5BU6A

Structure of bpsb deaceylase domain from bordetella bronchiseptica
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
264
structure length
264
Chain Sequence
PDPDDGLTFRVLSMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNPISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLAAFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSAHLIRHHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVALTQIRRSLVDYEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Protein BpsB Is a Poly-beta-1,6-N-acetyl-d-glucosamine Deacetylase Required for Biofilm Formation in Bordetella bronchiseptica.
pubmed doi rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Hydrolase
molecule keywords BpsB (PgaB), Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetyl
total genus 78
structure length 264
sequence length 264
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.1.33: N-acetylglucosamine deacetylase.
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 5bu6A00
2I5IA 1W1B1 2C71A 4M1BA 4WCJA 3CL6A 3CL7A 3RXZA 4U10A 2DFAA 3VUSA 4V33A 1V6TA 4HD5A 2E67A 2NLYA 1NY1A 2CC0A 2IW0A 3QBUA 3CL8A 4F9JA 2W3ZA 1Z7AA 4NYUA 2Y8UA 3S6OA 4NY2A 2VYOA 2XU2A 4NYYA 3WX7A 2C1GA 2J13A 2C79A 4NZ1A 4NZ5A 4OUIA 4F9DA 4L1GA 4LY4A 1W1A1 4NZ4A 1XW8A 5JMUA 5BU6A 3HFTA 4NZ3A 1W17A 2C1IA 2QV5A
chains in the Genus database with same CATH superfamily
2ISVA 2C16A 3AXIA 1R2RA 3M4HA 1K3UA 4UCFA 2R91A 4PULA 5BROA 1VS1A 1S2UA 4QE5A 2CLIA 3CHEA 1FWGC 3LRMA 3W7KA 2HSAA 4R7JA 1BVWA 4QSHA 1O12A 1QMLA 3V5CA 5KETA 1KC7A 1NTHA 3VOHA 5BOEA 1DKWA 2PMQA 3GNOA 3OG3A 1MXDA 4LH8A 4GKLA 3KVJA 5D2XA 2V82A 1JCMP 4LWWA 2Y24A 3EWXA 1KGUA 3RX4A 3GU1A 3K4WA 2B7NA 3ZOAA 3FYPA 1RD6A 3UFYA 2P0OA 2R94A 3OQ8A 4QEEA 4U2ZA 1Q45A 3EX4A 3WH9A 1QWKA 2ZOXA 4S2BA 4F0SA 3TC6A 4NAFA 3TNBA 3A9BA 3AROA 2J7CA 1QHOA 5A8QA 2YL5A 4Q8VA 3EB4A 5FF7A 1W1B1 3DOPA 1KM0A 1RQHA 1F5ZA 3GTNA 1VEPA 2IUZA 3ATYA 3THCA 3TNOA 4UTHA 3BMXA 4AY8A 2D73A 3DX5A 3LCLA 4I3GA 4O4VA 4UTWC 1WAWA 1YADA 4EK7A 3BAYA 1LTDA 3N2OA 2ZXBA 4AISA 4BWLC 1QNSA 5D9MA 6REQB 4LFYA 1VBUA 2QMJA 2ZRUA 3AO0A 4AZCA 5BYWA 3EA2A 3CAQA 4FNSA 3B8VA 2OFJA 2PB1A 3FA3A 3OZMA 3VIKA 1OX6A 3QGAC 3ELFA 1MDLA 2VVNA 4DUWA 3R10A 4ZQRA 1QATA 5HR6A 5ABEA 4BI6A 1WDQA 1J0JA 1FWHC 1OF8A 3EPNA 5C7VA 3QV9A 5D05A 1SZNA 2D2HA 3N3TA 2F61A 2PEVA 4PUDA 4MB3A 3G6MA 2FJUB 1PWLA 3WO8A 3HM7A 3WJYA 3KL3A 4MWAD 4N7QA 4U4MA 3ZJKA 4KGJA 4P8WA 4RUBA 1Q13A 1XRSA 4HT3A 3HG3A 4JDYA 1I2NA 3KBWA 1KFKA 4DI9A 1W6TA 1K03A 4HTYA 4LAMA 3WQOA 4D6FA 1XLCA 2E6AA 2INEA 1JDFA 4FXJA 1RQBA 3NDYA 1E9YB 4GX8A 1OFEA 5CKSA 4JNZA 1LLOA 1I2QA 4IL0A 1K70A 1R8LA 2OPJA 5BCAA 2OJPA 3KOZA 4M24A 4REQA 3QV6A 4GVGA 4MKSA 4ZB5A 1J18A 4PE8A 4IGNA 1RH9A 1GTHA 2PTXA 5FJUA 1PCKA 3R0DA 3UWQA 4J3ZA 3QLDA 4GIRA 2X7WA 2PDFA 4ALDA 1K9FA 3G77A 5AHEA 4WGHA 1TUFA 4IXXA 3GW3A 1YPXA 3I3DA 1LL4A 2OGJA 1E4LA 2GYIA 2J24A 4A22A 3T42A 1F7BA 4ILSA 4AZHA 3WF2A 3W1PA 1E6SM 4W85A 1JPHA 3GTXA 3UJSA 1PZ3A 1W1A1 2BVDA 2QCFA 4C6FA 3AUJA 4ZE4A 2YJQA 3NEVA 1GNXA 2WLZA 5AC7A 1KNWA 3B0PA 3MZ2A 1E0WA 4GGBA 4W87A 1CTNA 1JZ2A 3S5SA 4MLJA 3PBWA 3CAWA 2V38A 3ITGA 1E6ZA 4ZTXA 3VK5A 3E38A 2DP3A 5E0KA 5JIPA 2GVJA 1EX5A 4HCHA 4D8LA 3LM7A 4JTTA 3TW7A 5D32A 1Z32X 3H4XA 3NL5A 2TODA 1XUUA 2BLEA 2C19A 2JFEX 4IIDA 1Q6RA 4JY8A 1GQLA 4E2BA 3G1YA 2FQIA 1AVAA 3O15A 3BGAA 4EIVA 4DBEA 4HJWA 4RE0A 4QS5A 5CGTA 1JZ7A 3SUTA 1W5PA 1EH9A 3SCUA 6REQA 1P0NA 4R85A 2XN0A 4A3QA 4LUTA 4RV8A 2ZZ1A 2GWNA 3B4YA 3LDVA 3YPIA 1ISXA 2OQYA 1GVEA 5HNNA 1GK8A 1MXGA 1LRNA 4WHBA 4HZ8A 1SU5A 4I6VA 4R7WA 1HF6A 1TTJA 4WSKA 1FWCC 1W5MA 3ARZA 5SWUA 2Z7KA 3AHVA 3VNDA 2PRMA 3ALFA 1OFOA 3MKVA 4XO7A 2OQHA 3F5LA 2V5JA 5EA9A 3CQIA 4FIQA 4LVAA 4JNYA 3U3HA 3T1GA 3W85A 1YW1A 4GXPA 4AAJA 2OSXA 4H41A 3GKFA 5GJNA 2Y70A 4Q8WA 