5BT9A

Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
249
Chain Sequence
EARMVANCPVLVTGGARRIGKAIVEDLASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLEGDVRGLVKQASDRIGPIRLLVNNASLFQEDKVGALDMALWDRHFAVHLKTPVILAEDMRKALPEDQDGLVVNIIDQRVWKLNPQFFSYTLSKTALWNATRTLAQALAPRIRVNAIAPGPTLPSERQRPEDFERQVSKLPLQRAPELPEFGRTVRYFWENRSITGQMIALDGGQHLAWETPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of FolM Alternative dihydrofolate reductase 1 from Brucella canis complexed with NADP
rcsb
source organism Brucella canis (strain atcc 23365 / nctc 10854)
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
total genus 92
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bt9A00
3W8DA 1G6KA 2R2GA 1PGJA 3IJRA 3SC4A 3RBVA 3DAGA 2XOXA 3WSWA 2CMDA 5G0SA 1YRLA 1VSUA 1QLHA 1PR9A 3NDRA 5ICSA 3D7LA 4ZQGA 3HN7A 3KV3O 2V6BA 2FR1A 2VRCD 5KWEA 1PU2A 3F6YA 3FRJA 3I9OA 2RAFA 2HRBA 3CE6A 3SX2A 3NDJA 4ILKA 1D4FA 3IUPA 3PLRA 5T6BA 1PL6A 3WOHA 2JFHA 3DFZA 4FGSA 1HDZA 4HFJA 5EQDA 3OSUA 4EJMA 5MDHA 3OHSX 3OIFA 4XDZA 3VZQA 3BMNB 1HDRA 2O23A 3K8ZA 4J4BA 4K6CA 1LC0A 2GERA 1HSOA 4RPGA 3W4KA 1ONPA 5I7SA 3GH3A 2QHXA 1WVGA 4RZHA 4TQGA 5C7LO 4BMVA 1AUPA 4I9NA 4AJIA 4E2WA 5C3MA 3NKLA 3NT5A 4DL9A 4AJLA 1PIWA 3CUKA 4MVJG 1SEPA 3L6OO 5JDCA 5FI5A 4AVYA 4E2YA 3QVOA 2B4QA 5C7OO 2QZ9A 1KY4A 2Y1OA 4AJ1A 3FTPA 4DQUA 1GL3A 3I23A 5TX7A 1QV6A 1XYGA 3GN2A 1KC3A 1O6ZA 1JKFA 1DRWA 2P5UA 1ZXLA 4FFNA 3HN2A 1ZXBA 5KIAA 3R1IA 2Y1DA 2GN4A 1ZK1A 2JCXA 4U8GA 1SO8A 2VUTA 1YVEI 3GDOA 3NGLA 3G17A 3GEDA 1Y9EA 4I9HA 3H2ZA 1MFPA 1ZO8A 3PRJA 3V1YA 4FOOA 3JCZA 4YT5A 2ZYAA 1Z7EA 3MEQA 4UUMA 4QFDA 1L7DA 3GPDG 4O1MA 3ANMA 6ADHA 2Q1WA 1Q0QA 1OZAA 5TC4A 4EUFA 3GRKA 4E13A 4HV4A 3DOCA 3L9WA 3W6UA 4R5MA 3S2IA 2V6FA 3HE3A 2GDZA 1CQIA 3F46A 2ZK7A 3TSCA 4E5KA 1TA4A 4KUEA 2NVBA 1K5HA 3FBGA 3O38A 4J2OA 4W7IA 1QLJA 4BV9A 3R3JA 2Z5LA 5CDSA 1HE5A 1U7HA 4J1SA 5DNAA 5G2OA 4IINA 5AXDA 3U09A 5L53A 1UZLA 2NU6A 3K30A 5I8WA 3MTJA 2JCVA 2JAHA 4WLUA 2Z1NA 4HNHA 4RPHA 3DTTA 1I33A 4TZTA 1SZJG 2DUWA 4HKTA 5KJ1A 1QMGA 4BL5A 2PGDA 1LDBA 1HEUA 4P22A 2W2KB 3ONFA 4BQPA 3EZLA 3GZNB 2OBNA 3ZWBA 2PD6A 4RF2A 1HDOA 3AW9A 1VJTA 5A05A 1PEDA 3DZKA 1GPJA 2NM0A 3BZUA 3W8EA 3ZU2A 4D43A 1X0XA 1RYDA 3MWEB 4YRAA 2DTDA 3WNVA 2WMDA 1T26A 1OAAA 3H65A 5AXBA 1EUDA 2O3UA 5TLSA 2VYVD 1XSEA 4KTVE 4R1UA 5EESA 1E92A 1LSSA 4AJOA 2VCYA 4MVJP 3B70A 3I52A 1NQ5A 1EZ4A 2GGSA 2VUUA 3L4BC 4YQYA 2Q46A 3VH1A 4EJ6A 5JCJD 4EUEA 1I8TA 1HL3A 5DP2A 3LT4A 4GX2A 2GUGA 5EERA 3RUIA 3DB2A 1TT5B 3FHLA 2FHSA 3ZH2A 1TT5A 2Y0EA 2WE8A 1NYTA 4J7UA 1WMAA 5HBRA 1QYXA 1KY5A 4A27A 5BR7A 3OJLA 4O63O 5KJCA 1FF9A 1VE9A 1SB8A 3ZV3A 1NTOA 4XYGA 5JLAA 5FFFA 1QYDA 1LRLA 3V1UA 2ZATA 3L9XA 4INAA 3Q11A 4Y9DA 1H6AA 2AA3A 2ZB8A 1YGYA 4K6FA 3EMKA 3JQDA 5JAIA 3JD3A 2QYSA 2YDXA 3ZDFA 1NPTO 5KNLA 3AI1A 1RM4A 1DFHA 3JSAA 3WGHA 1K89A 2EJVA 3JQ8A 1E3EA 2IRWA 4R9SA 4UVDA 4BVAA 3K92A 4D45A 4E5MA 5COQA 1NVMB 3E18A 2XAAA 1MC4A 1GZ3A 3UKOA 3MOGA 3IKVA 3LQFA 1DB3A 4ZRNA 4GMFA 3AUUA 3VZSA 5BSEA 3BMOA 1ISGA 1U3TA 4FN4A 1B2LA 1ZK2A 3EZYA 4UUOA 4TRRA 4GBJA 2D5AA 4LMRA 1UUFA 2HK7A 3C1TA 4GVXA 2E6UX 2FPIA 3LT0A 4U0KA 2WEKA 1N9GB 2YHIA 3ZV4A 2HUNA 4B4VA 3BMQA 4JLWA 3ZW9A 4YJHA 2YV2A 4YJHB 1GUFA 4CPDA 5GMOA 3GPIA 1ML3A 1MLDA 3K2BA 1Q0HA 2GSDA 4QFCA 1DIHA 3LF2A 4NDNE 4WNCA 3JD2A 1V6AA 3D5QA 1KERA 1HE4A 1CJCA 2IZZA 3ZNOA 3UCFA 4UREA 1XG5A 3PHIA 5JAQA 2CVOA 1GQYA 3AK4A 2QQ5A 3L4SO 4WK6A 3VOSA 4AJPA 3KO8A 4GLOA 4CV3A 1U7TA 1VL8A 2RHRA 2I67A 3M6IA 3KYDA 5CEFA 1HZJA 1YOVB 4IY1A 3ZWNA 3BHMA 1ZFNA 1PSDA 4BNZA 4F3YA 4YXFA 3GGOA 4A10A 3FNEA 5EQFA 1BVUA 4NH4A 1I24A 2CF6A 4UEKA 5IN5A 5COBA 3PP8A 1P77A 2P9EA 2R00C 1NWHA 3G79A 4HFMA 4ZQHA 1IHXA 4PVCA 1RM5A 1I01A 5HTOA 4OMUA 1H2HA 1ZMOA 1M67A 1PQUA 3GLQA 4XRRA 1U3UA 4NU6A 4D3SA 3H5AA 1T24A 1CYDA 3KYBA 3UVEA 1DXYA 3T4EA 2HMWA 2PR2A 3L77A 1NX6A 1NPDA 1O94A 4OSPA 1YDWA 4TRMA 4IBOA 1GYPA 4BNVA 4CM5A 4YRBA 4OQZA 1F14A 1V3UA 1U9JA 4BGVA 4RGBA 3HZZA 3S8MA 3B1FA 4GAEA 4NJMB 3JQEA 1FK8A 4FFOA 4RZIA 4ITUA 3SJ7A 2PGLA 4EDFA 3ZWMA 1K3TA 4RPKA 2I9PA 2GD1O 4BNIA 2X7HA 4CLRA 3PTZA 1RM0A 4WLEA 4WEQA 4Q39A 3UW3A 3ZI0A 5KJEA 4RV9A 3WIEA 3DZBA 2Q49A 2ZYDA 3ETGA 4R9RA 2FZEA 4XKJA 2Z95A 3P2YA 3M2TA 4KUHA 1NWCA 1Y6JA 4OOEA 4RVHA 3ROKA 3UGKA 3OIGA 2P9GA 4AFNA 4FJ0A 1HSZA 1ZEMA 3WGZA 4BKUA 2J3KA 2HKIA 3Q9UA 3FWNA 3DTYA 5FEUA 4Y98A 1JLLA 2JFGA 3DEYX 5DOVA 1Y81A 1T2AA 4ND3A 5T57A 5AQ1A 5L3ZA 1PQWA 2E37A 3E9NA 3LF1A 2X0RA 5TJHA 4PLPA 4BV8A 5DZSA 4ZGWA 4GX5A 1NFQA 1BMDA 3I4FA 4W7HA 1EE2A 4XR9A 4OKNA 2P4QA 3PGXA 3PYLA 4NK5A 1T2CA 2PKRA 2IEDA 3A14A 4RVGA 4P4GA 1E3WA 2UUOA 2RH8A 1KETA 2B5VA 4A26A 1TEHA 1CRWG 5TGDA 5IXYA 4B4UA 1JKJA 1BDBA 1DIRA 4ZVVA 5L7TA 4YJFA 4DIBA 1DDOA 1KOLA 1B8VA 1PJTA 5A9RA 3UF0A 1QXSA 4OHUA 3FR8A 1DC6A 4J4TA 3U5TA 5BNTA 3CIFA 2GN6A 1JAYA 3ZNNA 2NQ8A 3WNQA 3B1KA 2WJPA 1AXEA 1T4BA 3PXXA 1P31A 4CM8A 4Y67A 4HFRA 2E82A 1IZ9A 4CM6A 4FFPA 1KEWA 1Y8QB 3ZCXA 1B26A 2CVZA 4FC7A 4DQVA 1YB5A 2AW5A 4KMSA 4NQZA 3DBHA 1LU9A 4E21A 1W4ZA 5AOVA 1LDNA 1BW9B 2AQHA 4ALIA 3QIVA 4QO8A 1DRVA 2VRBA 3OBBA 3RVDA 4F46A 2ZJ0A 2FR0A 