5BT9A

Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
249
Chain Sequence
EARMVANCPVLVTGGARRIGKAIVEDLASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLEGDVRGLVKQASDRIGPIRLLVNNASLFQEDKVGALDMALWDRHFAVHLKTPVILAEDMRKALPEDQDGLVVNIIDQRVWKLNPQFFSYTLSKTALWNATRTLAQALAPRIRVNAIAPGPTLPSERQRPEDFERQVSKLPLQRAPELPEFGRTVRYFWENRSITGQMIALDGGQHLAWETPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Crystal Structure of FolM Alternative dihydrofolate reductase 1 from Brucella canis complexed with NADP
rcsb
source organism Brucella canis (strain atcc 23365 / nctc 10854)
molecule tags Oxidoreductase
total genus 92
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bt9A00
2DPHA 1E3EA 4BKOA 5L4LA 5B4VA 3T7CA 5JC1A 3AW9A 4J1NA 3TJRA 1LDNA 4IJKA 4CMKA 4O59O 5BSEA 4E33A 4IBOA 1VJTA 3Q1LA 3PZBA 3DZFA 1R16A 1ZK0A 3LF1A 2Y1OA 4XR4A 1MFZA 1Z6ZA 3AM3A 3RJ5A 4L74A 4CLOA 2B36A 1XHLA 1KVQA 2HLPA 5JAMA 1D1TA 2VUSA 3GLQA 3C7AA 4K6CA 1UUFA 4BHTA 2GN6A 2O3JA 1N7HA 3VDQA 2Y05A 2DLDA 4H16A 4W4TA 3DO5A 3AOEA 2OUIA 1YWGO 4K26A 2FZWA 1TT5A 3DC2A 2G1UA 3E18A 3RI3A 4E4YA 1E0DA 2VYND 4FOOA 5JLAA 1LJ8A 1UP6A 2YQ4A 4OGWA 4FS3A 3KSZO 4NBUA 4ZHSA 1GUYA 1YBVA 2DQ4A 4RZHA 3CZRA 3BIOA 4CR6A 4DL9A 4OSPA 2ZKLA 2UUOA 3U4CA 3PIIA 4LRTB 4CL3A 1C3VA 1C1DA 2CDBA 3AY3A 4ZVVA 1UZNA 4E0BA 3RU9A 3HUDA 4E2XA 2VWPA 5F5NA 1ZJZA 1P9LA 1GCUA 3PYMA 3WTCA 1LC3A 4FFOA 2PKRA 3EZYA 2RIRA 4CMIA 4HX5A 4UREA 1G0OA 3HADA 4XA8A 2FZEA 2C29D 4Q3AA 2B5WA 1WMBA 3AOEC 3ZW8A 2QYSA 4R51A 4YTEA 3GUYA 4XR9A 2W98A 2WMDA 4NJMB 3ZV3A 5FEUA 2AQHA 3MWEB 2NM0A 3FR8A 3JD4A 5JO9A 4KQXA 4YYZA 5KVSA 3PJFA 5JS6A 3K92A 2Q1TA 4DC1A 2B4TO 1G0NA 3TFQA 4F46A 1F06A 4W6ZA 1HDOA 2WYUA 5AXDA 2UDPA 2JFFA 3BMNB 1RYDA 3GVIA 4IXTA 1RPNA 2DU8A 1ULUA 2GN4A 3CMMA 3VVBA 5IDWA 4D42A 4IIVA 1DC6A 3H5AA 5T5QA 4DPLA 3NTRA 3ROMA 1A71A 2BKAA 4IS3A 5DCWA 3PLNA 1E6UA 3JQ8A 2B5VA 1SOVA 5JDIA 4PIVA 3VHRA 3GR6A 3Q0EA 4GLLA 1XSEA 1MG0A 1E77A 2VHYA 1GAEO 4FJ2A 3V1TC 5LC1A 2E48A 3GQVA 5FFFA 4OKNA 1D1SA 2PK3A 1FDWA 5KKCA 4B4UA 2W2KA 4QT0A 2E37A 5DCYA 3B1KA 3WMXA 4NFYA 1B14A 2ZYAA 1PQUA 2Q99A 2Z95A 3A14A 4II3A 4J90A 3PDJA 5G0UA 3NDJA 4CODB 3MEQA 3WG9A 3RSHA 1QV7A 4GQAA 2X9GA 5JAZA 1PJLA 3BMQA 5AOVA 4YQZA 4MO2A 1GZ4A 5G4LA 2XAAA 4GKVA 2EEZA 3PK0A 4XQGA 4LMPA 1HTBA 4LW8A 2PTGA 4CMJA 5DBFA 1E3WB 4K9DA 4CM8B 2WSBA 5JDIC 1JAXA 3N74A 4XJTA 1E3IA 2X0JA 1L7DA 1SEPA 1F8FA 2Q50A 4UVDA 5LCXA 3I4CA 1KIFA 2QRJA 2GZ3A 4ZQEA 2ZCVA 4JJFA 5JSFA 4RPLA 1UXJA 1HDZA 2AXQA 1CQJA 1KS9A 4Y98A 2FR8A 4CQMB 3IDSA 1U1IA 1KEWA 1TT7A 1U7HA 5B1YA 1QR6A 2VTDA 2EJVA 4DVJA 2HQ1A 4JJIA 2X9VA 3IKTA 4NBTA 4QX6A 1BSVA 3P5SA 3W4JA 1XU9A 2J3JA 1M6WA 3LT1A 1EVJA 2AE1A 1E1MA 2EGGA 3EDMA 4R4JA 5L3ZA 3F1LA 4Q3BA 3D4OA 5IN5A 2BGLA 1QP8A 1X15A 3LT0A 3PHGA 3PJDA 3K2BA 1R0SA 2IYOA 1HLDA 6LDHA 5DT9A 1Y81A 4MVJG 5J23A 4JQCA 1N1GA 1V35A 3DBLB 3GG9A 3EAGA 1T4BA 5JY6A 1QLHA 1H9BA 1UDBA 2ZQYA 4HKTA 1X13A 2OXIA 3CIFA 3KEQA 5I7SA 3IAHA 1GEGA 2Q2WA 3G3EA 3GNSA 4WUVA 4OO3A 4J49A 1L1FA 4TKLA 2PGLA 3AU9A 1T2AA 4TRNA 1Y6JA 4FN4A 4HFNA 5K6AA 4KUEA 4BO1A 4EUFA 3ABIA 5K0ZA 1YJ8A 3H5RA 3PJGA 1FDSA 3LLVA 3NJ4A 3PFWO 4PLCA 4RZIA 1VKNA 1UH5A 1EK6A 5GZ3A 3S1LA 2HJRA 3VKVA 1CF2O 4MP6A 4IJWA 4R3NA 1YBMA 2X58A 3WS7A 4F3YA 2FWMX 3S55A 4R1SA 1CDOA 4CQMD 1XU7A 3QWFA 4XYLA 1MP0A 2DTEA 1LLDA 1AXGA 4RVDA 1JW9B 1LQUA 1U3TA 4KWHA 3GGGA 3TPCA 5IF3A 5CPBA 5T57A 2ZJ1A 2JD1A 1Z74A 4WECA 4D79A 1YXMA 4XDYA 4IQ0A 5TX7A 4Q9NA 1NTOA 3Q2KA 4BOYA 1U9JA 3KV3O 1EQUA 1LXCA 3TDKA 3KRTA 4INAA 4Y67A 3WXBA 3E1KA 4TWRA 3L77A 1WWKA 1UXIA 5K6AC 3S2GA 1DIBA 4Y6SA 1R4MB 1ZEJA 2IYPA 4JGBA 5COQA 3U3XA 3R0IA 4XB1A 4YQYA 1BW9A 1U2GA 4MOWA 2EG9A 3IOYA 4UUPA 4K6FA 1HE3A 4EI2A 2AMFA 2NV6A 5EQFA 3KSDO 4PRLA 5DZSA 1A4IA 4IDDA 4WCFB 5CP8A 1V8BA 2FR0A 2H1SA 3WGYA 1DAPA 3DZBA 3ZNOA 3OHSX 1FJHA 2VNSA 5A04A 1F8GA 4XKJA 3GH3A 3E48A 1K6XA 4UVIA 1B8UA 2GR9A 3DAPA 4KTTE 2O3QA 3BTUA 3DFZA 3MTJA 3O26A 4I5GA 1B16A 3TL2A 2DTDA 4PVCA 3BTOA 4GH5A 5TIIA 1X7HA 3U49A 4BO3A 4RL6A 3UF0A 1OC4A 3F3SA 2VOJA 3LZ6A 4DIBA 1UXHA 2VWGA 2NVUA 2GGSA 3TOZA 1UP4A 3OA2A 4BMNA 2ZB8A 1FDTA 3BMOB 4CMEC 5IZ4A 1ZSYA 4Y9DA 3TOXA 5DN9A 4M49A 3JD2A 3DTYA 5L9AA 5L45A 4YJGB 4YRAA 1HLPA 4JCOA 3NGLA 1B0AA 4IDGA 2BRUA 1K6IA 4U0JA 4BGVA 3HNPA 3A9WA 3PRJA 3W8FA 1N2SA 2UUPA 4H7PA 4J43A 3WGQA 3A06A 1PQPA 1LLQA 2P2SA 3OA0A 3STHA 2X0RA 1PR3A 1ENZA 2ZYGA 3E5RA 4J4HA 2QX7A 2C2XA 3VTFA 2PGJA 5CHEA 5AQ1A 1JWBB 2CDAA 4BUCA 3DFUA 3UCFA 5C5IA 2JHFA 1PJSA 4IS2A 1CQIA 1R66A 4MP8A 3RROA 1E3SA 1X7GA 3MJEA 2FPPA 3MOIA 4D3FA 4IXWA 3ZWCA 3FNHA 3G17A 3ITKA 3OETA 4PLZA 4CV2A 1HYHA 3QV1A 1DXYA 2IXAA 2CSUA 2B4RO 1M6HA 3I9OA 4UULA 2VYVD 5CDYA 3JTMA 3JQ7A 4BNZA 4K1LA 1OBFO 3W8DA 1P45A 1MUUA 2ZIZA 1E7SA 2ZTVA 1Y8QA 4A26A 1ZJYA 5ENVA 3E03A 3L6EA 2PZKA 5ER9A 2I66A 3MTGA 4D45A 5BNTA 4F45A 1E7WA 2Q49A 2HJSA 3WB9A 5HTOA 2JAHA 1X1TA 1YDEA 2HKIA 3C24A 3MJ4A 4PGFA 2YHUA 4LMRA 1R4NB 3AI3A 2HMVA 1DLIA 3VZPA 3BZUA 2EKPA 1PWZA 1NNUA 1DBVO 2Q2VA 1NPTO 1XKQA 1DIGA 5ITVA 3HE3A 1NQOA 5L53A 2TMGA 3ST7A 3AFMA 4HUJA 2PD4A 4IINA 1XCBA 3DZJA 1I36A 4GWGA 4G81A 1NFFA 