5BT9A

Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
249
Chain Sequence
b'EARMVANCPVLVTGGARRIGKAIVEDLASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLEGDVRGLVKQASDRIGPIRLLVNNASLFQEDKVGALDMALWDRHFAVHLKTPVILAEDMRKALPEDQDGLVVNIIDQRVWKLNPQFFSYTLSKTALWNATRTLAQALAPRIRVNAIAPGPTLPSERQRPEDFERQVSKLPLQRAPELPEFGRTVRYFWENRSITGQMIALDGGQHLAWETPDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
molecule tags Oxidoreductase
source organism Brucella canis (strain atcc 23365 / nctc 10854)
publication title Crystal Structure of FolM Alternative dihydrofolate reductase 1 from Brucella canis complexed with NADP
rcsb
total genus 92
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bt9A00
4II2A 3ONEA 4EUHA 3GPIA 1HXHA 3INRA 3O8QA 4F6LA 4AG3A 1T2CA 4RORA 4NFHA 4CM8A 1ZKMA 3WB9A 4NU6A 5FFFA 4R1SA 5ER9A 5COAA 5JAMA 4CMKA 1B16A 1FMCA 5BNFA 4LGVA 1E3SA 1EUCA 1HSOA 4IZHA 1P77A 1BRMA 4RDIA 3TOXA 5B12A 4MP8A 1T24A 2BFPA 4ZA2A 4BO5A 3K92A 3E48A 3BHIA 4R1NA 4MOWA 3GN1A 2VT2A 3W4KA 4CMAA 3OIGA 3QVWA 3QE3A 3IL2A 2GR9A 5BNTA 4NJOA 1SB8A 2VUSA 2PNFA 2DBRA 2VQ3A 4WCFC 4BGVA 3R6DA 3LC1O 3WYCA 5TQVA 3RUEA 5CDYA 1LX6A 2GN4A 5C7IO 4RVHA 3DZFA 3H6KA 1P31A 4IUYA 3H9GA 1PR3A 2NU6A 2HDHA 3QV1A 4G81A 1U7HA 3UXYA 3HQ4O 3D3WA 1H94A 4YJFB 4OL9A 3ZWMA 4ND2A 4AVYA 4HX5A 3I9JA 2JCYA 4K1LA 3HJAA 3QVXA 1E1KA 1C1DB 3IOYA 3TQHA 1HDYA 2QZ9A 3WOHA 3D5QA 4CM6A 1H2HA 5I9MA 1PJ2A 3MJSA 2B5VA 4EBFA 1EQUA 2OO5A 4JIGA 1GDHA 2EG9A 3DBVO 4RVSA 3G1UA 4FJ2A 4WLVA 1VI2A 2JFFA 4FGSA 3RC9A 3IJPA 4W9NC 5FI3A 4LSMA 4J91A 1BVUA 2ZJ1A 1QV7A 1D3AA 2EP7A 4JBIA 3EUWA 4RDHA 1C0PA 4NH4A 4EW6A 4XKJA 2ZATA 4CJXA 4KDFA 3H4VA 1A71A 2B35A 3WIEA 3V5NA 1I3LA 3C7CB 4AJEA 5A1TA 4N5NA 3B1KA 4WEQA 3D1LA 3DHNA 4P38A 3U0BA 4D0RA 4RPLA 4Q39A 2GGSA 1YQXA 4Y6SA 5L45A 1YQGA 5IDQA 4D46A 1LLQA 3OETA 3GFGA 1P1IA 4OKNA 3VZPA 4KUGA 1E7QA 1D7OA 2JAHA 3DHYA 3JQCA 1Y9AA 4JP3A 1B8UA 1R0SA 2DFDA 3F1KA 4PGFA 4OGWA 1NNUA 4XYLA 4WASA 1VJ0A 1VL8A 2EKLA 3FRJA 4IGEA 5A05A 2OMEA 4BO9A 2C82A 3TZHA 2BFAA 5TF4A 1ISHA 4E13A 1LSOA 1Y9EA 2FZWA 2FPIA 3TZKA 4OXYA 3OECA 1ONPA 3ADOA 3Q9UA 5ENDA 3AFNA 3JD2A 1N1GA 2E48A 4I08A 3Q1LA 2WD7A 3AM3A 4PG4A 1NFQA 3ROPA 4YVFA 1F8FA 5FF9A 3PQEA 5L4SA 4BNJA 1WWKA 1HRDA 4FJ0A 4PLTA 2Y1EA 4ZRNA 1A9YA 3N58A 3COSA 3V1TC 4YDRA 3SBOA 4CMCA 2CVOA 2PLAA 4FN4A 3HDQA 2EIHA 4U5QA 5KWEA 1ZMTA 2VCYA 3F46A 3RC1A 1H93A 3JD4A 4YQZA 4CM4A 1R4MA 4B7XA 3QVOA 5I7EA 1ISGA 1DHTA 3ANNA 4E31A 2ZQYA 3WGTA 1AHHA 4Q3CA 3W8EA 1M2WA 4YT2A 4CLDA 4BNKA 3W6ZA 7MDHA 4YCAA 5B4VA 5CG2A 4DBVO 2PTGA 4MKZA 1LLDA 1PZHA 3PJEA 3UCEA 2IODA 1T1SA 2VWGA 1SOWA 1F06A 1GR0A 2GRAA 4WNIA 4JBHA 3WMWA 1LDBA 1N5DA 3ZH2A 4E5PA 2TMDA 2GNAA 4B4WA 4YXFA 3S55A 4L9RA 4RCVA 4XCVA 2BHLA 4XQ9A 3NX4A 2WD8A 4EEXA 4UVDA 2X6TA 4KTTE 1XGKA 4JCOA 5A9SA 1CF2O 3VZRA 2CDAA 4J4TA 4NBTA 4ID9A 4RPJA 5KVCA 3KYBA 2NU9A 4LSWA 4TWRA 1I3MA 4DTIA 4QSMA 4AICA 2GD1O 2HU2A 3UGKA 2OZPA 3RU9A 2VZ9A 1VM6A 1HDCA 4DQUA 3U3XA 4E5KA 3A14A 3MCVA 4RVFA 2Y0DA 3DBRA 4HFJA 4LISA 1R16A 1DIGA 4J4BA 3H9QA 3C85A 4A7PA 1LI4A 2O50A 2CMDA 2AQ8A 4KWHA 1A4UA 3KSDO 4J0EA 1K6IA 4MVJH 2EKPA 3MTGA 5F5LA 1RKXA 1O0SA 5A9RA 4B4VA 3F9IA 4FBGA 1CERA 1J5PA 4WJZA 5JFOA 2HMTA 2OFPA 4KQXA 4TRRA 3KYDB 5DP1A 1FK8A 4TQGA 1T4BA 4IY1A 5DN9A 3VC7A 1NR1A 3ZU3A 3LT2A 2HRZA 2QX7A 4RLSA 3KEQA 1Y8RA 3O8QB 3DMTC 1PTJA 4FC6A 1IY8A 1ZCJA 3RAJA 4FB5A 4J49A 3M1AA 4CR7A 3ICCA 3KRTA 3I83A 1J6UA 3IMFA 4R16A 1BMDA 1QV6A 1ZUD1 4I5EA 2R00A 1BWSA 2AE1A 4HV4A 1GZ4A 1B0AA 1V9LA 3ZDFA 4E30A 1YB1A 3SVTA 1CYDA 3PJDA 3VPHA 5AXCA 4PLGA 1V0JA 4YJGB 3KB6A 4PG5A 1YS4A 1VKOA 2GLXA 4F6CA 4Z6KA 2GPTA 2QYTA 4A0SA 4BGIA 3OH8A 4TZKA 5G4KA 2OBYA 3NTRA 5BSGA 3TL2A 3WGYA 4J1QA 1WDLA 1IE3A 3GPDG 4BS9A 2BF7A 1I5RA 3H3JA 3HWRA 4XYEA 1ZSYA 4PN3A 4IS3A 3HB5X 3HDYA 4YT5A 2FP4A 4EZBA 5EJ2A 3JQAA 1O94A 1R66A 1M75A 3BIOA 3ETGA 1P33A 1EUZA 2P91A 1FDSA 4FGWA 4C7JA 1KC1A 2R00C 5JYDA 5F3RA 1XKQA 1HZJA 2Q4BA 4YJDA 1W73A 3H65A 5TJ9A 2AEFA 4J16A 4XZ3A 2X0JA 4U0KA 1GTMA 2Y1OA 3GNQA 2ZCUA 3IJRA 2EGGA 3KLMX 1BGVA 3WJAA 2Y66A 4G65A 3ZHBA 4BNVA 4E5YA 1QORA 4BB6A 5F21A 2I5PO 3ASVA 4A2CA 4Z0HO 4DC1A 1MC5A 4QFCA 3LQFA 3E9NA 1D1TA 5L3ZA 1VC2A 3ZWAA 2DT5A 4XYGA 1ZEJA 4OOFA 5ES3A 2FY8A 2W2KA 3ONFA 4ZVVA 3QRWA 4PLFA 1HETA 1X15A 5U1PA 2HO5A 4YRBA 1ZEMA 3D4NA 3PYLA 4CMHA 3UCXA 2EP5A 3AI1A 3JD3A 1Z74A 1ZSNA 4CUJA 6LDHA 4RF5A 1BHSA 4BKQA 2NTJA 5LDGA 2VWPA 1ENOA 2Q49A 3WWZA 1Y8QA 4IDAA 4IQ8A 1NWHA 3KHUA 4FIZA 1DDOA 4RV9A 1DRWA 1SPXA 3GGGA 3VOSA 4K28A 1OI7A 1ZK3A 1ZK2A 2A94A 3OP4A 5KJ1A 1LC0A 1ZJZA 4BVAA 3U5TA 1RM4A 5GZ6A 4NBRA 2W98A 4B8WA 2C2XA 1XQ1A 5CDTA 1I33A 1HYHA 3L4BC 3MEQA 1TT5B 3WGIA 3HHPA 4BNHA 4DC0A 2J3KA 2IXBA 4ALNA 4AJHA 4WLUA 1GYRA 1LTHR 4N5LA 3EZYA 2PD6A 5CP8A 1CQIA 1LDGA 4XQEA 5MDHA 3U9LA 1U5CA 2C59A 3W4IA 3DAFA 2GN9A 3Q6IA 5H81A 4MIEA 1JLLA 3BMCB 3EZLA 1YL6A 3STHA 4D0SA 3GRPA 2C0CA 3L4BA 5AXAA 1PJ3A 2BLLA 2PKQO 3AI2A 3GDGA 3RBXA 3RD5A 1PIWA 4ZRMA 3RJ9A 2WTBA 3AM5A 1UR5A 3AFMA 4A26A 3CSDA 1HF3A 1F8GA 3SJUA 4YB8A 5IF3A 5T67A 4GI2A 4YACA 2HRBA 2ILTA 4CLOA 2P5UA 1V3UA 3SJ7A 2IRWA 3JYLA 