 1QUEA 2BEVA 1IG0A 2QPLA 3PFBA 4I9UA 4PLPA 1EG2A 1R0SA 3LDUA 3AOGA 4BB0A 3A10A 4ZEOA 4RM3A 1XAGA 2I1WA 4QYTA 1PR6A 2VJQA 4RMNA 1FU8A 3F46A 3NWJA 2C3OA 3JWHA 1DBSA 1RIFA 1YQWA 4TMWA 5FUYA 4AP6A 1ELOA 4O4IA 4EBFA 3IHLA 2I4IA 4YRNA 3T9AA 1ZD5A 1TAGA 3U62A 1CUWA 2QYOA 5LP1A 4OI0A 1RYNA 2RH9B 2WHYA 1I5EA 1KDOA 3SC2A 2D7DA 4CKCB 3HDQA 4NBVA 4UARA 1W59A 4ZYTA 1WXDA 4I4CA 4N3GA 1AM4D 3AM4A 5BYKA 4CEHB 4OAPA 2FW6A 1RQGA 1E63A 2CXTA 1DHRA 4EJSA 1H23A 5LNK6 2O59A 4QXOA 4BMVA 3R9XB 2HCTA 1PJ3A 2WJJA 2HA3A 3ZY2A 1SUAA 1F0NA 1QO7A 4LTDA 5FBKA 5ICCA 3ZD8A 2AOUA 3MCTA 1NLFA 4FX5A 5T3YA 1O57A 4ILEA 4HS4A 1Z82A 2DBRA 3VPXA 4U7FA 3DYVA 1FNMA 1KY5A 2RGBA 3NH9A 5BRNA 1Y1SA 1PUIA 3SPXA 2ZK7A 4L8LA 3GU3A 4KB5A 3T3DA 1LDEA 2H08A 2XGMA 5LOVB 5DYIA 4TV8B 1BVHA 1Z22A 3IXLA 3KCNA 1N92A 3QUCA 2SKCA 4AW9A 3OG9A 4LDAA 4JGBA 3KZCA 4PLHA 3HL4A 1RHMA 4EABA 4JI2B 4ZMSA 3GF4A 3ASUA 1PG5A 1BN7A 2WKPA 3MSXA 3P9KA 4JYZA 1WSWA 3GQBB 4WK4B 2FPRA 5C8YF 2E82A 1K66A 2HKIA 3TI9A 2YZGA 4BNLA 2E3JA 3BDVA 1A9TA 3CBQA 4URHA 3U2QA 3OY2A 4HL6A 4MR8B 2WJYA 5I9MA 2W2KB 4UMVA 5AKEA 5CYPA 2A0YA 2FFBA 2ODTX 2W6ID 2UZ3A 4RGBA 4CEIB 2HSDA 4L7QA 2C3PA 3D0QA 2I6UA 3GDHA 1HE3A 1UJ6A 4B76A 4LFBB 5AM0A 2ZCJA 1QTRA 3H2ZA 2QM3A 2YRWA 4FNOA 4G1VA 3C3EA 2W00A 5J2TB 2VDNB 4G0YA 1UJBA 4M9CA 4PICA 4BKQA 5DBGA 1V3UA 5H1YA 2GCIA 2GEJA 3NHUA 4HR7A 2RH4A 2YJTD 4JEMA 1YUBA 4O2BF 1L5MA 2JKVA 4HN2A 2R6JA 1JDVA 1IDN1 2BR5A 3G3EA 3EJWA 1Y6RA 5DCWA 4CMJA 3U40A 3L05A 4MI1A 3WS7A 3IEVA 1J7KA 2W7TA 1Z8HA 1EBBA 3A1EA 5CYOA 4AULA 3W5AA 1MHTA 1N9GB 2A57A 1ACMA 4FIZA 3D8UA 4MS3A 4BMPB 4RTRA 3LLVA 3KTDA 3WV5A 3PUIA 4WERA 3TW8B 2WIAA 3ZWAA 4NWIA 2HR1A 4M0PA 3ZHOA 4FS8A 4LRSB 2XNCA 3ZDXB 2GJ8A 1PYDA 3LG2A 3PFKA 1SCNE 2QAIA 1ANKA 2YH2A 2Y67A 3PC2A 4UHBA 2EWMA 2CVQA 3URMA 3FPBA 1X2EA 2CB0A 2WK1A 4RK0A 3HCPA 4E5UA 3IPAA 4PR3A 1JECA 3IALA 3RTEA 