2IE0A 3E9MA 4D7AA 4J4TA 1BDMA 4GKBA 3TL3A 2NNLD 5A03A 3PQDA 4G65A 4HADA 4BV9A 4BNWA 2BFOA 2ZK7A 3U4HA 3ZHZA 4OH1A 3SJUA 4LN1A 4RO0A 1I2CA 2IEDA 4U0KA 1H93A 4B4WA 3ASVA 1RM5A 2BF7A 1AGNA 2YHIA 1SB8A 2BGMA 3UXYA 4WCDA 1AN9A 1I33A 4YJFB 1Z7EA 3WNVA 3LSYA 1FDVA 1NBOA 2EJWA 4JP3A 3EHEA 3D1LA 4YRDA 5IZCC 5JO0A 2PGDA 1LDEA 5TJHA 3W4IA 2NQ8A 4I9UA 1WNTA 3PYLA 3IL2A 4GPD1 1QV6A 2NQTA 4EBFA 1YBAA 1IB6A 3ETGA 1O0SA 1PJ2A 2O3RA 4PFJA 3CPSA 3PPIA 1LSJA 3ROPA 1QSGA 3TN7A 4ZN6A 4OYRA 4AICA 2FPGA 1WW8A 2B83A 4GGOA 4OJNA 1LX6A 4WLUA 4EJMA 1XELA 1NHGA 3I6IA 2RHRA 1JTVA 2GDZA 1OC2A 4KDFA 3VPFA 3DAFA 4XYGA 1WAMA 3K73O 5DULA 3D5TA 2VNAA 4RLHA 1PJBA 3UVEA 3MOGA 1B26A 4B79A 3WOHA 4CLOB 4BO2A 2UVDA 3ICCA 1LC0A 4UEOA 1T2EA 1BXGA 1EVZA 3R3SA 3PYXA 1DPGA 2YZ7A 3DBRA 4PLWA 3GN2A 2BI8A 1AE1A 1QXSA 5A3VA 1AXEA 3D5QA 1TT5B 3H8VA 3ZHYA 1NAIA 1EUZA 4DUPA 5L40A 4BKUA 2ZYDA 1RYEA 5G0WA 4BNUA 4Z3KA 4LSMA 2QW8A 2HRBA 3R3JA 3I4FA 3KYCB 4P8RA 5FYDA 5AXAA 4ALKA 1NQAO 4UAGA 2X1HA 1D7OA 3Q2IA 4LCJA 2R6JA 2ZATA 3RUHA 4NIMA 1UAYA 3GVPA 3PTZA 2Q1UA 4GMGA 3WWYA 1L7EA 2HUNA 4J6FA 5A9TA 5JW6A 2VHVA 1EZ4A 3AU8A 1C0PA 3UHAA 5KWEA 1KC1A 4E6PA 4YCAA 4PLHA 1I10A 2BFMA 2NU9A 4CMIB 2WYWA 2OL4A 5I7FA 2OORA 5C7LO 3ETEA 1Y9AA 4QTZA 4J2OA 1PL8A 2YUTA 1GUFA 4IPTA 1UR5A 4H3VA 1V6AA 2YW9A 3UKOA 2Y66A 3WGOA 5AXBA 3DOOA 4DWVA 5BT9A 3RUCA 4BNVA 2ZTMA 4D41A 4CJXA 3SVTA 3INTA 4EGFA 3D3WA 3DB2A 3MWDB 1NFQA 1WVGA 1X1EA 1KOLA 4BNXA 3CH6A 2CF6A 3EZLA 5I8ZA 4IZHA 3AOGA 1CETA 1PJ3A 4YJHB 5EESA 2AA3A 1V3UA 1I8TA 3KBOA 1A9YA 5KTKA 4DA9A 3V2UA 2A9FA 4XX0A 1O94A 2E49A 2JKVA 2JL1A 3AJRA 4ZQGA 2Q1WA 3JQ8B 5IJZA 2Q3EA 4ZU3A 2IZ0A 3PZRA 1IUKA 4LK3A 1MC4A 1VJ0A 2QG4A 3G1UA 2GNAA 4LVUA 3RUIA 3UCEA 1PZHA 2Z1MA 1A4UA 3QWIA 2NU6A 4XD2A 4YAEA 2FMUA 2WDZA 4R9RA 2D3TA 3C7CB 2W2KB 2CMDA 4XYBA 1XEAA 3H9QA 3PQEA 5A05A 4J0FA 3RJ9A 8ADHA 2WYVA 1Z73A 4BB5A 3WQSB 3L9WA 1LI4A 2PZLA 1ONNA 5KIAA 1BMDA 2J5KA 3GGPA 4TRRA 5CFZA 3DHYA 4AJ1A 4FGWA 5G0SA 4R01A 4QEDA 4BNFA 4XWYA 2EW8A 2DUWA 3OICA 4MJLA 4CM5A 1NQTA 4WLFA 1O8CA 2Q1SA 1U5AA 4IQGA 5I9MA 1ISMA 2VRCA 5COBA 1DIAA 3I9JA 2O4CA 3KZVA 1SEVA 3QY9A 1KVUA 3LC1O 4R9SA 4D0RA 3A1NA 3IC5A 3JQEA 3FPLA 4FCCA 1JA9A 1XLTA 2CF5A 2CVQA 3ZWAA 4A2CA 2EV9A 3ONDA 1GEEA 1OFGA 5L51A 3S8MA 1LLUA 1NXQA 2WM3A 2SCUA 4N7RA 1NVMB 1A72A 1QYXA 4R16A 2ZB7A 4CPDA 4PG4A 2QZ9A 4RGBA 5EIOA 1YOVA 2WWRA 1W4ZA 4OKIA 5HS6A 4BNKA 4F6CA 1P1RA 4OIMA 1H6BA 5ICSA 1DAOA 3RC9A 2XPCA 1EFKA 3IQDB 2VUTA 1A9ZA 4CR7A 3C1OA 3QQPA 1ZUD1 3GN1A 4BS9A 3H4VA 1NQ5A 1X14A 5TF4A 5LDGA 5U1PA 4E5PA 1ZH8A 1Q1NA 1R0KA 4CM9A 1U5CA 2P5UA 3E5MA 2D2IA 3AM5A 2DAPA 1PL7A 4FC7A 4CLRB 2PNFA 2OOSA 1ENOA 3NT5A 1YQXA 1ZK3A 3CTMA 5B12A 5L4NA 1ISGA 3QVOA 4IDCA 1HF3A 4JBIA 3B6ZA 2GYYA 1DC3A 4R41A 3CKYA 4LSWA 3NTOA 2PH5A 4KP7A 1MXHA 3ZU4A 3JQAA 3F46A 1J6UA 1WZIA 3FTNA 2D8AA 3RFTA 3BAZA 3PEFA 4FDAA 4OOEA 3L6OO 4NI5A 1T24A 2GZ1A 3GF4A 4B3HA 2J8ZA 2P9CA 1B8PA 1GFSA 1VL8A 2C59A 4ESOA 1W8DA 4CMAA 2Y1GA 2F1KA 1LA2A 1JWAB 3ZU3A 5ES3A 2DPGA 3VKUA 1RWBA 2I3AA 4Z0PA 4F6LA 2NLOA 2WEKA 1T1SA 3DR3A 3PHJA 1O6ZA 4I08A 3JYOA 5A02A 1ONOA 1Y7TA 5IN4A 1FXSA 2VWHA 4DRYA 1LEHA 3PLRA 5U9CA 1ML3A 1NX6A 1XQ1A 4P4GA 4XGIA 3ZCXA 3DDNA 2DT5A 4NBRA 3HFGA 4NH4A 3TWOA 5COAA 3GC6A 3DOJA 1U4SA 3JCZA 4XIYA 4YACA 3HDHA 3ZV6A 2WD7A 4E5NA 2J3HA 1N9GB 4FFLA 1ZK1A 3KOUA 3O38A 1GD1O 1DC4A 4U5QA 3RCBA 1QLJA 4IDBA 4ZQFA 1R6DA 4JX8A 4URFA 4XRGA 4Z3DA 3WFIA 3RC1A 3FR7A 4YEDA 3QVTA 3IP3A 1Z45A 1BDBA 3ZWBA 1CWUA 1EE2A 4OL9A 1SO8A 2X4GA 2H5LA 4FOSA 2X6TA 4IMPA 1A5ZA 4OXYA 3NAQA 5F1KA 5IDYA 2I6TA 4B7UA 3H3FA 4TROA 4ZA2A 3PWSA 1KERA 2AEMA 2NU7A 4RPJA 5DCUA 5MGBA 1WDKA 3DL2A 5JBIA 3AUTA 4OQYA 3NDIA 2P68A 1HYEA 3GRKA 4B8WA 4OSOA 4P38A 4GLOA 4ITUA 5ENDA 2HK7A 4ZQHA 3DZHA 5FI3A 1MXFA 2VOEA 4O5OA 2Q46A 2DM6A 2ZTUA 3QWAA 1HYGA 1ENPA 4DREA 2X8LA 5GZ1A 1GADO 4TRJA 1C14A 3S2IA 4P4NA 1DFHA 5DP1A 4UEKA 4NFSA 4DQUA 4R1TA 5I7VA 4E2ZA 4ALMA 1EDOA 1ZFNA 2E6UX 3D0OA 3K5PA 5KJ6A 3X2FA 3GMSA 4UUOA 5EMHA 1BTOA 3M1LA 1GTMA 4J2HA 1ADFA 3QHAA 1EE9A 4RF4A 5T8KA 3JD1A 3PHLA 4FQ8A 2NTVA 2OZPA 3ASUA 4Q3EA 4KTVE 4QUKA 2C7VA 2Y67A 1E1LA 3BYZA 3LC2O 4ZRNA 3HFSA 2CDCA 3OEWA 3LYLA 3HN7A 5KKAA 2PZMA 3AUAA 2POQX 3IS3A 3JYNA 3RC7A 3CE6A 5EERA 1I3MA 2CFCA 2BLLA 1ZVMA 5MDHA 1YDWA 1U4OA 4WEOA 3C1TA 4IDAA 1D3AA 4D3DA 4WPGA 1PQWA 1CEQA 2R00C 3JQ7B 3N7UA 5KOIA 2I5PO 4WLNA 1DFIA 3FHLA 3B1JA 4J7CA 3NUGA 2JAPA 4GVXA 4QECA 5JC8A 3S2FA 5L7WA 2J3KA 1G6KA 5KJFA 1YKFA 4GSKA 1E6EA 4JBHA 5T8KC 3WQQA 4BMVA 2G17A 3LVFO 3WR5A 3N58A 4CL8A 2G76A 3BHJA 2O4UX 3ZNPA 1EUDA 3BXXA 1U7TA 3WIEA 4YR9A 4MVJA 2FP4A 4E2WA 1EDZA 2RBEA 5CDTA 1ENYA 3VZQA 4BNYA 4BO4A 5B4UA 4BKPA 1PL6A 2WD8A 1EFLA 2C2YA 1HEUA 3LT2A 1GYRA 4ZGWA 3RC2A 2FRDA 4OQZA 2UYYA 4AJOA 4GX1A 3HDQA 3G1TA 3OP4A 1N92A 4QSMA 5A5EA 4L73A 5G4KB 3F5QA 3JQBA 3X2EA 1Y8RA 1W73A 3RD5A 2P5YA 1ADCA 4R3WA 5KNLA 1UJMA 2X5KO 1KEVA 4R1UA 2I76A 3M2TA 4HP8A 3WYCA 9LDBA 2QZZA 2C7GA 2RAFA 1GPJA 2Z1NA 2Q4EA 1ZSNA 1G1AA 1NAHA 2IZZA 3DONA 3GZNA 3SC6A 4Q39A 4YAKA 3WX0A 4BKQA 3F47A 4X54A 3JYPA 4GX0A 1JKFA 4PG8A 3KYDA 4OXNA 1SBYA 2DFDA 3GEGA 