4GVLA 2A92A 4UULA 4LRSB 4IJUA 1NAIA 3Q9NA 1EVZA 4DPKA 4GGOA 4R69A 3HUDA 5A4DA 1V3TA 3JQFC 2Y1EA 1IHYA 2O2YA 5CPFA 1M66A 3GUCA 3F5SA 4DYDA 4I8XA 3FBTA 1QYWA 1LA2A 4K26A 3PDJA 5F21A 4CLEA 1XU9A 4IQ0A 4AJNA 4BB5A 4ZHSA 4KQXA 1ADGA 4DGSA 3WGYA 3OIDA 3ZWOA 2VZ8A 2PK3A 2JL1A 5B1YA 1JA9A 3QJ5A 5TIIA 1KIFA 4NNJA 2WYWA 1X13A 3E9MA 4OGWA 4DLAA 2FSSA 1P74A 2HLPA 4WCFB 1HDGO 3ONEA 1H6DA 3L07A 1XKQA 4NBRA 2H63A 1JW9B 3RC1A 2J8ZA 4AJ4A 1E1NA 2X9NA 1ZK0A 5JC1A 1NR7A 4HP8A 3DMYA 5I7FA 3PLNA 4B7UA 1BWSA 2AXQA 1R0KA 1B7GO 4XWYA 4BUCA 1RPNA 4CLDA 2VZ0A 4OJNA 4IDDA 3LYLA 1KC1A 1JWAB 2G1UA 4JBIA 4EEXA 4MVJD 1GU7A 2E49A 3WBBA 1DOHA 4CUKA 1DHRA 3RI3A 1G0OA 3AUAA 1HRDA 3ZHYA 5JYEA 1PGPA 4GL4A 1X1TA 2HSDA 3KUXA 2OP0A 1CERA 5CP8A 1A4IA 1YB4A 2BFOA 4A7PA 3K9QO 2PD3A 3H9EO 4CLHA 1E1MA 1BHSA 3OJ0A 3FSRA 1PJ2A 3RUHA 3KYCB 1NQAO 4J9VA 4CM4A 4XR4A 3GEMA 1E77A 4CM4B 1EQ2A 4IZIA 1BRMA 1QYVA 2O3JA 2D8AA 5J23A 1C0IA 3CZRA 2BFPA 4CR6A 1JU9A 3DZGA 3GNQA 3GHHA 3S2EA 3P5SA 1NQOA 1DRUA 3D4NA 5JNLA 2ZKLA 5K6AC 4RLHA 1YBMA 3OQBA 4FC6A 4UVIA 1YONA 3GT0A 4OM8A 1JVBA 1VM6A 5EPOA 4Q3AA 1FJHA 2BI8A 3F3SA 1HXHA 2YJZA 4D3FA 4OOFA 3O8QB 3RUCA 3U4HA 3C1AA 1TXGA 4DREA 2NVWA 1ENYA 2PV7A 3E5RA 1ENZA 3NAQA 5KOIA 1C1XB 2DT5A 3LC2O 1ENOA 1XA0A 3AM5A 2UDPA 4GPD1 2Q3EA 4FCCA 3LC1O 3QVWA 4LVCA 3BTSA 1XELA 3JYNA 5I8ZA 2QZZA 3PEFA 4I9UA 3ZU4A 1UH5A 4B8ZA 3S55A 1UR5A 1WXDA 4WNIA 4TROA 3HSKA 3GF4A 1BXGA 3WXBA 1JN0A 3SVTA 3WFIA 2VT2A 1A4UA 4J4HA 2NVUA 4C4OA 4BNKA 4PRLA 2ZQZA 3EY4A 2D4AA 1P33A 3GNTA 3VH3A 1HDXA 4JXKA 1PQPA 2QX7A 5AXAA 4ZQFA 4KUGA 1EDOA 1DC4A 3D5TA 2I99A 5L4SA 1ZUD1 4UUPA 5I9MA 1W6UA 4MVJA 3KYDB 4BOYA 2DTXA 3S1LA 1N2SA 2VWGA 3PJGA 3RWBA 2AQIA 2CZCA 2P5YA 1XHLA 1KS9A 4Z0TA 4XQGA 4YR9A 1SBYA 3QVXA 1E5QA 3DOJA 5F1KA 2V6GA 5I9NA 3JTMA 1VPDA 2G82A 2TMGA 4WLFA 4HNGA 2PD4A 4GWKA 2A94A 4NG5A 4Z3DA 2GZ2A 4ESOA 1X7HA 3PVZA 4BNLA 3E6AA 5JXWA 2EW8A 3V2GA 1ZH8A 2PY6A 3CSDA 4UVHA 3NT4A 4Z0HO 2RIRA 6LDHA 1DJQA 2AG8A 3AOGA 3Q1LA 1NR1A 4ZJUA 1E6UA 3LU1A 3F1KA 3JQAA 4J43A 1R4MB 4J2HA 2EP7A 3AU8A 1ZJZA 1VI2A 1Q7BA 2Q50A 1SPXA 2NUAA 3K73O 3OJFA 1T2FA 3L0DA 1B0AA 3GGPA 5L9AA 5DCYA 1IUKA 2PZJA 5THKA 1ZW1A 2HK9A 4BNTA 4R54A 4YA6A 4CM3A 4FD3A 1A5ZA 1YJQA 1E1LA 1BGVA 4BNYA 2EXXA 3MJEA 1YE3A 3UXYA 1I32A 2EW2A 3I9JA 1N1EA 3QHAA 3DAFA 2HMVA 3F4LA 4MPDA 1U5CA 5FI3A 1ZSNA 3OJOA 1ZSVA 3PZBA 1YJ8A 4Z9YA 5T67A 5DBIA 4AJKA 2VTEA 4E3ZA 1MG5A 2NACA 1PJSA 3DBVO 1YXMA 5LC1A 4FJ2A 4GH5A 5JAMA 4HUJA 4JP3A 5CPBA 5IZ4A 3SBOA 2PFGA 3GY0A 4XYMA 2Y99A 2WYVA 3SLKA 3ENNA 3RD5A 3TFOA 4II2A 2NV6A 3PHLA 1PX0A 1XEAA 2B37A 4HWKA 3V1TC 3WYEA 2WD7A 4BO1A 1UDCA 3OFSA 1LJ8A 1GPDG 4ALMA 4Z9XA 5ITWA 4BNUA 1LQTA 4PGFA 1NVGA 8LDHA 3GAZA 1LLDA 4CV0A 5A9TA 1L1FA 1HETA 3DWFA 1VJ0A 1YWGO 4D44A 1ZJYA 1QORA 1GAEO 3H5RA 1QRRA 4RF3A 2YV1A 4BO7A 4BO0A 3PWSA 1F8GA 4F6LA 3OEYA 1TLTA 2DVMA 1O9BA 4UVGA 3ZWAA 3JQ9A 3F5QA 5JDIA 3JYPA 4N18A 3KM0A 4J91A 4P38A 2DTEA 4ZICA 1HZZA 4N54A 4CUJA 1B3RA 1RWBA 3DBRA 4KOAA 3X2EA 3DBRB 4PZEA 4FR5A 3RUAA 3TJRA 1WPQA 1JWBB 2C20A 3E9QA 2VYND 3D0OA 3WQQA 2PKQO 2EWMA 3NGXA 4NZ9A 3RBXA 4DPLA 3WGQA 4GSLA 3GG9A 3NRCA 3ROMA 3PFWO 4ALKA 1X7GA 4RJTA 5K0ZA 4QXMA 4YAKA 1UXJA 2PZLA 4L76A 2IXAA 1Y5MA 3F47A 5KVQA 2EGHA 4OAQA 4CLOA 3IL2A 4DUPA 4I5DA 1Y9AA 4RPLA 2RH4A 1YKFA 5C5IA 4XIJA 3IMFA 3U3XA 4XGKA 4XDYA 3GVIA 2HO5A 4MKZA 1DAOA 5LDHA 3PPIA 1IB6A 3QE3A 3SEFA 5CDUA 2D0IA 1JTVA 3JQ7B 2FN7A 1HE3A 2XF8A 3I6QA 4IXTA 3M1LA 4EUHA 1XDWA 4MIOA 1B8PA 2IE0A 1WAMA 4PLFA 2EF1A 2DBZA 1EFLA 1DC5A 2B4TO 3PJEA 3AOEC 2C29D 2I3AA 3R3SA 3GRPA 4B4WA 5IFLA 5T64A 4JQCA 4PG5A 3X2FA 1PJCA 1R4NA 2UVDA 3GN1A 1R4NB 2D59A 2QRLA 1CWUA 4DBVO 2CDAA 5CDGA 1FMCA 3DAPA 3EW7A 3OQ6A 4HBGA 4LRTB 5JMWA 2GYYA 3A9WA 2X8LA 4BNXA 1U2GA 3ONDA 4BGIA 4RF5A 4DC1A 2HMUA 2PTGA 2W2LD 4NU5A 3AM4A 4ZD6A 2OOSA 1I36A 2C7GA 5F1OA 4YJGA 3JQCA 2OXIA 4O5OA 3OMLA 5BSGA 4CM1A 4IUYA 1ORRA 1FDWA 1IZ0A 4U7WA 4LCJA 1LTHR 1I3KA 5GY7A 1TT7A 3TZHA 1H9BA 1VSVA 3DR3A 1RM3A 1V0JA 3FR7A 3MJ4A 2HJRA 1PJBA 3BA1A 3O4RA 4I5GA 5B4VA 2BGKA 3E82A 4CUZA 3FPLA 5ADHA 3DBLA 5KVCA 3FTNA 3VKVA 1E5LA 2UUPA 1EE9A 2FPGA 3VPXA 3W4IA 1YQDA 3SLGA 5IZCC 1UZMA 1H93A 3L4BA 3TPCA 3B20A 4EI2A 3H2SA 3DL2A 4H16A 2P68A 4RVFA 5ER9A 3A1NA 1U28A 2EP5A 1ZNQO 3ZWPA 1CIVA 2Y93A 1SOVA 2WWRA 1KVQA 4NFHA 4YACA 5EL0A 4DRYA 2EV9A 2Q1UA 1ZIDA 2BGMA 1N9GA 3E5MA 3LLSA 4XX0A 1BDMA 2JFFA 3KETA 1KYQA 4E30A 2PH5A 1EFKA 3EUWA 1WDKA 2J5QA 4YPOA 2X1HA 4E2ZA 4IIVA 3AUSA 4FIZA 4EITA 3JQBA 1Y7TA 3CZMA 4CQMA 2JJYA 1J49A 1O8CA 2I3GA 4MVJE 4CMEA 2B69A 2VNSA 3BXXA 3AM3A 4J1QA 4ONEA 3HDYA 4J9UE 4L4SA 4XCVA 2IYOA 5ENVA 4YCAA 3QWIA 4YAJA 2NVUB 2ZTVA 4CV1A 3QLJA 3C7DB 5EMHA 4DWVA 1EK5A 2HCTA 1ARZA 5ER6A 3JYLA 3P19A 5TQVA 1PWZA 4JJFA 1QP8A 1P0CA 4G65A 5DOZA 1LSJA 2JAPA 4DQXA 3ITDA 2Y68A 4Z9FA 4E5PA 2DUUA 1YL5A 2HMTA 5KCZA 1GY8A 1ISHA 3AI2A 2OHXA 1C3VA 2C59A 3RU9A 1N5DA 1WDLA 1QSGA 4CQLB 4G2NA 4CQLA 2DBRA 1Z45A 1E7WA 2VOJA 4IMRA 4AG3A 4PIVA 4IZHA 2GN8A 1ZZEA 3WFJA 1GV1A 4Q3NA 3INRA 3PIIA 4E2XA 3KSZO 3DBHB 4R5HA 1RYEA 3C8MA 3OQ1A 1MXFA 4YEDA 3ZHZA 5B37A 3LVFO 5G0VA 1QV7A 2H9IA 