4YV2A 5HPYB 1UXGA 4QUIA 4B81A 3X2EA 5K01A 1TFUA 4E5MA 1RCUA 2J1LA 3F9CA 4IXTA 4QBKA 1DRVA 1MJ5A 4R3NA 3GDGA 4UM5A 2C42A 1LQTA 4YCAA 4P93A 1L1FA 5EKDA 1DCMA 3UJ8A 3EEQA 3VMMA 4K6CA 5B57C 1E2PA 1WXHA 1F4PA 3O8QA 1IZ9A 2GAAA 3DL7A 2X6TA 4DMKA 5HYVA 1UL1X 3GBSA 3OX3A 3V00A 1D3AA 1SKUA 1HQKA 1WWKA 5DN6A 1BDBA 4GZLA 5B12A 1W5EA 3VPAA 4EHKA 1UC5B 2XOXA 2GZRA 1XEWY 2DJIA 4GM0A 3I61A 4JI0B 4J94A 2X2OA 3REOA 3BDIA 3QXCA 1G2IA 3W1WA 4IL5A 1B3BA 1MOPA 3V5NA 2WAXA 4XQEA 1A98A 4UDYX 2B36A 2X2FA 1P7PA 4IDEA 2ACEA 4KFSA 1WS6A 1O58A 4O59O 1BWRA 4GOXA 3SBXA 5A7GA 3SFZA 2J3IA 4B3JA 3IIMA 5D3MB 4MGYR 1PN3A 3RS7A 4AO7A 1EM8B 5A1JA 3H2YA 1AHHA 1VHTA 2ZP1A 1KL7A 2IHTA 1NUSA 1BMFD 3EIXA 3SFVA 1A76A 2GAFA 3LZCA 4D8TA 2ZJBA 1JDNA 2JFQA 4IO1A 3I09A 4OMDA 5A03A 4UNRA 1R64A 3MLEA 4HDOB 3T3IA 2C5SA 4PLVA 4Y6LA 2JFWA 4NPAA 2EW8A 5AUPB 1D4ZA 4WA8A 3VYRB 3I32A 2YNMD 4C08A 4DADA 3DPUA 2PV0A 2D8AA 3CEAA 1RYZA 3E3MA 1PSDA 5P8WA 3UV7A 1YKFA 1FX0B 1UOEA 2Z6UA 4Y6GB 5E4JA 1SZDA 5H82A 1EFRA 1E6WA 4R83A 4PGAA 1ZK2A 3QOFA 3WZ2A 3KBBA 2BSQA 4CG1A 4AZ0A 4TL8A 3DBRA 2I2BA 3P94A 4MZDA 4Q1EA 4XOUA 3U3DA 4C1BA 4QYSA 4DLKA 2IUFA 3IPCA 4BYGA 2M2IA 2H6EA 1U5BB 1VE6A 4IZHA 3O8OB 4FFRA 3GLQA 2O1WA 5EQDA 1J1ZA 1URPA 1P6QA 3C1AA 1V7CA 4ZO8A 5LB2A 1G0OA 2QF7A 3QFTA 3QG1A 1HBJA 2F3PA 3FIJA 1ATIA 3CUWA 1V4NA 4RKEA 2FZVA 3RKUA 2FRDC 1TO2E 5CU7A 3HBLA 1FU4A 1NDQA 2RC5A 2I76A 1D1QA 5AP9A 4C4YA 2YHIA 5KMGB 1KEEA 3ANYB 3PQDA 4PSVA 4DABA 1V16B 4IIHA 5KTOA 2IOYA 1U8UA 4N3NA 5LD2C 2IYYA 3N2EA 3EEOA 1L7OA 2Q5HA 2O4CA 5DWQA 2PDAA 1E96A 2PQ2A 2XKBA 2VZ8A 2JI6A 3REQA 2CDAA 4BIMA 2I2XB 3EUFA 5AI0A 2Q5FA 4XVCA 2WWWA 8LDHA 4YRFA 1FP4A 1YZTA 1M73E 2X8JB 3M3DA 6Q21A 4KZKA 3K70B 1JHQA 2WMYA 4CT4B 1U2QA 5FOWA 5LU8A 1CU1A 1R10A 3IIIA 1B73A 1Q1NA 1A4XA 4HTFA 4YAGA 1AG9A 1AV7A 1GUDA 4Q4AB 3TQTA 4C7VA 1J0AA 1E4YA 5FBRB 2O2GA 5C53B 