2FPIA 1HDCA 1P74A 3KM0A 2Y0DA 1V9LA 2I67A 1JVSA 4E21A 3TZQA 1J49A 1O89A 1Q0HA 3PHHA 2D5AA 3WWZA 1WXDA 3VOSA 4OOFA 4CUJA 2J3IA 3JQBC 2NWQA 3JQ9A 3HQ4O 1C0IA 4TZTA 3H9JA 3RU7A 2FHSA 4NJOA 4NQZA 3DBVO 4DIOA 1T1RA 2YFHA 3BMCA 3TSCA 3HDYA 4PLPA 5BR7A 4XCVA 1U28A 5CEJA 3KO8A 1HL3A 4CMEA 3AI2A 3V2GA 3I5MA 3E9NA 2NADA 4BO6A 4ZRMA 4YT4A 4AJ2A 3MZ0A 1Y5RA 3UCXA 5ILGA 3WTBA 1LDMA 3W1VA 1X7DA 1GR0A 3GDFA 5K9ZA 2A4KA 5KJEA 3RBZA 2Z5LA 1KY4A 4PLGA 1NP3A 3I83A 1I32A 4XGNA 4RF3A 3ZNQA 3Q11A 3W4KA 1ZKMA 3JQ9C 2FN7A 2V65A 4DMLA 1HDRA 1HT0A 3IP1A 1GV0A 4FW8A 4WK6A 4BNIA 3RUAA 4YWJA 3NV9A 1GZ3A 4PLYA 2D59A 3DBRB 1NYTA 4FGSA 4RCVA 4HY3A 4YAJA 1GQYA 3MJCA 3O8QA 4A03A 3U9LA 4BQRA 3QVWA 5DOVA 1R0LA 3ADPA 1LDBA 2FR1A 3CUKA 4CM4A 2PA3A 5F1PA 1EK5A 3BMNA 4JLWA 4BGEA 3PVZA 3SX2A 2VTEA 3ONFA 2GCGA 4PCVA 1D4FA 2NVWA 3JV7A 3QSGA 2XOXA 4PG7A 1GDHA 2IDZA 5EPOA 2JD2A 1JU9A 2X0NA 2HMWA 1MC5A 2NACA 2PR2A 2IRWA 3ADOA 1YH3A 3WQRA 1LSUA 3WMWA 4CQLB 2CUKA 4KQWA 5A06A 2B69A 5BSHA 1PWXA 2XF8A 4AJKA 5JMPA 2GRAA 3U62A 2X7HA 3LK7A 3GT0A 5THKA 4NU6A 2QHXA 1DO8A 3VH4A 2O48X 2AQIA 4S3MA 2DC1A 2OGUA 3ON5A 3GVCA 4S1VA 3HG7A 1OZAA 4Z9YA 1BXZA 2NVBA 2JFHA 3UW3A 5C3MA 3GK3A 5GMOA 3FWZA 1T4DA 1XR3A 1QORA 3GHYA 4FFNA 1WZEA 2B0JA 1VSVA 1PS8A 1PEDA 1VPDA 1YGYA 2FY8A 4L4RA 3GRPA 4TSKA 1E3WA 2O3SA 1C1XB 2Q4BA 4RLSA 4IDFA 3OIGA 3ENNA 1YB1A 4A10A 3FI9A 4D43A 2X0IA 2O2YA 2BELA 3GA0A 1VJ1A 3HJAA 4QO8A 3EVNA 1Q7GA 3KHUA 3OH8A 2PLAA 3EW7A 1KEPA 5IXSA 4OAQA 4CQMA 3WGIA 1U3UA 4OXKA 4FJ1A 3GNQA 3B1FA 4WEQA 3C7DB 3KLMX 4ZQBA 4FBGA 2NU8A 4R68A 2WE7A 3LLSA 2DBVO 3RAJA 1YONA 4AJ4A 4UVHA 2BFPA 1HXHA 3H6KA 4PLVA 3GHHA 2ZB4A 5IZCA 2PKQP 4QFCA 4CLHA 5A1TA 3K96A 4C7KA 4J4BA 1NHWA 3NRCA 1KEUA 1P1KA 1ZZEA 1HRDA 3QVXA 2YFQA 3JQFA 4DIFA 1PTJA 5F5LA 4BMSA 3DBLA 1LRKA 1Q7CA 4M1QA 1VSUA 3F9IA 1ZBQA 4AVYA 4B8ZA 2VZ0A 3O4RA 4HNGA 3Q6IA 4HBGA 1J0XO 1HWYA 2JJYA 3D3EA 3GVXA 2Y1CA 2HRZA 4CLXA 1ZEMA 3V8BA 2X5JO 4XDZA 3WNQA 3OIFA 4U6QA 5IG2A 1QYWA 5CPFA 3RBVA 3UOGA 1BWSA 4LRSB 1NVTA 4IIUA 2Y0EA 1S7CA 2RHCA 3NGXA 4I5EA 2H63A 4DTIA 3Q3CA 1RM3A 4IMRA 3EVTA 4IGFA 3ULKA 1FK8A 4CM3A 5I9NA 3CMCO 5CDSA 3TFOA 5ILOA 1VI2A 4O63O 1K3TA 4JIGA 3JQFC 3MJVA 3ORFA 2OP0A 2O7QA 3IJPA 4I9NA 5A9SA 1E5QA 2HAEA 1YOVB 2YQ5A 3MJTA 1LSSA 2EP7A 2YV2A 3K9QO 3HN2A 3P19A 3ZWPA 1EVIA 4Q3NA 5TJ9A 5EJ2A 2AHRA 1YRLA 2Y93A 3RASA 3ZN2A 4BO0A 3GOHA 3GMDA 4HFRA 1WPQA 1T2FA 4DXHA 3UN1A 1I30A 2B35A 3AI1A 3B20A 4RVHA 1P1FA 4U8GA 3P7MA 5BSFA 4PLFA 3FNFA 1FF9A 1DIRA 3FSRA 1B3BA 4WJZA 3PJEA 3D4NA 3L0DA 4XZ3A 5F21A 4M8SA 4E13A 1QRRA 2EF1A 4BNLA 3MJSA 2DBQA 4WCFA 2Y68A 3OJFA 3M6IA 3VZSA 3UUWA 3QA9A 1PGQA 3JQAB 4J16A 3ANMA 4J7UA 3EC7A 4OHUA 5TNXA 4AJJA 2XXBA 3WJ7A 3DZIA 4MKZA 2DBRA 3U5TA 3INGA 1VC2A 4D44A 4D0SA 3ONEA 3H9GA 2FOIA 1MGOA 3GPIA 5I7EA 3WICA 2B4QA 2UV8A 4RF2A 3ETDA 4I5DA 4ND5A 3T7EA 1NPYA 2OBNA 3RUEA 4RJTA 3UGKA 4UUNA 5KCZA 4RORA 1IYZA 2VYVA 1DRWA 1GPDG 2I9PA 3FF4A 3NTQA 3QJ5A 1ZSVA 5H82A 4BNHA 3R6DA 5G2OA 6ADHA 1C1DB 1YL7A 1VL6A 3BMOA 4MIOA 4ND2A 4DLLA 1SC6A 1ZK2A 4WCFC 1V3VA 4BNGA 1PZFA 1KVSA 4AG3A 3E9QA 4Z9FA 4CMCA 4R69A 2QYTA 1ZXBA 4WNIA 1LRLA 1I2ZA 5AXCA 4FFRA 4CM9D 2AEJA 4CV3A 4BV8A 5CDGA 3RUDA 3I9NA 1QMGA 4Q3CA 5KVQA 5FI5A 3ZW9A 2OP1A 2WD7B 1IPFA 1N8KA 3E6AA 1GQQA 4PZDA 3P2YA 1GU7A 4CMHA 2R2GA 2LDBA 3VH2A 4MKXA 3IMFA 3FTPA 4YXFA 3VC7A 2W2LA 1FMCA 1DHTA 3JQAD 3CSDA 2CVOA 2ZTLA 1WP4A 4WLOA 3AWDA 1XA0A 1PJTA 2OBYA 3G0OA 3PQFA 2C54A 3FCOA 1SAYA 1PJ4A 4HFJA 1QYDA 3ICPA 3L4BA 3C85A 1H6DA 1XDWA 3TRIA 2Q2QA 3ZWYA 2W90A 3GFGA 3ZWMA 3OECA 4W7HA 1XYGA 5F3RA 1WDMA 1GZ6A 1Q2XA 1T2CA 3KUXA 2FSSA 3LDHA 4XQCA 3EK2A 4ND4A 2HSDA 5LDHA 1I01A 4J9VA 3DMTA 3WGHA 1LTHR 3KXDA 5B37A 4B4VA 4YAGA 5DP2A 3BMQB 2V6FA 2OMEA 3L4BC 4RQUA 4GX2A 1ID1A 2IODA 4NDNE 1F0YA 3BA1A 3ZWXA 4LISA 4EITA 5IXYA 1CYDA 1MV8A 3OF2A 5FWNA 4TZKA 2C07A 4AL4A 4ND3A 5BNIA 1C0LA 1LUAA 1PX0A 5JDCA 2X9NA 1DIHA 1SPXA 4ZD6A 3HHPA 3DZKA 1B3RA 3I6QA 3RFVA 2D4AA 2D0IA 2HO5A 4Z6KA 3JQCA 3ZU5A 5CG1A 4PRKA 5FF9A 3IIEA 5JXWA 4HXYA 3WGZA 2Y1DA 8LDHA 1HE2A 1NR1A 2GPTA 3ZDFA 3AY7A 3ZV5A 1VE9A 3DBHA 3DMTC 1KETA 1BVUA 1X0VA 4N5LA 3DEYX 1K2WA 3ZGYA 2EW2A 1KVRA 4CMBA 1MA0A 4EJ6A 5IDXA 3GG2A 4J1TA 5DBGA 1XGKA 3VPHA 3EMKA 4YA6A 1H2HA 2I65A 3I1JA 3QWBA 4IY1A 4YVFA 5JCJA 5JDCC 4ONEA 4EW6A 3ANNA 5JAIA 2GN8A 1VKOA 3DHNA 2EHDA 3SLKA 1BG6A 2BH9A 3HWRA 5HS4A 1PGOA 3I52A 4L76A 4II2A 3F6YA 1F17A 1NVGA 2YY7A 4BNMA 1OAAA 1PZEA 5DF1A 4ND1A 5DOZA 3SBOA 3WIDA 3FNEA 2IEBA 4FPXA 4B4OA 4DLBA 4RF5A 1ISIA 2G5CA 4HFMA 3ROQA 4BQPA 3QWHA 4EUEA 1PGJA 3NJ8A 4W7IA 2VRBA 4E5MA 4RQTA 4XYEA 3ANLA 3L6DA 1P77A 1OMOA 1Y8RB 3KTDA 1SOWA 4BNJA 3DAGA 5CEFA 1M2WA 4BGIA 4TVBA 1U8FO 3GPDG 4NBWA 3GDOA 3I23A 5L95A 5BNFA 4L4SA 1EBFA 5U4QA 4C4OA 2Y0CA 1E3LA 3GZNB 2AQKA 3GZ4A 4M55A 4AJEA 4TMFA 3WSWA 2C0CA 1P0CA 3I9MA 1HZZA 2JCXA 2VHWA 4GL4A 3KYDB 3HB5X 4ZJUA 4K28A 4TKMA 3MCVA 3CINA 1U8XX 2HMUA 4EDFA 3GNTA 5I9LA 5IDQA 4KOAA 1CERA 2EKLA 3JSAA 1BRMA 1IZ9A 3H2ZA 1EMDA 3VDRA 1ZNQO 1UP7A 1BW9B 3PP8A 3IUPA 4EUHA 2DFVA 4PG5A 1NR7A 4MVJD 3GEMA 3BMCB 3F5SA 5KVVA 4DBVO 3QP9A 4GMFA 3KYCA 