2BMAA 2C20A 3UKOA 2CUKA 3PJGA 5F1OA 1KS9A 4O63O 4DRYA 2BELA 1RJWA 3ORFA 1QLHA 5B37A 1B3RA 1SEPA 5IDXA 3OJOA 3D0OA 4ZGWA 1PGOA 4E0BA 1BVRA 1DJNA 2E4AA 1ZH8A 4D43A 1R0KA 4BB5A 4JX8A 3ZWYA 3RKUA 1UP6A 2YQ4A 3IKVA 3RUAA 1GV0A 5AYVA 3AOEA 2Y0CA 3WBFA 4DA9A 4PFJA 3I9NA 4L4RA 4AJKA 5TGDA 3I3OA 1I10A 3WICA 4GQAA 4BO1A 1YBAA 2D59A 4CMJA 1E3IA 2F00A 1X1TA 3DTTA 3MJ4A 3W8DA 1DC5A 2EWMA 1U2GA 4CV1A 4M87A 3ITDA 1U4OA 1M76A 4D45A 1CQJA 3U09A 1J4AA 4YAIA 2HSDA 1EBUA 1GCUA 3AUUA 4EUFA 4DWVA 4O1MA 1Z6ZA 3WSVA 4CUZA 3IUPA 1NP3A 3ZNNA 3ZCXA 4IXTA 4W7IA 3BMNB 3LK7A 3EAGA 3IIEA 4OJNA 4BV9A 4U6SA 1B2LA 2B4TO 3K31A 3Q2IA 2DC1A 4R9SA 1JKIA 4DLAA 2I3GA 3RSHA 2ZYDA 3D5TA 5CPBA 5T57A 1W8DA 3FTPA 4YYZA 3INTA 5JAIA 2H63A 4B7UA 5DULA 3WYEA 4FDAA 1E77A 1PJBA 1Y8RB 2YHIB 2AA3A 4FD3A 4CUKA 3MJTA 2HKIA 4K26A 4IDEA 4RPGA 3BTSA 1NPYA 4ND3A 1VSUA 2JD1A 3NGXA 2JD2A 1KBZA 4CODB 3QHAA 2DTXA 2UAGA 2GYYA 3C7AA 4ZICA 1PGQA 3S8MA 4LW8A 4J2HA 4YAJA 2VHYA 4XGKA 2VRBA 1LDEA 3D64A 3HADA 2B4RO 4AJIA 5JDCC 3ROKA 3I1JA 4GBJA 3DB2A 1R12A 1DAPA 4JP2A 1HDRA 4MVJI 1AXEA 2EHDA 4W9NA 4J6FA 4NHEA 2UUPA 1MX3A 2Y67A 3B20A 1TVEA 1R6DA 2PFGA 3LYLA 1G0OA 3EY4A 1KERA 1MB4A 5DCUA 3WFJA 4CR6A 5L4NA 2GN8A 4ESOA 1NM5A 3ENNA 5I8ZA 1KEUA 1E1NA 4GX1A 3VZSA 1UXKA 1ZVMA 3K5PA 3O4RA 3WBBA 1YQDA 3VKVA 2PV7A 1I0ZA 2GZ3A 3HN7A 3JQ9A 3PHHA 1ZK1A 5TS3A 2X9NA 4H7PA 4OKIA 4RF3A 3ZWVA 3UFXA 3JQ9C 2P68A 3PHLA 4BO7A 4CM3A 4JGBA 1EVZA 1T1RA 2ZKLA 1NAIA 2WE8A 3WTCA 4RJTA 1I36A 3DZKA 5KIAA 4UVGA 3HSKA 1U7TA 2FR0A 1K3TA 1QKIA 3C1TA 3NRCA 3JCZA 4OIMA 3K8ZA 1H6AA 3UH1A 3RVDA 2BGLA 2O3QA 1YBVA 1I3KA 3IQDB 5C7OO 1N7GA 3JD0A 1IZ9A 4JNKA 4NNJA 3AU9A 2ZTMA 5JDCA 2ET6A 4IDCA 3WFIA 4ALMA 1GPDG 4HFRA 4DPMA 3RWBA 1I30A 3SLGA 2IXAA 2NSDA 3DWFA 3E82A 3GG2A 4TVOA 3LLSA 3PDUA 1H9BA 1CETA 1ZJYA 1A72A 3ANLA 1BXGB 3IKTA 5IN4A 1QRRA 1BW9B 4J4HA 3I4FA 4J1SA 4YRAA 1SMKA 1BSVA 1I01A 3B1JA 3CPSA 3ZWWA 3ZGYA 2B5WA 1HT0A 1DPGA 4WEOA 2Q2WA 4ALKA 1R4MB 5DF1A 3LVFO 5CEJA 1TI7A 2IYOA 4YJHA 1PWXA 3JQAB 4R01A 1V6AA 4CMEC 2CF5A 1PEDA 2XAAA 3KO8A 1EDOA 3VHRA 3MZ0A 4GLOA 2AE2A 4DLLA 1Z73A 2UVDA 1CWUA 1XEAA 4L74A 3S2EA 4RZHA 1PL7A 2IZZA 1S6YA 4KUEA 3SXPA 2P5YA 1LNQA 1TEHA 4PRLA 1HDXA 4ROSA 4EYEA 2ZTUA 2JAPA 4BQPA 3K9QO 1ZO8A 5C7LO 2O3UA 2V7PA 4JLWA 3F4LA 1X1EA 3FN4A 1SBYA 3JQFA 2WWRA 2FPPA 1LQUA 2C2YA 2GO1A 1H2BA 4PRKA 3WGOA 2G0TA 4R41A 5J23A 4MVJA 4NFYA 4XWYA 3D3EA 4RPHA 3JQ7B 4NMHA 3ZU5A 1H6BA 3U4HA 4OSOA 1NFRA 3E1KA 2Y1CA 1UXIA 4PLHA 2OUIA 4Z0TA 4XGIA 1PS9A 1PJQA 2P4QA 3PWZA 4B7CA 7ADHA 1HZZA 3PFWO 2OL4A 4NFSA 3CMMA 3NT4A 5I9LA 4H3VA 4XB1A 3DZGA 4E5MA 4R51A 1GADO 1E0DA 3A4VA 3VPXA 3OQBA 1HLDA 4J7UA 2O4UX 2O3SA 1LLCA 3HUDA 3KYCB 3JYQA 1C0IA 1U9JA 3W1VA 4YRDA 3WYBA 3F5SA 3PP8A 4QO7A 2VYVA 3TPCA 3KETA 4H16A 3VH1A 4UUMA 3NDJA 1D8AA 4J90A 5JE8A 5JMWA 5F1PA 5HM8A 1E1LA 4P8RA 4AJPA 3QSGA 4GMGA 3RQSA 3GDFA 4E21A 2HJSA 1NBOA 4Q9NA 4LMRA 2A35A 1IUKA 2VNSA 2NTVA 3RUHA 4MIOA 4DQXA 5C5IA 2P2SA 3P19A 4ALIA 1Q1NA 2I67A 3NDIA 4Y98A 5U9CA 3JYNA 4PG6A 2EJVA 4D42A 4GAEA 5DCYA 1DFGA 2FN7A 1IPEA 2C54A 3PHJA 1A27A 1MGOA 2NVWA 4IS2A 4HY3A 1DC3A 2Q45A 2I65A 1IL0A 2FPGA 3H8VA 5GMOA 3AW9A 4Q3DA 3ITKA 4BNTA 1PQWA 1Q0HA 4RGBA 3JQ6A 4BNLA 2WYVA 4DUPA 4WUVA 4EDFA 3FWNA 3CH6A 2YV3A 4BO4A 1R15A 1BG6A 1JWBB 2O3TA 3E5RA 4BO8A 3KZVA 3I9LA 2X8LA 1WPQA 1WZEA 3O26A 4BGEA 3PDJA 1KYQA 5C37A 2EW2A 2ZJ0A 4LRSB 1MA0A 2X23A 1QYXA 1WZIA 1MG5A 3H5AA 4DIFA 1UP4A 3GMSA 4CLHA 1U3TA 3FNEA 3GY0A 2NLOA 4PLVA 2NACA 3WSWA 3W4JA 4HUJA 1Y81A 2X0RA 3ZWXA 5ICMA 1UZLA 2AG5A 3NKLA 2WMDA 1Q7BA 2DTDA 4JXKA 4M1QA 4AL4A 2R6JA 4J7CA 1VPDA 5KJCA 3P7MA 5EN4A 1GY8A 4IINA 5JXWA 4BNUA 2Z1NA 1ENZA 1E6EA 4JJIA 3WWYA 4M86A 1Q7CA 1LQTA 1ORRA 2C07A 5T5QA 2TMGA 1EEHA 5HRUA 3NTQA 4I8XA 1LEHA 1WDMA 4RF2A 5FEUA 4M55A 4B3JA 3KM0A 4NG5A 4IJUA 4WLOA 3DOJA 4D41A 3OEWA 4ALJA 3ZWBA 4IDFA 3WDSA 2OORA 4D3DA 2H6EA 1YGYA 3ST7A 1Y8QB 3ZN2A 1Z7BA 3OM9A 2PKRA 2WD7B 4DVJA 1YXMA 4TROA 3HB4X 5KJFA 5TSDA 3KBOA 1EVJA 4Z3KA 1VSVA 5ENVA 3SLKA 2X22A 1U3UA 3UN1A 3OJFA 3IP1A 1X7DA 1D1SA 2ZYGA 3GGOA 1B8VA 3HG7A 1ARZA 4R4JA 3BMOB 4XX0A 3UF0A 2J3HA 2HLPA 4BNXA 3M2TA 5A9TA 4J9VA 4KP7A 4Z9YA 5K6AA 4I9HA 1UAYA 4R3WA 1VL0A 3L77A 2OBNA 4HXYA 5DOZA 1XDWA 1E6WA 3E9QA 4QUKA 4TRJA 2YV1A 4OSPA 1PJ4A 2VZ0A 1WLYA 5DZSA 2EERA 1P0FA 2NV6A 2P9EA 1GEGA 3PK0A 4A27A 4YT4A 1XELA 1YJ8A 1G0NA 2HMWA 2PZJA 5KJEA 1DC6A 1LJ8A 1SC6A 4LVCA 3I9OA 5DDIP 5H82A 4FCCA 3MJCA 1DFIA 1FDVA 3DFUA 2OXIA 4E32A 2BFMA 3H9JA 4Z3DA 5LCXA 5EMHA 4WNCA 5A5EA 2I66A 4CM9A 3T7EA 1RWBA 3DR3A 3IUSA 1XWFA 5G4KB 5BT9A 2H1SA 1E5QA 1NHWA 3BTUA 1YWGO 3GA0A 1GUYA 3PPIA 4D79A 4E5NA 1DOHA 4PLYA 1VLLA 3HFGA 4ZN6A 4A73A 4K6FA 1UP7A 1EQ2A 2V6BA 4XJSA 2DBQA 3WMXA 2QRJA 3NJ4A 5BSHA 5I7FA 2CVZA 2JJYA 3RUFA 1TA4A 1UH5A 2OHXA 1FF9A 4LCJA 4YAEA 2AEJA 1UZMA 5I7SA 4RVGA 4BNMA 3Q3CA 5H83A 4IM7A 3JQ7A 3LC7O 4FFLA 3WQQA 3CXRA 1PJTA 4XJTA 4ZD6A 3ZI0A 1H6DA 1EFKA 1DFHA 3CINA 2YV2A 2QRLA 3FF4A 3CEAA 1EZ4A 1HE4A 4BHTA 3TFQA 4LVUA 2C7VA 2O4CA 4R1UA 1FDWA 1U8FO 2NNLD 2NM0A 4WE3A 5TNXA 4D3SA 3U4DA 1MUUA 1K5HA 4OO3A 2VN8A 2GERA 4M8SA 3ZNOA 2GZ1A 3VDQA 