4FPXA 4BB6A 2Q1SA 4XYEA 3ST7A 5A3JA 4K28A 1P44A 4RDHA 2EJWA 5G4KB 1EBFA 4TWRA 3D3WB 4PZDA 5JS6A 1U8FO 3INTA 3KTDA 1T2EA 2BI7A 3DHYA 1TVEA 1VRWA 3I4CA 5U4QA 3QVSA 5TF4A 3JQGA 4B8WA 4WOJA 1PGOA 2V6MA 5DULA 5FWNA 1PGNA 3RKRA 1IOLA 3Q3CA 2VHYA 4O59O 3B6ZA 3ZHBA 1UDBA 1C1DA 1LXCA 4URFA 2RCYA 2OL4A 3VKUA 4YJFB 1G0NA 4NBVA 4J49A 4BS9A 1YH3A 2G17A 3JQAD 4YAIA 5KJFA 4YRDA 4J16A 9LDTA 2DKNA 3QRWA 1VKNA 3G49A 4CM9A 4KTTE 3EYWA 4WLNA 3INGA 4N5MA 3RC7A 5IN4A 1LX6A 3HHPA 2X5KO 3KHUA 2FMUA 1Y8RB 4K9DA 3AJRA 4CM8B 1GR0A 5L7WA 3STHA 2YHUA 4B79A 1I0ZA 4EYEA 1UXIA 2HAEA 4FFMA 2H6EA 3F4BA 3DO5A 4R1TA 3HNPA 2VNAA 1D7OA 1U1IA 3TL3A 4B7XA 3QV1A 5BNIA 3R0IA 3H5NA 4YWJA 3KOUA 1S7CA 2XXBA 3GFBA 3WYCA 1X15A 4GMGA 3TDKA 4E32A 3JQFA 3AOEA 1OBFO 2DQ4A 3PIDA 3C7CB 3LK7A 1WLYA 5A5EA 3PJDA 4R3NA 1HLDA 2PWZA 5A3VA 3VZRA 4I5EA 1ONOA 5FF9A 4FJ1A 4ALJA 4R01A 3JQ8B 1V9LA 3IAHA 4FSHA 1GD1O 2NNLD 1E3LA 2D3TA 4RVSA 3RFXA 3TZQA 3H3JA 3NX4A 4UEOA 5DDIP 5C7IO 4YDRA 4LW8A 3OF2A 4WPGA 1PS8A 1Z82A 1UXGA 4PLVA 2HRZA 4BNNA 3HDHA 5L95A 5EJ2A 2HJSA 1XQ6A 4CJXA 2BMAA 2DBVO 1KVTA 4ZQBA 1Z7BA 1BW9A 1V8BA 4DXHA 5KTKA 3TZCA 1I2CA 4MJLA 4Q9NA 1EMDA 8ADHA 3IIEA 5JY6A 4TMFA 1R0SA 4WEOA 1UP6A 3KLPX 1H0KA 3PQEA 4BGEA 1SNYA 1V3VA 2D5CA 3OETA 3U4IA 4D46A 1D1TA 4N5LA 5BSHA 3GK3A 2GO1A 3GGGA 2YZ7A 1JDJA 1SAYA 1PS0A 2J5RA 2PZKA 3DMTC 4TKMA 2C54A 1VC2A 2P91A 3IUSA 1EVIA 2RBEA 4EGFA 2GZ3A 3NUGA 3U9LA 2PGJA 4KDFA 1R66A 1P1JA 1GEEA 3AU9A 3V2UA 2O3SA 5L7YA 2V65A 3L6DA 3UN1A 4IS3A 4QSMA 4ROSA 1HDYA 1XQ1A 3CEAA 2O3RA 1FDUA 3IJPA 2IZ1A 4I08A 2HU2A 2EKLA 4U5QA 1PJQA 2YDYA 1I3NA 2QRJA 4B3JA 4CMAA 2NU8A 1SMKA 4R3WA 1EK6A 4YYZA 2EIHA 1OOEA 1U4SA 2ZJ1A 3KEOA 2VUSA 4IGEA 4ID9A 3VPGA 4CMHA 4CM7A 4IQGA 1LQUA 3HDJA 4RO0A 5A04A 2AEFA 4IJWA 2B5WA 1DEHA 5HA5A 1PZEA 4J0EA 3KB6A 4B3HA 2BFAA 2NADA 3RUFA 1EBUA 4WJZA 4D42A 1AE1A 1WP4A 1TI7A 1GTMA 2AE1A 1A7AA 2BGLA 1F8FA 3GVHA 5TS3A 2BELA 4A5OA 1RKXA 4BNWA 1NM5A 4Y6PA 3K2EA 2PNFA 3N74A 4A0SA 1AN9A 4AJEA 4ALNA 3Q6IA 5CEJA 3C7AA 4FOSA 3KYCA 2EHDA 2O3QA 4OKIA 5A06A 1P1KA 1K6IA 3PQDA 2YHIB 1BSVA 3E1KA 1DFGA 2DU8A 1DIGA 3MCVA 4MVJI 2Z1MA 3UH1A 4OYRA 4RVUA 1V35A 4IDCA 1GUZA 1E7MA 1XWFA 3GNSA 1M6WA 1LUAA 3P2OA 5HS4A 2I65A 2Y1CA 4GGPA 4HX5A 5ES3A 1A9ZA 1P1HA 1HTBA 4BO8A 4CLRB 2J3IA 4IM7A 2Y05A 3GEGA 1YBAA 3QW2A 2YYYA 1ZK4A 3GHYA 3HB5X 5KVSA 4IXWA 1ZMTA 5ILGA 4M86A 1PS9A 2X0NA 2F00A 4Z0PA 5T5QA 5TSDA 1NBOA 4BNHA 1R16A 3QP9A 4CMEC 3IP1A 3BMNA 5T8KC 1BG6A 3BMQB 1CF2O 1T25A 5DF1A 5CG1A 4D3DA 1HKUA 2FSVA 5B12A 5CHEA 3TOXA 3RJ9A 3C24A 3IS3A 3NEPX 3VVBA 4L4RA 4ALLA 3ZHXA 3VTZA 1P3DA 3VVCA 4FBGA 5JFOA 1E0DA 4XQ9A 1K0UA 3BHIA 5L4LA 1EDZA 4UVEA 4W4TA 4NFYA 2IEBA 3QWAA 4QT0A 1ZK3A 2WYUA 4RCVA 3ITKA 3OP4A 4ND2A 1U4OA 4TRNA 1G1AA 2DFVA 3RSHA 2JD2A 3C1OA 3H6KA 4B3IA 4UEJA 5DBFA 1LC3A 1YL7A 4YAEA 2WM3A 5H81A 3W1VA 4JJIA 3KBOA 4CM9D 4LISA 1LDGA 2UYYA 4MKXA 4Z3KA 4PLCA 3WSVA 3TWOA 2ET6A 4XQEA 5KKCA 2C2XA 3GAFA 4JP2A 1Z74A 2ZB4A 4NR0A 5IJZA 5JSFA 1HYHA 3TL2A 4DLBA 2PA3A 3WMXA 4BNGA 3CINA 3D4OA 3OECA 4W6ZA 4JN6B 1X14A 3I9LA 4KWHA 4L75A 1VLLA 4DC0A 2QW8A 2AQKA 4XA8A 2W2KA 4LN1A 3RKUA 4OQYA 4XJTA 1KVRA 3TZKA 3O03A 3PHJA 2GCGA 3U4DA 4LK3A 3QA9A 4AL4A 4J3FA 5A03A 4FB5A 1CEQA 4BNMA 4D0SA 1QG6A 2PZMA 5THQA 4YVFA 5JW6A 4ZQEA 3WQRA 3ROPA 3ZWWA 1GCOA 3CKYA 3PWKA 2VWHA 4OIMA 1ISIA 3KLMX 5AXCA 4PLZA 1NVTA 1GQ2A 1WDMA 1YQGA 4PLWA 2A35A 4WOKA 1EQUA 1MB4A 1OFGA 4E6PA 1LLCA 5ILOA 2WTBA 1ADCA 3GZNA 2ZTLA 3ANNA 1LI4A 3GVCA 3HWRA 4GWGA 1Q2XA 2DFDA 3WR5A 4WLOA 1AGNA 4HADA 5AYVA 4CODB 3KRTA 3D1LA 1HLPA 3A06A 4FQ8A 4IDBA 1H6BA 2Y1GA 3H9GA 4IJVA 1GQQA 4NBWA 3ZNPA 1JVSA 2CVQA 3Q0EA 4Z6KA 1U3VA 1YDEA 3WIDA 1A27A 4DBZA 4FW8A 4BQRA 3COSA 2J3HA 3HADA 1DAPA 2JKVA 1LLQA 2OZPA 1WZEA 5G0WA 5GZ6A 3VAZA 3BTVA 1L7EA 3PZRA 4MVJM 2I6TA 4R4JA 2OFPA 1LEHA 1PTJA 3K5PA 1VJ1A 4M54A 3CTMA 4PG7A 4W99A 3S2GA 1MX3A 5C37A 1WMBA 2VZ9A 3WB9A 5DT9A 3ZGYA 4E4YA 3DDNA 4MOWA 2ZQYA 3DXFA 2O2SA 2Q1TA 5A5FA 1NNUA 1P1FA 3LC7O 3CMMA 2R6JA 1T1SA 4J6FA 1DLIA 3RFVA 4F45A 4CMBA 5CAEA 3WJAA 1CQJA 1DHTA 4BKQA 9LDBA 2QIOA 3W6ZA 1IL0A 4IDEA 2F1KA 3ZWYA 1HYGA 1VL0A 2DBQA 2CNBA 2ZB7A 3AY6A 4MP3A 5HM8A 4BKPA 1DPGA 3OM9A 3BYZA 4BMNA 4QUKA 4WKGA 4YAGA 1N92A 3DZHA 2AEMA 3I5MA 1OC2A 4XB1A 3EAGA 2OP1A 3IQDB 2NU7A 2J3JA 4M87A 3KZVA 2GASA 3DBLB 2W90A 2POQX 1Q1NA 5G0UA 1LRKA 4Q3EA 2AG5A 3H9QA 1ISMA 2TMDA 3FI9A 4K1LA 4XZ3A 5A02A 5TRTA 5IF3A 1GUYA 4R1SA 4ND4A 1B14A 2O48X 4XGNA 3WGTA 1UJMA 3S2FA 3PDUA 3QWFA 2WDZA 3JQ7A 5CDYA 4G5HA 1K6XA 2FY8A 4DA9A 5U9CA 1PR3A 4L0QA 5IDYA 3QVTA 2X23A 4XEHA 4P8RA 2GNAA 5T8KA 1K2WA 4R68A 4WCFA 3QQPA 2ZYGA 1A9YA 3M2PA 2GPTA 2YY7A 3VC7A 3ZZNA 3UCEA 3OJEA 3T4XA 1B3BA 1C1XA 1A71A 1M2WA 3WG9A 2VHZA 1RJWA 4FS3A 3ZWXA 3A4VA 2PH3A 3F1LA 4OO3A 1FDSA 1YOVA 2EERA 4IDAA 1U3WA 4J90A 5CG2A 1N8KA 1PL7A 2ZTUA 1DJNA 1P9LA 4M1QA 4MIYA 2Y66A 3L6EA 3IC5A 4M8SA 2DLDA 1O0SA 4CR8A 2EG9A 3DFUA 2X6TA 4ZA2A 3RC9A 3PYMA 2BRUA 3GMSA 4PLYA 3VHRA 3AFNA 5IG2A 3LZ6A 5LDGA 1AXGA 2J5KA 4NIMA 4BO5A 1ENPA 1XIVA 2BF7A 4QQRA 1DIAA 2AQ8A 1IULA 2BH9A 1C0KA 2NQTA 3V8BA 3WLEA 1UP7A 2FZWA 2C5EA 2GF2A 