2Y99A 1H9AA 1LRJA 1YS4A 2I3GA 4J1QA 4PLTA 3RWBA 4WLVA 4XGKA 1YVEI 2B37A 1ARZA 1Z82A 3DQPA 4TVOA 3K31A 4DLAA 3INRA 1YE3A 4UUMA 4EZBA 1UAGA 1D8AA 1EVYA 2D1YA 4FSHA 2HK8A 3AY6A 1A7KA 4BNTA 1W6UA 4TRMA 2DBZA 3KB6A 4MVJM 2EXXA 4IUYA 3JD3A 2CD9A 2UAGA 3RKUA 4CV1A 3E82A 4MP3A 3FRJA 5L7YA 3R1IA 3D7LA 3TZCA 3V1UA 4E2YA 2NVUB 1IHXA 2VT2A 2C5EA 4RPHA 1TI7A 3WSVA 5JYEA 3H65A 1CIVA 5TRTA 3O8QB 2GASA 3RIHA 2RH4A 4CM4B 3CEAA 3WGGA 2BHLA 4G2NA 4NMHA 3KSUA 4NK5A 1O9BA 2X5OA 2EERA 4YJHA 4AJHA 1J4AA 3TZKA 2PD6A 2C5AA 1UXKA 2O23A 4DGSA 3AUSA 1YJQA 2R00A 3QVSA 1UDCA 4RPGA 2AG8A 5JYDA 3JQGA 1JAYA 2XXJA 4E3ZA 4FFMA 2PKQO 4B3JA 4A27A 4W82A 2HCTA 3VZRA 1A7AA 3L07A 4U7WA 2BMAA 2E4AA 2V6BA 3A28A 3AFNA 5CG2A 3OMLA 3UAGA 3ZWWA 3GAZA 2V6GA 1JVBA 5KJCA 2DUUA 3HB4X 3AK4A 2CZCA 3PGJA 4G5HA 1BGVA 1H94A 4KZPA 1H0KA 1KC3A 1GY8A 4D3SA 2PWZA 1R12A 1NWCA 2VQ3A 2VUUA 2P4QA 2WE8A 2EKQA 1Y9EA 3GDGA 1ISFA 3PXXA 3JD0A 4L9RA 2AQ8A 5T6BA 4D46A 4CR8A 2YV3A 4Z0HO 4YAIA 4JROA 4RV9A 1PS0A 3PIDA 4GI2A 4HNHA 3ZH2A 5TT1A 1Y8QB 3TNLA 2VWQA 3ZI0A 1DC5A 4DYVA 4A7PA 3CZMA 1VLLA 4ALIA 2VZ9A 3SEFA 4QFDA 2WTBA 4I5FA 4DMMA 1GL3A 1YL5A 3RQSA 3ITDA 1X0XA 1I3LA 2HMTA 5T67A 4YBZA 2VYNA 3ZZNA 4CM7A 2BFAA 3JYLA 3JQ6A 4R5MA 1TEHA 1EQ2A 1MG5A 1U3VA 3L4SO 3COSA 3LF2A 3FPCA 1MX3A 2HK9A 4MDHA 4WNCA 1Q0LA 1B2LA 1V0JA 2GUGA 3PDUA 4XRRA 2VT3A 1IL0A 2F00A 1YB4A 5A4DA 5TSDA 1AHHA 1YQGA 4GAEA 3BHMA 3OJOA 3PWZA 1OI7A 4GWKA 1TXGA 2O50A 3PHIA 3SLGA 4Q3DA 5GZ6A 2EWMA 3BHIA 3ZWNA 4LGVA 3O9ZA 3G49A 3RKRA 3Q9UA 3B70A 5KJ1A 2JHGA 3H9UA 4NHEA 5BSGA 4IQ8A 4MVJI 3C8MA 1V3TA 3WLFA 1IPEA 2YJZA 2GSDA 2ZQZA 4YDRA 4CLRA 3ZHXA 3DWFA 5IAAA 2QQ5A 2AW5A 2YHIB 2FSVA 3V2HA 5A3JA 4I9HA 4E30A 3D64A 3V5NA 3W6ZA 3LC7O 1LSOA 2YYYA 4AJLA 5AVOA 4BO9A 4KWIA 1Z75A 4BL5A 1UDAA 2GN9A 4RVGA 1C0KA 1NFRA 4FJ0A 4W9NA 1S6YA 1DB3A 1JN0A 1P31A 1M66A 1RM0A 2H6EA 2PZJA 4WGGA 3WFJA 1VM6A 4EEZA 5A9SB 4BNNA 1SZJG 4CUKA 1TB4A 4LCEA 5EL0A 1AUPA 3GEDA 2NUAA 4NR0A 1E7YA 3UICA 1UXGA 3PFFA 4M87A 2OHXA 1K5HA 1IZ0A 3TZ6A 4RDIA 4AJPA 4WKGA 3FD8A 3TQHA 4E31A 3VPSA 3WDSA 5I8WA 3I9KA 1DFGA 1B15A 2DTXA 4UVEA 4N5MA 1IY8A 3V1YA 3DTTA 3GVHA 4NPCA 3ROKA 4J0EA 1ONPA 2J5RA 4JJGA 4M86A 4N18A 4EEXA 3OM9A 1HSOA 3UFXA 2ZCUA 1O95A 4IDEA 5TGDA 5HA5A 4GBJA 1F14A 4MVJE 4W9NC 2G0TA 1BXGB 3H2SA 2GZ2A 1N9GA 4NJMA 4NZ9A 1NASA 1WDLA 1P1HA 5T64A 3D4PA 4CLEA 4NBVA 4QXMA 3CXRA 5JMWA 2QIOA 2NSDA 4XYMA 3U4DA 1H2BA 5ER6A 2IXBA 2CY0A 4UEJA 4E12A 1TLTA 4DPMA 3VAZA 1P1JA 4CM6A 1IE3A 4J91A 4BKRA 4O1MA 3T4EA 3A4VA 4HWKA 1UZLA 5TS3A 3DHEA 2O2SA 1YO6A 1IOLA 4NG5A 5JCXA 1K0UA 4L75A 2P4HX 3P2OA 1P44A 3TF5A 3NDRA 5BQFA 3WJAA 3KYBA 1HDYA 1JDJA 1GV1A 1H6CA 1I2BA 1ZK4A 4PG6A 3ZWVA 4DYDA 3T4XA 5JY1A 2V6MA 5TQVA 4YRBA 3H3JA 3S2EA 1GUZA 1I5RA 4J9UE 1PJCA 4XIJA 5JNLA 3WBFA 2W4QA 5DNAA 1O5IA 5JFOA 3BTSA 1Q7BA 1Y1PA 4JK3A 4E32A 2P9EA 4M89A 4Y8VA 4O6VA 2EP5A 1OOEA 4MVJH 4ROSA 1GQ2A 5F1OA 4XB2A 4UVGA 3VTZA 1T2DA 2BD0A 4Z9XA 2EIHA 1ORRA 4B7XA 3D3WB 5A5FA 4YT2A 1HDXA 1RKXA 2NTNA 3QE3A 1XG5A 3K6JA 1N5DA 4CMGA 5G0VA 2IZ1A 4P22A 4CM8A 1E1KA 3EY4A 4RVSA 5EQDA 4O0LA 4DQXA 2HU2A 4W99A 3KETA 2AE2A 5IFLA 2Y1EA 4C7JA 2PD3A 2ILTA 1Z7BA 1AHIA 2WJPA 4EYEA 4JNKA 3DZGA 4I1IA 1E5LA 7MDHA 2VN8A 4ALNA 3EGOA 1T26A 4RDHA 4YT5A 2AG5A 2QRLA 5THQA 2X23A 4ILKA 2AEFA 3ZNNA 2VZ8A 1R37A 1KVTA 4KUGA 1HZJA 1J5PA 1CJCA 3FNGA 1NPDA 4A0SA 4A73A 4AJNA 4RVFA 4KMSA 2O7SA 3C1AA 1TVEA 1SCUA 1B8VA 4WLEA 2NTJA 3F4LA 1M76A 5AYVA 5C7OO 1PGPA 4FIZA 4YPOA 4BO8A 1KBZA 3ZWOA 1QKIA 1U3WA 4U6SA 3QIVA 1LLCA 3WYBA 1JQBA 4JBGA 1P33A 1N1EA 3GFBA 1SNYA 4YB8A 2W8ZA 3IUSA 2J5QA 4PVDA 2LDXA 1E1NA 4B7CA 5EINA 1E7RA 3HDJA 3K30A 4TQGA 4AJIA 4MIYA 1BVRA 1RM4A 5B4TA 2W2LD 2C82A 2VHZA 3LT4A 4ALLA 1ISJA 4FD3A 1QYVA 5G4KA 2V7PA 3HZZA 3VVCA 1PS9A 1LU9A 1PIWA 4L0QA 4XJSA 4ALJA 4BVAA 1LQTA 3GUCA 4R54A 4FB5A 1R15A 3DBHB 4H15A 4OM8A 2PH3A 1HSZA 1Y5MA 2X22A 1ZMTA 5EN4A 3EYWA 1DLJA 2X86A 3NT2A 3RVDA 1BHSA 4IZIA 2Y1FA 3OJ0A 4MVJP 4MKRA 1E3JA 2P9GA 7ADHA 3Q9NA 4ZICA 4Y6PA 1DHRA 1DOHA 1KY5A 3NYWA 2ZB3A 3WGTA 4WASA 4CLDA 1HE4A 1P1IA 9LDTA 3ZHBA 3PGXA 5C7IO 1R4MA 1MFPA 1VRWA 2TMDA 2G82A 3M2PA 1GYPA 1HETA 3DMYA 1MB4A 4OMUA 1U2DA 3PWKA 1MLDA 3OEYA 1PSDA 4N5NA 4RPKA 3PI7A 4R1NA 1LNQA 2D5CA 1WLYA 2A92A 4A5OA 4YT8A 1ZMOA 3VH3A 3RBXA 3M1AA 2VRCD 2ZJ0A 1KYQA 3LU1A 1HKUA 1LDGA 4P4LA 4EJ0A 3F1KA 3UH1A 3G79A 3JYQA 3KLPX 3OQBA 4PZEA 1DJNA 4N54A 2GLXA 3JQDA 1FDUA 5JPIA 2JCYA 4BIIA 5HRUA 5ADHA 1K6JA 3W6UA 1RJWA 1H5QA 1K89A 4BGUA 1IULA 4CM1A 3GGOA 1PJQA 3H7AA 3C3XA 1T25A 4GGPA 2OO5A 3LQFA 5HBRA 4WOJA 1E7QA 5H81A 4QO7A 2A35A 2PFGA 2H9IA 1I3KA 1I24A 3VH1A 1HE5A 2YDXA 5JCJD 5L7TA 4YJDA 1LDYA 1ZIDA 5DDIP 2C20A 4YJGA 1ADBA 3AUUA 3IKVA 3FBGA 1ISHA 2DKNA 3I3OA 1TA4A 3DXFA 1DSSG 3NKLA 1PGNA 5JAQA 1YQDA 3NEPX 3ZU2A 4BO7A 2YDYA 4QQRA 2PV7A 2RCYA 4KUHA 3QRWA 1XWFA 4DC0A 4NFHA 3RUFA 4E5YA 4CV0A 5H83A 3ZV4A 4B3IA 2CVZA 3SJ7A 1W0CA 3EUWA 4RVUA 1I3NA 1Q0QA 4CQLA 2BGKA 3TZHA 4BB6A 1M75A 1BXKA 1DJQA 4NK4A 1N7GA 1XQ6A 1ZW1A 3KEOA 1GCOA 4Y6RA 3VPGA 4XQ9A 1E92A 1ADGA 4MIEA 2HMSA 1JLLA 3H9EO 1DRUA 2CNBA 4J1SA 4L4XA 3L9XA 3QLJA 1H6AA 