4H15A 3QWHA 1MXFA 5A9SB 2Y99A 3RKRA 5IAAA 4IZIA 3X2FA 1E7MA 4CLEA 1Z7EA 2X0IA 3OMLA 4OOEA 1ML3A 1L7EA 5FI5A 3VH3A 1DIRA 3ZW8A 3GVIA 4Q3EA 3PGJA 4B3HA 4IJWA 3TRIA 4CL3A 3H9EO 4HFNA 5G0UA 2XOXA 3RFXA 1WP4A 4CQMB 2CDBA 4NDNE 3LT0A 1GAEO 2X1HA 3K6JA 4XYMA 4XDZA 5G0SA 1EBFA 3WGHA 3ZWNA 5CPFA 4CM5A 4GX5A 2FSVA 3PLRA 3VTFA 3OEYA 4GX0A 2CDCA 3RASA 4I5DA 1MFPA 4UAGA 4ND1A 2ZB4A 3GMDA 3IAHA 5DBFA 3NDRA 2I3AA 3WGQA 4B4UA 4NU5A 1S7CA 3RBZA 2JHFA 3TL3A 4C7KA 3PWSA 3GRKA 3QVSA 5JC1A 3T7CA 1U3VA 2OP0A 4JK3A 1GD1O 2BGKA 2X5JO 5L4LA 3V2GA 2GUGA 2PZMA 3V8BA 3F3SA 1HYEA 3V2HA 3UCFA 2Q4EA 4NJMA 1OC4A 3PRJA 2YDYA 1E5LA 5JW6A 4F45A 2DFVA 3PZRA 2X0NA 2YQ5A 4NBWA 5IXYA 2QZZA 5FWNA 5HWSA 1XSEA 3ABIA 3GEDA 1SOVA 2FMUA 4GSLA 3PGXA 2ZIZA 2PY6A 1CDOA 2B36A 4CQMD 3MTJA 1AGNA 2VHWA 4LK3A 4O59O 3DZBA 1EDZA 5JDIC 1UXGA 1HSZA 3HDJA 4MVJG 1NVGA 2W2LA 4MVJF 3PVZA 4Y67A 2GSDA 4KOAA 1WXDA 4KDEA 4L75A 1SNYA 3QY9A 4CLRB 1DIBA 4NR0A 2DUUA 1Z45A 4DLBA 5TC4A 3LZ6A 2FOIA 3RROA 1E3WA 2IYPA 5IZCA 1B14A 1O6ZA 1JA9A 4YJGA 1ZSVA 2XXBA 3MWDB 2O7SA 2VWQA 3DZJA 5CAEA 4GGPA 1NQTA 4OYRA 5ADHA 1F12A 3DBLA 1DLJA 1IHYA 4QO8A 2OP1A 2RHRA 4KZPA 2FRDA 3TN7A 1T2FA 2BD0A 3GVXA 3H3FA 2C29D 2VRCD 1HDGO 4U0JA 2CFCA 1PJCA 2ZQZA 1PJSA 3BTOA 1NVMB 3E9MA 1UXJA 4KUHA 2E82A 5JC8A 4J43A 4PZCA 3HNPA 1ENYA 1GYQA 1A9ZA 4EITA 1ZXLA 2Y0EA 1JW9B 1Q7GA 1PZGA 4E12A 1P44A 5I9NA 1R4NB 2UYYA 4R69A 1B26A 2EW8A 3AUSA 4BKPA 3JQDA 5CDGA 1UZNA 3AWDA 3OJLA 2GZ2A 3WGZA 1SO8A 4WPGA 1WAMA 1NPDA 2D0IA 3DAPA 4FFOA 1C1DA 3WLEA 1SZJG 2NUAA 2WYWA 3JQAD 3DEYX 4K6CA 4WGGA 2BRUA 4MKRA 4XA8A 4C4OA 3ZWCA 3DAGA 3AU8A 3H5RA 5JDIA 1X0XA 4QX6A 1O5IA 4UVHA 1RYEA 5JSFA 2EV9A 2YZ7A 5U4QA 4DYVA 5EPOA 2YYYA 3AM4A 4WCFA 1YO6A 4ZQGA 1FDUA 5ER6A 4XGNA 4YWJA 2YW9A 1M6HA 3GFBA 3M6IA 2RHCA 4FPXA 3VKUA 5EESA 3K73O 3ETEA 2J3JA 3H5NA 3LDHA 4EJMA 3RUDA 2JCVA 3SX2A 4BO0A 3EK2A 3S1LA 2AXQA 5JMPA 5A3VA 1QMGA 1HE2A 3RC7A 4PG8A 2EGHA 1F14A 3UAGA 4EJ6A 2V6MA 3OBBA 3AOEC 4BMVA 3JSAA 1EE2A 5B4UA 4J9UE 4J2OA 3DBHB 3DTYA 2EEZA 1G1AA 2VHZA 4U7WA 1NQ5A 1V3VA 4R1TA 4I9UA 3IC5A 3JTMA 5HA5A 2YFHA 4KMSA 1RM3A 4FOOA 1AN9A 1UJMA 1VKNA 1QYVA 4LCEA 2ZB3A 3DMYA 1VJ1A 2X4GA 3JQ8B 1AE1A 1YOVA 3GT0A 1ZNQO 4YJHB 2EF1A 3INGA 4I5FA 4MVJM 4ZU3A 5A03A 5DP2A 2C5EA 3H2SA 4P4GA 3MJEA 1CIVA 2HUNA 3S2IA 5ITWA 1ULUA 4Z9XA 4HWKA 2QYSA 4IDGA 4HNGA 4WLFA 3VAZA 1ADGA 4YAGA 3NT2A 4TKLA 1J0XO 1BXGA 3EVNA 3KSUA 2RBEA 3LSYA 1YONA 1PL8A 4FSHA 4MKXA 3WLFA 4BIIA 2D8AA 2FHSA 3V1YA 1CJCA 3NAQA 1DLIA 4ZQBA 2AQKA 1NWCA 4TMFA 4BO6A 4IDDA 4B4OA 1OZAA 4CR8A 4W99A 1M67A 4CQMA 3HFSA 2VUTA 3ZU4A 5A04A 2WE7A 2NU7A 3A1NA 1WVGA 3OICA 1PQPA 1C0LA 1K0UA 1P1JA 4GPD1 1CEQA 3B6ZA 2YFQA 3Q0EA 4XR4A 4E33A 4DREA 4NI5A 1RM0A 4P22A 4TSKA 1ZBQA 5I8WA 5L7WA 4NQZA 5A02A 3JD1A 1H9AA 4WOJA 4UVEA 5JAZA 3HDHA 5KVVA 2P9CA 3ZWPA 3Q11A 3RUCA 1DXYA 4WLEA 3BMQA 4AJ4A 2J3IA 5TT1A 3R0IA 4NPCA 3FR7A 1U2DA 4QXMA 3LLVA 1AUPA 3GHYA 4TVBA 5KOIA 2W90A 1PZEA 1JU9A 1XIVA 1BW9A 3VH4A 3CZMA 4BO3A 5JY1A 3ON5A 2X7HA 4YEDA 1PGNA 1P9LA 2F1KA 3TFOA 1OBFO 1QYWA 3GOHA 1O8CA 3GK3A 3NTOA 1K89A 5JS6A 1QYDA 4RLHA 1P1KA 3F6YA 3U62A 4O5OA 1FXSA 5ITVA 1H6CA 4JBGA 4YTEA 3OA2A 1ISIA 3M2PA 1M6WA 2POQX 3LF1A 3UUWA 4BKOA 3C1AA 2W4QA 2JFHA 4M49A 3EW7A 1ISMA 1V8BA 1L7DA 4GH5A 1A4IA 3TZCA 2OOSA 1ZK0A 3N74A 4OHUA 1KEVA 4FW8A 3E18A 1I24A 1EUDA 1GL3A 1JDJA 1YKFA 1T4DA 2XXJA 1P45A 5G0WA 1IOLA 2D5CA 3BAZA 4CMIB 5JCJD 1GYPA 3EHEA 4U6QA 1U1IA 5LDHA 2LDBA 5K6AC 1RM5A 3A28A 5BQFA 1JAXA 1KY5A 4RQUA 3GF4A 3DOOA 1BXZA 4TRNA 1I8TA 2AMFA 3OF2A 4E2WA 4RZIA 1W4ZA 1IB6A 3C8MA 5L40A 3OQ1A 1KVQA 1N7HA 4GWGA 5ICSA 3BMNA 1D4FA 3BYZA 3DC2A 4FFRA 1QXSA 4BQRA 5JNLA 2Q1SA 1X7HA 4X54A 4PZDA 5JO0A 2DKNA 1LUAA 4Y6PA 3ICPA 1U5AA 3O38A 2IDZA 2G17A 3HZZA 2ZTLA 4Y6RA 2DVMA 4PLCA 1NASA 1R0LA 1F0YA 3JYOA 1E7YA 4RF4A 5K0ZA 4TKMA 1ISJA 1Z75A 3PLNA 2NTNA 3FR8A 3GGPA 5CHEA 4CLRA 3ENKA 2W8ZA 1LU9A 3BMOA 4RL6A 3RBVA 2VOEA 1KEWA 2DTEA 5KTKA 3GVCA 4ZQHA 1K2WA 2VTDA 4XDYA 1JQBA 2DLDA 3OA0A 3TF5A 1HLPA 3KLPX 2G82A 2ZYAA 1ZK4A 4E6PA 2X86A 2J5RA 4HP8A 4IQGA 4ONEA 1B15A 4FS3A 1OMOA 1LDYA 3OJEA 5IZCC 4BV8A 2Q2QA 4JROA 4UULA 1R4NA 1E3JA 1YL5A 2WSBA 4XB2A 4E4YA 3P5SA 5IN5A 2DBVO 1W0CA 3D3WB 1GQQA 5B4TA 5CEFA 4YAKA 1Y5MA 1PSDA 5HS4A 3MOIA 2R2GA 2QQ5A 1NTOA 1YH3A 2UV8A 3KUXA 3BTVA 3VH2A 4O0LA 1HE5A 3GVHA 3P2YA 1MXHA 3CMCO 4DQVA 3BMCA 1E7RA 2PKQP 2NQ8A 3PHGA 1QSGA 1EK5A 3R3JA 5KJ6A 4W7HA 4PVDA 5F1KA 3FPCA 3FTNA 3QWBA 1IZ0A 3AY6A 4N7RA 3TSCA 4BUCA 2Y68A 1PQUA 3GUCA 4NK4A 4CMGA 1LLUA 1ONOA 4CM4B 3DHEA 5L7TA 3TZQA 1X7GA 2HMUA 4KTVE 1UAGA 1ZXBA 3ZNPA 5CDSA 3K96A 1NQAO 1ADCA 3KTDA 2SCUA 1OC2A 2J8ZA 2PZLA 4L4SA 3W6UA 5BSEA 1LBEA 2J5KA 3F4BA 2ZTVA 3M1LA 3QLJA 3DXFA 3WX0A 4NJMB 4ZHSA 4P4LA 1RPNA 2BKAA 3EMKA 3O03A 1YE3A 1FJHA 1HKUA 1GFSA 1T26A 1GU7A 4IIVA 3FSRA 4PZEA 4QTZA 1XLTA 1I2CA 4GSKA 1ZIDA 1N1EA 3K30A 4FC7A 3UVEA 2UDPA 4WKGA 4R3NA 2WEKA 2V6GA 4XRGA 1DIAA 5TRTA 5FYDA 3B1FA 4MVJP 3L9WA 4IMRA 2QW8A 3NJ8A 2NVBA 4AJ1A 3VDRA 3VVCA 4RVDA 1LRKA 3GEGA 3KXDA 1IPFA 2D3TA 1E92A 2BI8A 1FDTA 1K6JA 5IZ4A 4OAQA 1YOVB 3OFSA 4UEKA 4MVJE 4OXNA 2PGDA 