3BMCA 3HFGA 4QTZA 4XRGA 3MWDB 3WQSB 4PN3A 2GZ1A 4TZKA 2ILTA 3PYXA 3UAGA 1EUCA 2B0JA 1Q7GA 3IDSA 2B83A 3H9JA 5ENDA 1NP3A 1X0VA 3G1TA 4GX1A 5L51A 4NJOA 7MDHA 1N7GA 1C14A 2X0JA 4BO3A 2X5OA 5JO9A 1HT0A 2OMEA 4BKRA 2NLOA 2P2SA 3N7UA 3AY3A 4WCDA 4CMKA 1ADFA 3DQPA 4BNJA 1N1GA 3PWZA 3ADOA 2G5CA 4DLLA 5JC8A 2FRDA 2J6IA 1OMOA 4JBGA 5JE8A 4L74A 2VTDA 1Z6ZA 1GYQA 3WICA 1HE2A 3KXDA 3WTCA 3GUYA 3GDFA 1I3MA 3GMDA 4WCFC 3AWDA 1O95A 1I2BA 3MJCA 3VDRA 1BTOA 4L4XA 3ADPA 2CF5A 3UUWA 4IIUA 2DC1A 1J6UA 5G4LA 4QO7A 1GFSA 2NWQA 2IODA 3RCBA 3WS7A 3JQGB 4TVBA 3NYWA 1XLTA 3ULKA 2FWMX 1Z75A 3U62A 5JPIA 2BKAA 3EC7A 1O5IA 3WWZA 4GKVA 4I5FA 2NTJA 1E3IA 3C85A 3I9MA 4BNFA 1XR3A 1AHHA 4IJKA 3K6JA 1PJ3A 1FDVA 5IDWA 1Q0LA 2YFQA 4TKLA 4E0BA 2WE7A 4NBTA 4CR7A 4DMLA 5L40A 3GVXA 2RHCA 3LT2A 4CV2A 3DONA 4PLTA 2HDHA 3FNHA 3W8FA 4II3A 5H82A 4J7CA 5IXSA 1IYZA 1GCUA 1B8UA 4OSOA 4YTEA 4A03A 5GZ1A 1A72A 4NFSA 2R00A 5JCJA 2IYPA 1I10A 4BIIA 1QR6A 3FCOA 1MFZA 3M1AA 4IMPA 4MIEA 4TSKA 3ON5A 3BAZA 3EGOA 4A73A 1PJLA 1AHIA 1LNQA 4L8VA 4Q3CA 4N7RA 2C2YA 5TJ9A 2Y0CA 4FDAA 3R6DA 5I7EA 4UUNA 3HDQA 3U4CA 2X58A 1GYRA 3OICA 5B4UA 1E7QA 2B36A 1EVJA 4XB2A 1ID1A 1F06A 3JYOA 1H9AA 2O50A 1VL6A 5F3RA 2NTNA 4DTIA 1TB4A 1YO6A 1DLJA 3MZ0A 4Y6SA 3RJ5A 1NASA 1I30A 4OL9A 1SOWA 3D3WA 3VTFA 3JQ9C 2QG4A 2AE2A 5EINA 5COAA 3TF5A 3ZU5A 2B4RO 2YW9A 1Y8QA 1M6HA 2W8ZA 2X22A 2Y0DA 4MKRA 5BQFA 3H3FA 3WGOA 3SXPA 1E3SA 2FPPA 4ZU3A 1LBEA 3I3OA 3ZV5A 1JQBA 2I76A 2EKQA 3PHGA 3ZWVA 1I2ZA 4NHEA 2GN9A 4Q3DA 3OA2A 1H6CA 5K9ZA 2P4HX 3Q2IA 2Q2VA 2OGUA 4YBZA 1UXHA 1MV8A 3QWHA 4KWIA 1DBVO 2QYTA 5IDQA 2FR8A 3VPFA 2Q99A 4XD2A 1J4AA 1PZGA 4XYBA 5KVVA 2AMFA 5I7VA 2CDCA 4RVDA 1DSSG 1UZNA 3BHJA 2XXJA 2GLXA 4AICA 1U2DA 2VHXA 1E3WB 3D4PA 1UAYA 3E03A 1WNTA 2NSDA 4MP6A 2ZTMA 5BT9A 3AI3A 3EVTA 3GG2A 3UCXA 1CDOA 3KVOA 1GZ4A 3FNGA 3ICCA 5JY1A 2DPHA 3JYQA 1S6YA 3PJFA 3VDQA 3RROA 2IDZA 1A7KA 2Y1FA 3TFQA 1KEVA 2EGGA 4BKOA 3RUDA 4E5YA 2DPGA 5EN4A 1HDCA 1Q7CA 2D1YA 2GRAA 4PRKA 1UXKA 1NFRA 1W8DA 2VN8A 3P7MA 1Y8RA 5AVOA 1KEPA 2WD7B 1NAHA 4GSKA 4XIYA 3KSUA 3UFXA 2VQ3A 2X0IA 3OH8A 3RFTA 2DM6A 5JO0A 2JHGA 1XU7A 1M75A 4TVOA 4D79A 2G0TA 4DIOA 3FD8A 3K96A 1F0YA 4IDGA 1PWXA 1MP0A 4OH1A 3HQ4O 4IGFA 4R1NA 4AJ2A 1UAGA 3ZU3A 1EVYA 2OO5A 4LGVA 5A1TA 5CEEA 3WDSA 1H5QA 4BO2A 4CQMD 5HRUA 2CDBA 4QEDA 2YQ5A 2Q2WA 1YL6A 4S1VA 1XGKA 1NHWA 4L73A 4CMGA 2E48A 3D3EA 1B16A 4QX6A 3PI7A 2LDBA 4OXNA 4RL6A 3WBFA 4YB8A 2G76A 3BMOB 3MJVA 2GR9A 3H8VA 4FFRA 3VPSA 1PZHA 2W98A 4E5NA 3NTQA 2IZ0A 3O8QA 4PFJA 1M76A 3SC6A 1F12A 4L9RA 5DN9A 5CFZA 4R41A 5GZ3A 3EVNA 5TT0A 3FN4A 3ICPA 4RLSA 2HQ1A 5IAAA 1ZCJA 2VWPA 3B1JA 1LLUA 3DZJA 1EEHA 4FGWA 1FXSA 4BO9A 4EEZA 3JQBC 3MJSA 1GADO 1WZIA 3K31A 3NJ4A 1GDHA 1GEGA 2C7VA 2Y67A 3V5NA 3ZN2A 3C3XA 1T2DA 2H1SA 1R37A 5ITVA 3QWBA 4PLHA 4AJJA 1PGQA 2SCUA 1JAXA 3ETEA 2WD8A 3QY9A 4DMMA 4I1IA 1MUUA 3O26A 4J0FA 4YT8A 3DMTA 1WW8A 4XJSA 4E33A 2BFMA 4HY3A 4B4OA 4WLVA 1Z73A 2YUTA 1ULUA 5DP1A 4YJGB 3NV9A 3T7CA 2ZB3A 3WYBA 3GDGA 2O4UX 5F5NA 3F9IA 1IY8A 4DPMA 2VYVA 2LDXA 4H3VA 4YQZA 2VOEA 4W9NA 1H2BA 4GQAA 3JQAB 1X7DA 4KZPA 1O89A 2ZIZA 4A2CA 1U8XX 3LDHA 4R51A 1XCBA 4N5NA 3JD4A 2OUIA 1B15A 5TT1A 4MP8A 4DYVA 1R12A 4LCEA 3LT1A 2JD0A 4DVJA 1PJ4A 4EW6A 3G3EA 1NHGA 1DO8A 3JD0A 3PHHA 3GC6A 4RQUA 4C7JA 3CH6A 4X54A 1BVRA 5IDXA 3I9KA 2D2IA 5JDIC 1T1RA 3ZWCA 1D3AA 4G81A 2BHLA 4WASA 1VKOA 1MXHA 4BO4A 3H9UA 5HS6A 3U49A 3I9NA 2JD1A 2FOIA 1N7HA 3VH4A 3AUTA 1ULSA 4MO2A 4C7KA 3WJ7A 3IOYA 4GKBA 1F17A 1KVSA 3ROQA 1X1EA 1YQXA 7ADHA 2O7SA 5B4TA 2Q45A 4D7AA 4HXYA 5MGBA 4RF4A 3WGIA 3A28A 5G4KA 2I66A 3JD1A 3AY7A 3ANLA 1SC6A 4XQCA 3BTUA 3DHEA 2NTVA 3AFMA 4WGGA 4S3MA 3HFSA 2ZCUA 3N58A 2XPCA 1E1KA 3WTBA 4BGUA 1BXGB 3H7AA 1BXZA 1P1IA 4IQ8A 1ADBA 1NPYA 4E12A 1UDAA 4H15A 5CDTA 5JYDA 4NK4A 2W2LA 5U1PA 3UOGA 1C0LA 3Q2KA 3HG7A 3RAJA 2VYNA 4MVJH 1BXKA 5DCWA 1GZ6A 1E6WA 1OC4A 3ORFA 4J1NA 1T4DA 4PZCA 4RDIA 4U6QA 4LVUA 3W4JA 4CLXA 1MGOA 4JGBA 3ZNQA 4AJHA 1JKIA 4HFNA 4DIFA 4PG8A 1IE3A 3EDMA 1DFIA 4NPCA 1CETA 5DBGA 2Q4BA 4JBHA 4PLGA 3ZW8A 1LSOA 1D1SA 3RQSA 4ND1A 4CMIA 2W4QA 3RASA 3HJAA 1QYCA 4CMIB 4OXYA 3T7EA 4CL8A 5BNFA 1P45A 1HWYA 2CFCA 4W9NC 2CY0A 3KSDO 2C0CA 1PL8A 4H7PA 1ZKMA 1W73A 3JQ6A 5EIOA 3WMWA 4RPJA 3VZPA 1MG0A 1DIBA 1R4MA 2YQ4A 4GLLA 4PG4A 4LSWA 2JCYA 4EZBA 3EK2A 1J0XO 4ZN6A 5JCXA 2NU9A 1Y1PA 3EHEA 5JAZA 3G1UA 3I1JA 2O4CA 1MA0A 2JHFA 1QKIA 2QRKA 3MTGA 1LDYA 4JCOA 4KQWA 4MINA 2VRCA 4MVJF 1NXQA 2VHVA 1ZEJA 4M55A 4XGIA 3BIOA 3PFFA 1KEUA 1LSUA 1SB9A 1ZVMA 2WSBA 4JX8A 4YT4A 1W0CA 2UV8A 1MC5A 2OORA 1ZBQA 4JK3A 3ENKA 1E7RA 2CD9A 4F6CA 3GQVA 4CLOB 1SEVA 2PLAA 4QECA 1DC3A 3TQHA 1ONNA 4FFLA 1ISJA 2AEJA 3UHAA 3PQFA 4PCVA 4J7XA 4NI5A 3LSYA 1I3LA 5F5LA 1C0PA 2ZCVA 2X5JO 3IKTA 3H4VA 4BO6A 1R0LA 4WECA 1FDTA 4Q3BA 2I5PO 3MOIA 1R15A 3IP3A 1U5AA 2YV3A 3PGJA 5BSFA 3DC2A 3GR6A 5H83A 1C1DB 2X4GA 4LSMA 3NJ8A 5JBIA 2YFHA 3ABIA 4WE3A 3RUEA 2HK8A 3UICA 3BTOA 4J1TA 2BD0A 2PKQP 3DHNA 4PG6A 3RU7A 3O9ZA 4O6VA 4W82A 1E6EA 4IS2A 4MDHA 5LCXA 3SJUA 2AHRA 4GI2A 2Q2QA 3TZ6A 1KBZA 2FP4A 3WGGA 4JROA 5G0TA 3WLFA 5A9SA 3NT2A 4GX0A 5A9SB 2OBYA 