4IJVA 3OBBA 4E5KA 2PY6A 4JP2A 5JE8A 1NWHA 3OSUA 4J3FA 5HWSA 1SMKA 3NX4A 2E82A 4GX5A 1QYCA 4L8VA 2GF2A 4J7XA 1M67A 1HDGO 1I0ZA 1E6WA 1EBUA 3FBTA 1C1XA 4FC6A 1EEHA 4IJUA 3SXPA 1ZCJA 3NT4A 4IGEA 3SC4A 5ITWA 3H5NA 4JXKA 3U09A 1A27A 4PN3A 3ENKA 3HSKA 3JQGB 2QRKA 3DOCA 2I99A 2RH8A 3QW2A 5C37A 1ZXLA 4DBZA 3OQ1A 5KVCA 1IHYA 4NNJA 2JCVA 3K2EA 4GSLA 1GYQA 3OFSA 1JKJA 2OFPA 3O03A 4NU5A 4WE3A 4WOKA 3W8EA 3KVOA 1DRVA 4CUZA 1R4NA 4DQVA 2JD0A 2J6IA 4AFNA 1PZGA 2JFGA 1JKIA 3IJRA 2HDHA 1EUCA 1LBEA 1VL0A 2BI7A 2DVMA 4GVLA 1P0FA 4ID9A 5TC4A 5CAEA 3I9LA 2GD1O 3AM4A 3WLEA 1YB5A 5GY7A 3F4BA 3OQ6A 4IM7A 4HV4A 4BO5A 1QG6A 4FR5A 1CRWG 2VCYA 3GY0A 4M54A 3OJEA 1UZMA 5DBIA 2GO1A 3U4IA 2GERA 3BTVA 2ET6A 3OJLA 3FWNA 4DPKA 3RFXA 1ZO8A 4I8XA 1WMAA 2YV1A 4JN6B 3OIDA 5G0TA 5L4SA 2O3TA 2A94A 3GAFA 1XIVA 5TLSA 4Z0TA 1PU2A 2O3UA 1SB9A 4YJFA 4KDEA 4MINA 5A9RA 1NM5A 1YL6A 2Q45A 5CDUA 4FFPA 3WYEA 2P91A 1DDOA 4PZCA 4XQEA 4R5HA 1B7GO 1PR9A 1P3DA 5HM8A 5ICMA 3FN4A 1F12A 3WBBA 2EGHA 4LVCA 1E7MA 2VHXA 4XEHA 3K8ZA 4MVJF 1ULSA 4MPDA 5TT0A 3VPXA 5CEEA 3U0BA 1DEHA 3E8XA
chains in the Genus database with same CATH superfamily
3CO0S 1V41E 3P0IA 2FPSA 1XF9A 3PV0A 5SY6A 4XTCS 5JC1A 3AW9A 4J1NA 3MLBA 4C06A 3K8OE 2QV7A 2DERA 1LDNA 2OG2A 3IOCA 5D7NA 4M37A 3N3BC 4HN2A 2D1QA 4NS1A 1NBWB 4DRXA 2ZUEA 1TVKB 4GG1A 4OQXA 4ZT4A 5KSOA 2BBOA 4GL2A 4ND8B 4Y6GB 1VJTA 1AGXA 3IESA 2CGEA 2IOFK 5EI5A 3SXUB 1QVVA 3H13A 3QNMA 2P2NA 3EXIB 3MQ4A 4B87A 5EE9A 4B6PA 4XR4A 2CFTA 5L3SA 1SULA 4X91A 4CLOA 2ZIGA 4C3VA 2HLPA 2XBMA 2FP3A 5LP6C 1MRSA 1MX5A 1N6LA 2FN4A 2OSBA 3FGOA 3LPDA 5D8DA 3STXA 3C98A 2IYEA 1TCUA 5B36A 3OHMA 4WJLA 2IYZA 1AKVA 3AQ4A 2V8OA 4CE6A 5JWOA 3PTAA 2FHPA 3EOAI 3KVRA 5CLHA 3MWJA 3T38A 1V1RB 1ZA2A 4H16A 1A4XA 1GKKA 2FZ5A 5EJAA 4TM8A 1UWVA 2RHLA 2WPDD 3AKDA 4Q3KA 1D0SA 3RI3A 2G1UA 4JWKA 4E4YA 2JLCA 2OCPA 2VYND 4RY2A 5JLAA 1U1CA 1FTYA 2CLHB 2IA5A 1GPLA 1SHKA 2GILA 4NBUA 4LBVA 1GUYA 4PCUA 1YBVA 2P8JA 2DQ4A 5JVDF 4RZHA 5CDFA 3IUQA 4OSPA 2ZKLA 3AESA 5JADA 2QUAA 2C9MA 2ZUUA 1C3VA 2J7PD 3T35A 4ZYWA 1UZNA 2WICA 2IEYA 4E2XA 1P5ZB 2QY9A 3ZJ4A 1Y9ZA 1ZJZA 4NV3A 1J24A 4MULA 4GQIA 4TTSA 2O59A 2Z43A 3DDHA 4PE5B 5FUQA 2B94A 1SA0A 5JWRA 2PKRA 3EZYA 3K9WA 4RKYA 3DEJA 3ONVA 2PKWA 1M1UA 3KZKA 2W6PA 5E0KB 1JHUA 4I1RA 1V48A 2YN4A 3T9EA 4EPTA 2B5WA 4ARAA 4LJ9A 3O21A 4K6HA 5AT1A 3ZW8A 2AW3A 1XNJA 4RAOA 4FYMA 421PA 9GPBA 3ZHVA 4XR9A 4QBTA 2JFZA 3SF8B 2W98A 4NJMB 1KMIY 3ZJ5A 1S3FA 4IDNA 2XHZA 3FR8A 3BGIA 1D5CA 2AYXA 2W22A 3PJFA 4UHKA 2I6FA 4HXFB 1D1QA 2VNKA 5ETJA 5CFPA 1U8TA 1J09A 2FWRA 4QU9A 2GFQA 3HTXA 5E6RB 1CUUA 4NYMQ 1I7SB 2VT7A 4E5SA 3TLEA 1PK8A 4JOCA 3IRUA 5BXYA 3P71T 2P5SA 2JFFA 3BMNB 1YJ5A 1EGHA 4PU0A 4TN5A 4BX8A 4IXTA 1EHCA 4X84A 1TEVA 2GN4A 3ASYA 3OIUA 2IP4A 3PC8A 5AUPB 4CKWA 3ZD6A 1U65A 4IIVA 2FG7C 4XLZA 4NY1A 2UYHA 4DPLA 5JZ9A 1DG9A 1XTTA 4C0KA 3N8GA 3QU4A 5TPZA 3ROMA 3SSMA 2IS6A 2XAUA 2IK8A 5EJGA 3T3MB 1AH2A 3F96A 1T3GA 2QPAA 2WQZA 2UVPA 3UOAB 3KB8A 1QIIA 1HEIA 4TMVA 3WYAA 1M2OB 1SOVA 1QP0A 2RI6A 3MAAC 2D5LA 3EB9A 3KDPA 1E9DA 3Q10A 3Q0EA 1XSEA 4GLLA 4NPHA 5A4KA 1IEVA 2HV9A 1TD1A 1MG0A 1E77A 2VHYA 2VR1A 1VPWA 4CTNA 1KEKA 3SS8A 4CT5A 2AVDA 4TV9B 2ZWMA 4GIBA 1RYMA 1ORVA 3N0WA 3PX7A 3RW9A 2OBFA 1JT9A 5KKCA 1E9AA 1ZR2A 5FAXA 4RC9A 3UBMA 3B1KA 1UPBA 3IBFA 5LBIA 2ZYAA 5G0UA 2Z95A 4II3A 4AMUA 2R96A 8MHTA 5T4EA 3UWKA 1POXA 3H4IA 3HMKA 1ESNA 3KKZA 3PEVA 2R4TA 1J8DA 1FRQA 3PC8C 3IP5A 4P3NA 2SNIE 2UZ3A 4KN9S 5ARBA 4P4SB 5AOVA 1XI2A 4WRRA 4YQZA 5JANA 3K9BA 1PX2A 2DY1A 2XAAA 5G4LA 2EEZA 5IFKA 1G8HA 1Z0FA 1P7YA 2AJLI 3KE8A 4GGMX 4Q1DA 1WHSB 2PVSA 1JAXA 1IATA 3IMCA 4JLNA 3A1CA 2OKGA 4MRVA 2O0LA 2XSZA 2HEGA 3W2GA 2GM4A 1F8FA 4D9JA 2Q50A 4DUGA 4G97A 1ZGBA 3I4CA 1X94A 4F1KA 4LDAA 4OXXA 2ZCVA 1MAAA 1UXJA 1HDZA 2FPXA 3IPYA 3JQRA 3T5DA 4GLJA 4CQMB 1X77A 1X74A 2GF0A 2P2YA 2W6NA 1P6XA 2C2ZA 5JHGB 1VBFA 4BE9A 3T12A 1T2NA 1J0BA 2JGKA 2ZWIA 2EJVA 2PMBA 3EY9A 2JEZA 1LBHA 1Q83A 4JBLA 1XLWA 3EPRA 3GRRA 4WBNF 4NBTA 1V1MB 3DEHA 4S0XA 4Z3OA 3DWGA 4DFDA 3P5SA 4G9BA 1XU9A 3JALA 1T6YA 1UKYA 4CKZA 4R4JA 5L3ZA 1JH8A 2YRFA 1TM7E 5AVJA 3V1KA 5CD9A 1PN3A 2R6DA 4KQ1A 5BV1A 1O87A 5LA6F 1R0SA 4D5EA 2W5UA 1Y81A 4MVJG 5DRTA 3VA7A 4HMPA 2GAJA 3DBLB 1SCNE 2QENA 1T4BA 4L78A 4RADA 3QU7A 1RE1A 4JY7A 3WLKX 3RYIA 2ZQYA 5GGYA 3TLCA 4F0JA 1X13A 2IGTA 3EWAA 2OXIA 1LD3A 5DH9A 4ZYYA 5CFRA 5LQJA 4G0WA 4NU8X 1PDWA 3T99A 3GPLA 4NESA 5AM4A 1SWWA 3G3EA 3GNSA 3MMPA 4WUVA 4PYNA 4J49A 2HPHA 4OYLA 1XEXA 1A9XA 1G9TA 1SUIA 5AHWA 4DSTA 3CGWA 5A5VA 4FN4A 5HE9A 3D6AA 5HJEA 5LXTB 1X2EA 3EGDA 4PLCA 1FDSA 3LLVA 4PHHA 1U3FA 3HR8A 4TZ0A 1UH5A 5GZ3A 3HKCB 4MR8A 3HLKA 3RHFA 5KJ6A 1NVAA 3KB1A 3A8TA 4OUDA 3ANXA 4FE4A 4IJWA 3TKLA 4WFJA 3P96A 4Z1MD 2RH5A 1JFSA 3FM9A 2AFHE 1DEKA 2IPXA 4ZI2A 1KAQA 1LTQA 3OPYA 5IBQA 3QWFA 3K2IA 1GVNB 5J5AA 4LPSA 2WU0A 2CYBA 3CG4A 5A4MS 2CNOA 3KR2A 4URUR 1LQUA 3L84A 3NHZA 1S1CA 5IF3A 3BCHA 1R88A 1M2NA 5T57A 2ZJ1A 3DHWC 1GG2A 3G0GA 4XUGB 2A1IA 5AP9A 1C9NA 1QVRA 3VC1A 1XMQB 4KBYA 3PLAE 1YXMA 4KLZA 1ZDMA 1QPGA 2B30A 1SVWA 2G28A 4Q9NA 4WFKA 3Q2KA 3S40A 1ZD5A 2G5GX 1D6SA 1YACA 