2CY0A 3EC7A 4PVCA 1C1XA 1G6KA 2YHUA 4O6VA 3G17A 3WTBA 3TDKA 3KYCA 2Y1DA 1ULSA 3PJFA 4A10A 2O23A 1XCBA 1DSSG 1Q2XA 1HL3A 4CLXA 2P4HX 3EVTA 2A4KA 4ALLA 1NR7A 3QWIA 2B83A 1O9BA 3A06A 1GV1A 3AK4A 1ZZEA 3JQFC 4BL5A 2WDZA 3KVOA 4L8VA 1OAAA 2O2YA 4INAA 3PIDA 4HADA 5IXSA 2VT3A 4MO2A 3DONA 4XD2A 4K9DA 1Q0QA 2HQ1A 3U4CA 1L1FA 1U3WA 4DPLA 2VTEA 1P3DA 2Q2VA 1EE9A 1P0CA 1DJQA 4YPOA 2I9PA 4DIBA 3PTZA 3WQRA 3C7DB 4CV2A 3R3SA 2PWZA 1XG5A 1C3VA 2IEDA 4AJ2A 5EERA 1T2EA 4UEOA 1LRJA 4FJ1A 3QQPA 4M89A 1ADBA 5JO9A 4DPKA 1GCOA 4XQGA 3RU7A 2A9FA 1UUFA 3VPGA 3KV3O 4XIJA 2DAPA 2AEMA 5IG2A 2FR8A 1NHGA 4GVXA 1ONNA 1KEPA 5TIIA 3DZHA 4EGFA 1N9GA 4RO0A 4RQTA 1KY4A 2PH3A 1R37A 3AY7A 3GDOA 3I9KA 4GVLA 5IJZA 2VHVA 2AG8A 3DL2A 5G0TA 3AOGA 3UOGA 2PD3A 3I5MA 2HAEA 2CD9A 3U4IA 4F3YA 1KIFA 2CF6A 2JKVA 3JQ8A 2H9IA 3BXXA 3PFFA 3RCBA 1YBMA 2BH9A 3SC4A 4ZJUA 1U4SA 1MV8A 4BNWA 1H5QA 1PU2A 3I9MA 4WLNA 1T2DA 3WQSB 3AJRA 4MJLA 1ZMOA 1DC4A 4DMMA 3QJ5A 1HE3A 2Q1WA 3CE6A 4FR5A 4ND4A 4DL9A 3GC6A 3OQ6A 5JPIA 1N9GB 2FWMX 3F1LA 4S3MA 5JLAA 1BTOA 1BDMA 2EKQA 1EK6A 5AVOA 4QECA 2HK9A 4J1NA 2HMSA 5KKCA 2B4QA 1LDMA 2ZCVA 1HTBA 1YB5A 4G2NA 3P2OA 5EINA 3HE3A 2YJZA 5T8KA 5A5FA 1KETA 4CPDA 1XQ6A 1GQYA 3KEOA 4YT8A 1OOEA 3E8XA 3G0OA 4N5MA 4DBZA 1XU7A 4MP6A 2D1YA 4KWIA 3Q2KA 5JAQA 3RFVA 4BNFA 3FNGA 2IZ0A 1QR6A 5HBRA 4BMSA 1MLDA 2HMVA 4MP3A 3OIFA 2AHRA 5K9ZA 2PGJA 3DO5A 4E3ZA 4DYDA 1KVSA 3VTZA 2B37A 2ZB7A 1JVBA 4NBVA 1QP8A 1PZFA 1KVUA 1LRLA 3GHHA 2JHGA 1PJLA 1HDZA 3KYDA 4OQYA 3CZRA 1WMBA 3LT4A 4PLZA 3ANMA 3AUTA 3CIFA 4XRRA 4DIOA 2AQHA 5TJHA 3HN2A 4J1TA 1EMDA 2ZB8A 3T4EA 1NFFA 4XQCA 4Q3AA 2DM6A 3ETDA 1UXHA 3NGLA 5DOVA 9LDTA 5THKA 3LF2A 5EQFA 1LSJA 3WNQA 1JTVA 1B8PA 3PHIA 4GX2A 3GZNA 3TZ6A 1PL6A 3DDNA 3SC6A 4A03A 2C7GA 2VOJA 2FZEA 5KVSA 2Y1GA 4A5OA 5B1YA 1DBVO 1ID1A 2HK8A 3GQVA 2PK3A 4KQWA 2DQ4A 5THQA 3LU1A 2QIOA 1C0KA 3QW2A 3FNHA 3GAFA 1N92A 4JJGA 1LSUA 3JQGB 2JFGA 2Q99A 2QRKA 3VPSA 4I1IA 3I23A 1ISFA 2HCTA 3E5MA 3ZHZA 5JY6A 4Y8VA 1P74A 3OSUA 4YQYA 3RFTA 1X14A 5GZ1A 4DGSA 2W2KB 1JWAB 1I2ZA 4UUPA 3MWEB 4QFDA 2DBZA 4B3IA 4EUEA 2EJWA 3GZNB 4D3FA 1XYGA 5A3JA 4WOKA 1KVTA 5KCZA 5L7YA 3E03A 4TRMA 3A9WA 3X2EA 1PGJA 4TZTA 4GMFA 2O7QA 3GAZA 5EQDA 3EDMA 3DBHA 1GQ2A 2C5AA 1XA0A 4QT0A 5DBIA 4B79A 3JYPA 3OIDA 3F5QA 1AHIA 3NUGA 1JVSA 3ZHXA 2Z1MA 2GN6A 1ENPA 3AI3A 4R5HA 5AOVA 4CM9D 1NYTA 2O3RA 3V2UA 3WJ7A 1YDWA 4NZ9A 4CL8A 3FWZA 2V6FA 4YA6A 1DIHA 3IS3A 3L9XA 3SEFA 1T25A 5C3MA 5T8KC 2PD4A 3L6DA 3PEFA 4R9RA 3RI3A 5L53A 3I52A 1A7AA 4OMUA 5IDYA 1IYZA 3ZV5A 3BHJA 5KNLA 3DOCA 1UDAA 4J0FA 3ZW9A 4UUNA 4AJJA 4RPKA 5MGBA 1DEHA 3L6OO 3ONDA 2BFOA 2DPGA 3QIVA 5TX7A 4IBOA 4L76A 1KOLA 4QQRA 4PIVA 4Z0PA 3C1OA 1JKFA 3H9UA 4GKVA 4EEZA 1EVIA 5AXDA 1ZFNA 1PS0A 5DBGA 4URFA 2GDZA 5CEEA 4ND5A 1NX6A 2VWHA 2GF2A 1B7GO 3NYWA 4JN6B 5CG1A 3FBTA 3PIIA 3S2GA 2NWQA 4BKUA 3ZV4A 3WXBA 1WMAA 4AJLA 4F46A 1GZ6A 1W6UA 2E6UX 2X5OA 4I5GA 2QG4A 3TNLA 3ZWOA 2J6IA 1X0VA 3WS7A 3NV9A 3W8FA 3GG9A 4DXHA 1DRUA 3GH3A 2UUOA 1WNTA 1Y6JA 4FQ8A 2RH4A 1F17A 3D4OA 2Q46A 3CTMA 3JQEA 4CLOB 2IE0A 3PYXA 4Q3BA 2FR1A 5IFLA 5T64A 4BKRA 2DU8A 4ILKA 3NT5A 4U8GA 1J49A 3I6IA 1V35A 2YY7A 2G76A 2DPHA 2VYND 2Z5LA 3FBGA 5EIOA 2AW5A 3L4SO 4YR9A 2H5LA 4J3FA 2YDXA 3PI7A 3ZU2A 2RH8A 3FNFA 2BI7A 4L4XA 1UDBA 3BZUA 4UEJA 3WG9A 4GLLA 4JJFA 1DAOA 4PCVA 1ZW1A 1E7WA 2I99A 1WDKA 3G3EA 3RC2A 3ZHYA 3I4CA 3K2BA 3MJVA 3D7LA 3WGGA 1I32A 2NVUA 1TT5A 1MC4A 2Z95A 3GVPA 1VJTA 4CM8B 3U49A 2VZ8A 5ILOA 2VUUA 2BGMA 4E2ZA 4IQ0A 1DB3A 2HJRA 5COQA 5COBA 2AQIA 3LT1A 1E3LA 5TLSA 2W2LD 1SB9A 4W82A 4OXKA 1A5ZA 4R68A 1GZ3A 4LRTB 4BNIA 1QG6A 3FCOA 5AQ1A 3H7AA 3G79A 4HNHA 1Q0LA 1I2BA 1TB4A 4CMEA 4CV3A 1T2AA 4CV0A 2X5KO 2PGLA 1XHLA 5F5NA 3FD8A 3JQGA 2E49A 4MIYA 1E7SA 2EXXA 3DQPA 5DT9A 3F47A 4PG7A 1U28A 3GLQA 5T6BA 3BMQB 4FFNA 3K2EA 4XEHA 2WYUA 3QP9A 4R5MA 3WR5A 4BMNA 4BNYA 2Y1FA 1O95A 1B3BA 1P1FA 4AJOA 1LC3A 2YHIA 5G4LA 4NK5A 4R54A 2O48X 5L95A 2G5CA 4ZQEA 2VRCA 4L0QA 1XR3A 3WIDA 2JL1A 3ROQA 1PX0A 3CKYA 1A7KA 2D2IA 1C1XB 1IHXA 3KSZO 2NVUB 3TOZA 3UICA 4QEDA 1QYCA 1BXKA 3N7UA 4FFPA 2OGUA 5HTOA 3GNSA 5DCWA 3DMTA 5BSFA 2Y93A 5BR7A 2JD0A 3MOGA 3FI9A 4GKBA 1H0KA 3QWFA 4OM8A 4HBGA 2O2SA 1TLTA 3JV7A 3TWOA 3ZNQA 2X58A 1YRLA 2RCYA 5G0VA 1YJQA 3IDSA 1IULA 4BNGA 1GPJA 1HEUA 3R1IA 4EJ0A 3H2ZA 4XIYA 3ULKA 1LA2A 5G2OA 4B8ZA 3GNTA 2VHXA 3IP3A 4DMLA 5JCXA 2NQTA 5TT0A 3AY3A 4ITUA 3FPLA 1YDEA 3C24A 1JKJA 5KVQA 3VZQA 4P4NA 1YVEI 1DO8A 3GEMA 3UW3A 1VL6A 4HKTA 5GZ3A 3TJRA 2I6TA 1NXQA 4BGUA 1Y1PA 1M66A 2E37A 3GR6A 2Q50A 4OQZA 2X9GA 1HYGA 1ADFA 3L07A 3RUIA 5A06A 1JAYA 4AJNA 5L9AA 2J5QA 8LDHA 1MG0A 5GY7A 3ASUA 4MPDA 5JBIA 3QVTA 3L6EA 3G1TA 1N2SA 4IDBA 4YJFA 3ZV6A 6ADHA 1NAHA 2VNAA 1NQOA 4IPTA 3EGOA 3FHLA 3VVBA 4S1VA 4XYBA 2I76A 1XU9A 1NPTO 4W4TA 2CZCA 4LMPA 4IGFA 1DRVA 1E1MA 4WCFB 1VRWA 4MDHA 2VYNA 1I3NA 1N8KA 4N54A 9LDBA 1TXGA 4LN1A 4WCDA 3PQFA 3ZV3A 1JN0A 3EYWA 4ZQFA 5HS6A 1OFGA 4CM7A 1EVYA 2B69A 1YB4A 4W6ZA 5JYEA 3L0DA 3QWAA 4J7XA 3JQBA 5KKAA 2Q1TA 2XPCA 3PYMA 2NADA 2P9GA 1Y7TA 3G49A 4RVUA 3LC2O 3ROMA 2RAFA 1EFLA 1O89A 1PWZA 1BDBA 4MINA 2O3JA 1KC3A 1GEEA 4BO2A 