3NTOA 4D41A 2VHWA 4Y6RA 1E3JA 1GV0A 2CSUA 3GOHA 4ND5A 3U0BA 3WWYA 3OEWA 5JMPA 1NQTA 1OI7A 5JDCC 2Q4EA 1HF3A 2HMSA 3ETDA 3NDIA 3DZIA 3G0OA 4JNKA 3VH2A 2X86A 3I83A 1K6JA 1IPEA 5L4NA 2O3TA 3GFGA 4U6SA 2UAGA 4M49A 1H94A 3RC2A 4RORA 1R6DA 3MJTA 3I6IA 4PVDA 3KEQA 4XYLA 3GA0A 4R16A 4KDEA 1P1RA 2EEZA 3CXRA 1D8AA 3JV7A 3WX0A 3ZV6A 3OA0A 1SCUA 4CQMB 1PZFA 1UP4A 3FWZA 3TN7A 3RIHA 4EJ0A 4JIGA 5K6AA 2C82A 3HB4X 3LLVA 5DCUA 3CMCO 3DZFA 4BHTA 1YS4A 4CL3A 3D64A 1E7SA 2C5AA 4O0LA 4LMPA 2E4AA 5FYDA 5KKAA 2VWQA 3TNLA 1Y5RA 1P0FA 3TRIA 5KJ6A 4U0JA 4JJGA 4OXKA 1LDMA 4KP7A 2IXBA 3RBZA 4IDFA 4EBFA 2X9VA 3FF4A 4BMSA 4D0RA 4NMHA 3VPHA 4Y8VA 4CMCA 1ZSYA 2VT3A 4ZRMA 5IZCA 2P9CA 2BLLA 4YT2A 3ASVA 2CUKA 1WWKA 1I5RA 3QSGA 5TNXA 3ASUA 1EUZA 2DAPA 3V2HA 4B7CA 4WUVA 3TOZA 4P4NA 1E7YA 1LRJA 1YBVA 3E48A 3PK0A 2A9FA 1J5PA 2C07A 1HYEA 2H5LA 4NBUA 3DOOA 2V7PA 1ISFA 2O7QA 5L45A 1KVUA 5F1PA 4RQTA 3NTRA 4TRJA 5I9LA 2A4KA 5ICMA 5HWSA 3FPCA 3FNFA 1YB1A 3BMCB 3CPSA 2EKPA 3E8XA 3GZ4A 4CMJA 1LDEA 1IPFA 4E31A 3GVPA 1NFFA 4P4LA 4UAGA 4M89A 2X9GA 4YJDA 2B35A 4IPTA 4NJMA
chains in the Genus database with same CATH superfamily
2QRGA 3JAWA 1G6KA 1DWOA 3C15C 4H4CA 3DPIA 4B45A 1PGJA 2FPGB 4F92B 5MGNA 3OOWA 2ZCJA 2PMKA 3DAGA 2XOXA 2CMDA 1T9KA 4QVGA 3IEPA 4P7JA 2JLSA 4D02A 1QLHA 3OFNA 4KDRA 1L6IA 5LLDA 4H7JA 2J0QA 4W5OA 4RJLA 2WF6A 4I50B 2FR1A 4XVUA 5KWEA 1PU2A 4RGQA 3AZQA 5KYUA 3CE6A 2Q6VA 4XXHA 2H52A 3SDZA 4LG1A 1TYCA 1ODSA 3KT0A 3ZEAA 1ACMA 3B1WA 1Q0SA 3FGZA 5T6BA 1PL6A 2B2NA 3WOHA 5DISB 2JFHA 4FGSA 2G71A 4KH1A 5I48A 4AKGA 1V8DA 3ILHA 4JA2A 3HVIA 3P9RA 4JFRA 4EJMA 2RHGB 3I73A 3QZUA 4XDZA 1V71A 4L5JA 3QX8A 4TKUA 3BMNB 1MABA 2EBUA 1XD2A 3UK0A 5JH7A 4LKOA 2O23A 1M7BA 2C04A 1SA0A 2KB0A 4K6CA 5CXXA 3R9KA 3TNYA 5CFQA 1HSOA 1TK2A 2BJHA 3FETA 1L4KA 1ONPA 3ED5A 4KWCA 1J97A 4LX8A 4YROA 5FTMA 1I1HA 5I7SA 3S68A 2YJTD 4TQGA 4F1KA 2Y27A 3HVJA 3TBHA 3U4GA 4BMVA 5ISMA 2ZBPA 1KF0A 5C3MA 4EG7A 3CY6A 3WDMA 2X9QA 1PFGA 1NJ5A 1AKTA 1CD5A 3C6KA 3TJRA 4JYZA 3CUKA 3HK2A 3VKWA 3EB9A 3HCEA 4O4JB 2RI1A 3GJZA 2WY2D 3S29A 4L15A 3WK4A 4RESA 1KZYC 3QVOA 5LU8A 3S8EA 5C7OO 2ZT8A 4LOJA 5JSYA 2Y1OA 2J0VA 3IAM1 3K4PA 3KUUA 4UNNA 3WOVA 4C4TA 3I23A 4DQUA 5TX7A 4UM7A 3GN2A 1O6ZA 2C4HA 3C3YA 2IZOA 5FQNA 3OQJA 2OFFA 1FFCA 4W6QA 4AC9A 2IH2A 1GXSA 3SXJA 4KAJA 3D2CA 1D5WA 5KIAA 3D59A 1LBSA 4HGOA 3DKRA 5KNBH 4N9WA 1C4WA 1R6UA 4ENPA 1YVEI 4HC4A 1LF0A 2PQ2A 3GEDA 2MJLA 3KB8A 4O0MA 4W7SA 2JG3A 4YYEA 4ZT5A 1DO2A 2ZYAA 2VTVA 3MEQA 4MKHA 2XNSA 2WU3A 3RYIA 4QOSA 5J9FA 2OORC 1ICEA 1E6KA 4IX9A 3T5TA 4AO8A 4HV4A 3FOEC 3OZEA 2CV1A 1IZYA 2V6FA 3HE3A 1Y1KE 3F46A 1LVUA 2JFVA 3ZEIA 4E5KA 1S1MA 1G41A 1K06A 1TA4A 3RJMA 5AK5A 4J2OA 1L7XA 1JNYA 13PKA 2I2XB 4ZDWA 2BFCA 2OBFA 3R3JA 4JKYA 3C97A 4ENTA 2JFZA 4GI1A 5C4IA 1L4MA 2NU6B 4IINA 2PR7A 1MMFB 5L53A 1UZLA 5KOHB 3MTJA 2IX3A 4MGIR 1RI2A 2Z1NA 1XAHA 2JLVA 3DJFA 4IIEA 3IMEA 4LHXA 1KP9A 1I33A 1XEFA 2ZR0A 4D0GA 4JB0A 4IHJB 4EGCB 1CJKC 1KAGA 2PGDA 1LDBA 2O14A 4EP1A 5D1HA 5JJIA 3DWGA 1BE6A 4BQPA 3GZNB 4I81A 1IPHA 1U3GA 3F7NA 1YR1A 4RF2A 1JR2A 4NOMA 1TUGA 1GPJA 5FBHA 5KCMA 4B43A 2NM0A 4PO9A 3UXHA 4ECEA 5FPHA 3ZU2A 1N6HA 1CLUA 4P6VF 1X0XA 1XOIA 2BGNA 3PC6A 3B5JA 4NCKA 4GP9A 3WNVA 4R83A 3WMGA 2ZSDA 1EG7A 3C4QA 4OHBA 1GN8A 1T26A 3UYKA 4CCSA 3QVVA 4RTJA 3ICEA 4HK4A 3ESCA 2OENG 1VL2A 3NOQA 4MIKA 4EB3A 2B25A 5TDHA 1MVNA 4Z49A 3LUBA 5E1DA 4KXLA 2QEQA 3GFQA 2EHJA 2A5LA 3C8UA 5TLSA 1GRRA 1XSEA 3PQ6A 3R0XA 4R1UA 4US1R 1C7EA 4BATA 1WB6A 3FWKA 4OL0A 3I52A 3CR7A 1EZ4A 4Z54A 5JCJD 1IN7A 2FQ1A 5JNVA 1M34A 1XKXA 4DR4B 4EUEA 2B98A 2WWHA 1A7JA 5LWQA 1CR6A 5IJ0B 3OPMA 2QLFA 2P6UA 4ZVUA 1EGVB 1ZD8A 1RAHA 3C6YA 4MMYB 1CUAA 1ULTA 4U39A 3MUEA 3LBIA 5CVEA 5AW4A 5LM3A 3W5CA 3W7AA 4WZAB 2Y0EA 3ROEA 3ENWA 1FFGA 3AHJA 3E5NA 4R81A 4MUFA 5GIOE 2PUGA 4G0UA 3H7IA 5KZMB 2JAWA 3NWOA 1M5UA 4MW1A 3R7DA 4E7OA 4KQJA 1CZOA 2W4IA 2XMRA 5IBPA 4UJ3A 4HYQA 2AA3A 3BGWA 2HQOA 1BN6A 4J29A 1G5RA 4JJAA 3JD3A 4P7BA 5EE5B 3AI1A 4G1BA 1ECCA 1RM4A 1H2FA 1MO4A 4EF4A 1K89A 1E3EA 2IRWA 1GLNA 2WUFA 4UVDA 3RIGA 1UMDA 3GJQA 3ZCSA 2POCA 3VVLA 1LB1B 2WT9A 2I29A 4D45A 2GNPA 4NMXB 1NVMB 2I0FA 2IHTA 4LTNA 3G8AA 3P20A 4DIUA 2IUFA 3Q8KA 1SXPA 1WHTB 4XWGA 1GZ3A 4N47A 3UKOA 3ZTTA 1NXPA 4WACA 5BSEA 1CNMA 4JJKA 1MAAA 1TKCA 4IO1A 1UODA 5KSOA 1DDGA 2CDNA 2NXCA 3D6HA 3VYVA 4QGSA 1N6PA 2FYTA 1U2TA 3BWEA 3HUEA 1C9KA 5JG7A 3PLAE 1PAUA 2HK7A 2FPIB 2LPMA 3L8CA 5JJBA 2E6UX 2FPIA 3EC1A 3LT0A 2WU0A 4I4TA 1G7SA 2Y3IA 1OW3B 2HUNA 2YHIA 1JPJA 2OYRA 3D3KA 4P2BA 3LL7A 3RHTA 2P9ZA 1J8QA 1I3OA 3KDSE 1ICIA 1V9CA 1XCMA 3KOMA 2I2DA 1MOSA 2WU1A 2YMLA 4LZJA 1RKQA 3OCZA 4MS4A 4CPDA 1JHPA 2QS9A 2A8YA 4OSEA 4BVFA 4BRSA 1KYTA 1W47A 2ASEA 4CF5A 1ML3A 4U9UA 1QUEA 1W4BA 1MDBA 4BP8A 1D0IA 4NDNE 3VHXA 3IDOA 3G0CA 4EG8A 4NP6A 1V6AA 3ND9A 4IG9A 3DTVD 1YS9A 5SZJA 5G41A 2A58A 3THOA 5LQKA 2GAJA 1A76A 4Y30A 1OWOA 1Y6ZA 2IZZA 4KE6A 2XZLA 2V7EA 3UMSA 1D2RA 4CEJB 2XYPA 1XZKA 3ZNOA 4NDZA 2AXNA 2DX7A 2HNKA 3LX5A 3P0JA 4X9XA 1CF4A 3V7WA 2IJGX 3DE4X 2CVOA 1GQYA 4FWTA 1DU4A 5LB4A 3H1BA 4PYQA 2IH5A 4GLOA 4CV3A 4GZ5A 4B3GA 4L28A 4OP2A 