2XM1A 3WUGA 1OGBA 4ES4A 1XLDA 4GZIA 1H7XA 3MTWA 5BW6A 4Z2HA 4P7QA 5DCDA 3UXAA 4QNEA 4R34A 4ZXLA 7PTDA 1HX0A 1R3RA 4I6KA 4GVIA 5AFDA 4GIEA 2E40A 1VH7A 3W81A 1AFSA 3SCNA 4K37A 3VZZA 4Q6JA 1QDSA 4FNUA 2XVPA 1GOOA 4IIEA 1Q6GA 4RPQA 5CQ1A 1PL9A 4GACA 4JX5A 3OLEA 4F9DA 3FAXA 4UOQA 2YCIX 4HPXA 2VFFA 2NXHA 2RJHA 3QQ0A 1XW8A 3SM0A 5H8MA 4R9XA 3FGCB 1E9ZB 1PTDA 5IBXC 4JQ4A 3PPGA 4UTTC 4YN5A 3TN4A 4IPPA 4GG9A 3B0XA 1ZTVA 3A4XA 4MGGA 3GNDA 5A6SA 3L65A 4UNIA 1BYDA 4O19A 3PF3A 3R94A 4GBDA 1P6WA 4H9ZA 1MDRA 1FWIC 1ZALA 1ONXA 3A64A 3IIXA 1UPMB 2WMHA 3AHXA 3G8RA 1J8VA 4LQ1A 1VPQA 1YIXA 3AUOA 1S2TA 1H4PA 1NDWA 4MSSA 2O9PA 1BTMA 3QY7A 4KF1A 5JBDA 1E1EA 5LA2A 3B06A 1S5NA 4DYJA 2VEKA 1ZY9A 2E67A 3WMSA 3AIBA 2ZVIA 4LF1A 1JDDA 1VBGA 1KBJA 1Y8BA 1UASA 5AYIA 4QRNA 3W7NA 1A49A 1VEOA 2W61A 3IGSA 5I3JA 3M0YA 4XZBA 3R8RA 4QGCA 3HMJG 1OF6A 1WKYA 3A12A 2V68A 4JFWA 3VIHA 1J5SA 1RP8A 3F2CA 2VEMA 5G4EA 2RDTA 4RCXA 2EPNA 4QSFA 3K13A 1J93A 2DVUA 3KLKA 4L56A 2IMRA 3W73A 1RAKA 4EP8C 2F6XA 1MNSA 1FWTA 2KZHA 2MANA 2YSWA 2VX7A 4JFVA 3W4RA 3WBYA 2O9TA 5M1TA 3HGRA 4NASA 3BV4A 5CBIA 1FWNA 5EFDA 3A22A 4MJ2A 2FGBA 1HJVA 4IXHA 3Q4DA 3TQPA 1RJRA 1Q5MA 3HPSA 2ICSA 2LLEA 5G5IA 3KW3A 1MW0A 2EF9A 2OEMA 1UD8A 1UA7A 1LOSA 3IJLA 3DN5A 4XAGA 5FEXA 1V6TA 2XFWA 3E1F1 3QC0A 1KTNA 5HAOA 5HJLA 3ABQA 5TD4A 1Z7AA 5JU6A 3WMCA 3VIFA 1C90A 1D3HA 1POJA 1NAL1 4TU1A 3N73A 4WDTA 1JQVA 3NOEA 4JY9A 1XRFA 2X09A 1BVZA 4O1DA 3K8KA 1A5MC 4XX6A 3I7RA 4E4UA 2W66A 2CIPA 2GGIA 2GJPA 4Z17A 1UR9A 2P76A 4ACYA 2R9RA 2X1TA 3NO1A 4WY0B 3NQCA 3OBKA 5A3HA 2OLHA 4CGTA 1PVNA 1T6MA 1Q6FA 2DZTA 3L4TA 3WQWA 4XZLX 4W8AA 4MWAB 3OVPA 3VIMA 3MMUA 5T9BG 1FDJA 3GQYA 3P62A 3PZGA 4KS0A 4K7YA 1A5AA 4EPKA 3M46A 3KL0A 3N2TA 3LN3A 1UKTA 4DJDD 3TR9A 5A8OA 4DHGA 4NZCA 4C1NA 3QR0A 1CXKA 4R53A 4XUGA 4S3JA 3F03K 2X30A 5FJTA 2FZ9A 3NQAA 1MZRA 3T0BA 3EAUA 3AQUA 3MUIA 1UW9A 1Q85A 1Q7ZA 1UC5A 4MUPA 3P8JA 4JKKA 1P1MA 3WN6A 2D3LA 1E3ZA 1A5BA 1DIOA 4B3ZA 4BQ3A 5LKYA 2FH8A 1JNDA 4GI4A 2R24A 4KW2A 1FRBA 3RNDA 2SFPA 4OOUA 3WH7A 4PMRA 4QCEA 4XD5A 5A8GA 2AL1A 4PSRA 1DV7A 4IMFA 1OC6A 1AZ1A 1KTBA 4JYDA 3O0KA 4XAFA 1YPIA 3IIZA 3MUXA 4JR5A 3LGEA 2E8YA 3PSWA 1XSIA 4N6EA 3QKEA 3ZVIA 4IOTA 1Q66A 4BQ2A 3S1WA 4MFDA 2R82A 3ZSTA 1JIBA 1M01A 5AN7A 1BG4A 5BRQA 1R47A 4XAYA 5I3GA 2WAGA 1TB3A 1VR6A 2J4GA 3WJXA 3HG2A 3ABZA 5A6LA 4D8AA 1Z8AA 3SFKA 2QIWA 4Y90A 3W53A 2UY4A 3C0JA 4QCFA 3GKAA 2JALA 2V0TA 3W9ZA 1FTXA 3RM9A 2J62A 1D3CA 5HWJA 1TX2A 2YXOA 4PFHA 2XIMA 1SGJA 1SUXA 3O0FA 1E1FA 2CLHA 3TC7A 4CQ9A 4PTNA 1PCWA 4X3ZA 1DE5A 4CD7A 1ADDA 4FLOA 4RNHA 3WBXA 4BF9A 2ALRA 3BLFA 4O18A 5D2TA 1F73A 3MJMA 1Q6EA 4DBSA 1YDYA 4IZGA 1PZ1A 3EA1A 2F6UA 3GDMA 5D9OA 1L2UA 4CD4A 1UJQA 3EWBX 1VIZA 1GVRA 2WSQA 4HU4A 1QXLA 3G3MA 1ZUAX 2BBFA 5C9ZA 4IPIA 3QN3A 3SCQA 1QCWA 5GPRA 4O0ZA 2QJJA 2J6XA 3ZR4A 3TV8A 4PMVA 3NO5A 3Q58A 3WF0A 3WLHA 3G1XA 3IV3A 2V5LA 2PP0A 3OYXA 3C3UA 4YWSA 3P8IA 4O28A 3NQ7A 4GBUA 3VNKA 1ZL1A 3LPFA 1LBLA 2A1YA 1M5WA 5ABHA 3LMZA 4UOJA 1LROA 4IH3A 4YYFA 1FFRA 4K1WA 1P4CA 1XLEA 1JPIA 5HPCA 2HVNA 3B8UA 4TTUA 6ALDA 5LXEA 2PRHA 3VMOA 3EPMA 5BZAA 2FZBA 3OVQA 2ONEA 5C54A 3PNUA 4OGZA 2Z26A 2J8GA 3EB2A 3VIJA 1IIGA 2IPFA 2VTFA 3MYPA 3WLJA 4H3DA 1M6JA 2A79A 2QIIA 4JTFA 3S6OA 1R6WA 2BVWA 1J4EA 2PLJA 4JKLA 1DP0A 1HXJA 2HQAA 1A4LA 1UBPC 4GZEA 1A5SA 1OFRA 6ENLA 1XYCA 3HGSA 5A6TC 1VFSA 2B7PA 3PZ9A 3WEZA 5BU9A 1JCYA 3WDIA 5HQEA 2G3NA 3ZZ1A 4ZTYA 1N55A 2PDHA 4GE8A 4OQVA 5G1YA 4XG1A 4H8VA 1EO5A 1BVNP 2VEPA 4H1ZA 2YB4A 1XPYA 1EJVC 4G56A 1MFUA 3C2OA 3QR3A 4M81A 4GZ7A 1GQKA 1I0DA 5EKYA 1KM6A 3EWCA 5AC8A 2Y5EA 1ECEA 2BB0A 1PSCA 4DWSD 4KEUA 4J3WA 4I9JA 3BLEA 1MYRA 2DSUA 3O06A 4WR3A 3QZ6A 4PMJA 8CGTA 3GZAA 3H2EA 3EWUA 4LXFA 3U2OA 2QLYA 4GD0A 1FWDC 3KAOA 5D03A 3XISA 3B0VC 4DO5A 1G0CA 1S38A 2OR2A 3NGJA 2D0FA 1K4HA 