4ZAZA 4X6YA 3HCFA 1Y63A 3KRTA 3PEEA 3EF3A 3H16A 1G60A 1L5WA 2GARA 4MMZB 3AVXA 4UBLA 5CVJA 3P2JA 3TIXB 1W76A 1L5MA 3EIFA 3KKOA 2GLTA 3NQ41 3QHPA 3IQIX 4AMYA 4EI2A 1OBVA 2I4IA 3FPHA 3VYUB 2NV6A 3C6ZA 2JHAA 4OAPA 5BV0A 2IZOA 4LBZA 3V34A 4DA8A 4CEHA 3JAMA 5DZSA 4IDDA 3H2JA 4WCFB 1ODKA 3ZDBA 1JQAA 4M83A 4OBXA 1VA5A 2H1SA 1EP2B 4G36A 3OHSX 1ZA1A 5IVKA 1QRSA 2NVOA 1X86B 2VNSA 2NUBA 4NWIA 2XCIA 1PWYE 3GH3A 4TTRA 3PU6A 5J1TB 1K6XA 2AKYA 3WHPA 4ENPA 5I51A 1HK7A 2BBSA 3CVOA 2OFOA 5FV7A 5YASA 5F35A 2O1WA 2V74B 3KHTA 1B41A 1GTJ1 2QN9A 3DFZA 5CA1B 1QHSA 3QPVA 5B58C 5HOEA 1SELA 3O26A 4I5GA 3II6X 2LKCA 3AB3A 4JKYA 4HNRA 3VJLA 2DTDA 4JVNA 4PVCA 5HQJA 4RL6A 4AXBA 1P1BA 2MYUA 3KE9A 4H18A 5TEWA 4YMGA 2R751 3GV0A 4MB6A 3H18A 2BZ0A 2NVUA 2XMSA 3SCZA 3EF0A 3OT4A 3FWHA 2H16A 3UY4A 4HTFB 4P0QB 3TOZA 1OWNA 2OAP1 2QUBA 3DH0A 3DLHA 3HWSA 2ZB8A 3AIIA 2GM9A 2QTGA 2UZ1A 4EF4A 5HUQA 4H7KA 2ARKA 4O1IA 1EG2A 4ZDJA 4D56A 3M4YA 4Y9DA 1QRTA 3FDZB 2JG3A 1FSSA 1M2VB 2ZU6A 3BWEA 4UCXA 4V1CI 4TYYA 2Z1DA 5CITA 4IDGA 2BRUA 1X8JA 4RZ3A 1SCQA 1BXRB 3N2GB 4BGVA 2ZUWA 3HNPA 4KLCA 2IF0A 4AZ0A 3PRJA 1VP9A 2BFDB 2QLNA 1OZFA 2LD4A 2UUPA 4Q48A 3W8FA 2EKDA 1RKUA 4H7PA 5E0OA 4KWTA 3EEIA 4FBMA 4GZMA 4MUBA 1PQPA 4Y2GA 1JHXA 5B3AA 3ZXUB 5E9QA 1Y1TA 1KMHB 2PRZA 2ZYGA 2GFIA 4XUDA 2C88A 3RHSA 4RZSA 3KAPA 3L8DA 4JDUA 4Y3UA 2MYNA 5CHEA 1Z13A 4LQCA 3VTFA 1QVWA 1IXRC 4BUCA 4JVLA 3UCFA 3VO1A 5D7BA 3UANA 1E3MA 4X1OA 1QC5B 4MP8A 1EJ2A 2PIAA 5HF8A 5J5VA 3MJEA 4D3FA 1CP2A 4IXWA 2CHUA 2PWAA 3EEYA 4IG4A 3ITKA 3TKAA 2FZKA 1UEIA 4KX5A 1OY1A 3I0ZA 3LBIA 4UU7A 1DXYA 1V4NA 1T91A 2CSUA 2IXAA 3EOBI 3R2JA 4GI7A 4UBKA 5DW0A 1RHJA 1K4MA 2ANBA 2BRUC 2ORVA 3IVCA 3M89A 4UULA 4DLXA 5CDYA 2IBTA 2NXNA 4K1LA 1CQWA 1E1CA 1PKXA 3ABSB 2QRVA 3OP1A 4XSGA 5DHAA 3UJ3X 1XL1A 3W8DA 4D0GA 1MUUA 2PS0A 2ZIZA 1E7SA 2DWCA 1JG2A 2CVHA 3SIWA 2OWEA 1NYRA 5ENVA 3R5FA 4EKNB 4ENUA 4N4AA 3QX8A 1DBRA 2W2OA 3IP9A 3L6EA 4NCNA 4DE5A 1NVFA 2VHCA 2FN3A 3FY4A 2C7OA 4MUXA 3SD7A 3PCXA 5TDHA 4D45A 5BNTA 2QPLA 1DZIA 1E7WA 1H4TA 2BMFA 5HTOA 4EJFA 1I2DA 1C9EA 1S2NA 4RHYA 4LRQA 5FRDA 1VFNA 1YDEA 2HKIA 4I4LA 4GMDA 3C24A 3NHPA 3KLNA 1MO3A 4AMZA 4BMYA 1C3OB 1R4NB 1Y4ZA 1JAIA 1GITA 5FL7D 4MMXB 4JLVA 4U3JA 1V8FA 3HCEA 5CXSA 2W4MA 4MVCA 1CZNA 2C4VA 1NNUA 1NE7A 1GCIA 1WSWA 1JILA 1FP4A 5CAEB 1QGUB 3UIEA 2C9ZA 4I1YA 3HRHA 1AJEA 1XKQA 4N65A 1DIGA 1TM5E 3BF8A 3CUEF 2JEYA 3S28A 3K9GA 4EFLA 1QQAA 4HUJA 2CNDA 5ELXA 3V3TA 1OD6A 4HPWA 3Q7QA 1I36A 1XCLA 4YJ2F 3T54A 1GRNA 2Y1LA 4G81A 3SZUA 3WDMA 3UUGA 4J4TA 5EJ9A 5AW1A 5DM70 5JISA 3PQDA 1KXJA 3KSBC 3UPDA 3WZLA 1QCZA 1R8JA 4JYMA 4YY3B 1WM1A 2EBFX 4R1PA 2JIBA 5E3JA 2GPSA 1I2CA 2FMHA 2IEDA 3W5AA 2FMXA 5CCXA 4YUWA 1UADA 1Z2OX 1E1RA 2VTBA 5AKEA 3P9QA 2YHIA 3UOWA 3ZLBA 2BGMA 1R18A 2ZP1A 3FYTA 2QT9A 1RPTA 4WCDA 1T0HB 4YJFB 3IX7A 4DR6B 4K0RA 2AUTA 3L06A 3QLEA 1C7IA 3O8DA 3RJTA 3T1QA 2ZIXA 3AF0A 2PGDA 4MR7B 4DCTA 2BEUA 3W4IA 3IVMA 1Y4AE 2FZCA 5G40A 4CEIA 4JSTA 3KT0A 5K05A 3L0YA 4GPD1 1O97D 2NQTA 3D7NA 4RTKA 1Q91A 3ETGA 5C52B 3PPIA 4MWCA 1U98A 3LM8A 2XNCA 3TN7A 4ZN6A 2IOHA 3BXEA 4UXJA 3R9XA 3KT6A 4M1KA 1G7TA 2L2QA 1WW8A 1UPAA 3FWKA 2BDEA 3DOIA 4OJNA 4WLUA 4GD3Q 4EJMA 1IOWA 5I47A 1FFHA 1ZWKA 3W8NA 1IB0A 1Z47A 1DXOA 5KOJB 3K1TA 4P83A 4IMJB 2Y3IA 1JTVA 1VMAA 4NOMA 1BKDR 3O1JC 4JLJA 4KDFA 1IVNA 1XYYA 4XYGA 4YI5A 1A8IA 1ZP6A 2QTCA 2HHJA 3K73O 4HEA6 4MQFA 4PAMA 4H17A 5CGZA 3TD9A 1TCVA 2ZTHA 2L19A 2MSKA 3AP1A 5AESA 2HF9A 2FX5A 4NCKA 2AK3A 4RLHA 3SZOA 3MOGA 1B26A 5C51B 4ZEMA 3MGKA 1FVFA 3ICCA 3L0CA 1J0CA 3AIKA 4K8OA 4C0QC 1M6VB 2I78A 1IQUA 3KEMA 3P1JA 1DIOB 2VF7A 3MMNA 3R3SA 2QLJA 3PYXA 1P72A 4ZT5A 3DBRA 3BDVA 1QOQB 1K7CA 1H2YA 1GG9A 1R0CA 2W2NA 2Z9CA 1NW6A 3L1KA 3QYPA 1AE1A 2RJOA 1OWMA 3HXTA 5H02A 2VAXA 3DE1X 3GUZA 4P3XA 3FFWA 4YREA 3WLTA 4EYSA 3GLGA 3ZOZA 1J2UA 1TT5B 2WWTA 3NYQA 4NG4A 1EUZA 2AJTA 4DUPA 1A9RA 1ZMBA 2EKBA 4EVIA 3T1HB 1RCUA 5T4BA 3CBGA 5AW3A 5L40A 2ZYDA 3Q98A 2IU4A 5G0WA 3F5DA 3BFXA 4Z3KA 1A97A 2WLTA 4O2RA 3AF3A 3TM5A 1IXZA 3D6TB 5BR1A 1VIYA 3Q7IA 4P8RA 1EX7A 1O1YA 5FYDA 2OY0A 1X6VA 4G01B 5L8VA 4PCLA 4A23A 5JNRA 1DAIA 1I1OA 3GCZA 4LCJA 2ZBQA 3PQ5A 4FINA 4TTTS 3W0LB 3HJRA 2B34A 2WI8A 4I1SA 4PYIA 5DX1A 2ZI4A 4QGBA 5CRIA 5DGCA 4PZUA 1MOSA 2ZRLA 2GPJA 1U0LA 4GYWA 3IAAA 5KNBA 1V8ZA 4QDZA 2F17A 1RJ9B 3OY2A 2G9UA 2RAUA 4TMWA 4YCAA 3WK7A 4CMIB 2A9OA 5TMPA 1Z0JA 3CZQA 3NH6A 2OORA 2VA8A 4OI2A 1F60A 1EG7A 3KJXA 4R8VA 2ZLBA 5KYYB 4BEBA 1JHRA 3C41J 1JHAA 1H8HD 2ZUVA 2PFKA 4MHSA 5F76A 3UK2A 3IQWA 5K3CA 3AMVA 3V80A 1W4AA 1YAJA 3A6FA 3LUCA 4IPTA 3VR1A 4H3VA 5T6MA 1GXSA 1TC2A 3TPFA 3UUFA 3DEAA 4RPIA 3C8DA 4B6EA 1SK8A 3DOOA 3BIJA 1M8GA 4D41A 1VGRA 1DOAA 3C43A 1NY5A 1AF7A 1DQNA 2OXTA 1KORA 1TJ3A 3DLAA 5BQ3A 4KO2S 1TCCA 2JKZA 2O7VA 2CF6A 2LKDA 3CH6A 5I8ZA 1FSGA 3MT0A 6CHYA 1DV2A 4JOSA 4CDGA 3EPJA 4GXTA 4MYRA 1UBUS 4AU1A 5KQSA 1ZH6A 2NO1A 4NMMA 5KTKA 1F5NA 2YMPA 2AXPA 2IY8A 2P1ZA 4L95C 2E49A 2I7VA 1NC1A 2Q6VA 2V7EA 1Z0SA 3AJRA 3KXKA 4RGQA 3VR5A 5IRCD 2OORC 2D06A 4ZU3A 2IZ0A 2VBGA 4HDMA 1IUKA 5EPUA 3WRXA 5LYJF 1FTGA 4TT8A 3FHJA 2AF3C 2VK8A 4PRZA 1JMKC 4JJ4A 