2IZ5A 3A2NA 1Q3KA 2I67A 4EO9A 4EUSA 1MPTA 1BQ3A 2CXSA 2EC5A 1TF2A 2FA9A 4I19A 4KVZA 3ZDEA 4DR7B 4M1KA 3KR0A 4HLDA 1X9GA 2L17A 5HCNA 4MVXA 5EQFA 3RTEA 3T5CA 3GA7A 4N40A 2ZBGA 1SIUA 5IN5A 3WL6A 3N3AC 1LVHA 1RZUA 3HLKA 1P77A 4HFMA 2MR6A 2R97A 3VH1A 3OKCA 3TFOA 1IHXA 4OXXA 1EX6A 1I01A 1RM5A 1CIPA 2PTHA 4ZYLA 4CXMA 1H2HA 5B3JA 3ED1A 1A1VA 1U3UA 1CYDA 1DXYA 3L7CA 1N2HA 3TS1A 3FUCA 3VTAA 4EVQA 3IA7A 1II8A 4UFOA 4HS9A 2OZLB 4N4AA 3S40A 3CH4B 4TRMA 3I8OA 2BM1A 3R6LA 1G3MA 2GRUA 2XLCA 1GQFA 1YTLA 3SKXA 1Z0FA 4MWSA 3TOSA 1K0FA 1U0RA 3IO3A 4RGBA 3HZZA 2SECE 4F04A 3CO0S 3S8MA 3I2GA 5HFAA 3B1FA 3ZE2B 4FHZA 3RSCA 1FK8A 1O5OA 2ZANA 5D5QA 5DGDA 4ZJPA 5CBPB 5L3SA 1USUA 2UVQA 2PGLA 1A5TA 3LX6A 4XVQA 1K3TA 2NO0A 1WXXA 3GLSA 4RPKA 3ZWMA 3T41A 2X7HA 2ONKA 1ZI6A 2ECPA 3F6PA 4IZ6A 4WH0A 3ZI4A 2O2HA 4WEQA 4RTQA 2YWHA 3KWLA 3S1AB 4GZ3A 4RV9A 3D6JA 3DZBA 3ETGA 1A88A 4NH0A 4QOJA 1X2BA 4AZ0B 2IYZA 4YRCA 3IAS1 5CK4A 2YHAA 3M2TA 4RKYA 3ROKA 3N76A 3UGKA 3UV3A 3HUUA 1E4EB 2P9GA 1Z0KA 5TS2A 4RHCA 4FJ0A 4DKXA 4BKUA 3FUWA 1NDHA 3AEXA 3U1BA 4F93B 5C2JB 3FWNA 2PKXA 1XCPA 3NFRA 1E0JA 4Y98A 5CITA 1M1YE 1WKVA 1LS6A 1JZSA 2JFGA 4HQLA 3A4LA 4GMKA 2Q8PA 4O29A 1XXHE 3WP0A 1B1CA 4ZRDA 4CG1A 1PQWA 3FTCA 5DHSA 2VJQA 2J31A 3F6SA 1IG3A 5B1IA 5TJHA 1JS1X 1U8AA 2RHBA 4ZPJA 5H68A 3LP8A 4ND8B 1FBTA 4ZWNA 4ZGWA 1T3TA 3MHPA 3LQQA 1NUUA 4GS5A 2M6KA 2YXBA 2QGNA 4X1IA 3MTBA 1EE2A 1JFFA 2AUTA 2P3SA 1K3UB 1M2OA 3ORSA 1REQA 5EKUA 2X0FA 1D9XA 1QLWA 1SBZA 1UQTA 5C31A 3O1LA 1QB8A 1T2CA 2BKEA 2IEDA 2QUHA 3A14A 2G80A 4FHGA 1KZ4A 1KH3A 2UUOA 3HEMA 3D4LA 4XOIA 2RH8A 1KETA 2B5VA 4YIHA 4D9NA 5E3HA 1CRWG 4R2HA 1SCIA 3D2BA 5TGDA 3ZDQA 5IXYA 4B4UA 4YASA 3WIBA 1NBAA 4QGHA 4ZVVA 1H8ED 2RC6A 3I0NA 1PNOA 3LX4A 4H2DA 4DIBA 3S8YA 5SZIA 221PA 1OX5A 3C7TA 3KKKA 3MN1A 4MUGA 1B8VA 3SC2A 4FEEA 2HTFA 5J5AA 1BE1A 1QXSA 3MBKA 1PDOA 1P0MA 2H59A 3EVEA 4OHUA 5LA6B 3EMBA 3U3DA 4EKIA 3U5TA 5K3DA 3AW8A 1JAYA 4AUMA 2PX2A 1QHGA 1FFDA 3ZNNA 1E2HA 4OA5A 1R8QA 3CCFA 1AXEA 1SC1A 1T36B 1JDVA 1T9CA 1QIKA 3A6EA 1U2SA 2RCNA 3T38A 3BB4A 2G0NA 2IUUA 1C1YA 5FFMA 2VDUE 2PLRA 2CVZA 2Z57A 1YB5A 2M98A 2IXFA 5B57C 4NQZA 4TTRA 4MMXB 2GAOA 3SZRA 1KMHB 4CCYA 2QQEA 5AOVA 3KL2A 1G55A 3IUEA 4FFDA 3RO7A 3ZBPA 4BWGA 3VKFA 1V5EA 2AQHA 4XM1A 4LHWA 2VRBA 5ALNA 1MEEA 5EIAA 2A92A 1HORA 1Z63A 5ALGA 1MW9X 3L6CA 2LVBA 1G2IA 3SZOA 4U6NA 5JALA 2QZPA 1AT1A 1NOJA 1UEIA 1BROA 2O54A 4NMMA 1EVZA 2HL6A 4DPKA 4GGOA 1QFXA 1Q11A 4NFLA 4QJ4A 4WBNA 4W5RA 1L5ZA 3MXOA 1L5WA 2Y1EA 4JMPA 4YN3A 2XNJA 5IABA 4DYDA 3PXUA 3LCCA 1R0WA 2CYBA 3GJ6A 1QYWA 5CCXA 1XXHB 4ZHSA 4BB5A 1EWQA 3DJYA 3WGLA 2ZBQA 1W9MA 1S3SA 3WGYA 3OIDA 2WKQA 4KX5A 2G28A 1JA9A 5DHAA 2PSDA 5FDFA 3PPXA 4OXQA 5TIIA 4RYDA 2YX1A 4HH4A 4OGWA 2FSSA 3ONEA 1BYIA 4NBRA 1QIIA 2H63A 1JW9B 1YZFA 2GM9A 3RC1A 1UM8A 2FQXA 3C43A 5FWXA 1E1NA 3NH9A 3F7TA 5FUBA 2HPHA 2JDID 2ZE5A 1NR7A 1MIOA 3UY4A 3DMYA 4WNAA 2HGZA 4B7UA 1Q7RA 1HQYE 1R0KA 1KQFA 1B7GO 3RSFA 1F2UA 1B8NA 1U0TA 4YRTA 1WPGA 4CLDA 3ESRA 3TLAA 1CZNA 1YKSA 3ZD8A 3K9CA 1P18A 3LYLA 1FNDA 1JWAB 2FDRA 1XMVA 2G1UA 1GU7A 1HT1E 4JBIA 4WOCA 4WXPA 4CUKA 6REQB 2YKGA 4MCJA 2IXEA 2NZ8A 2EAUA 4GL4A 3QITA 2HJWA 1X1TA 5JAPA 3KUXA 5DPMA 2OP0A 3DSRA 1F8UA 5BWOA 1PO7A 4QOIA 5HRAA 4Y2VA 1YB4A 4A7PA 1ZGHA 1P1CA 3GP5A 3SM3A 1GO2A 4IIJA 1LBHA 3PFNA 4CLHA 3LPCA 1BHSA 4XVCA 3FSRA 1NU8A 2ZYIA 1EFVA 1KYWA 3KYCB 4HDAA 3SJZA 1A8HA 4EECA 1PEYA 1XP5A 1Z9BA 4TYNA 4PNPA 4AP5A 1Y7LA 4OHRA 3KAPA 1AO0A 2VNIA 3DYBA 1FDRA 5J1TB 5J23A 5M3BA 1OX6A 1C0IA 1OFTA 4NXMB 4G84A 1XDSA 1Y98A 2VCEA 2P8SA 1OA0A 4PC7A 4V0RA 1Z8NA 2VF5X 3DZGA 3GHHA 5ESXA 5E2IA 3S2EA 3SDSA 1GA4A 3U7JA 4YAWA 5JRDS 1JJIA 4H17A 2A5GA 2DQZA 3HB0A 4M22A 5JNLA 4ZTUB 3CKKA 2DHCA 1IAQA 4CL2A 3VM6A 1JJAA 4RLHA 1YBMA 5EJ8A 1X92A 2PO7A 4INZA 2OHVA 1JVBA 1VM6A 5EPOA 4Q3AA 4GZMA 3N6XA 1FJHA 3C8ZA 1SKMA 1MW8X 4BPRA 2ZEJA 1HXHA 2YJZA 2JK1A 3M4JA 4WXRA 3UKDA 2XMCA 4IOLA 3R7BA 3WLIA 1M6YA 2ZRQA 1X74A 4X97A 4XB6B 2Y8EA 4CFSA 3TD9A 1WSBA 1XTZA 4G5XA 4LSGA 3KJEA 4F8EA 3EVFA 3PXCX 3CJTA 1NDUA 3I8SA 3DLAA 3NAQA 3B6MA 3HYTA 1C1XB 2YMPA 3AM5A 1P5RA 3OESA 1ECLA 3VDMA 4GPD1 3W5AA 5A7FA 1BHQ1 2P4EA 4FCCA 3LC1O 1PK7A 1MNAA 1OH5A 2P65A 1Z35A 1V6SA 2J9GA 3H11B 2E4YA 3R20A 5I8ZA 1Z26A 3C5CA 5FTKA 4WHMA 1UH5A 4E09A 2V3CC 3RS7A 1GILA 1SQ0A 2GMWA 5CURA 2B4AA 1OUMA 1GA6A 1Z25A 2F3TA 1TZCA 4O4IF 3WXBA 1BXGA 2XH8A 1NSYA 3WFIA 4HTAA 4C4OA 2Y0PA 4M60A 4BNKA 1CHNA 1NYLA 4PRLA 1OX4B 1YQEA 2O2JA 3WK8A 4M98A 4QDJA 4TTJA 3T1NA 1V5WA 3GNTA 1GPLA 3VH3A 4JXKA 2VYCA 2QX7A 4LGYA 1LPOA 4L5BA 4C2UA 4MWDA 3AF2A 1EDOA 3D5TA 5JSZB 4I1SA 2I99A 5L4SA 5U4XA 3TM4A 1FP2A 5SY6A 5LJIA 1W6UA 2Y9PB 3LP5A 2ACVA 3PGKA 3EIUA 5EE1A 3BC1A 2EL9A 2LIPA 2WVJA 3AUXA 3N5CA 5AD1A 2CZCA 4Z1MA 3DLTA 4YR9A 1SBYA 1XHEA 1E5QA 3I9FA 5I9NA 2FZKA 1VPDA 3DPSA 1SIOA 1G8FA 1ULBA 2CLCX 3BHNA 3RYIB 1M0EA 1Z22A 1PQ4A 2PD4A 4NG5A 1DOZA 2XQGA 3FTDA 4B2YA 4NEQA 1X7HA 3CT6A 3UTCA 3B1VA 3WL4A 5JXWA 3CSDA 1RDFA 3LOPA 4UVHA 3TQSA 4S04A 4G2TA 6LDHA 2BUAA 4G9EA 1GJRA 3FVRA 4Q6WA 1DX9A 4D26A 4ZJUA 1V8FA 1T3GA 4BZXA 2A6PA 3F1KA 3RVKA 1TM5E 4AKHA 2PVCA 