4JL1A 3VXGA 2NQZA 4JOMA 4RDWA 3W00A 4MKNA 5A8PA 3LOTA 3KCOA 4FPSA 3NZRA 1DQXA 4DO7A 1ML1A 2E28A 4UTIA 3B3DA 4DNMA 2XIJA 1ALDA 2FHBA 3CU2A 4XAZA 5M03A 4IF2A 3UP8A 2GVGA 1XXXA 3TTYA 4UBPC 2QCDA 2X40A 3RO6A 1I2OA 3SY5A 4KWUA 2DQXA 3MT1A 3W7QA 3QBUA 1PB0A 4WEVX 3N25A 1TR9A 1H49A 2OKOA 3DESA 3ITVA 1EFZA 2E1DA 1XLGA 3FDKA 5H2ZA 2BWGA 2DJLA 4GCXA 2E9BA 5JBEA 1GOIA 5C2GA 4A8IA 5H1WA 2WMGA 4I5UA 1ZCCA 3BVJA 2POZA 5HNRA 3BJSA 1XBXA 4JQ1A 3C8NA 2YIHA 3BZGA 1JXKA 1CECA 2Q8ZA 1LT7A 1NWUA 4LUTB 2FFCA 3W76A 2OZ0A 2GDQA 2OLSA 1VIWA 2NLYA 3T2PA 2JQXA 1R2TA 2WZMA 4D6DA 5F1VA 1JI1A 2HNHA 1SQ7A 4F0HA 1JYXA 3FVMA 1TV4A 4L61A 1UCWA 2WQPA 5HWNA 1O95A 3MY9A 2H9AA 2XJ7A 4G1KA 3PPCA 4F0KA 3TK7A 1QK0A 2WQDA 4DXKA 3H2CA 5JUVA 1DOSA 3W2MA 1JPKA 2D2GA 2E0PA 1AJ2A 4YNGA 3UNDA 5D4YA 3OZPA 1MRAA 3M0KA 2XUCA 2YOCA 3W22A 2JF7A 5DN1A 3VUSA 4HMDA 4MZ8A 1DE6A 3WDHA 1V3JA 2Z1KA 3FA4A 3LV6A 4GI6A 4LRSA 3W72A 1AJZA 1H0IA 1R7OA 3WLLA 1KLZA 1JR1A 3FKRA 3GC2A 2PFHA 3DGRA 3HFTA 1CCWB 4HN8A 2A2IA 2RJGA 1OT1A 3VD3A 4GQGA 3WF3A 3ABSA 2FIQA 1GOQA 2WHMA 1YNQA 3K4DA 5CC3A 4A2RA 2ZDSA 3A13A 1JGMA 4CU6A 1PJ9A 7A3HA 5GNXA 4MOZA 4C91A 3KP0A 4DPQA 4HYRA 4M3PA 1K9EA 4AD5A 5F2IA 3W1TA 1US2A 4NAEB 2GOKA 3TYZA 3L5MA 3PNZA 3SW6A 2UZ9A 4X0VA 1M7JA 3N2BA 2CZFA 3T07A 4G1NA 4OHQA 5A8MA 1Q6DA 2XDFA 5CH9A 5A8NA 1V8EA 2J13A 2QQ6A 4HIBA 3DERA 5EB8A 2MNRA 3G1FA 1I6NA 3PWIA 5H8PA 1AW1A 4FO4A 3W7DA 4DBWA 3AXXA 3CQHA 3ARXA 2V2DA 2NUXA 1C29A 3N04A 1K8ZA 5E6YA 1Q7MA 3UZZA 1VFUA 1TPFA 3B9EA 3DC0A 4ERAA 4R5EA 4S3EA 2CU0A 1K9DA 1HL8A 1AMKA 2ACSA 3GVVA 1DIDA 1Q65A 3O6DA 5C70A 4HTBA 3B05A 3TQKA 4XO6A 3QLLA 1WV2A 4J5NA 1Q2RA 4S3DA 3O07A 1K8XA 3VIIA 4A8NA 3W7IA 3POCA 3MI6A 1PS9A 1TQJA 4MPKA 4P5UA 3WNNA 4J7RA 2WMIA 3UF9A 3ZFHA 2CZ5A 4KERA 4J3XA 4MHBA 2EXOA 4XKYA 3WX7A 1GVQA 1E72M 3I7QA 1TVPA 1OCQA 3SUWA 3BURA 1CT5A 4HK5A 1D7FA 3IVTA 4H8NA 1PKMA 2EJ1A 4D6JA 4KEMA 2F84A 1NDZA 3QZAA 3GTHA 3PUOA 2DUXA 3LS9A 3VD4A 9XIMA 3VOFA 3N11A 3BG5A 4PTWA 4FLRA 1CYGA 1QWGA 3HG5A 5CZJA 1HKIA 1IZJA 1U1JA 2XIIA 4HCDA 1RSCA 5IRPA 2W63A 3CL7A 3FEMA 3PZQA 5T8GA 5AC4A 3OZYA 4I5XA 1QOQA 1R3QA 3LQLA 4A2SA 3AHTA 2RH9A 3N6JA 4A29A 3RU6A 2H90A 3VUPA 1LG2A 3BTNA 5B7ZA 4H9VA 4AUBA 3PTDA 5FACA 3ZMRA 3M16A 1BPLB 3CV6A 1M41A 2JE8A 1VPYA 3A24A 1SMAA 1SW3A 3SGZA 3D5HA 1J01A 1CGTA 3TCSA 5FIPA 1OB0A 2PCEA 4OUIA 3LA4A 3EKGA 3NIYA 4WIWA 4AZIA 4FB7A 2V6AA 4Z1DA 2QYGA 1ONWA 5HINA 3M5VA 1BQGA 5CGQA 3CL6A 3PTQA 1HG3A 1TV2A 2BSLA 3BE7A 4BQ4A 3AALA 3KRZA 3EEZA 4JICA 1VFTA 4I9TA 4Q7NA 1AZ2A 4GUFA 5D9NA 1L8PA 1P0BA 2DIEA 2QXWA 2ZE3A 1TX0A 1N8FA 2HPIA 5DY2A 4QIUA 4WCJA 3RPMA 1J5TA 4E2OA 3C86A 2A7RA 2WZHA 4FR1A 2V8ZA 3G6LA 3WJZA 4WKFA 4JNMA 4OVXA 5DBUA 2VX4A 4D72A 3IPWA 3B9AA 3IJ8A 1BYCA 1D3GA 3G18A 4AMCA 3EWYA 5BMWA 4AZGA 5A6BD 2Q8LA 4CNPA 3LQGA 4CQDA 5FSDC 3CV1A 4IMGA 2F2HA 2XG9A 1VGAA 3R0UA 3VZXA 3EOUA 1XI3A 3RX3A 1BGGA 2ODOA 3GG1A 3MDUA 4B5UA 3IGHX 1LL7A 3CWOX 1VPXA 3RPDA 4NJHA 3VKKA 3PB2A 3LU2A 2XH0A 4A3HA 1SVDA 4N4PA 4E8CA 1POKA 2V3FA 5DEZA 1XWYA 5CPOA 5HATA 2GQ3A 2WWDA 5HMFA 3GXDA 4AWSA 4LW7A 2EG7A 4FNPA 4S3CA 3AS3A 1XPGA 4MZYA 4E4PA 5F7UA 2W27A 4FK9A 4JIHA 1IWAA 5GNZA 2BS9A 4ZXOA 3GTFA 1M3UA 1LZOA 4RX0A 2E6YA 2QVNA 2CLPA 1UPPA 3XIMA 2A6LA 4YS1A 2GPTA 2FMNA 1ZLPA 3W7RA 3MSYA 1VFOA 4LVFA 3DBPA 4AG0A 1QASA 4BHYA 1Q63A 1ZBWA 3G22A 4GJJA 5TIMA 1ADOA 2HBVA 3AU2A 4UFIA 1Q4WA 1WB0A 3ITYA 2VENA 3MCOA 3W3OA 3DHDA 2HPMA 1RVGA 3TAKA 2WNWA 4JEJA 5FL1A 4M19A 4C6DA 1CXEA 3IGUA 1RPXA 1GVIA 3UPBA 1IWPA 3W6YA 1TPC1 2E9LA 1D9EA 3C52A 1SSGA 1RP9A 3UEQA 1F61A 1WKEA 4NYYA 2Z7GA 2ZZ3A 1XYAA 3STFA 1LUCA 4HVXA 1VFMA 1BFNA 4BWLA 2BOFX 5HANA 3QPEA 4M6VA 1RR2A 3THDA 1OX4B 1SZRA 4LUSB 3TVAA 1VFHA 2ZX6A 4DM2A 3NSMA 3BOFA 3N18A 3NQ2A 2O7SA 4ZO9A 1FCQA 1FWFC 3FSTA 3MSDA 3CH9A 2ZXAA 1OG6A 1OQFA 1R38A 1A3WA 