1PS8A 3BHMA 4GGOA 2PR2A 2GASA 3CUKA 4N18A 4YBZA 1LSSA 2A92A 4G5HA 4E2XA 2WM3A 4Q3NA 4Z9FA 4EI2A 4JQCA 1MFZA 3E6AA 3D4PA 4AFNA 4UVIA 1V3TA 3DZIA 4FOSA 3KOUA 2CSUA 3T4XA 2B0JA 1P1HA 3NEPX 3O9ZA 1SCUA 3DBLB 4GWKA 3V1UA 1K6XA 4CMBA 4NIMA 4MVJD 3PQDA 2HK7A 1HWYA 2ZK7A 1YL7A 2PA3A 4OH1A 1TT7A 2WJPA 4NBUA 2IZ1A 1E3WB 3OJ0A 2Q1UA 3DFZA 1UDCA 3AUAA 3Q9NA 3DBRB 3RJ5A 1E3EA 1RYDA 3PZBA 5CFZA 4IJKA 4IJVA 5AXBA 2V65A 2JCXA 2PH5A 1SEVA 3BA1A 4L73A 5CDUA 2D4AA 5EL0A 3I6QA 1QLJA 1AXGA 4D44A 4II3A 3RIHA 4E2YA 3PWKA 3GUYA 2X9VA 4CMIA 8ADHA 2PZKA 3C3XA 2YUTA 3OHSX 4HFMA 2GCGA 4M54A 2DUWA 5DNAA 1CRWG 1KVRA 1X13A 3S2FA 4CQLA 5IDWA 4WK6A 3GZ4A 4IMPA 2Y05A 3ZZNA 1PGPA 3GN2A 4CM1A 2VYVD 4UREA 4GL4A 2IEBA 4I9NA 1MP0A 4BNZA 2RIRA 2XF8A 1GUFA 4IIUA 3WNVA 1LDNA 4FFMA 1SAYA 4WECA 1C14A 2CVQA 4Y9DA 3PXXA 5L51A 3QA9A 2Q3EA 4UUOA 5JCJA 3VPFA 2CNBA 2QHXA 3UHAA 1WW8A 3B70A 4BOYA 1LXCA 1E6UA 2NU8A 4CQLB 5I7VA 1NVTA 1U8XX 2D5AA 1DHRA 4PLPA 2FSSA 3JQBC 1P1RA 2LDXA 5LC1A 5A4DA 3ADPA 4XR9A 1HDOA 1VE9A 4D7AA 4PLWA 1GUZA 4BNNA 2G1UA 4IXWA 5BNIA 5ILGA 1Y5RA 1PR9A 1Z82A
chains in the Genus database with same CATH superfamily
3X2SA 4XWKA 3K4PA 1ZQ1A 1XTKA 4HX9A 3W5BA 1QPZA 3O8QA 3FDZB 2XZOA 4DT1A 4AG3A 1FXUA 2ONJA 4PWZA 5FFFA 5AWFC 3K15A 4R1SA 5ER9A 5JAMA 3EEYA 4CMKA 3K5HA 1NVEA 2C04A 4FB4A 5EJ6A 1GNPA 4JUBA 4IH9A 4YV2A 1E3SA 1HSOA 2GF9A 2HBYA 3WGJA 4RDIA 2R6FA 3TOXA 3RU2A 4JI2B 3K92A 3LNTA 4TMZA 4IVNA 3E48A 4FI3C 1FSFA 4Q9AA 4R1NA 4EF4A 2WUVA 3ICEA 1U0NA 4PTYA 1E2IA 2DQZA 3T1OA 4ZCIA 3W4KA 3UA4A 3VVLA 4MX8A 1YFZA 3HSSA 1ZI6A 2YH2A 3O47A 3LX6A 4BRZA 1EP1B 1GTZA 1GGNA 2GR9A 4HDAA 4WCFC 1W75A 2PNFA 2QTVB 2VQ3A 2WAXA 5ALNA 2HV8A 3R6DA 4EECA 3H9CA 1PZMA 3RUEA 2HA7A 2AOUA 3OCJA 3QVVA 4FYJA 3DXYA 5AVXA 4CKBB 3COVA 3ZK8A 5HCNA 3L49A 1E9VA 4IUYA 3JWIA 2JAWA 2NU6A 4Q21A 2C4UA 4Y2GA 5EP4A 5EKSA 4D26A 2G7ZA 3O1HB 1PVVA 3IYLW 3BZWA 3E2MA 4ZHQB 3D3WA 2ES4A 3CXUA 4XGRA 4YCBA 2Z2JA 1JIJA 4X5OA 1S2DA 3T3IA 4CCSA 1Z4OA 1SXJD 5DI3B 3NAMA 4AVYA 3ZCSA 1A9SA 4HX5A 1WTAA 3ZQ4A 5IT9A 4ZDKA 4P92A 1RPTA 2G9ZA 3DDCA 3GP5A 5SZKB 1E1KA 1T6XA 1I7QB 1KO7A 2QZ9A 1H2HA 1TIPA 3K3PA 3FIUA 4KX3A 3ZHVA 1EG7A 5I9MA 2ZCJA 2B5VA 2VSQA 5LQUA 1L4FA 1XEXB 2OO5A 4BTLA 2F9FA 4MV6A 1GDHA 1JH8A 1VG8A 2NSJA 3HGQA 3DBVO 4IKEA 3UJAA 2GAOA 4C3UA 2AG1A 4FGSA 5JU6A 4I1PA 4NFLA 1GZ7A 1KI7A 1MN6A 4J91A 4LSMA 2I1LA 3NNSA 1L3IA 1KAHA 1YBFA 2E5FA 2CXPA 3NLLA 4RZXA 4YQEA 3UMYA 2D0DA 4G1UC 3U3RA 3UXEA 4D25A 4MAFA 3LX4A 1L5ZA 4PHTA 4EW6A 3SF0A 1AURA 1PKXA 1DKOA 3N2KA 4KI0A 3BT7A 1E9CA 4M36A 4WBSA 5ANRB 2SHKA 4B48A 2JBAB 4KXNA 1PK9A 2R79A 3DHNA 5AW2A 1KH1A 2P41A 3G85A 2ZROA 3QGMA 1ABFA 4G36A 3H5VA 2XIQA 3I8SA 4EY5A 4KYUA 4F72A 3SSNA 3K2QA 3WK8A 5B1SA 4AN0A 1SZDA 5GADl 4D6PA 3JZMA 4G2TA 2UXDB 4X00A 4KR6A 1P1IA 3OZFA 4OKNA 2CYAA 3JR7A 4KUGA 3K35A 2BMWA 1E7QA 4TTQA 3FYDA 3T7KA 3O2NA 2PAAA 3JQCA 2DFDA 2VF5X 1NNUA 1UJNA 3SOPA 3ELUA 3GLIA 3R6WA 1FS6A 4KNYA 1M6YA 1VJ0A 3CUUA 4IWXA 4QBGB 5E6RA 1KYTA 4LKRA 5AK6A 3WGLA 2C82A 3TZHA 1AK9A 2BFAA 4E13A 4NOKA 1Y9EA 2QU7A 4IFIA 5KNBD 1VE6A 1ZGJA 3RSOA 4OXYA 1WVIA 3Q9UA 3ADOA 4OBEA 4LNHA 3PQ3A 4AM8A 2E48A 3FFWA 3QZUA 3Q1LA 4OX9Y 2IS4A 4PG4A 4M0MA 2IYWA 1GPYA 5CVCA 1RCUA 2VPXA 5F33A 5F3DA 3Q40A 4YVFA 4EH1A 3JAMA 1CEYA 4BNJA 1NDUA 1BEEA 4WESA 1KDZA 2YWHA 3BSYA 2IYNA 2PDAA 1VRCA 2XSZA 1BNCA 4EG6A 2OUKA 3BK1A 2QK4A 2CLDX 3L7DA 1KQPA 2J0EA 2J0UA 4FN4A 1UF9A 4MV0A 4RV5A 1KHTA 3GRUA 2P2DA 2V5AA 3Q4GA 5IHXA 4ZYXA 5EHXA 2YYAA 1CRZA 2P65A 4KNVA 4U7GA 4CM4A 3O8RA 1R4MA 2ZR9A 1CZOA 4F4FA 1QP4A 3BWVA 3OC6A 3H2BA 3T7RA 2OXCA 5I7EA 5F98A 1U5BA 2G88A 3BRSA 4ZARA 3RK4A 2QL5A 3TEFA 1RRKA 3DKIA 3HO8A 4L0MA 2JLVA 2HU7A 4EZEA 1X86B 3W8EA 3PDIB 5LM3A 4EY6A 1VL5A 2EFYA 3BE4A 3DVAB 3G8DA 3B1ZA 1J8QA 1F51E 2ZUEA 4BP8A 1D1PA 2QX8A 4JYCA 4WFQA 3HJRA 1Z63A 3EBPA 3I3SR 3SQXA 3BJZA 4IIYA 1AGXA 3GRYA 1KYZA 1LLDA 1PZHA 4I4IA 1Q0PA 2OD7A 4FTWA 4UDYX 1TUGA 1XP5A 2J6BA 3VX4A 4POOA 1EUQA 4UBIA 3UKDA 4JEHA 1X9HA 1F06A 2RDMA 1S9DA 1SVSA 5JAPA 1LDBA 4UBOA 2GNAA 3EXFA 3RHTA 5KOYA 4YXFA 1RAAA 1JB9A 3VR3D 1RJEA 3ADKA 4WBNF 5JQGB 3I6BA 3L1KA 3NX4A 3FOFC 3ZLJA 2SKCA 2WTMA 2RE8A 1WV1A 4ZU6X 4Q01A 1QAOA 4YX9A 1M83A 1FTQA 1NKTA 3WYAA 5A9SA 1YZFA 1U31A 3CSSA 3QX9A 3JPYA 4B3XA 1H1TA 4RPJA 4BN4A 5F9FA 1KWKA 3C5EA 1L8QA 1V47A 1I3MA 3ANTA 2AR9A 3RR2A 4AICA 2DHQA 4FYYA 4ZVSA 2IV2X 3ZY4A 4I3GA 5LIPA 4UXIA 1GNRA 3C5HA 4YCDA 3QU2A 5IABA 1P75A 3WK5A 5K2OA 4AKIA 4DQUA 1XJQA 3X44A 3V55A 4RHUA 2V5VA 4MZXA 1H0SA 1DKRA 3CUEF 3MCVA 2ZBEA 4GO1A 5D3KA 3U3XA 4DIUA 1SHTX 2Y0DA 3NHAA 4D4KA 2LKCA 4HFJA 3SBXA 5AKJA 1YHNA 2DWPA 2DECA 3EDCA 1KJ8A 1P1CA 4D92A 3IMGA 3GA7A 2ZVPX 4PXAA 3PVCA 1CZLA 2FPMA 1LI4A 4Q03A 4URWR 4S24A 5IAKA 2CMDA 1U7ZA 4HZGA 5BV7A 1ULBA 4YPFA 1N9KA 2PYIA 3SJCA 9MHTA 3Q87B 1QVVA 3K9LA 5CBKA 4HH0A 2ID7A 2WUEA 4DCJA 3W3AH 3M3HA 5F5LA 3ZIUA 1O0SA 3KQWA 4ARBA 1IWPB 3BF7A 2C84A 2BPOA 4LJAA 1VI6A 4KXMA 2NO5A 2HMTA 3CKKA 3DAHA 2QBYB 2W8BA 4ZMRA 1T4BA 1C4XA 3TDNA 5FDFA 1NR1A 2UZ1A 5BP7A 3ZU3A 1IXSB 4E51A 1NMSA 1O4VA 1R5JA 1Y8RA 2IOQA 1CZHA 2OHJA 4J8PA 3DMTC 1L8XA 3JWGA 1ZRSA 