2C2OA 3AU8A 4ZU1X 1E4YA 1Q7BA 4CKCA 2HR1A 2NUAA 2V5VA 2FI1A 2GZRA 2VJBA 1W2HA 3F4KA 2H1HA 3CVJA 4H35A 4MGHA 4AWBA 4E5SA 1B0AA 1GAQA 2P40A 3GGPA 4QYIA 1IUKA 2H2AA 2PS3A 2O8CA 3MYRA 1ZW1A 1RD4A 4MI1A 5BSVA 4BNTA 3OOYA 3RRMA 4YA6A 5A3QA 1CBUA 4RE5A 2A7XA 2JLBA 4H1UA 4PZ9A 1YJQA 4CEHA 1BGVA 1KEZA 5A4IS 4E46A 1YE3A 4E1BA 4LFAB 2YASA 1WCYA 3EQ6A 5CX1B 4ZVKA 4F1WA 1KJ9A 3P9KA 2VJOA 4KI7A 5FI3A 1MR3F 4B2LA 1E1QA 1TUBB 1ZSVA 5CNIA 3KT3A 4IDHA 1TUBA 4Z9YA 5T67A 2PU7A 2GEKA 2W9XA 1S2LA 4P7KA 5BN4B 5EIBD 4E3ZA 1I51A 2D6FA 1PJSA 2YC2C 4NZOA 3NMUF 5LC1A 5JECA 5DNDA 4HZIA 3UUGA 4GH5A 3HGQA 2NYVA 2A1IA 4GZ6A 1EFPA 1TM7E 2FLVA 2J09A 4FX5A 4QG3A 3SBOA 1W8IA 2PFGA 4LDJA 3BFPA 4AUNA 1C4XA 3SLKA 4B81A 4BGUA 1T9AA 2DHDA 4U7PB 3U56A 2C5LA 2BSQA 1KQOA 2NV6A 2P2NA 1T4MA 4X61A 1RHJA 4OHFA 1XEAA 2YCBA 5BOVA 3EQ2A 1VKHA 4R1LA 2W70A 3V1TC 2IYSA 4C30A 4LWZA 4HN4B 1U3FA 2AUMA 5B2EA 4M1TA 3OFSA 4WADA 1LJ8A 3N2YA 3A1CA 2YXPX 4U9HS 2WFLA 2HA2A 2OYCA 5KAMA 4B3CA 1X1AA 5HOQA 2YY5A 1KO8A 3J80A 3GJ7A 4PGFA 3EWSA 3KZOA 3F2VA 1AXRA 1G20E 3ZLJA 4X44A 2DLNA 1TQ4A 3I0ZA 5IU6A 1CRQA 4AIRA 1VJ0A 1J9GA 1UOOA 3CF4G 4C76A 4CETA 3AVWA 3ZPXA 1MT3A 4JVNA 4JI5B 1YJXA 2XVZA 3DV0B 3QE2A 1C3XA 4C04A 4D9IA 3CRNA 3I1FA 2H4ZA 1VLHA 4LQCA 5AI0A 3I3SR 5DLEA 2UUCB 1Y5LA 2QBYB 2JASA 3KQYA 5AVJA 1YJBA 3DYIA 5I4KA 3A36A 4GI7A 4ZICA 4P38A 4ZK6A 4D4LA 3EA4A 3AEQB 5HR5A 2UKDA 4CKEA 3IDQA 3L8YA 3UK1A 1KJNA 4RTOA 5ALDA 1DKQA 5F1YA 2QV0A 2OSVA 2JAXA 5IX8A 5IAGA 1EIWA 4PZEA 2OK7A 1L5LA 4JLBA 4FFSA 1IAVA 2X9LA 3EYAA 3ES9A 1WPQA 1Y3BE 3GXBA 5EY5B 3E9QA 4XVRA 1C9DB 4DEVA 3UWSA 4DJ5X 3LT5A 4WERA 3FB1A 2PKQO 1Z4PX 1ULAA 3D8UA 3W1WA 3WYFA 2OLJA 1Z33A 2R6DA 3P52A 5CAEB 1RRKA 2CEAA 2P3OA 1TCAA 3WGQA 2ZR9A 4C43A 3GG9A 1UBJS 3K8QA 3NRCA 3LW8A 3QF4A 4MJXA 2P3QA 4P2GA 4XSGA 3STTA 4ZCTA 4B75A 3FXAA 4WN9B 1WZCA 1MVOA 1IONA 2WU4A 4LQ4A 1CZHA 4OQNA 3UB4A 5C8XA 4XWWA 5DHFA 2WT8A 4JLPA 3IL2A 1NJSA 4I5DA 3EZ6A 2RH4A 1AU9A 5EXEA 1YKFA 2QB5A 2E6KA 2Z6VA 4XIJA 4YRMA 5C5IA 2YHBA 4J0IA 3GVIA 2GFIA 3OQPA 2KHZA 1ML4A 5BNWA 3OOSA 3ANSA 3G2NA 1O08A 4U3JB 3MINA 5JFTA 5CDUA 2D0IA 2OM2A 5DXJA 1GIAA 4V0OA 4OBWA 1HE3A 2HQBA 4CKZA 1S4QA 2ZSJA 4B6JA 1NVAA 3M1LA 1UMBB 1XDWA 1CJVC 3UMYA 1PLJA 1CKEA 4MIOA 5D5HA 5ALRA 2IE0A 3HZHA 5E0KB 2ZWIA 3ESAA 3KQOA 3FOFC 1ODLA 2IXGA 3E3LA 3E4CA 1JFRA 1LI7A 2AV6A 1CUCA 4DRZA 2VJNA 3PF9A 5IYZF 1HI9A 5T64A 2HHJA 4EKGA 2EP8A 4BN4A 4INPA 2R44A 2DBYA 5TE9A 2YWEA 4LGMA 2FF7A 5T7BA 2D59A 2UYQA 3DMDA 4UE3S 3ZDYB 4HJRA 2IVFA 3T5AA 3DM5A 4YX9A 5CDGA 4AN1A 5JZ9A 4D4KA 2O2CA 2FMIA 1NQVA 1M9NA 1D9ZA 4MA5A 2DJIA 4HBGA 4LRTB 4B3SB 2F4NA 2GYYA 2Y0BA 1CUEA 4OMDA 4G0WA 4JQSA 1SOUA 1XLTC 4I50F 3CX7A 1SU7A 3PE6A 4LZPA 2PTGA 3DR5A 1J0BA 1A4RA 2W2LD 3AM4A 3E27A 5TV2A 4M0MA 1GFWA 4ZD6A 1I36A 3DLIA 1ACLA 2C7GA 5BSRA 4YJGA 1H1LA 2MSWA 3V4RA 2K7ZA 3GYBA 3OMLA 2G63A 3IT1A 4O5OA 3RQIA 5BSGA 4POAA 3AR5A 2A78A 2ACKA 4TTPA 1ORRA 1FDWA 5E38A 3A4MA 2V0CA 4U7WA 3TZHA 1LTHR 1UKYA 3KJNA 2BM9A 4P08A 1RM3A 4FCTA 2ZWVA 3G2MA 2XHEA 1W4RA 2QRUA 1PJBA 4YBRA 4BV2A 2Q62A 1X7YA 3O4RA 4R84A 3E82A 5ALIA 3C14C 5B7QA 5ADHA 1AB5A 3DBLA 3EZ7A 1VHTA 1JYSA 3ZKWB 1SUSA 4BQOA 2P0YA 3GLHB 4URUR 5CB4F 5KUTA 4CF4A 2FPGA 2PQ0A 4QU9A 1QS0A 3OAAA 1UFQA 3OUZA 1QS0B 2C5SA 2RJ3A 1Z88A 3VPXA 1MDFA 2V9PA 2XQKA 3HY3A 4MLZA 1UZMA 4R2JA 3SLGA 3W4IA 5IZCC 3RYCB 2QV7A 4GRDA 3H2SA 5ED4A 2YVQA 3PNYA 3H2HA 3EFBA 4GPAA 1CE8B 5HM6A 1EESA 5AM5A 4AKTA 1J70A 1G98A 1PLLA 1Y7HA 2H4FA 2WFAA 2EP5A 3IHWA 3NHRA 2N46A 4GHWA 1RWOA 2Y93A 2WWRA 1KVQA 3BK2A 1KDZA 3AG5A 5EL0A 3T7TA 5AVVA 3ZHQA 4OG2A 4IHAA 3ODPA 2YH2A 2F8SA 1QIFA 3OZCA 5AR1A 1IMJA 3V46A 1VA4A 2BGMA 2C8JA 3DEJA 4DAOA 1RI1A 2FQQA 2C58A 3E5MA 3I2KA 3LLSA 4I7EA 4JCCA 4AP9A 5IUKC 4BTVA 5KX5F 3GLFB 1KDVA 3I1IA 2X7JA 1D09A 3BJZA 4E30A 1IJFA 3EUWA 3TG2A 4JWTA 1G6Q1 4YPOA 2X1HA 3ABRB 5ADWA 4RX1A 1JIVA 3AR9A 5D3ZA 5E4YA 2VHTA 4O2BA 4QAQA 2AD1A 4FIZA 5JMTA 4S0XA 2R8RA 3QVUA 3EVDA 1UZAA 3LMKA 3CQ9A 3VSCA 1J49A 2I3GA 9MHTA 3MTQA 3OC0A 3SQOA 3W05A 2ZE8A 3I6ZA 4LZWA 1SG0A 1H1DA 4CMEA 4NYIR 3AM3A 4AK9A 1VJGA 4C22A 4ONEA 3HDYA 2JIPA 4J9UE 4LC9A 1IXZA 2BDEA 3NYRA 3VNSA 3KSAC 3L41A 3HA7A 2OZVA 4G0ZA 2NVUB 4DZRA 2JIOA 3V4PB 1TEZA 3HDGA 1EK5A 1PR5A 2HCTA 3MJFA 2AMVA 4HCJA 5TQVA 1XRNA 3O8BA 1F0NA 1JXMA 2DFTA 2Q5HA 1P0CA 3KR2A 3KS9A 4KVGA 4QEKA 2VPPA 4X95A 3ITDA 2OK8A 5LNK6 1ZWLA 5AI9A 3L04A 2P9QA 3OWXA 2HOQA 4Z9FA 2WJZB 4M7OA 2GX6A 5KCZA 2XA9A 2BTEA 2B6NA 1VJCA 3M5PA 5FLXA 4B6QA 4WZ6A 3BN3A 3QEAZ 1W36D 4G2NA 3IQWA 1IBMB 4CQLA 2PUCA 1Z45A 3MFYA 2VP9A 2AX3A 3NOOA 3VNAA 2IS4A 3LHFA 2CLSA 1N6RA 1K4MA 5IHPA 5IMSA 1JSLA 4IZHA 1R50A 4RHUA 4YCDA 1U9IC 5J2TA 1WD5A 3GJ8A 3HJRA 4EMTA 1KFBB 2ZSFA 4DLZA 3RS4A 3UV6A 2A5FA 3KKZA 4IXNA 4DIDA 1GGVA 1RTTA 2OWDA 8AT1A 5INTA 1CRZA 2H1CA 3S1SA 4YC7A 1OZFA 1RYEA 3QG5A 3OQ1A 4MZXA 3R7LA 4X8MA 3ZHZA 2YJNA 1IUPA 4KV7A 2JBHA 3AEKA 2H9IA 4PPQA 1ZAYA 2EVWX 4FPXA 4BB6A 2JLXA 4QBIA 2GXQA 1H2RS 4AQYB 4JI0B 1M7GA 2GSWA 3OLXA 2HPAA 4TWRA 4MR7A 4HI0E 3A6PC 2ZJ8A 4KYIB 3QI2A 5C8VA 4EX7A 1T9GR 2WSSA 1ZCFA 3HXTA 2DMRA 3TSZA 1TVEA 1VRWA 4EHHA 5CVJA 