2PGEA 2Y5JA 4L7ZA 3W87A 1DJWA 1G4EA 4WLCA 5F2MA 1XIFA 1CWYA 3CB8A 1UP3A 2ZBTA 4Q4MA 1DIEA 3TN3A 1MW3A 4D6HA 4E2DA 2QDEA 3MKKA 3IK4A 3P6LA 1EGMA 4BEQA 2I5GA 4PTDA 1QI3A 4AFYA 4E3TA 1QHZA 4WOQA 2FB2A 3EKLA 4LUYA 4Z0SA 3W7HA 3J7HA 1HKMA 2EO7A 1K7EA 1A50A 4LU0A 3OJGA 3H7UA 4PZVA 3V0TA 2OELA 3H8AA 4Y9AA 2G5WA 3OQEA 1T5AA 4ZODA 1DXFA 5A5WA 1RALA 4NRRA 3LBOA 1KFLA 3QMTA 2P5NA 3CB3A 3QSRA 4UOZA 5C2CA 4MUZA 1RPKA 4UTUA 5IFPA 2GOUA 4UQCA 3H24A 1A4MA 2VL4A 3N17A 1QRQA 6PTDA 1OC7A 5H6HA 4JFUA 1XDJA 3D0CA 1T8QA 1J0KA 1W3IA 1RUSA 1KBBA 1Z6KA 2G3FA 4XBJA 1P0KA 3WD3A 4TUFA 3BMWA 3NGFA 5TQLA 4MB1A 2BHUA 3O2LA 4WY0F 3CH0A 2VWSA 1BG9A 3M5XA 1AH0A 4OIFA 4YTTA 1LQ0A 4GOAA 1US3A 2BY2A 2CLFA 4H8UA 2YZRA 3LHUA 4AU0A 1V0MA 3SUUA 1YNPA 3WH8A 3QH2A 4WRHA 4M5PA 5KSWA 3G0XA 2WMKA 3N9RA 1UWIA 3KWSA 4HB7A 3JR2A 3L23A 1WXZA 3MVTA 4O17A 5G1TA 3PTMA 3C0LA 4K6AA 4AZ5A 5BXRA 2JF6A 4GIAA 1C7SA 1ODZA 2QR6A 3NPVA 4TMBA 2I56A 2QT3A 5E70A 2GVYA 3VGFA 1B3YA 5DMNA 2X1SA 3KVMA 1XIMA 3CZJA 4MG4A 3O63A 5CJNA 4QQUA 4N9DA 1Z3NA 4J9JA 3UYIA 2VNCA 4LUJA 2NQ9A 3GM8A 2WJFA 1VFFA 1ZBVA 2XFFA 3DYOA 1EUNA 1OFBA 1MUMA 2HDJA 3EXSA 4MYXA 5EPDA 4EAYA 1J96A 1FXQA 1GG0A 4AF0A 4DO4A 4RE2A 1PUDA 5G2WA 4EAMA 2CZEA 1W31A 1KXTA 4ML9A 3ZWTA 3VOIA 1PPIA 1C92A 3VX0A 3ARVA 3ARTA 2CLOA 3PZMA 1OADA 1OVDA 4UQAA 1KM3A 3AZRA 1Q4NX 1XDLA 3BK0A 1VQTA 8TIMA 4DNHA 2PCQA 3QV8A 4F9JA 4NP7A 3WSUA 3CXOA 1XG3A 2QDDA 1V0KA 1ICQA 4M6UA 4NNAA 1W0MA 1BGAA 3E49A 4RL3A 4XD3A 4HNLA 1B9ZA 1LORA 2YDRA 8RUCA 3TH6A 4TXEA 4NU7A 4GQ0A 3ES7A 4H19A 2PDJA 3UNTA 4L1GA 2VDIA 3QEZA 4JXCA 1IEVA 2J7FA 3T2QA 1TFVA 1AW5A 2ADAA 2Q01A 3BGJA 3CMGA 4IHCA 4P8UA 3SN0A 3EX1A 1YE6A 4O1EA 2FZDA 4ZCWA 3U4FA 4M56A 2GGJA 2CETA 3AMLA 3IGXA 2E6FA 1KRMA 4K36A 1JD9A 3PK7A 3AISA 3FS2A 2YL6A 3V75A 4EWJA 4JHOA 1WXJA 3OPSA 2UBPC 5B80A 4FX7A 1TV3A 3HPAA 4ML4A 1EX1A 1HO4A 3E0FA 4YVVA 2FVLA 3CUHA 3AXMA 5GVJA 2QS8A 4G7EB 2ZZ5A 2PU1A 1VKFA 5HDRA 4KIRA 3ZVHB 1E0VA 4QFUA 3W2JA 1VYSX 1WZLA 4A8LA 5F4SA 1NF0A 3W7JA 3FKKA 3VCNA 4PB5A 4P7NA 4F8XA 3ARUA 1XIBA 3RRXA 3QR1A 2JEPA 3H53A 3UXDA 4M0XA 3PP7A 1A5NC 4WGXA 2ON3A 3ZM8A 4AXNA 4NZ5A 1H7NA 4MY8A 4PEEA 3I10A 1JCLA 4XSLA 1GKPA 2PWVA 1EJRC 4TVCA 4WZHA 3KRSA 2ACQA 2ABBA 3HV8A 5HWMA 1G4SA 1J0IA 3ONBA 3APYA 2P50A 5FSEC 1UZHA 3ARWA 7CGTA 4ZL1A 3CC1A 5DLCA 1H41A 4GY1A 3FLUA 3ES8A 3I7SA 4E38A 1X8CA 1GQNA 2X0HA 4BEUA 2VHLA 3NDZA 2I14A 3WLNA 1O68A 3E0IA 4JTLA 2V3GA 1XIDA 5FJOA 1EA0A 3S47A 2WANA 2DORA 1TSIA 3QPZA 2QJMA 3EB3A 2NVDA 3PJTA 1VRDA 3GHTA 2YW4A 3LXCA 3REQB 3HZ3A 1FA2A 1JZ4A 2OZ3A 4BCEA 2J47A 3H21A 4JYEA 5EFFA 4FAMA 1O7AA 1H50A 2VCBA 3ME3A 2CESA 3GG7A 4HSHA 4KH2A 1OBAA 2GLKA 1WA3A 1GEQA 1H5VA 3ZT5A 3AIQA 1MI3A 1TTPA 2XVLA 3KFTA 3KDOA 4ZQCA 1PBGA 5MKGB 1KFEA 3VU2A 1BHGA 4O4WA 1UUOA 4YYCA 2YXXA 3D6NA 1PIFA 4DX3A 3LRKA 3A5FA 4X61A 3P80A 1H5YA 1TV8A 4RNIA 1W5OA 1RK6A 1S3HA 1Z41A 3G1HA 2OO0A 5FD0A 1R87A 1XQKA 1I1XA 2NUWA 4JTKA 3CL8A 3SB0A 3PSVA 1OIFA 4TV6A 4L4PA 1XSJA 2NSXA 1TWSA 1BEUA 2OZTA 3H26A 4RXFA 3WF1A 3TFCA 3UR7A 4GC4A 1C8XA 4L9ZA 1A80A 1DWIM 2VRQA 2XIQA 4HA1A 5CJ5A 5J8LA 4RDYA 1OFDA 1Q6LA 2PGFA 2CBJA 1PXGA 3D46A 2YBVA 5LIUX 2WVVA 1Z89A 1GW9A 3QJAA 3DBNA 4XBKA 3OU8A 1FWSA 4Q6XA 4XK2A 1Q6CA 7TAAA 4BZYA 1YBQB 3MKCA 1KBKA 4B90A 4NAEA 1S3TC 1XSKA 2XH4A 4AIOA 1SR0A 1XLFA 4CCCA 3GE7A 3SY1A 2WZTA 4NJKA 4RDVA 1V3MA 4ADTA 4LYKA 1JPDX 1I75A 1FH8A 3U7BA 1ZJIA 4AY7A 2ZKMX 3N14A 2F9RA 3GR4A 1IR2A 2AKZA 4MY9A 4S3BA 1V03A 2YB1A 3H4WA 1ITCA 4L65A 1VD6A 4HN4A 4I5RA 3AIEA 2PF8A 1GJPA 2C14A 5LA0A 4KCWA 4RZBA 4HMEA 2ISWA 3ANYA 1KLYA 3SO7A 3LB0A 1R46A 4LVBA 4H7ZA 2Z1BA 4EXBA 3FYOA 3ERPA 3NVTA 4L64A 3FGCA 3H7VA 4J3TA 1EL3A 4L5ZA 3S5NA 5BWAA 3RITA 3LZ3A 3DFOA 3AMCA 2GK1A 2C1HA 2QV5A 4KIEA 5CLTA 2VEIA 3I68A 1DTUA 1DPMA 1WP6A 2UY3A 4KCUA 2X7VA 3ZVHA 3DAQA 