4RD0A 4YO8A 2AR0A 3D8TA 4KG7A 4I50A 2QMQA 4C0XA 1A4UA 2C8VA 3HXPA 5C31A 4XLTA 5EHNA 4XD2A 3PFGA 1G63A 1S9HA 3JWPA 4R9RA 3C7CB 2AIRA 1GPMA 2W2KB 4XYBA 3SYLA 3TSYA 2FCAA 5JBNA 4PX3A 4A82A 2Z8XA 4ZO9A 3V2IA 4LYDA 4NP6A 1MX9A 1NNSA 4PZYA 1LI4A 5D1HA 4RMJA 5F51A 1E62A 2PZLA 3QVUA 4WNYA 3KTOA 3LX5A 3CYFA 5E4FA 3PXAA 3W05A 1ABEA 1BMDA 1DKLA 1W9HA 3N2ZB 2J5KA 1AS0A 2HD4A 3GGPA 4A0GA 1MDBA 3R0XA 4FGWA 3ZDZB 4PQEA 1UXOA 4KN5A 5HP4A 4G0UA 2PGXA 3PPYA 2GCOB 2WYHA 4NF2A 1HKHA 3NOVA 1P2UA 4X7BA 4EOGA 4DSOA 3PFIA 1ZUWA 3OICA 4MJLA 3WRXC 4QNMA 3P32A 4Q9IA 4BCCA 3VOTA 1ISMA 1YVPA 5COBA 2HNBA 3T5TA 4BMXA 2O4CA 3RS9A 4P9NA 4GYYA 3TS1A 3QEBZ 5IYZA 2A5JA 4G67A 3IC5A 1XKXA 1SUWA 4FCCA 4DNOA 5KAPA 4EM6A 5BR8B 2ZRDA 4YLGA 5IS2A 3T4PA 3BT7A 2JI8A 4BECA 5AUQA 3HWWA 1KAGA 1LLUA 4E70A 4OHOA 1AGPA 1NXQA 1P3JA 2VATA 3DPIA 1NVMB 3QG5A 4HB2A 3UO8B 2K7FA 4G9EA 1UEXC 1VJDA 3KQMA 1GGJA 1Q15A 5AI4A 1NXXA 2QZ9A 3BEOA 4B46A 2EQAA 3KTFA 3LRTA 3X1WA 1N0WA 2Y1KA 3D43A 2GKOA 1NI4B 2RHTA 2RHJA 4BNKA 4DQKA 4NOKA 4OIMA 4OYHA 2AJBA 1BEZA 2XPCA 2PSHA 2XY4A 3K15A 4CR7A 3AJ9A 2HDWA 3QVGA 3MELA 3GN1A 3ESYA 3QQPA 5TF4A 1FRVA 4BS9A 4DIMA 4E5PA 3O95A 5JJ5A 1GZSA 4O2AB 2IV3A 1E89A 1ZRNA 1F0PA 5CNMA 5KYXA 4CEJB 2FOLA 1JHZA 1FS4A 2GJAA 3DUFB 4WKPA 1UMDB 4NU0A 4QBFA 4JLDA 1EXMA 3OEEA 1ORDA 2F8TA 2IU6A 3W06A 1ISGA 5M29A 3UWMA 1DBQA 1FC0A 2CW5A 2YRXA 4NZYA 1KJYA 2XADA 4LZOA 1DG3A 2RK4A 5LMCA 2QSUA 1QHYA 2IVZA 4DUGD 1W25A 1Z2EA 5AUOB 1XCPA 3F46A 1WZIA 3FTNA 2YZNA 4NL4H 5BMOA 2D8AA 4EKEA 3O4VA 3ISVA 2N0SA 3BAZA 3VOBA 3L6OO 1T24A 4UNPA 4JGGA 1TEZA 1VL1A 5HKBA 4XWAA 5K0SA 2J8ZA 4DLYA 3G6KA 3WYCA 1C30A 2V7TA 2C59A 2YV5A 3QBJA 1M0EA 2EX4A 3UBTA 2HY7A 4OQ4A 1MAVA 2PBLA 3ED1A 3EAFA 1XQVA 3PF9A 4JA2A 2C8JA 3DCYA 3ZU3A 3DMGA 3IPRA 5CIQA 1O6BA 1H05A 2QROA 4Z0PA 3W79A 2AKEA 3O4IA 1FS5A 2WEKA 4OHRA 3TE6A 5KYWA 1QPZA 4IGKA 2PLRA 2XQFA 1NW8A 5FBQB 4I08A 1I2AA 1FL9A 2IYUA 2JFWA 3KXIA 3A4YA 1Y7TA 2IKSA 1NYQA 2J3QA 4O4HF 4KXXA 4QAQA 4WY5A 1GKIA 2H11A 2VPYA 3A6GA 3I92A 3KVYA 4E5DA 2E5LB 4EBFA 5DGHA 3P0JA 2FZGA 3SF0A 3F67A 3O3CA 5CX1A 1WDTA 5U9CA 1JJVA 4MUMA 1ML3A 4P4GA 4RJIA 3DDNA 2DT5A 2DCUA 1RI1A 3ECAA 2QZPA 4P0TA 1QFZA 5GJWC 3WQHA 1ABBA 1LV8A 3QKSB 4FMCF 3DT9A 3UFXB 2A2ZA 1U4SA 3DOJA 2ZXEA 1OHHD 4YACA 4K5QA 4L5BA 2F9FA 3V7YA 2J3HA 1N9GB 2A59A 4H3KB 3KWLA 4HAXA 4C0HA 1ZWLA 4EW2A 4U5QA 4PV7A 3C48A 2JANA 4LWZA 3RCBA 1XBTA 1H2ZA 4LE2A 3AVPA 2BHRA 1QMPA 2FX3A 1KYWA 2BI4A 3IEXA 4IFBA 4OAOA 3A3YA 1R6DA 3EFOA 1J07A 1NR5A 1Q11A 1XNHA 1IOZA 3G68A 4S1PA 2YFYA 2HU7A 3KX2A 1BS1A 3FR7A 3OZRA 3IHTA 3KPUA 4YO7A 2PS9A 4KX3A 5FUWA 3W2TA 1CWUA 4ARIA 4OJYA 5EJ6A 4K9MA 3RSZA 4FOSA 1KAOA 3QE0A 4GI3A 4WNAA 3SI7A 2X6TA 4Q4HA 1WHTB 5HRCA 2JFVA 1J8FA 4OXYA 4TSRA 5TXGA 2I71A 5IDYA 2I6TA 3ZE1B 1E6LA 3H3FA 2OFXA 2XRFA 1FUIA 2ZJOA 4ZA2A 4AO6A 2AEMA 3FOBA 5ALXA 2EFDB 5A4FS 4CF6A 3ZKAA 3AUTA 2HBQA 3MHPA 3W6PA 4AUNA 4RWEA 2P68A 3E53A 1WSBA 2VDQB 4DMGA 5C8YA 4CIAA 3PFKA 4X8MA 3ESAA 2AB0A 2ZDGA 3GRKA 5IM5A 4P38A 4YMIA 1NF2A 1XAIA 2PBZA 5FI3A 3DZHA 3L1UA 1JSCA 1MXFA 2VOEA 4QYXA 2Q46A 4IP0A 4LQDA 5G1OA 4OHZA 4DJ5X 1AHPA 2ZTUA 3VV3A 2A33A 4DREA 2X8LA 1ZD3A 3RVRA 1I3OA 1OXKB 5DWDA 1IG3A 1C14A 1OPRA 4BX3A 4P4NA 2KPOA 1FXUA 4MTCA 3QEKA 1G8KA 4N0DA 4OV6B 4MGIR 5DP1A 5H4HA 2Q9BA 3IAUA 3DAYA 4NFSA 5IULC 5C53B 2NYVA 4D8TA 4UTPA 3IBCA 4E2ZA 1EDOA 1ZFNA 2E6UX 5EMHA 1GCGA 3MAJA 1RXIA 5T8KA 2JGAA 3CLSD 4P2GA 1R6AA 2FN8A 1RI2A 4PM4A 2NTVA 3ASUA 2Q5EA 4G4GA 1DMRA 5JS2A 4QUKA 5CDFE 1CPYA 1OU0A 1UK8A 1E1LA 1CQIB 1J2YA 1ZYUA 2QTTA 1RADA 2QVBA 3BYZA 3LC2O 4ZRNA 3FKSA 1K3FA 5EZ6B 3TZBA 4BV3A 5J4LA 3LYLA 5A5GA 5HDQA 4AY5A 4ESHA 1E2LA 3NS7A 2YJ3A 4EO4A 3CHYA 2BLLA 1ZVMA 3H75A 1P29A 1YDWA 2P9YA 2RKOA 3HVKA 2LTAA 5IBRA 5AK4A 4YRGA 4FU0A 1PQWA 4LV8B 1CEQA 3AR6A 3JQ7B 3N7UA 3CPEA 1DCTA 3B2NA 3NH9A 3IT1A 2HV8A 3ZBTA 3B1JA 3ORHA 1F9EA 3VNAA 2O07A 1N6RA 3NUGA 4W8OA 1RQGA 1TYBE 5JC8A 1FFGA 4XOUA 1GNLA 3VOAA 3S2FA 4FDTA 4YUXA 1KDTA 2FZVA 4LHZA 3U6BA 5SYMA 4RHXA 1U99A 1L9KA 3A6KA 5T8KC 4BMVA 1XMXA 4B82A 1ZPDA 1A5AB 4D4IA 3IMGA 4W9RA 4RH1A 4DXAA 3BHJA 1BJRE 1JEYB 1JHYA 1EUDA 3NM6B 1U7TA 3GMTA 4TSFD 4OJTA 1ADJA 3V9PA 1CRPA 5KU1A 2HZBA 1A77A 3W1EA 1EDZA 5CDTA 3U4AA 3VZQA 4BO4A 4BKPA 1I1QB 2CZQA 2WD8A 3LX4A 3ZIUA 1KH3A 2C2YA 2WHEA 4UCFA 4P7BA 1GYRA 3F5MA 3KQYA 3BRWD 3Q8XB 1XMJA 9ABPA 2XTAA 4TLDA 1K9VF 2FGKA 3NORA 4A9AA 1L5HB 3LUHA 4QSMA 4C6TA 2VUHB 1K7YA 4M0UA 2IPOA 1DAFA 3FLAA 2FTKE 4P7JA 3DNMA 4RX1A 3TQTA 3LO5A 4MCAA 3VO2A 3X2EA 4DANA 1M72A 2BEWA 1NMYA 3IKMB 3LXMA 2JIOA 3RD5A 2P5YA 1ADCA 1F8XA 4UNRA 4AROA 3IEUA 3FSJX 4R1UA 2AYYA 2IQIA 2WKPA 4KODA 1K0FA 1U90A 4YJ3F 4RZUA 4MVXA 5IVDA 2C8KA 2RAFA 2RGNA 2O2CA 3FUWA 3OCXA 1ZSNA 1NI3A 1G1AA 3UMCA 3DONA 5I01A 4RMIA 2EG5A 2AS0A 3SXUA 3NAGA 1JFFB 3WX0A 3F47A 1G18A 4RA9A 1M1YB 3JYPA 1FQOA 1JKFA 2WSIA 2LGJA 1ECFA 3KYDA 3KZXA 3B52X 3L4KA 1XTBA 1QQ6A 3BX1A 2TS1A 4MRAA 1QIMA 2D2VA 1K06A 3P4XA 1XPUA 1HDCA 1TO6A 3KM0A 3HVIA 2FEKA 2I2FA 1JVSA 4IJ5A 5BSWA 1GTRA 1TQ2A 4E21A 1W36D 1Q0HA 1O89A 2BFNA 3D4IA 2XXAA 2WU8A 1V1RA 4K9OA 5ALYA 1PAUA 1OZ0A 5AOBA 3CIOA 