4FC6A 3IHKA 1D09A 1XVAA 3EEFA 3KZ1E 5BY2A 2XZTA 2HK6A 2QNBA 3DFIA 1UQTA 4NABA 5GIPE 1J1IA 2P1ZA 3AVXA 4J49A 2DUNA 2VXCA 2AOUB 4IF4A 1N5OX 5F3WB 1RE1A 1GKLA 3IMFA 3H1PA 4LWOA 1EH5A 1DTSA 4LCBA 2NXNA 1FVOA 2CCGA 2Z08A 2R00A 1OYVA 3VQTA 3JX9A 4O33A 1YS9A 2YN4A 3G02A 3IUEA 1EXVA 1H65A 1CHDA 3P27A 5H4HA 2K5UA 1OLUA 3KEFA 4KQIA 1CYDA 4G9GA 2ZWOA 4A8TA 3D6AA 4G5XA 4N8EA 3PNOA 1AD2A 2XMSA 4ZT5A 5JNVA 1XD8A 3KB6A 3ZD7A 4PG5A 2Z2IA 3G1WA 4F6CA 4KQ9A 5EQJB 2OFFA 2CVPA 3DM9B 1TTHA 3OCXA 2CWWA 4TZKA 1CD5A 1T3ZA 5BW5A 2LE0A 1TZKA 3DXZA 2XTZA 1WDLA 1U8YA 2VSNA 3GLKA 3GPDG 4J1QA 2XDQB 4QGBA 4Z1MD 3ZQ6A 1W2HA 1NATA 2DFPA 3HRKA 3RNLA 4L27A 5BSTA 4D98A 3PPXA 4AJ9A 1GSIA 3WGMA 2GPJA 4LV5B 4OGFA 3BIOA 3PF8A 3ZTYA 1SY7A 3KCQA 3ESRA 1S3GA 4IHAA 5ALRA 1QZUA 3DP7A 1M0EA 1QIEA 1KC1A 4C1NA 1JDZA 4K0RA 2X6RA 4C7JA 4CKCA 4E4TA 3EXG1 1BA3A 2RB4A 2Q4BA 4NYMQ 1W73A 3H65A 4ADSG 4J16A 4B4KA 2YJ3A 4Y9UA 1IAQA 2Y1OA 4M21A 3F9RA 5GWXA 2EGGA 3DV0B 1NU8A 2WD9A 4GE0A 3WJAA 4G65A 4K6MA 2WOJA 2FWBA 3ZUGA 1FDIA 4BB6A 4BNVA 4C87A 4E4RA 2C3OA 2LGJA 3DYBA 2WYIA 4QFCA 4IXMA 3NOOA 2QV7A 3LQFA 2HY7A 4UAUA 1QHIA 1R9MA 3KELA 4JB3A 1XXHA 1VC2A 1OXSC 3ZWAA 4D4LA 3S8YA 4F3CA 3O0TA 3L18A 3MGCA 3N2YA 4LOLA 4DLSA 5CNMA 3RYFB 4ZVVA 1HETA 1X15A 3NHYA 1E5XA 2XECA 4XVRA 1UMDB 3PB3A 4TYQA 1RC8A 1ZEMA 4CCYB 3OCYA 3LDUA 2Z04A 2KPOA 2J45A 1Z74A 2RHOA 3L0SA 4RV4A 3CCBA 2ZKIA 4G0NA 4QOJA 3WP1B 5FLKA 2OECA 3HA7A 2ZSBA 4P0TA 1JLSA 4YJ3F 4BKQA 4D9CA 3G8BA 1EU1A 1XWIA 1Y8QA 4UMFA 1SIWA 3KHUA 5FEMA 1HK7A 4TTAA 2R7LA 5DHRA 1BN7A 1ORHA 1OI7A 2A94A 2CL7X 4RYDA 2IKQA 1ZCZA 5HW0A 1LC0A 5GZ6A 3GIWA 4TXHA 4QPCA 3RAPR 3WWDA 2D5IA 1XQ1A 4TLCA 4PYJA 1I33A 3QKSB 3UWKA 2QL6A 1L7VC 1TYZA 1WXHA 3EVDA 1ZH0A 3FDZA 3HHPA 3LRXA 2D5LA 3U13A 1T3HA 3KE9A 1MAVA 3V8BA 1H4TA 5DCLA 2NUPB 3VUFA 1QZTA 1X7XA 2BKEA 1GXSA 4R8RA 5E9QA 5A2QA 4MI3A 2B2XA 1OIWA 2P3LA 1ZUHA 4NCBA 3E3AA 1AA9A 1CJKC 4XQEA 3TMKA 1U5CA 3UAZA 3U9LA 3PICA 1G7CA 2EX4A 3D9QX 2C59A 1QUFA 4JVLA 3W4IA 2FLWA 3R7WB 4DSAA 5DFAA 3Q6IA 3ZHTA 4HLCA 4LMBA 1GL7A 1C5KA 4MIEA 1LPOA 1CQJB 4NONA 1WDWB 3GRPA 5LZ2A 1YNOA 2HXYA 2PKQO 3GDGA 5J1TB 5J2UA 1PIWA 2VSXA 4ENUA 1SOMA 2IELA 3VR2D 3WGNA 3AM5A 5DBHX 3CSDA 3KJNA 4J0HA 3B3JA 5H16A 3OPVA 1HF3A 4M7PA 4GLBA 4ZAFA 5IF3A 3SJUA 1TO2E 4YB8A 4BIMA 2HRBA 4CLOA 1XQWA 2P5UA 2Q9UA 5JJBA 4IZOA 2IRWA 3LQRA 2C20A 2HCFA 2PNJA 2CUKA 3DV9A 3Q15C 5F1OA 3C70A 4AUEA 5E3HA 1KS9A 4LXQA 3WV5A 2SCUB 4UE6A 2Q5HA 4LZOA 4ACBA 1O3YA 3SF8A 3A9VA 4UEQA 4EB6A 1XNHA 1CDEA 1NBMA 1SEPA 2RGRA 1Q16A 1PGOA 3MW8A 4E0BA 1T3SA 4LXUA 4CTMA 3HM9A 3U4QB 1KR5A 4QD3A 2ENUA 4L9WA 4AG6A 3RHZA 4RTNA 4EYOA 1C4OA 1G21E 3ZZTA 3RKUA 2H4WA 4EF6A 2ECKA 3IKVA 5EE0A 5GJBA 3EZFA 3LCUA 2AFHA 2XYQA 1I5OA 4DA9A 1XZMA 1KFEB 2BMEA 3I9NA 2XUFA 2XX3A 1W19A 4MV8A 4DJDC 4HDMB 4HMQA 2IOFA 3I3OA 3SVZA 5CVDA 3SAJA 1Z35A 4A23A 1WUKS 1YBAA 2D59A 1SBZA 4I3FA 4BO1A 4CG0A 1X1TA 4ZI3A 1TGVA 4D9BA 3AV3A 4PYKA 5BUQA 1KZHA 4BYMA 4CV1A 5K09A 3HDGA 1ZD3A 5BXQC 2QVXX 4DCVA 2VP5A 3HKEB 3UWSA 1ZOIA 4YAIA 4EGSA 3AUUA 1GCUA 3STXA 4EUFA 4DWVA 3EH1A 3SWWA 1IHUA 3C0KA 2RGAA 3TNJA 4CUZA 2UZ1B 2WOOA 3BA6A 4UDOA 1NP3A 4IXTA 3S1AA 4P5PA 1MB0A 3LK7A 4L5IA 4W7IA 5CH8A 1IUPA 1K8QA 1JFRA 1VOTA 4H31A 2B4TO 1UMCB 3K31A 1SH7A 1CS0A 1SQFA 5EVJA 3L79A 5AIAA 5TARA 2JJMA 2KLBA 2QD1A 1V6CA 3FOCA 3RSHA 3M8KA 2JVIA 2C95A 4GFDA 4R31A 3P4XA 5T57A 2GPSA 3BKXA 3FTPA 2OAEA 5LBUA 3INTA 3P9QA 4P9NA 1BEUB 1FFHA 3D3KA 1E2BA 2XMBA 3QYJA 1XV5A 4HH3C 521PA 1A96A 1NUHA 2FI1A 4CUKA 3C3BA 1NRWA 3NHBA 2KSQA 1U81A 2HKIA 3RK1A 3EDQA 5F2EA 3ZX5A 5BOSA 1DX9A 2XDAA 4RKEA 3T7SA 2IT1A 3ER8A 4QDTA 5EHIA 1A8UA 3KTAB 4DWWA 4PTZA 3R8FA 4EI9A 2JFOA 1I3OA 1YR6A 1Q12A 1ZOSA 3FLMA 2E7ZA 2VHYA 3WB0A 1Z6QA 4KYVA 4JLNA 4ODIA 2YJ6A 3EOAI 2B4RO 4O2LA 4RPIA 5JDCC 4J0QA 3DB2A 4ED9A 1L0BA 4JP2A 1YVUA 1AXEA 4J6FA 3RK0A 1IM2A 5UKDA 1MX3A 2Y67A 5NLLA 4C0WA 1AVTA 2RHMA 3LYLA 3R3VA 2WNSA 4WN9A 5DCUA 3SDZA 2P9YA 4CR6A 3KX2A 5CNIA 2JGLA 3EF1A 3RYTC 2ATXA 5L3QA 2G25A 3P97A 2V7EA 1VZ3A 2QTFA 4GWLA 3K6SB 1CR2A 3HCRA 4MUAA 1WY5A 1GUDA 3BQ9A 4PCLA 1PN3A 1YJXA 2SBTA 2IUFA 3QI2A 4LRQA 2DY1A 3RS5A 3FZQA 2X9NA 3ZWVA 4PR0A 1GPBA 1DVRA 1WABA 2ZR8A 3GJTA 5FKJA 3UAVA 2P68A 1ZLYA 2QWXA 1T1RA 1NW5A 2ZKLA 4JGBA 4A0FA 4EEKA 5HM6A 1CVRA 1L4UA 2CL6X 1EFAA 4OA8A 1I36A 3V9AA 4C20A 1C7FA 3HSKA 4R2XA 3OO1A 1MOSA 3A37A 1SHZA 1YD7A 1CY7A 4X84A 1JQ5A 1C30A 1K3TA 1QKIA 2AC2A 3AETB 2Q62A 3F49S 3R4VA 4MMZB 2AJLI 2FZCA 5KTPA 2Z6QA 3KKMA 5H59A 3VA7A 1CJSA 3NHFA 2WM2A 2JIBA 1PWYE 3JD0A 1IZ9A 4QQKA 2NO9A 3KAPA 5KBYA 2EATA 1ZJ4A 4IDCA 1FEZA 3PFIA 5KC9A 4JSYA 3SQDA 3O31A 3C3CA 1Y8ZA 3TUJC 4DPMA 2JIZD 2AWOA 1PYGA 3E82A 1X6VA 3GG2A 1QM5A 2CWDA 3LLSA 1CETA 4TVOA 4F9TA 3ZDAA 1A72A 3ANLA 1KMIY 4ASUA 4QSHA 4AN4A 3TE7A 1BW9B 2Q5JA 2XTNA 1E3TA 4J4HA 3MERA 3TLGB 4Y2PA 4BN5A 4N8SA 1Z0ZA 1M34B 1BE6A 2G72A 1I01A 3B1JA 5IKMA 3V7UA 3ZG6A 1P81A 2QZPA 2D6FA 4ALKA 4P98A 4G0UA 2BZGA 1WB5A 4HATA 4YXWD 5CEJA 4GDMA 2XNHA 4RTSA 1X94A 3AKEA 4WY5A 3P2EA 1BOOA 2NXJA 3I1YA 4NBKA 4R01A 4MQ6A 4E7PA 3RADC 4DNOA 4DMKA 1IJFA 1IHPA 2XAAA 4QATA 3WL8A 3L8GA 