4OE7A 5TAOA 5AOUA 4QP0A 3SIMA 3BJTA 3R58A 4JTSA 1UKQA 3L4YA 5CPNA 4Q8OA 2B31A 5EY5A 1FWJC 3WFZA 1QI4A 1ZFJA 1TE1A 2Y4SA 2YCKX 3LSCA 3I3BA 4CN4A 4CN1A 4LBUA 3NOYA 2O9RA 4JFTA 3T81A 3TSBA 3RCMA 2B7QA 4IWWA 4O14A 1GHSA 2TPSA 3ARPA 2CHRA 3L7RA 1Z44A 4PC8A 1IXPA 3M0XA 4XISA 4QNWA 5B7YA 4GQBA 1A0EA 4HKPA 3TP4A 1AQ0A 4JIQA 4O52A 3M0VA 2NT1A 4EACA 2AAMA 5JVLA 3C4UA 3DEQA 1WDSA 2CYGA 4LNCA 3S6TA 4B5NA 1TPUA 4EF9A 1EGVA 1HJUA 1HP4A 1GVSA 3CHCA 3FHQA 1TA3B 6TIMA 2P3ZA 1NIUA 1U5VA 3CM4A 4L4OA 4FMVA 4AZ7A 2VR4A 2QCHA 3CUXA 2PP3A 3E3HA 1L6FA 4M7SA 2O0TA 1XD1A 2ZUMA 4PMUA 2FTWA 1ENUA 1KRBC 3WQVA 2WVVB 1KV8A 2WPBA 3I6RA 5D2WA 1HNYA 3TYDA 4E2VA 1O5KA 4YMZA 3RG6A 2GSHA 2HV5A 1W3NA 3W82A 1A5KC 3XINA 3LLDA 2P1FA 1E0UA 2Z00A 4LVDA 1IE7C 3BL3A 1G94A 1N2VA 2AGTA 2A6NA 4DVOA 4FLQA 4UCGA 3TC3A 4W7UA 2PDPA 4ZZ9A 3PJWA 4FI4A 5LNRA 1EOKA 1UMLA 5JH2A 4UFJA 3VVGA 1GZJA 3CT2A 4UXDA 5LIYX 3TIMA 3NXLA 1XLJA 4DUOA 4NNBA 2X1IA 1K6AA 3U9IA 5GQBA 1I4NA 4X0NA 4A6GA 1E0XA 1HKVA 4MAVA 3H2AA 1ICSA 3EDEA 4ZSUA 4AEOA 1Y5XA 3CHVA 3GX9A 4JN6A 4NJJA 1BF2A 2QJNA 4RLIA 3W7MA 1FQ0A 3UPMA 2V69A 3ABOA 4XBSA 2VXNA 3MBDA 4LB3A 1CB7B 1DJQA 2BXZA 1GYLA 4OZOA 3R12A 3EMZA 1EKOA 1KXVA 4C6PA 3FVDA 2DUAA 1CGYA 4KKXA 3AJ7A 4MWAA 5D30A 3NQ8A 4E0CA 2A7PA 2VQUA 3AC0A 2PRLA 3QM3A 7ENLA 3TQVA 3H6OA 4GC3A 3ONCA 2VGGA 5A6AA 3W71A 4DY1A 3HURA 3C2YA 3ARYA 2WNNA 2DVTA 4L6HA 2H9AB 3IUDA 2VM8A 3V18A 3W02A 1KKRA 5CSYA 3VTRA 4DXXA 1OFAA 3EOEA 4RDZA 4MWAE 3E2SA 4DIAA 4LC8A 3A47A 1UWRA 2WSKA 4XZ9A 4JIEA 1BKSA 3BQ6A 2HVOA 3W1UA 2EQDA 4FNTA 1QNVA 3FX4A 1I9CB 2QUUA 3GG8A 3P14A 3LGDA 4LY8A 5C9XA 3V4BA 3ARRA 3V35A 3K5XA 2QCNA 3ENLA 3KP1A 1QPNA 2XYLA 4YU1A 3URQA 2EG6A 1A53A 5IHSA 4Q4SA 4PBGA 4PBEA 3MV11 4Q8MA 4C6EA 3L2IA 2BXVA 3CTLA 3QZEA 2OSWA 4L9XA 2VUNA 5ENLA 2D2JA 1HZYA 4H00A 2XHYA 1NOUA 1V6WA 3AS0A 4QJ4B 3QQWA 5K2ZA 5C8BB 2HRWA 1OHLA 4MVAA 2RGLA 3WBWA 2VX5A 3DZ1A 4I9AA 1G9HA 2HNEA 3RR4A 1AD1A 3SCSA 1LG1A 2GL5A 2YYTA 2I17A 4L6DA 4BS0A 1IHIA 1WBJA 2VI0A 2VFEA 4AWTA 5AECA 3VZYA 2Y2WA 3LM3A 4NF7A 1OSEA 1H2JA 1H0GA 4QLLA 4JPGA 4O11A 3UY7A 2I5IA 5JXQA 1BWLA 2F7FA 1NQKA 1RA5A 1U83A 1E5NA 1WZMA 1TZ9A 5HOSA 3PJUA 5LIKX 2WZIA 2WBKA 3NEHA 4O8RA 2ZUTA 4Y9NA 5CPSA 4Q33A 2J77A 4S23A 4DAFA 1EXPA 2W67A 4FIRA 1RY8A 1J10A 1FDZA 1WCGA 1TJPA 2J9XA 1D8WA 3LSBA 4J1OA 2P10A 1ME7A 1R30A 4J28A 4Y2WA 1PZ2A 2C79A 3HG4A 4NL1A 1QJWA 3I65A 1SR9A 5KZEA 2Z1WA 2XH7A 5D37A 4WDUA 1U1UA 4UWMA 1UD2A 4PMZA 4U33A 4Z42C 1UOZA 1W37A 2OCZA 3FA5A 1V6VA 3OW1A 3T2OA 3F2BA 3VI2A 4EPBC 3LZ5A 4K2SA 3BOXA 4GNVA 4Z2JA 1DL3A 3EOSA 1VC4A 2VDGA 3CLWA 3MA8A 3A23A 3QTGA 1A0CA 2Y0FA 2VR2A 3EZ4A 4UTLA 1S2WA 1VENA 1XYFA 4JTDA 3LD5A 5E1QA 5K7JA 4ONVA 3KZSA 1VBJA 1NFGA 2Y8KA 3PY2A 4IG2A 3UJEA 3AIUA 4GI9A 1QOXA 1L6YA 1V6YA 2NW0A 1J2BA 4GI8A 4X2RA 3GRIA 4WD0A 1XGDA 2X1UA 1EC9A 3SCRA 4N42A 4ZGYA 2BASA 4M80A 1V6XA 4U3AA 1HIZA 4GIYA 2VKZG 3TJIA 3M0MA 2X8RA 4AEEA 1OFPA 3WD1A 3WYZA 4MTVA 1NP0A 1RQEA 2Q6ZA 3B8DA 1Z69A 1S1RA 1H60A 2WHLA 3MBFA 1W1VA 4QQ3A 3WUBA 3S1XA 1SZGA 1DQUA 3A3XA 5IBXA 5EMKA 1H09A 4FZIA 2NVAA 3UZWA 1X6NA 5CG0A 2O9OA 3O3RA 4X63A 1HT6A 4RZ5A 1EXBA 1RV8A 1M68A 5K3VA 5I03A 1W3HA 2EKCA 2AGKA 3PAJA 3CIWA 2FVKA 1XLKA 1WXYA 4FOUA 3AZTA 4L4MA 4UTFA 1PTGA 2J78A 3LCWA 3BC9A 3KOYA 3MB9A 1FXPA 3VDCA 1ZQ5A 4C5ZA 2WC4A 1KCLA 1XICA 4PMXA 1X38A 2DSVA 3N2XA 1T96A 4US5A 1TJ2A 4KEZA 1CGXA 5EMMA 1OCNA 2BVTA 3GVGA 3LHVA 3WNOA 1THFD 1UA3A 2YLLA 3S6DA 4AYGA 4U5IA 1G7UA 1UWQA 2X0SA 3GBEA 4W8LA 5DF0A 3H12A 6CGTA 3RLHA 1QO2A 3IIPA 3FCPA 4H04A 1V93A 2P0IA 1QNRA 4UUIA 3PHAA 3A5VA 1H3GA 3AU6A 1G67A 3BSMA 2DZPA 3QHNA 2DV0A 3UQNA 1I2RA 4XZNX 5ABGA 3ZYZA 4P8XA 1EDQA 3D3FA 3FN9A 1H7PA 4CU8A 4GY0A 3LNPA 4XD6A 3TMLA 5CXPA 1QW9A 3P60A 2XWDA 2B0MA 1MUCA 3VDHA 2ISDA 3RUBL 1GTEA 1ZNNA 4I7UA 3FAWA 4HCLA 3VDGA 