3UO8B 4HEJA 2NZUG 4WOJA 5D3QA 2FMKA 2LR0A 1PGNA 3B3AA 5JPCA 3KKNA 4JR1A 1IOLA 5GM1A 1RFGE 5KHOC 3Q3CA 2VHYA 4DRXA 4O59O 5JD4A 2PUAA 1I13A 5EYPB 2C3OA 2I4IA 1QYIA 2ZJYA 3EG9A 2YJ6A 1LKZA 2KLHA 1BCRA 1C1DA 4GLFA 1BX1A 1VRVA 2XTZA 4QUGA 4X1KA 3T5BA 3MK31 1A69A 4DEYA 2FW8A 3N1UA 3RS9A 1Q0ZA 5KJFA 3IAM6 5B64A 4YRDA 1HX7A 4OH7A 4X1YA 1FFHA 1MIOB 1MA3A 3EYWA 5CFPA 4BNXA 4WLNA 3NBMA 3OT4A 2G67A 1DC8A 2F43B 2H4XA 5CJJA 2WICA 3OEHD 1CFZA 3KHUA 2IWRA 4B3TB 2IHJA 2CXUA 1SU4A 2AOXA 2HAEA 3F4BA 3Q7SA 4L85A 5EP1A 3H5VA 4M1WA 4YUXA 3LBHA 2ILVA 4PO8A 5GM2A 3E9ZA 3EWNA 2Q1YA 5BNIA 2M6SA 2OXCA 3OD5A 5D3MA 4YWJA 5CA1F 3NHBA 1S7CA 2XXBA 5JXHA 2BEWB 3WYCA 4GMGA 3FYUC 4NLLA 1Z8FA 3AOEA 1E5TA 1F9EA 2B2CA 3C7CB 4HGNA 5IC5A 4PWZA 5IK2A 4F3CA 1WLYA 2Z6QA 4N01A 3PJDA 1AM4D 4L4ZA 1IZ7A 1L5MA 2MIIA 4C2AA 3UANA 3D2LA 4BBJA 3RAEC 1ONOA 1XJQA 3JQPA 1JRLA 4R01A 4RK7A 4EY6A 5KSZA 1XNGA 1OTHA 1W4LA 1NVEA 3W2GA 4DLWA 4BOYA 4FMCB 5EJ9A 1U6KA 4TMVA 3ZW7A 3VSDA 4JL6A 4TLDA 3BGSA 3DVSX 4KXXA 3RF6A 5F23A 5MN4A 4KRFA 1TLFA 1ODJA 3TZQA 2WWFA 2Z2IA 3IFSA 4TSRA 1IQUA 2BR3A 4LA4A 1SUFA 4PLVA 5FUVA 5KNDH 1JFLA 4LYDA 5JEEA 2JI4A 2HJSA 4E70A 5HUQA 1A9PA 1T0IA 4KDCA 1CEEA 1WUJS 2DBVO 2V9CA 5FO0A 3RK1A 1M3SA 1Z7BA 3ZUPA 4Q9NA 4N49A 8ADHA 5KO2A 3K9NA 4MHSA 2C9BA 2ZWMA 5AKJA 3D3NA 5EUQB 1UP6A 5ALTA 3PQEA 5KAPA 4M9CA 4NBSA 4B71A 5JISA 1YRHA 1SHJA 2D5CA 2YN4A 2IYEA 5JADA 3Q3IA 1D1TA 1N2JA 4UUBA 4X0EA 2YOHA 3I5XA 4DJAA 3DMTC 1ZVKA 1ZR4A 3CTPA 2CCGA 3FMGA 2I78A 1WQ1R 2QGFA 1VC2A 5D00A 2OC4A 1P2BA 3HPRA 2RBEA 5FV7A 2GZ3A 5EZQA 3JVIA 3OTIA 2EFDB 1EGQA 1NLMA 3QEBZ 1UJ2A 4EWLA 4LVOA 3H05A 2V65A 1P5JA 4F84A 2OQIA 3L6DA 4HB0A 3TR6A 4IS3A 3H13A 4QSMA 4ROSA 1OIVA 1XQ1A 3U6BA 4YK7A 2CNNA 2HU2A 2EKLA 5SYMA 5IC6A 3K5WA 1JHOA 2HRDA 4BAZA 1YS7A 3K32A 1E98A 1IN4A 3HZRA 2YDYA 3QEMA 3S99A 3T3GA 2QRJA 1EDBA 3V8NA 5JS8A 2WIDA 2QT1A 1F4VA 4YYZA 2EIHA 2V3VA 1FTSA 1XEXA 2ZJ1A 1V96A 3H8JA 4XM2A 2X0EA 4FMBB 1LQUA 3O21A 5B7GA 2ID8A 1JI3A 4FHFA 2XZDA 1Y3AA 1IJEA 2YN2A 1SELA 3ZHVA 2ZWOA 4KBYA 5LP6B 2FFRA 4G0NA 4G24A 3TZBA 3RUFA 2PS9A 4WJZA 5CB8A 1HDEA 3S4YA 3AEUB 1FDIA 1GZDA 1Q6ZA 3UHFA 2ACWA 1XZMA 2ZW9A 2AE1A 5JCOC 2WJYA 2YFYA 1Y7IA 5K2MA 3GLRA 5IBQA 3BH7A 4JBLA 4RVNA 1F8FA 3GVHA 4R6XA 3FM9A 1IJKA 2QMYA 3C8HA 4FGLA 5TS3A 3VMFA 1RKXA 2CBZA 3NBAA 4BNWA 1PF7E 3CWQA 5BOSB 3L40A 1RKUA 2GTIA 4Y6PA 2W2PA 2XMZA 1AN9A 2WHEA 2HUPA 1OXBB 1XVLA 2E4XA 3CRVA 4YGXB 2O3QA 3FZNA 3A10A 3CVOA 1O6BA 1QF6A 5A0TA 3PQDA 1P19A 4ZXFA 4LMBA 4TT3D 3E1KA 4MVJI 3O91A 2RHTA 1SA0B 1YK1A 3M4YA 4Z1OA 2Z1MA 3ABOB 4EB0A 2FZVA 4RVUA 5A6SA 3MF4A 1FMFA 4GE3A 1NLYA 4B73A 4EY8A 3E9DA 3LRXA 1SG6A 1XZEA 3D54D 3AUFA 4ZQCB 1QOQB 3MWLA 3H11A 4GGPA 3GWZA 4HX5A 2W8BA 4LOAA 4CLRB 3RHFA 1AMUA 1GNPA 5AW6A 3C41J 1XA4A 3KPJA 4FCWA 1HNZB 1TADA 3O31A 1CK4A 2H08A 2J45A 1FMJA 1JQAA 3HFRA 1ZK4A 2A0YA 2ZYTX 4M4SA 1Z8HA 2R8YA 3SJCA 5DLPA 1RZRA 1ZMTA 2ZIEA 2X0NA 3E9CA 4Z0PA 5TSDA 4KIGA 2ZS8A 2WABA 3QLVA 1MO3A 3JVDA 4NAUA 4R8RA 4Y1RA 4CMEC 1N7JA 3IP1A 4I4TB 4EHNA 3QW4B 1JSXA 1GZVA 3H5OA 5DKFA 1KMMA 1PVDA 3OZAA 1CF2O 1T25A 5CG1A 4D3DA 3U44B 2FSVA 5B12A 1AKQA 2DUJA 3TOXA 1ZG3A 2ZPTX 2JVIA 4PYNA 4MS4B 5KTTA 3LQRA 2RK3A 3IS3A 3NEPX 1FDOA 1TO2E 4CN8A 3G6WA 4ALLA 1L5FA 2J33A 5IJAA 3RV4A 3ZHXA 4AZ3B 4HBZA 5JFOA 4KGXA 1ZONA 2ZKIA 4RY8A 1VXRA 1K66A 4XQ9A 1OREA 4RETA 1X7ZB 1X7XA 1YBFA 5L6MB 3IUYA 2B4YA 4HN9A 2WYUA 1OXSC 4RFSB 4RIFA 1J5XA 4RH1A 2G3YA 5DN6A 3V32A 3ZGOA 4LBWA 2AFRA 6CHYA 1H4SA 1OZ0A 1KORA 3OFVA 3H6KA 1OSNA 4DBLE 4TWAA 2WM3A 1QHFA 3IPYA 3TJMA 5KKNB 1H3EA 1XPUA 1D4ZA 1OFVA 3DAHA 3PUWA 2O8CB 4P1ZA 4RMHA 3GLIA 5ECWA 3WYGA 2RGUA 2QN7A 1MAUA 4IEEA 1JZTA 4KB5A 4ZI5A 4ZOQI 5LJLA 1ZU4A 3M1YA 2PJZA 5A4JA 3TWOA 2ET6A 4TWBA 3UHJA 1GP2A 5KKCA 3O8NA 2OHHA 3GAFA 1W6RA 1G64A 1B42A 2IOYA 3RT1A 3OZXA 1HYHA 3L84A 3LFUA 1DXHA 1USVA 1XTJA 4OD0A 3WMXA 4G5QA 4BNGA 3NHSA 3AEQA 1YKGA 1X2EA 1R9NA 1KO5A 1MO2A 2PSHA 4L75A 4DC0A 5H16A 2BMJA 2AQKA 3N0TA 4BMZA 1RKBA 4LN1A 3U6KA 3PHJA 2OE2A 4DNOA 2TYSB 1B23P 2JIBA 5CX1A 3ZLUA 5CNMA 5KS2A 4OQEA 5A0FA 2EQBA 3T3MB 4LK3A 3EFOB 2M2IA 4CTMA 1QH1A 4O1IA 4J3FA 4MW2A 2XCLA 4OHWA 2VAMA 3U48A 4K0KB 4GBGA 1QU2A 2ICAA 4KFTA 2J4CA 3GLGE 4QXAA 4ZQEA 1OB2A 4RM3A 3C39A 3TQQA 3U5ZB 1AO3A 4C89A 3IAXA 5DYGA 4NZYA 4OLJA 1N75A 5EZ6B 3KLMX 5AXCA 4WFQA 5LPNA 2V7WA 1NVTA 1GQ2A 3NHWA 1Z0IA 4HB2A 4WOKA 2VPTA 2A88A 3COJA 2DY1A 1GG2A 5B2FA 4PHTA 5HZMA 1BAPA 3EF0A 1SFRA 1MZVA 1XMXA 3T7IA 1LI4A 3GLHE 4ER5A 3URMA 1IHUA 4BFXA 4JYBA 3WR5A 4WLOA 2C2HA 3LZCA 1KA9H 1P4GA 4HADA 3KE8A 3LA8A 3ZLVA 5EE3A 3D1LA 1TD1A 2QNBA 1BVHA 1D1QA 4CGYA 2CB0A 4FQ8A 4UUQA 1J1ZA 1CT9A 3OZSA 3Q7TA 1RPZA 1W59A 3H9GA 3NHYA 3P1JA 2E1RA 1J99A 2ZWPA 3PUIA 2CVQA 2IF0A 3Q0EA 3BKWA 4Z6KA 1U3VA 3R3HA 4DBZA 1A27A 4FW8A 1VMEA 3CGWA 4BQRA 1I6WA 5BMOA 2UZ1A 2AVNA 3HADA 4ARZB 3KQSA 4JVLA 1P6QA 4ARZA 2Z2XA 3LY8A 1UK8A 3JSXA 1WMSA 1L7EA 4WOBA 3GGCA 3TYXA 3VAZA 3VMMA 5CLFA 2XZTA 2OFPA 4R4JA 5A4AA 1R74A 2VVTA 4QICA 7REQA 5FAXA 1VJ1A 1U0FA 4PPFA 2EQ5A 4YONB 4CDMA 4X1IB 2I71A 5DGTA 4EK9A 2R8EA 4KQ9A 4F72A 1KI6A 2QZSA 4HX2A 1M7HA 5DT9A 1GGMA