1JXMA 2IY7A 3G9QA 4GLOA 4WZBE 5HUJA 3WK4A 4TV8F 4C03A 1U8EA 4G1BA 2FSPA 3EXHA 5FA8A 3DC7A 2NP7A 1WZUA 1CWUA 4JJAA 4L74A 3M6LA 4RTJA 4RZHA 1LWNA 2VQEB 1PL7A 2XZDA 2Z8YM 4Q4JA 3CNQS 2HA6A 3SXPA 5IG2A 1TEHA 5SY4A 3OI7A 4EYEA 4F2PA 1E5TA 2HF2A 3SQMA 2ADOA 3P1JA 3TZLA 2CEKA 2O2HA 4ER0A 3QBEA 4I4TF 1ZO8A 1U7WA 2VP4A 4JH0A 2V7PA 4JLWA 3KOWA 3BAFA 2OCGA 2V4UA 4ENTA 5A3RA 1RYNA 3JQFA 3ELDA 3I2JA 3ET4A 1W4LA 3DAYA 3I42A 1PZNA 3CKLA 4RA6B 3HXQA 4R41A 4BVGA 4Y6QA 5AR1A 4MVJA 3U80A 4BVLA 2XVYA 5FL7A 1CY0A 2Q6KA 4NMHA 4M9SA 2QZSA 2H59A 3ESDA 2OV2A 1O0BA 4RIFA 3U4HA 5HE8A 2ZBVA 2XE4A 4X91A 2D1QA 4M0EA 1VCMA 4QA9A 1J0CA 2C4NA 3FCCA 4Y2TA 1Y3AA 1XNGA 3WIBA 4BQQA 4XGIA 7YASA 1JE1A 2P4QA 2MR6A 4UNIA 3K32A 4OYHA 5BMVA 2OL4A 4NFSA 2REBA 3CMMA 3NT4A 4P2GA 3W2IA 3MCZA 5EXSA 1HQDA 3A4IA 1OH8A 1EDDA 2EJTA 4PNPA 3DG9A 3W78A 4S1TA 3S2YA 2E5LB 1X80B 4H59A 2WG0A 2F1RA 3THOA 1GKUB 3A1CA 1P0PA 3GCGA 4CTNA 1YFKA 4CLEA 1GADO 3A4VA 3N2GB 2VQDA 4HEQA 1HLDA 3ITNA 2VDJA 4FE7A 1RZVA 4IWNA 3BH0A 2QUKA 3JYQA 4AF7A 1NF9A 5BV1A 3WYBA 1ZISA 3F5SA 3IE2A 3TPCA 5L3RA 4BLOA 1XTQA 3HVJA 1VJ5A 4H16A 4QBHA 4L5JA 3TBHA 2VDVE 3C43A 4X60A 5CT4A 1TZJA 5EIWA 2C7BA 3AGQA 3VH1A 5DU2A 4I1SA 5CB4A 4FM9A 3NDJA 3PFGA 3VC3A 2ZZMA 4FMBB 1E1CA 4J90A 2VT7A 1CRQA 5JE8A 4AUNA 3T1NA 1CB7A 4P8RA 4YWHA 4AJPA 2XCLA 3QSGA 1PDOA 4GMGA 4K8RB 3D7KA 4RFSA 2N3ZA 3K16A 3HI6A 5CFOA 4NV1A 1M34A 4Q9NA 5CITA 5EXTA 4FOPA 2C00A 5CMLA 2A35A 2NTVA 3RUHA 4A4DA 1AGPA 5AESA 2CFIA 2E9SA 4ALIA 1PUXA 4DQLA 4F85A 2C2MA 5FBZA 2ZP1A 1M2EA 1YI8A 3B8HA 2EJVA 4WOCA 5K51A 4YRIA 4YV0A 3TRFA 1BKSB 1G17A 1YMQA 1DFGA 4TLMB 2FN7A 5TS2A 3W34A 3IP5A 3PHJA 2Q5LA 2ZRDA 5A7GA 3R5HA 5B36A 4DV0B 2O59A 3DMRA 4ZRDA 3KKOA 1DC3A 1J33A 1LKZA 2AMVA 2CXSA 1A7UA 1QH8B 2O1EA 1OWPA 1J2UA 1GA4A 1QQ7A 2QTGA 3CUYA 3I0ZA 4LY9A 4PHHA 1MW9X 3VNBA 1CNMA 4DUPA 4Y0VA 1XAJA 2YV3A 1C9NA 4BO8A 1AUOA 4ZEVA 1N2BA 1U8TA 3OTWA 4ES6A 3LS2A 4WMLA 4UHFA 4CTJA 3OKCA 2JCBA 1N6OA 2YX1A 2QSYA 1FMFA 3OC0A 1G20E 1MJGM 3QXGA 4F06A 2Q6TA 4AK9A 2G8NA 2O0MA 2ZJ0A 2E6KA 4LRSB 4R1MA 1NMYA 1PWHA 5AHXA 4ZAWA 2NAFA 2DPLA 3TFWA 2O8CB 2XH8A 3BB1A 3JAKA 4DIFA 1QFZA 3V1NA 3L8CA 3FNEA 4QDOA 2FN8A 2QN7A 2NLOA 3TUZC 3WLHA 3OE5A 3OOYA 4HUJA 1RT9A 3LBHA 3ZWXA 1W36C 3T4PA 2AG5A 1BX1A 2WMDA 1KZ9A 2YBDA 2DTDA 4M1QA 2PL9A 1EFDN 1E94E 4J7CA 1C3OB 1CCWA 3REQB 4IINA 4R71A 5JR3A 5JXWA 2ZU0C 1ENZA 1E6EA 2PGAA 1SM4A 4JMPA 4BDTA 1LQTA 4AO6A 1DQPA 3DLTA 2TMGA 4J16C 5HRUA 3E22B 3CX4A 1OZFA 3VSBA 1OH5A 4RF2A 4YO7A 2WB4A 3DLPX 3HBLA 1G3RA 4PS0A 2P6OA 4GHWA 4ALJA 4OA5A 3T9FA 8ABPA 1JYFA 3F2IA 2XGGA 4R2JA 1YCHA 3ST7A 2DFKB 2W6IA 4M0DA 3FMGA 2Q6LA 1OVMA 3KVVA 2PKRA 2WD7B 1U6JA 4FYVA 4DVJA 4XX1A 2YV5A 3G9ZA 4TROA 1CFZA 1NULA 3V34A 5C46F 3GROA 5TY0A 5E6UB 1EVJA 1E6CA 1SWWA 5MN4A 3LIPA 1JGTA 4GI5A 2R6GA 3ILXA 3IXLA 1U3UA 3UN1A 4BJ6A 1VMIA 3RS9A 4D9MA 1D6JA 4XSVA 5K3CA 1U1EA 1USWA 1P6QA 3GGOA 1NBAA 3F74A 4XX0A 5GONF 1QJ4A 2J3HA 4UFPA 2HLPA 5EZYB 1KJQA 4WY8A 3SZRA 3L06A 1H2FA 1S2GA 4Z9YA 4HQFA 5TDHA 2ROQA 2XZPA 4R3WA 5CIYA 4HXYA 2ZWMA 2OBNA 3TTUA 1OYYA 2P9ZA 4DV5B 3NASA 3QPUA 4OSPA 7REQA 3J81k 2RGBA 3AEQA 3O73A 3WA7A 2EERA 1RIFA 1MGPA 3I2YX 3PENA 4OCZA 5HILA 4FN5A 2BE9A 2P9EA 2F8LA 5SY6A 3E35A 3TAXA 4E1VA 3V6MA 1CUEA 1GEGA 1VYVA 3Q7RA 3R6TA 4G4SP 1Z2OX 1DAGA 2QLNA 2Q0XA 1G291 1PYOA 1ZINA 3R5XA 4NQRA 4RHEA 4XARA 4Y2HA 3T7TA 3ZBTA 5I9IA 5JS1A 2FW0A 1Y89A 3DFMA 4CIDA 3IEXA 2TRSB 4C4ZA 1C2TA 3UYKA 4BJHB 5KNCH 1DC8A 3IUJA 2QL7A 3AIOA 3ZLVA 1JQDA 1JYSA 2HCJB 2ZIGA 3D8HA 3F2VA 2EFJA 4GT1A 3K9HA 4MEJA 4RD0A 5H82A 4ZXPA 1XUOA 5HTKA 3UT0A 5IEJA 2EARA 3IAM6 3LD9A 1Z4IA 2CNKA 5LQCA 4TWJA 3D1JA 3CJQA 4M9CA 2HSGA 5TQJA 3FWYA 4WNCA 2ZYRA 3VNQA 1X39A 4BAUA 1GOTA 2I66A 1FL9A 4OB7A 4ZCMA 3LOQA 3DR3A 5C9ZA 3R7SA 1O97D 3R75A 4EFLA 3N0RA 1CZUA 2CMHA 2CKMA 2PWYA 4LNUA 4TMKA 4AO8A 1NHWA 2FFAA 1GTG1 1NIPA 3BTUA 4GD3Q 1QHNA 2IPMA 4JASB 4ZOCA 1ZCFA 2A78A 2QRNA 2Y4OA 2GBLA 3RF7A 2EZ4A 5LOVA 4QVKA 3B3FA 2AT1A 2AL7A 2CJWA 3IT0A 4FS8A 2NO4A 4QEKA 3P0JA 3R20A 2LTAA 5TPWB 1UP7A 3BGIA 3N2IA 3WQBA 2DBQA 4B7ZA 7MDHA 1QB8A 2JJYA 5KYTA 2OHXA 3IERA 4YAEA 2GM4A 1L4KA 1COWA 2DXIA 2MINA 3B5IA 4NPHA 1UZMA 5JD3A 5I7SA 3S5JA 2BM8A 2XSZD 4M9ZA 5AIBA 1MX1A 4C7OA 4PSVA 1SC9A 2B3DA 4R8VA 3LC7O 3WQQA 3CXRA 2IBTA 2BW0A 2I22A 2IP2A 3HXKA 4POAA 1OV4A 2J67A 1CUHA 1H6DA 4CWAA 1DFHA 5B6JA 3CINA 1S2NA 4NLLA 3L43A 5IUNC 1G5FA 1S2OA 3TFQA 4NV3A 3RNOA 1TM4E 2G6TA 1Z2EA 2WU1A 4EHAA 5ALYA 1U8FO 2NNLD 2Y77A 1CZNA 5TNXA 4DSTA 4TSFA 1MUUA 4GZ3A 4V2UA 2QV0A 4OO3A 3CZ9A 2GERA 1GXSB 5DSTA 2P9HA 2X4IA 1RJFA 1BQ3A 2R7MA 1MXFA 2ZBRA 3RKRA 5ICFA 5IAAA 3A2LA 2QR3A 4NJEB 2JI4A 1E7MA 4NE2A 3X2FA 1QF9A 1A8QA 1GZ5A 1DZ3A 1Z2AA 4L8YA 4LRWA 4N9WA 1D07A 4ZQIA 3IDQA 2AFIB 3PGJA 4IJWA 5HUHA 1F0NA 4JVSB 4RZQA 2R0QC 3L84A 3H9EO 2Q7DA 2C97A 4HFNA 3PLAE 4AZVA 1O96B 1U7DA 1U3GA 3RFXA 4TX1A 4CQMB 1RLTA 1C9DB 1NU6A 2YIMA 3L8HA 4KQJA 4EA7A 4B6JA 4CHTA 3A1FA 4XDZA 4XJVA 4XWWA 3ICQB 5CPFA 1C7ZA 1NLFA 2YXPX 4GX5A 3OPYI 4J94A 5BRNA 3MYYA 4JOBA 3SEQA 5DHAA 1EVLA 5LMZA 1SD2A 4YNBA 3B7PA 3EMDA 4UAGA 5KNBH 1XI2A 3NDRA 1UMDA 