3DHUA 3BW2A 4XZMX 3QTPA 4WOZA 4F66A 2ANUA 3S2JA 4HSOA 4GO8A 5TF0A 4AMAA 4B5SA 4IP5A 3EOLA 2PE4A 1O5QA 4IIFA 2DH3A 4AX7A 2R1LA 3B03A 3VPLA 3TXZA 3HOJA 4HHLA 3CWHA 2INFA 4AD0A 3L5LA 4BI7A 1PX3A 1TR1A 1JFXA 4Z2KA 2HWGA 3RMEA 4JTJA 4CKQA 5TBOA 1QPQA 3NR0A 3MV01 2NXIA 3FJLA 2JGYA 1KM1A 1GEHA 2WM1A 3DYPA 1LBFA 2IPWA 3T78A 4UNKA 5CSSA 1UZ4A 1ISWA 3WCZA 3CPGA 3G24A 4ZO7A 3WNPA 4AVOA 3TSMA 1UG6A 2CZDA 3CZGA 3WFAA 3PUEA 3VGHA 5I3FA 4GUIA 2PODA 5EBAA 3BSHA 3JVAA 3QXBA 4LYQA 1UWTA 3QQ1A 1VCFA 1H7WA 2VFGA 3U2CA 4ASTA 3KS6A 5HR7A 4LB4A 2BGQA 3RJYA 2JKEA 3MMDA 1R85A 1X1ZA 4NUWA 2OXNA 2EHHA 3RGTA 2AQOA 4ZQOA 1XC4A 4P61A 4C6IA 1A0DA 5A2CA 1FKWA 1HVQA 5HK4A 1XS2A 1J6OA 2XSAA 4LCRA 3KBNA 1L6SA 5LNWA 3QGVA 3PUDA 3ZR5A 2Z1SA 2XGIA 5JQ9A 1XJBA 1QAPA 5EL1A 2QF7A 2EBNA 1HO1A 4RNFA 4QX4A 4WXYA 4KEVA 3CHDA 4EPDC 3IWPA 4I7WA 4KFOA 5DMYA 4KETA 4Q8NA 3GXIA 3OODA 4IMDA 5I79A 4P7RA 1YMYA 2AMGA 3BLPX 1LM1A 3U48A 3S2LA 4ATWA 3R5EA 4LGXA 1GQIA 2WK2A 4IQJA 1H61A 1Z42A 1SJAA 1TVNA 2C7FA 3VD5A 4KPLA 3WLSA 1T7LA 3OTRA 3AFBA 4PTXA 5CPLA 2J7HA 4XZHA 3K2GA 4C6BA 3A4AA 3PBVA 1DJNA 4MJ4A 1VJSA 4CCZA 4JQAA 1P1XA 3SQSA 5RUBA 2PDXA 1OINA 2HXTA 5CC7A 3V7PA 2I57A 3DHFA 2A3LA 4ATDA 2E4TA 4C6LA 3NZGA 3KRUA 4UTTA 1UR8A 4O1AA 4YIWA 2GZXA 2A7NA 2ZIDA 4MNMA 2XISA 4ADUA 3LRLA 3UJ2A 3BCFA 4KRZA 2GSEA 3IARA 3EXRA 2QUVA 3V16A 2TSYA 3PULA 1FOBA 1ZZMA 5H8UA 1YKWA 4GYFA 4ZQPA 4QXIA 1I60A 1WO2A 3AYSA 4LY4A 4H2HA 1UZ1A 3WIJA 2NV2A 5K4XA 3FW6A 5T9CE 1KQZA 1WBHA 3NL6A 2JIEA 1XP3A 2PDQA 2WO5A 3LPGA 1JNEA 5I77A 2FZMA 3VGBA 4GJ1A 2CWXA 3RU8X 3BCDA 1X6UA 4HNUA 3AMKA 2CERA 1NU5A 3H7RA 4D6EA 3F4DA 1OX5A 1XDMA 2ZCGA 4JL2A 1E1CB 3PBUA 9CGTA 3MO4A 1G1YA 3W38A 2EPKX 1HKWA 2J7DA 3JS3A 2O4QA 4FS9A 2VMFA 2CPUA 5REQB 3CO4A 1B0IA 1KGWA 1UP2A 3BUVA 3ZQ9A 4W88A 3BCJA 1R9YA 4Q8TA 3LBMA 3M6DA 1J2WA 4MLRA 3LTPA 1K8CA 4FOKA 3FXYA 4XTDA 2PDWA 3NQ6A 4TIMA 4UQDA 5KZDA 1S1PA 2AOSA 3NZQA 4FSAA 2VFDA 2B81A 4JN7A 3OVGA 2X2YA 2IKIA 1TELA 1EDTA 2WLYA 4O1BA 3O16A 2NX9A 2QGYA 3VE7A 3NTYA 4JDBA 4US5D 2TMDA 4TX9A 1E0TA 3UW6A 3K8MA 4UMBA 2VOTA 2NT0A 2FB3A 1PKLA 3TROA 1E6RA 3RM8A 2ZXQA 3TJLA 2VC9A 3DG3A 4M1BA 1S2AA 3L4WA 2C0AA 1FKXA 1VEMA 5L6UA 1LQAA 2D22A 1XD0A 4LX4A 1JUEA 1K1DA 1BRLB 4GGHA 3CZKA 4CQ8A 1IXNA 3KOXA 2OOFA 3BOLA 5A6BA 3VKJA 1OK6A 3OHIA 1BWKA 1U5JA 4JKMA 4F48A 3WQCA 3GFXA 3P61A 3SRDA 2OO6A 3MYOA 2I7GA 4JTAA 3TKFA 3L21A 5C0QA 2H8XA 3NFUA 4ECLA 5TNVA 1KFCA 3PANA 4DWSA 2DUZA 2V30A 1W9XA 4KCVA 2VCAA 3AMGA 2YKKA 3EEGA 4LANA 1MQPA 4E8DA 4UIOA 4RNJA 3W86A 4K8HA 2Q02A 3ECQA 1TCDA 2GQAA 1EPVA 3NL2A 3NG3A 4H2CA 1IEQA 4AIBA 3E0LA 2YGYA 4MMWA 4K1GA 1VJZA 4JIRA 2G95A 3WEMA 1LQ2A 3DFHA 4D9PA 4DJFD 4U31A 3T44A 2R1PA 3REQA 2WCGA 4KFNA 4PSPA 4PCTA 2OTDA 1QOPA 3BLLA 1XYZA 1V7YA 3BSGA 3LV5A 3RM4A 1QTWA 3W7EA 3TWAA 1Q7QA 3TQ0A 3P67A 1WDRA 3UG8A 1W9UA 1FBAA 4L6OA 4G9PA 1WOBA 3DKLA 2DH2A 4YLWA 3RX2A 4H7CA 2OWXA 1FX6A 4IM4A 4NQ1A 5ABTA 2YLAA 4IFOA 2PTYA 4ENLA 4CQBA 1UD6A 3UVAA 4LBSA 3L66A 4AD3A 2ACUA 4HPNA 1EC7A 1QUMA 3R6IA 3KBMA 5AVHA 1BYAA 1RK5A 3FSUA 3F4NA 4H4IA 3EWWA 1QNQA 1B31A 2FTYA 3EWZA 4NZ3A 1W17A 4XD4A 5BXPA 4GINA 2HTMA 1X97A 2G3MA 1DQWA 3NZ1A 3CUFA 4ZFMA 4Z1CA 1CB2A 1K7XA 2V5BA 4JX4A 2DSWA 1DEDA 1XIIA 2Y8VA 2QJGA 1NM9A 3WG6A 3WY1A 4JIPA 1UR3M 2OEKA 1VCGA 4CVUA 1X98A 1LJYA 1CNVA 2VJXA 1KFWA 1BXCA 3KTXA 1XRVA 3VNJA 3VILA 1W3JA 1LF1A 2J7EA 4LUSA 1T0OA 3JUGA 3UCDA 3BAIA 4JCLA 3M9YA 3EPOA 5FEWA 1VF8A 2BHYA 2DY3A 2VC5A 3TOYA 4OU1A 1DJYA 5BWFA 1QHPA 4HMNA 3NNTA 1GVYA 2VT0A 3PZOA 2XWEA 2OX1A 3WQ8A 3N6HA 1TZZA 3CPRA 2MUCA 5DQPA 4JQ3A 2FZ8A 3RLVA 1WOAA 4MB4A 5T91A 4R7OA 1MUWA 1EP1A 2B7OA 1U33A 5IFTA 3VM5A 1XGZA 3VE9A 3FK4A 1V51A 1F74A 4LAKA 2JEQA 1ZS2A 1M7XA 4QBXA 3OA5A 1NWSA 5DT7A 2HS6A 3SQLA 1V02A 4M6PA 2W92A 1JCJA 3W07A 4MNLA 4PA8A 4AH7A 3DFTA 4Z1AA 4BI5A 