3WLIA 4HZGA 1FDRA 2LRHA 2Q2QA 5JFTA 2J9FB 1AMNA 2ODEA 3ZJVA 3M2TA 3B6EA 1HMPA 1IPHA 2QS9A 3HE3A 4KODA 3D1JA 4MS4B 2DQZA 3T4PA 4AK9A 5EPOA 3DXZA 1RMTA 3L6OO 4BMXA 1BNCA 1T8YA 4NULA 2QUJA 2PO7A 3TLXA 1G8PA 5LA6F 4G37A 3VZQA 5HKKD 1P9LA 1YS2X 1Z8NA 2V7PA 3NASA 4TS4A 5B1HA 4C7MA 1IOVA 1FDSA 1QU2A 4D25A 1GTMA 2HJVA 2V0GA 2FNAA 3BWBA 3IJPA 5HUHA 3T3HA 1MAUA 1ULUA 1YR9A 3C6ZA 2RAPA 4JJAA 4ZARA 2R5NA 1YU6A 1XTPA 3OE4A 4NMMA 2O07A 4JHLA 4LF7B 1SVNA 5EINA 1KYWA 4MR9B 3BT7A 1W1IA 2DY1A 2ONCA 3NTLA 5E1BA 1J7JA 5HZHA 3ONVA 3RARA 2G9QA 1CRQA 2B8JA 4L95C 3CU5A 3V42A 3WKAA 4M0KA 5IVKA 4TS9A 1C7RA 1WQ3A 3GWGA 1P0IA 1ZRMA 3MF4A 1MDBA 4XSGA 3ZD7A 1WV1A 3GN2A 2OZEA 1SXGA 1G7SA 3R74A 4JQCA 3LZDA 2IW3A 2GD1O 5E6RB 5E6UA 1SM4A 1CF2O 4FMCF 3RFVA 2W42A 1O2DA 3AHDA 4F3KA 4BLPA 4BO5A 1GNTA 2VQDA 1RI2A 4GLJA 3EQ8A 3M1IA 2FHSA 4M9ZA 3P4YA 3NDBB 4PPNA 3RUPA 4FKMA 5CPBA 4X44A 3FYSA 4R1MA 4MW6A 5LP6B 4IHJB 3BZUA 2AF4C 2X2PA 1E8MA 3OOSA 1Q2XA 4H3SA 4WJZA 2Y27A 3RYCB 5ITSA 3UN1A 3I9V6 5IEBA 2YZNA 1L1EA 3MJEA 5I7RA 1SQ5A 4HQKA 1ZH2A 3ND5A 1V5EA 3ZY4A 2C3UA 1HSZA 4TXLA 4PLCA 3LQKA 5KOJB 3PEVA 3OEHD 1B8VA 3RLIA 3BXEA 4G5FA 1Q7TA 2A5YB 2D1RA 3BJIC 3CS3A 1WV0A 3FNRA 4FMBB 4TRRA 4Y7DA 5CG1A 5DB4A 2ZRCA 3EFEA 1GNLA 4OGWA 3QBTA 2IPNA 2PMDA 5BN3B 1Q1AA 1IIRA 1O97D 1E98A 1WPXA 1IAQA 2RBKA 4GICA 4HDAA 3L6RA 4TROA 1NXTA 4UE6A 5EZ5A 4B0OA 4DF3A 4DMRA 3W8NA 1L5KA 1TT5B 2RHLA 3LGSA 3UJHA 4DEVA 4GI3A 1QWSA 4JGGA 5EA2A 1IEWA 3O4HA 2A5FA 1L5LA 4NFHA 4BFXA 5K0ZA 3CVUA 5DHRA 3H2IA 1S9HA 4XX0A 5CUQA 1Z83A 2EBWA 3LM8A 4JT4A 4DV0B 3GJSA 3NPAA 3X1KA 3FOEC 2GFIA 3BC1A 3ED1A 4Q7QA 4Y6SA 3AGQA 4B82A 2FMFA 1I80A 3KDPA 5BSEA 1NRIA 3B7WA 1VRVA 3RBAA 1T6YA 3QBDA 2B69A 1KK3A 4H1WA 2YOGA 2E0IA 1XCPA 1K75A 1G55A 4I9HA 3BIXA 4DS3A 2IHNA 1IMOA 1JIXA 1R0CA 3O21A 1B14A 1DIGA 1T9ZA 3VHRA 4F4DA 1C1XB 5HIJA 1MQ9A 3FNBA 3QXJA