3WNCA 3GYGA 3RBZA 1MF7A 5IBQA 1F0KA 1B00A 3ILVA 3AHJA 3KR9A 3PWSA 1PFVA 3EGWA 3N39C 1EA5A 2BOVA 1U3VA 1J39A 1D2RA 4JK3A 2ISQA 2X40A 2W6ID 3E4DA 4TN1A 1VFNA 1YNSA 1C3OA 4BQSA 1LV7A 1WDTA 1GT6A 4JR0A 3TLJA 4G63A 3LVRE 1HYEA 2F55A 1MOZA 5F9MA 2C31A 2CNOA 3M9LA 4IJQA 4LXYA 5AUPB 4JVNA 2VF2A 2NAPA 1OC4A 5T41A 3P2IA 1TL7C 1SUSA 1W87A 2YDYA 3K1ZA 4LOJA 4RANA 4TL6A 2VQ6A 1ITZA 2DFVA 4QVGA 1IZ7A 1XLWA 4WX2B 1H8ED 2VEDA 3DV0A 4OQXA 3OQHA 4BTVA 2NUTB 5IXYA 3FVQA 4B33A 3ABIA 3Q0IA 2L82A 4MNTA 2FMUA 3BILA 4GSLA 4LYDA 1C30B 1S8NA 1M2GA 3RJMA 4V02A 4RCYA 5FOVA 3ZGOA 5E4FA 1UK8A 3G5TA 5ITSA 4GYWA 2VHWA 3SK0A 3EGVA 5DTJA 1SBNE 3DZBA 3AF3A 2VNHA 1YE5A 3R23A 4PU0A 5HF5A 4UM9B 2QRMA 1HSZA 1RCFA 2NTEA 3HDJA 1FU8A 3CT6A 1K88A 4PICA 4YJ2A 3BWXA 3FCAA 2PFKA 1XVTA 4KOAA 2QR5A 4YAFA 1WXDA 4MROA 4C9BA 5BV2P 4MDEA 2BTEA 1SNYA 2V3VA 2XDQA 2ZTSA 3OQIB 3QY9A 1II9A 3S5UA 1WS6A 3ZQKA 1B93A 2XNSA 4NR0A 2QM7A 2DUUA 4JL8A 3GEIA 5FPYA 4RACA 1NVVQ 2XUAA 1B14A 1POXA 1RWQA 5CK4A 3IAEA 1PV2A 4PYOA 3R7LA 1ZSVA 3TTTA 1LW7A 2XXBA 2VWQA 1GU1A 1S5PA 1Z5PA 4PGHA 1UOPA 2A5GA 1YV9A 4BLTA 1QK5A 4U9UA 4PONA 3U19A 4MYTA 4YUVA 5GM1A 4YCMA 1IHYA 2GPAA 2IYFA 4QO8A 3KYIB 5HFNA 5BN1A 1E9DA 2RAVA 4KZPA 3GLSA 3TN7A 3QMWA 2BD0A 3GVXA 2VRCD 1X7ZA 5CURA 4U0JA 3UK2A 1PJCA 4CYMA 1LTQA 3W06A 4JXZA 2VXYA 1J0DA 3E9MA 1NQXA 1UXJA 1V37A 2E82A 2WWTA 4K81B 4YAWA 3NGMA 1XO1A 1ENYA 3FHJA 1KO1A 5J2TA 4OUDB 5T4BA 4RULA 2AC7A 4FQ7A 1Q7GA 3FJOA 3UB3A 3N6RA 4E12A 1P44A 4F9GA 1FU7A 1NVBA 1CUDA 3WSTA 2FJUA 4UUQA 3NWOA 3LI2A 1COWD 4BRUA 4NCHA 4S04A 1MIHA 1Q74A 1T4MA 3UOAB 3IRUA 5CDGA 2C9BA 2QBYA 1Z17A 2CNDA 4Z1MA 1Z4KA 2GZ2A 2EYUA 2EBUA 1A77A 4HLNA 4QIHA 1NPDA 2ZVJA 4KU4A 4GR4A 5JEEA 1V5WA 2A7XA 1V8DA 2VR1A 3OWOA 4TSRA 4ZVKA 2R1VB 4Q1AA 3F3YA 3G0BA 4R40A 1ZD2P 1BJRE 1ZW6A 1KS2A 4K6CA 2HYIC 4I3HA 1JKJB 4TKUA 3DAGA 4CIWA 2ETXA 3UIEA 1G4AE 4HH1A 1RPZA 4F92B 3O3OB 3G5UA 4DDTA 2D5BA 2Z0MA 1RYEA 1L5QA 1B42A 1O7JA 1XT6A 5JSFA 1WTCA 2YZ7A 3K0FA 2JAUA 4NMLA 4DYVA 5EPOA 2X0KA 3V33A 3CF2A 1N1MA 4P3KA 2EHJA 1YJAA 4WCFA 1NMEA 2F2TA 1FDUA 4OAPA 1VIAA 4ZQGA 3WLNA 4CG1A 1QE5A 1Z28A 3M6IA 4YJ2F 1QOZA 4IGIA 2ZI5A 2RHCA 5EFZA 3TB4A 4FZJA 5MN6A 1WBBA 4IDPA 5TMEA 2E5WA 2REOA 4IIDA 4HTAA 3OQMA 2P1RA 3KHSA 2HGSA 4M1SA 4FLFA 2AFHB 3SX2A 2ZT7A 3AW8A 4PGAA 2HWWA 5I7HA 3LKZA 5BPHA 1T0IA 2GEKA 1IM8A 1JL3A 1QS0B 3RKSA 2EGHA 2X41A 2BFFA 3IQGX 5EHNA 4BMVA 4QVIA 1MU0A 3CY6A 3KKZA 3P20A 4REMA 4MVCA 5TXGA 3SKVA 5JSUA 2NX2A 4X1YB 2MYTA 1ZITA 4Y0NA 3RLIA 5JUWA 221PA 3IMKA 3NH6A 1MH1A 2Z6UA 1G7SA 3NM5A 2FMHA 1P62B 1KH2A 3Q2OA 2BY4A 2ZG6A 3ETLA 4JT2A 5DBEX 3ZE8A 2X0EA 4Q9JA 3S29A 2C99A 3OZBA 4G0ZA 2BSXA 2R44A 3FI0A 1AN9A 3GFRA 2PX3A 3GFPA 1VJCA 3OCCA 4MUMA 1RKQA 2IY8A 4QYTA 3RS3A 1E0JA 4JQYA 5JNRA 2ZB3A 2EZUA 3CRNA 3LWDA 5HUQA 2QTHA 4XUDA 1DAFA 2XHZA 3H04A 4YJHB 2VEOA 5A03A 4QLOA 1NY6A 5B3JC 5HF9A 1G8HA 3H2SA 2GEJA 4BVEA 2HQOA 1XYYA 2YWBA 4IDGA 4WLFA 4HNGA 5AOCA 3QEBZ 1QGZA 1JSCA 4YAGA 1RYHA 3EVNA 1IQ0A 1H8EA 3FHOA 3KSUA 3EHDA 3A6GA 1PL8A 4MKXA 3WLFA 2H85A 4QG7A 3KC2A 1P7CA 1Y80A 2BAGA 2BR5A 2FHSA 2SKDA 2XE8A 3BJRA 3C87A 4PC3A 3AVVA 2FETA 4R2HA 5ENZA 2V6IA 3U5ZB 1ISSA 4QDZA 1OZAA 4XCXA 4CR8A 3MHTA 4E70A 4W99A 1VLZA 2FSFA 1SZCA 2VUTA 1AGYA 3CWZA 3RRYA 3U3JA 1EUCB 2WE7A 5A04A 5LQAA 2XEDA 4TM7A 1IBKB 4JLAA 2YXLA 3OICA 3QPCA 3MFYA 2H2HA 3U7QB 1C0LA 5CDFA 3AETA 5FRDA 3GJZA 3NAZA 3Q0EA 4IHQA 2G06A 4PHGA 3TINA 1LCIA 1OWLA 1XWWA 1RM0A 1TVKA 4NI5A 5L7WA 1QK4A 1U4NA 4NQZA 4R2KA 3JD1A 4BWYA 2ZGVA 3OLVA 3FPEA 3GGJA 3H1TA 1MT3A 5GONB 3GAMA 4ROTA 1M3SA 1ZNYA 3D6NB 5J9FA 1KJ9A 3B2QA 2ZVQX 4TYPA 2BTQB 3Q11A 1DXYA 1MVLA 3C6YA 4RJIA 4WLEA 4BP1A 3IL2A 1I7DA 1NNEA 2J3IA 1IXZA 1JSRA 3TI9A 3V2IA 3GZTB 1H2AS 2W6QA 5KTRA 2PL1A 3OZVA 1GFIA 3ZDEA 3N76A 4D6XA 3GHYA 4TVBA 5KOIA 3K6SA 1PZEA 1XDGA 1G63A 4WNAB 2I03A 4RENA 4JLKA 1ORDA 3DBOB 1H2EA 4HR7A 4F93B 5DNCA 2F1KA 2NZWA 3C4JA 5ESRA 1X1DA 2I34A 2QE7D 3O8OB 3EARA 3NTOA 4TQ9A 4WCVA 3RYFA 4M9UA 4LA4A 3OE4A 4RW0A 3BE8A 3O93A 1BWRA 3SIXA 3F6YA 3TDMA 3I61A 1AB6A 4EJ2A 2DSTA 3WAJA 1ICEA 1J0AA 1R1DA 1F2UA 3A8TA 3DE3X 3L7CA 3CS3A 4LY3A 4JD5A 4UDNA 2DWQA 1BOFA 4OHFA 2HPZA 4D0NA 1QCZA 2JAOA 3E15A 3H18A 4YRPA 1XK7A 3QXJA 1J90A 3TW4A 3QG1A 2DWOA 5ALKA 1L4YA 1SQGA 2JFHA 2Z4RA 3CF4A 5C31A 5JD6A 4F9FA 3BRQA 4R9NA 3L7AA 2FRXA 5JXIA 1XRLA 3BXGA 3R2JA 2M1XA 1L7DA 2YICA 2HLDA 3AVPA 3KJGA 2IK8A 4MV4A 4CVNA 3NIBA 2H3EA 4LFBB 2OHGA 4OHUA 3PGA1 3TBKA 4G1MB 1KEVA 3UFXB 2H1FA 3PPWA 1YKFA 1R0ZA 1UPFA 1T4DA 2XXJA 3B51X 3E9RA 5BW8A 2OCLA 1IOLA 3IOCA 4AZSA 2R8BA 1DKQA 2WWFA 1IWBB 3ZV7A 2LDBA 2YYZA 1SQ5A 1W4RA 5BQFA 2Q5OA 4CKWA 1FW6A 1FU4A 4NNPA 1X3SA 3DOOA 1BXZA 2I1WA 4DR5B 4JA2A 4WADA 3I45A 1UMCA 4E2WA 1PFGA 1FVHA 4PX3A 3E3OA 1RIIA 5DM0A 3RYHB 2HWYA 3D0KA 2NNWB 3KQHA 1MMFB 2E1PA 4FFRA 1UBJS 4RBNA 1QXSA 1X74A 2WJAA 5C34B 4AWXA 3FLBA 5JNLA 2N1MA 4KR3A 1WXQA 8ATCA 4DRXB 1K7CA 3IMEA 1U5AA 3O38A 3WO1A 1AKMA 1U0LA 2ZTLA 4RA9B 1GRNA 3GV0A 1R8QA 3GUHA 5FP0A 4B74A 1V95A 3CRVA 1F0YA 4BBJA 5EC8A 1TCAA 1F9EA 3TLBA 1RNLA 2XT0A 1F8XA 3OF3A 1UKAA 4MQLA 1ISJA 2WF9A 1Z75A 4CIXA 1PF7E 3FOEC