4W86A 3CLMA 3DKJA 4NXKA 3LCGA 4ZQNA 3IANA 5F4WA 3C2RA 2CLEA 2WVSA 2PDNA 3PBMA 5CAKA 2DZSA 5CEWA 2ZZ6A 1KBLA 2PD9A 5I02A 5CC6A 3VOJA 1KQYA 2WCSA 4OBTA 4AZ6A 1OJXA 7REQB 5DCBA 1XM3A 2GVEA 1UQZA 4JAWA 2WJEA 3TTQA 3NQBA 4IL2A 3W1RA 3TYEA 3WBEA 2RDUA 5EGRA 3OVRA 3WUEA 1P5BA 5G4HC 2P53A 2Y7FA 1SSDA 4LV4A 1WE5A 3GSMA 4WDXA 2QF8A 3G0SA 3URNA 1W8SA 2V5DA 1CGUA 3O6AA 4CVWA 1J79A 1REQB 2VP8A 4HMCA 3UJFA 3AI0A 3EXTA 3E6EA 1AK5A 1KCKA 1ZHAA 3U5YA 3NZPA 1ZSXA 1JUBA 4ZB2A 4TVUA 2QPXA 3LHTA 1L0PA 3UCQA 2X42A 1F2JA 1JCNA 4MAZA 3HA1A 4BK9A 3UZXA 1WDWA 4PCPA 3F4CA 3GIPA 1KKOA 4OECA 4UR9A 3UVIA 1EP3A 3LGGA 3NO3A 4PBFA 3T0DA 3NURA 4QDPA 5LZLA 1TMHA 1L2QA 5LNVA 3GD6A 1MFVA 3AS2A 3WENA 2NX1A 5DMLA 3QYSA 1U30A 3S5YA 5LIXX 1GYMA 3WBAA 1NSJA 3KEHA 5LA1A 1F8MA 3M7WA 4D71A 3CQJA 4GYPA 2FGLA 3M43A 1GGOA 2VCCA 3EDFA 2PGRA 1XLIA 2XN1A 4DLFA 1L8NA 1DHPA 4XV0A 2REQB 1FP9A 4QG9A 4C6JA 4CN6A 5I07A 3R43A 4CQAA 3BWWA 1OABA 4Q7BA 1CLVA 4B5VA 3VYLA 3L0NA 3ZJ7A 1MSSA 2VOMA 1L6WA 4WY0A 2A3BA 2GJRA 1F6PA 4YTQA 4K3ZA 1R3SA 2BG5A 3TW6A 1MXSA 4KWWA 2ZA3A 1ZJAA 1W5QA 4JIIX 1XIEA 3K46A 1F07A 4IQLA 4EKJA 2WHJA 4AB4A 1KR1A 3B9OA 4DAIA 1WKFA 2X2GA 2PDYA 2P3EA 2GGEA 3EGJA 3S9YA 1A5UA 3SBFA 3BG9A 1PDYA 1DWGM 8XIMA 1BSIA 1BWVA 4AC1X 3BQ5A 5ECVA 4LOCA 2HVMA 2JKPA 1TRIA 4Y9MA 1EBGA 2PC4A 3ZIZA 5DMMA 4IJBA 2CLMA 4Q4RA 3ZXWA 1W5NA 4JQ2A 2NQHA 3D3AA 5KMYA 1UR2A 1PE1A 5E0CA 3G3DA 2NSOA 1IGSA 1SZEA 1XHGA 2CLLA 4EPEC 4QEHA 4C65A 1E40A 3G8EA 4GVHA 1EBHA 1I1WA 2QZRA 3H2FA 4J2MA 4GFSA 5EMLA 3SECA 3M0ZA 3M07A 4GWEA 1H1NA 2QCCA 3N9KA 5I0DA 4O10A 2JK2A 1JCTA 3B0UX 4MM1A 1XKJA 2GSJA 3GR8A 3SADA 4M29A 1SM9A 5D38A 4CD6A 4O15A 3VIPA 5DY3A 5A1AA 3OIHA 1U5HA 2VD9A 3PBGA 2BOGX 4X60A 3DIPA 2QDGA 5A2AA 3W25A 4W4QA 3V36A 1KRAC 1XIHA 2WPGA 1VP5A 3GDTA 3SY8A 2DEPA 4OV4A 2PLCA 4TOQA 2HE8A 4HK6A 4XIMA 3C2FA 4CEUC 3QV7A 4LCSA 3TYUA 4C7DA 5FF3A 2HISA 3WFLA 4AY1A 3W7PA 3EX2A 3G1SA 4IFKB 4IGHA 4RR4A 4OBSA 3VD9A 2GUUA 1MQQA 2WYSA 4TV5A 5ECUA 3SQMA 3SUSA 3VGGA 2WKJA 2XGBA 3NQDA 1PIIA 3R4IA 5G2HA 3POHA 3VABA 1EZWA 3OYZA 1T41A 3WDPP 4HYWA 1K02A 2G50A 4NKCA 2DVXA 2JIWA 3W23A 3UXKA 2ZE0A 3SJ3A 5DRIA 2ISFA 3U4AA 1E1CA 2ZYFA 4FNQA 3FFSA 5E09A 3V0UA 5FI8A 4BA0A 3MMWA 2BHZA 4L4LA 4Y9OA 1FHLA 4LYPA 4CNSA 4QLKA 3BAXA 2V3EA 3S4TA 3H2MA 4U10A 3B8WA 5XIMA 3KM8A 4GVFA 1HGYA 1US0A 1R2SA 4JGDA 1Q8AA 4DI8A 1RJQA 4IMEA 4GNJA 4RPPA 3RPTA 5I24A 4O16A 4HNNA 3E02A 4TX6A 1XCXA 2QHAA 2Q71A 2DZAA 2PWEA 1UUMA 5JH1A 4GXWA 5DX7A 2VFIA 3P82A 1N82A 1S5TA 3PZVA 4E6MA 1UWSA 4WJ8A 4AIEA 4G7FA 4JTCA 4Z08A 1QI0A 4HHMA 1E4NA 4GJIA 4MJMA 4EANA 5K9CA 4H9MA 3K4AA 5FKYA 4LC6A 3WK3A 2IPGA 1OY0A 3CTTA 3VDBA 1GPWA 2FPVA 3OIXA 4FALA 1MMFA 2JBMA 3H70A 4MKVA 4GX9A 2GQ8A 1DIKA 1EGZA 3TU9A 4NJGA 5ABFA 3VKAA 1FP8A 3B40A 4S38A 2PDIA 3BLIA 3R7MA 1D7KA 2PLKA 1IV8A 3OLIA 1AD4A 3UCCA 2FH6A 2Y7GA 4YXGA 1QT1A 2CHOA 5DELA 3PZNA 2KX9A 2WSYA 3GVWA 3VIOA 1EA9C 3U0HA 1I45A 2P8BA 5I23A 1JDCA 3GIQA 1AQFA 3VAVA 2OZ8A 2I9EA 3HPZA 2OOGA 2D3NA 1DWJM 1CBGA 3ICJA 3AXKA 1NF7A 2YYUA 4C90A 1Z48A 2GDUA 2E6DA 4LV9A 2AQVA 3CT7A 2V5KA 4AHPA 3MUCA 4JTRA 5K4ZA 1UWAA 4AIUA 1LP6A 3LK6A 2GJNA 5BMXA 3O05A 2DDXA 4H9UA 3THUA 3TSDA 5AYYA 4P7OA 3BAKA 3UGRA 3W75A 2C1GA 2ZUVA 4JTQA 2YA1A 3W70A 1BTCA 5C9UA 4KBXA 2IQ0A 2EAWA 3VO0A 4AXKA 2PU0A 2PZNA 3E96A 5A6JA 2DT1A 3WD4A 4IFKA 3NDOA 3VNMA 2CBUA 2WSPA 1EJSC 1EHNA 3S0CA 2WC7A 3RILA 4MWAC 1F3XA 3KS5A 1LT8A 2RFGA 4HA0A 3IRDA 1JZ8A 5FAJA 4B92A 4D6IA 1VYRA 1EIBA 5M5DA 2XZ7A 4GABA 4H6KA 3NM1A 4PCSA 2OT1A 3RAOA 3SI9A 3G1RA 1WAUA 2QJHA 4UMCA 4QJ1A 3ZJ8A 4O1CA 4PUNA 3VX1A 2DFAA 1O4UA 2VD8A 3IACA 4GUHA 4R3UA 1FHVA 1XLAA 5CZSA 5FA5A 1V6UA 2ZQ0A 3L12A 4I9MA 2D69A 3L4UA 2G8ZA 4H6EA 4WKHA 1V02E 2YCJA 5AY7A 1WZKA 2YA2A 4XB3A 2AKMA 2ASHA 3C0QA 4PMOA 3UR2A 4POCA 2I9UA 3M0JA 3WQ4A 4AHOA 