3WWZA 4EFKA 5BW4A 3GRYA 2NWQA 1B73A 5JVDA 3WYGA 1C0IA 3TBFA 3QA3E 3EXG2 4K3VA 4Q37A 2BGTA 2CE7A 2W8BB 2FHSA 4HNAA 4NJOA 2JIPA 1G5RA 1WCWA 3BWVA 3DBVO 4UBMA 2QR3A 1T1RA 3A6HA 1CU1A 3OPYI 3HDYA 4EKGA 4KAFA 1U28A 4C3UA 1NJ1A 2RGNC 3NI2A 4K6OA 5LQSA 3UYLA 4BWFB 1AUOA 3V2GA 3IPAA 4PHCA 1KSGA 3NC4A 4AJ9A 4H1HA 3EC2A 3NCTA 4ZRMA 4PAGA 4L27A 4QOGA 4ZCLA 1PFQA 3VO9A 4ETMA 1LDMA 2M6LA 1H2EA 5HVNA 5TGZA 3GDWA 1GPYA 1GR0A 1MX1A 3H2BA 5FWAA 3GDFA 1QQ7A 1W46A 4ADSG 4CKBA 5KJEA 2D2EA 2Z5LA 5BQ5A 1SVMA 4PLGA 1NP3A 2FMIA 2RJ3A 3E2PA 4C9BA 4CVNA 2ADMA 1DEOA 2VPZA 4XGNA 3ZNQA 1IHDA 3TNYA 3GT3A 3TIFA 4U8HA 2O8BA 2QPTA 5EXPA 1P1CA 2XTZA 3R75A 2HSJA 3CKKA 4RACA 3TX6A 3RUAA 3SF8A 4YWJA 3RBAA 3FVVA 2X7XA 2XYPA 1EB9A 5IJ9A 1U28C 1YB6A 2ZJBA 3PF8A 4A03A 2ONZA 3U9LA 3CT6A 4BQRA 4F93B 4CM4A 2PA3A 1IZZA 5BW5A 4TS9A 4C29A 2WJYA 3MRTA 5H4GA 2PKYX 1EK5A 2VJPA 3BMNA 3JVVA 1RSZA 2GD0A 4IHAA 5EOVA 1E3TA 4TTQA 1X8KA 2FF7A 2L18A 3BFPA 3K0AA 4C4AA 5K09A 2G9ZA 3TTYA 4Z4GA 2RK6A 3E22B 2VF5X 4YRIA 4PG7A 3H1EA 3NBZC 4N3NA 3QVMA 5H59A 3GLIA 2OE2A 4UHHA 3Q4GA 4KBFA 1ESEA 4Q9AA 4U7FA 1JQEA 5IW8A 1JU9A 2HIMA 2ZT6A 4K6MA 5LMNB 1O96B 4JDPA 1MC5A 2XUDA 16PKA 1DAMA 2IRWA 1WD5A 2Y0PA 1FUEA 4F2HA 3LBAA 3WMWA 4KQWA 2OG1A 3K9CA 2B69A 1RD4A 2NU9B 1FA9A 4BATA 2GRAA 1L3BA 4TV9A 2DR3A 4P54A 2OM2A 4NMLA 4KQIA 2D2FA 1JG4A 3GT0A 4MUIA 4O3FA 5THKA 2X0DA 5KOYA 1AZWA 4Y1FA 3VSCA 1IQRA 1D6JA 3EXG1 1K88A 3JPWA 4FTWA 1T3TA 2O19A 2H2GA 3D54D 4B44A 4EEKA 4FMBB 4NCIA 1MORA 3ENVA 3M0EA 3NATA 1XR3A 3P0RA 1GIAA 1QORA 1N36B 2RK3A 5AHKA 3WIOA 1WZEA 3PXGA 1K9SA 1PS8A 1YGYA 1VPDA 3ZE9A 4L4RA 5GP1A 1J8YF 1HUQA 1XEWX 4WA7A 4TSKA 4M0EA 4DMKA 2O3SA 4X3PA 3WLLA 4RLSA 4PS1A 1EQAA 2Z58A 2TRSB 4A10A 2I7DA 3AM1A 4BRUA 4D43A 5ALWA 5ESRA 3O90A 3THYB 4XX0B 4KYVA 3MWGA 5FNVB 3PQ6A 4FSXA 3KHSA 4QO8A 1YMUA 1Q7GA 3V4LA 1KFEB 1EVLA 4WBNA 3ADKA 2PLAA 4OAQA 4TLCA 3SM3A 1T36A 3IPXA 4CQMA 2J0SA 4X1IB 1P5RA 3V4RA 4FJ1A 1PTKA 1P2DA 2BSXA 3H6GA 5FOXA 1XK7A 2R7MA 3JRWA 4KR0A 4PYRA 4MYSA 2WSYB 4B3TB 4INOA 3ADCA 3UAVA 4PC2A 5FWYB 1QTQA 2ZW9A 3MS7A 4MW5A 1QJ4A 2BFPA 2DJIA 3AVQA 2GWRA 1QIHA 1RW4A 1SGWA 5KNBD 3CUSA 5EWMB 4H7EA 3MOSA 3GHHA 4KQEA 3WRYC 1WABA 2C5FA 2W48A 4CLHA 1RQPA 4Y1EA 4J4BA 1NHWA 3AGPA 2ZRHA 3NRCA 4NAVA 5SZKB 2LUOA 2OLJA 3QVXA 4BZWA 3DE0X 1OXVA 3EVBA 4NABA 2IS4A 3OF3A 3DBLA 5KQGA 3NIGB 1TMOA 4FHZA 4M1QA 5B3LA 3WOVA 1L8XA 2MCFA 3KZMA 1P2BA 3J7AC 2IX3A 2RCNA 3O4RA 4KSYA 4HNGA 3BWCA 2I8LA 5ESWA 4PSDA 3H8JA 3LWBA 2RC5A 4UASA 2LZ0A 4V0KA 3ZVKA 4J0IA 1C50A 2X5JO 4OQMA 3U4GA 2QLTA 1D8TA 2G6BA 3OIFA 4DG5A 5LXTA 5AM0A 1P7VA 2VJNA 3AHGA 1IRXA 3CV3A 5DHQA 5REQB 2RJNA 1BWSA 2ZR8A 3RBVA 3OTOB 3O0TA 4GLFA 1UC9A 2HQRA 1LBIA 2AC4A 1E6KA 2FW7A 4DTIA 1XMVA 4X97A 4NE9A 5ELMA 3VR5D 3AEUA 3FJ1A 3EVTA 3ULKA 1MDFA 3ZTYA 4C05A 5I9NA 4KPEC 2W6IA 5D01A 3TFOA 1DDGA 1S9DA 3Q3GE 4C0LA 3LVBA 4JIGA 1V8OA 2F1RA 2OP0A 1BX3A 3OZAA 4BX2A 2NT3A 5CT4A 1Y8AA 2DLNA 4JVOA 1K92A 1V96A 3SBDA 2WJ3A 1E59A 2WWVD 3ZGNA 3HN2A 2AMJA 3U3OA 4KV9A 1UQTA 2YZGA 3FAKA 5EMJA 4S24A 3LG2A 5TJ9A 1YRLA 3ZN2A 4KHPB 1IWPB 2H51A 2B25A 3GMDA 3MINA 3N76A 3WAJA 5GJBA 1SKAA 4L72A 2BGRA 2K5UA 1GOTA 2N46A 3D5EA 1QAMA 2W2XA 3TL6A 3UN1A 2I33A 2B35A 1Q20A 3G2QA 3MBKA 3EPLA 1P1FA 2HEIA 2B8TA 3IP7A 4LZLA 3FSRA 3WLRA 3GT7A 4XWGA 4F1WA 3MGAA 1KJWA 1C9YA 3C5EA 3TZLA 1FRZA 4DEXA 4XZ3A 3H42B 2V5UA 2BZSA 4L0CA 4E13A 4GOKA 3KT8A 1EP1B 2DWQA 3ILVA 3OUTA 3MJSA 2WWWA 4QARA 3SC2A 5JTUA 1JJIA 4WCFA 2D7DA 4MVYA 1USVA 1BWQA 4B84A 2H57A 2WB4A 3VZSA 3B6KA 4ZVOA 4ESVA 2C94A 6GPBA 4J16A 3ANMA 1DUSA 3BH7A 4E14A 1IVSA 1DBPA 3QX7A 4KQKA 1PR6A 3BFJA 3EVZA 1YK0A 1CE8B 3H9GA 3ONEA 2YWFA 1MGOA 3DQQA 3PDIB 1AV7A 4IRXA 4WK0B 2VXYA 2O8DB 2F7SA 2B8WA 5HKKA 2B4QA 3PUKA 3W1WA 4S04A 1FMJA 2F62A 1P17A 2OBNA 4D9CA 2B7CA 2W00A 4RJTA 4RTNA 4UUNA 3WB1A 5IM4F 3RSSA 5JG7A 2UUCB 1DRWA 2ACKA 3LW8A 5H82A 3ZGXA 3L7MA 5FFNA 4HTFA 3R6DA 1EM6A 3DM9B 2AL7A 4EY7A 6ADHA 4DBLC 3F5FA 2XTJA 1MIHA 2I8CA 5AWFC 4DLLA 5A2QA 3IOBA 4WCFC 3M8KA 3T41A 4BNGA 3RS0A 1CJMA 3AXSA 4BC0A 2QYTA 5FTJA 4J16C 1ZXBA 3FPKA 3EASA 4JVMA 4Q47A 4U9HS 1I2ZA 5AXCA 4HNUA 2AEJA 1YU6A 4WOBA 2DGDA 5CLGA 3DTVB 1JS1X 3RUDA 3I9NA 1M8FA 1S0UA 2PYIA 3HWX1 4EB6A 1P0PA 1BXRA 4M9UA 4RESA 3N2GA 5K03A 2WD7B 4HWOA 3TG2A 3FNQA 1GQQA 3H5TA 4PZDA 4B9AA 4DJJA 3SGLA 2JHCA 4NS4A 1QO0A 2XBUA 3QF7A 3K0CA 2VF2A 4LFAB 1NNI1 3TGPA 4OB8A 5LBUA 3ZYZA 3OESA 4S2EA 1KMHA 1QB8A 2PQ0A 4DRZA 4Z4IA 2FQXA 2MSDB 2ORED 3U56A 3L43A 3PENA 2ZVJA 1G9XA 3TUIC 4MWEA 4KB5A 1VJGA 2MSNA 3B36A 3OKPA 1SAYA 1PJ4A 3L40A 4KIJA 5HZGA 4YIKA 1H6DA 1MHTA 3FXAA 3TRIA 4EW3A 1KOFA 4DY6A 3PGVA 3DVRX 3IILA 4HGPA 3AFIA 3TKYA 3ZWMA 2NU7B 1IVYA 2VDJA 1PYOA 1RYFA 1T4MA 3CM0A 3WA7A 1WDMA 1YS6A 4NFLA 4EO9A 1ATZA 4P93A 2PSDA 1Q2XA 4FMDF 5ALOA 5SICE 4E3WA 1E2BA 3E2MA 4C4TA 3F7TA 1T2CA 4CHGA 5E7IA 3MC1A 1QCDA 1Z15A 2IPLA 2Q9CA 3L1VA 4MI1A 4W5RA 2I91A 3IMEA 4WX2B 5H16A 3K0CC 1KGSA 3EK2A 5LDHA 1US8B 5ALUA 2V98A 3UH0A 2XUGA 1EXDA 4J9VA 5LMUB 2C4HA 5K0LA 3WGHA 1AB5A 1LTHR 3QM1A 5HZHA 1JKXA 3ICQB 1OVMA 2DP4E 1Z0ZA 4O0MA 3FMVA 4Q4LA 4W5JA 1YQTA 2X2EA 4YAGA