1NWRA 2QVHA 4JTEA 1XG4A 1OX4A 3GXPA 4NAFB 2R8WA 1N8WA 3CNYA 4AVFA 4UNLA 2CCRA 2J66A 1M9HA 4GUJA 3WDQA 3IRSA 4K8GA 2ZADA 1JAEA 1PO9A 3BGGA 3KHJA 3IJQA 1YBQA 3EKZA 3NJ3A 1RVKA 3L68A 1ZJHA 3TTOA 3GH4A 4ZSTA 3AZSA 4Z2LA 1MEIA 4QS6A 4PEKA 3U57A 3PG9A 1ZBKA 4L1WA 3AMDA 3P3BA 3IAQA 1OIMA 2KAUC 1B9BA 1D8CA 3FDGA 3ITTA 3OP2A 2ZUSA 4DZIA 2O92A 1ZRQA 4LBRA 4GFIA 1KM5A 3EMQA 1EF2A 3HPFA 1HJQA 4RW3A 2ZTJA 5HXMA 1EYEA 9XIAA 2NUYA 1I0BA 4WJXA 3S8HA 3C8FA 4FXRA 2GVLA 4UQEA 1VCVA 3UA3A 3L2MA 1ZENA 3WQEA 1GORA 1H11A 2PTWA 2RUSA 2PD5A 4OTKA 4XKYB 3PBYA 4DO6A 3N12A 3C5QA 2HMCA 4C7FA 2CKRA 2NZLA 3OG2A 4XZIA 2NV1A 5LHFA 3GNXA 1FHUA 4CNOA 1ONEA 3K1GA 1QPOA 3QOMA 3WH6A 3TLQA 4DXVA 3S9IA 3M44A 5HNUA 3H54A 5I09A 3KTSA 3MW7A 5BXSA 4DJEA 4E5TA 1T8XA 4B5TA 3VINA 3UWWA 4PUJA 4MNKA 3LERA 4PB4A 3L5AA 4R33A 5KZMA 2CC0A 4RE4A 4MF4A 2VYOA 3OB8A 1DVJA 4Y9PA 4F0LA 2J6VA 4N0RA 2Z27A 4ORIA 4KESA 3KL5A 4ROQA 1KFBA 5J5DA 2YX0A 2J75A 1WPCA 5I3DA 1X39A 4W7WA 2W62A 1KR0A 3UD6A 1UJPA 1DBTA 5E6ZA 3PPFA 5H91A 1ZU8A 1ZP4A 3WQ6A 1IGWA 4QTGA 1GKRA 3I4EA 3SSJA 1XIJA 1IIHA 1ISVA 1S5VA 4BJHA 3B8SA 1GCYA 2ZRVA 3CJPA 5KEZA 4B16A 4Q8PA 3JU2A 2Y88A 4E4FA 2ZA2A 2ZWZA 4IP4A 4J27A 3O6YX 4GQRA 1EYWA 3CHFA 1GZGA 2ZXDA 4GYJA 3GR7A 1NOFA 1FVPA 3CYVA 1IR1A 3URAA 1Q6OA 4RK8A 4Q32A 3V5OA 4LEFA 4V1YA 3S46A 1TYGA 1W32A 1TPVA 2V2CA 1BD0A 4IFRA 4EE9A 5CC5A 3RN6A 3M6YA 1ECQA 1IT8A 4A3UA 1AA1B 4FXFA 1U22A 3P5ZA 4AHQA 1LLZA 3ZT6A 3NA8A 3E12A 5AHNA 4R88A 3RCNA 2GQ9A 2YBTA 4GNKB 1TREA 4CU7A 3ANVA 4GCAA 1GW1A 2A0NA 1W2VA 3W29A 1J0ZA 3IVSA 5K9DA 1E3XA 1XLBA 3LENA 3UZYA 3DXIA 3QY6A 3RRAA 2ZUWA 4Y6GA 2VZUA 2XU2A 1YTEA 1UH3A 1BLIA 1OC5A 4UZSA 1B4KA 4W89A 3CV2A 2GUBA 1ME8A 3E5BA 4QE1A 2C8NA 1KTCA 2IS7A 4H6QA 3KLLA 3N15A 1FFQA 3GC4A 4KWOA 4XVEA 4HOWA 4GRSA 4N9EA 3VOCA 3W7GA 1EJ7L 4NI3A 2YCLA 3OGRA 2X41A 4LAZA 1V0LA 3AJXA 1KFJA 1DYSA 2Y7DA 3G1VA 2J79A 2AL2B 3EBVA 2GUYA 3CMJA 2OSYA 3SAZA 3TYAA 1ICPA 4O50A 4IX2A 1GQJA 3APGA 5JBFA 4CD5A 5XIAA 1V3KA 4DQWA 2BP1A 2WSRA 2PURA 2PSNA 2HROA 2PWDA 3BARA 4HQVA 1KGXA 3KE0A 5CPQA 1XKYA 3CS2A 3MSRA 1U1HA 3DG7A 4LVGA 4NI8A 3MHFA 1SFJA 3WNLA 3Q37A 1XV8A 3W7OA 3I6TA 1VZWA 1MVYA 4B9YA 4UZUA 3S5ZA 4CNNA 4PCFA 1HP5A 2Z0IA 3DI1A 4DJFA 1DJGA 1QI5A 1PKNA 2QGHA 3HJZA 4V33A 1KM2A 4RJEA 1LL6A 1XLLA 1UD5A 2FYMA 4PCNA 4FF7A 4PB3A 1SW0A 1CLXA 5D09A 4QHRA 4W9TA 4HNOA 2HCVA 2E8ZA 4XIAA 4JFSA 2E68A 4A3RA 3PTKA 3QFEA 4OOZA 1VAHA 4LCQA 4HA3A 3W0KA 2EJAA 3VDAA 2J8TA 2QUNA 2RKXA 3AICA 3C6CA 4GUGA 3NSNA 4ZVJA 3M0LA 8A3HA 1S39A 4UFLA 4KRUA 1YXYA 2VGFA 3P74A 1ESWA 5HJYA 1SPQA 5FL0A 2YFOA 3LCIA 4GYPC 2J8FA 3KUMA 2DZBA 1V08A 3AYRA 4YCPA 3C2VA 3T7VA 3KHDA 3T0CA 2OU4A 4C60A 1X1OA 1ISYA 1CGVA 4N6FA 3TW9A 4CNUA 1XLHA 4X2PA 1YPFA 4J2PA 1YYAA 3A21A 1F05A 4GZJA 2PDKA 2NVCA 3M1ZA 4CD8A 3CUZA 4YTUA 2ZX8A 1L9WA 3N19B 3SRHA 2FDMA 2W4XA 3IJ9A 4FR6A 2PI6A 3ZLGA 1SJBA 2Z4GA 1TG7A 4JEQA 2WHKA 2G3JA 4DF0A 4WQ6A 1R7AA 1RLCL 3IS4A 4NZFA 1UC4A 4QDWA 1OWQA 4XKMA 3B04A 2IXVA 3LI1A 3R25A 4NNCA 3TE9A 1NWTA 2PBOA 2VZSA 3S5OA 1ZCOA 4D6CA 4DWSB 3HN3A 3P7YA 2F8QA 3QYQA 1XUZA 3T40A 3OBAA 1H63A 1WZAA 4QDMA 3LYEA 5E0FA 5FJRA 1VB9A 3N3MA 1TTIA 3IIOA 4W5ZA 3RJXA 1B3ZA 1QPRA 3WD2A 4S2CA 3SGUA 2Y61A 3G2GA 2HXUA 4S3GA 3II1A 3SUVA 4LAOA 1B3WA 1E5JA 5AC6A 4DBUA 3GUGA 5BOOA 1TTQA 3T55A 4DBDA 2ZZ2A 1YNYA 4YVPA 4D8ZA 5A2BA 3C3NA 1T99A 4UMAA 5LGZA 4HA4A 4QR6A 1OGSA 3I6EA 3NWRA 4UFMA 1TJRA 4LEQA 1ZB5A 4FLSA 4C6OA 4DN1A 2OT0A 4ZA0A 1YTKA 4HHPA 3OA3A 4C1LA 1BRLA 1XCFA 4DELA 4UFKA 2X0YA 3T6CA 2G41A 4S1FA 1MW2A 3PWAA 3IUHA 3R11A 1HJSA 3GDBA 4ICNA 1HFBA 1OG0A 2INZA 3U8GA 3MO7A 2O4MA 3Q45A 3P0WA 2BNJA 4GH1A 3KBVA 4B4FA 2OG9A 3KVLA 2IKJA 2Z28A 4M1RA 3UXIA 1NARA 3GH7A 4HYVA 4DYEA 1FWEC 4IPLA 3WK1A 1GYNA 3A3HA 2VGBA 1F3EA 3WELA 3W2KA 5EBUA 4PN2A 3U6WA 3PZIA 5F2LA 1VBHA 1UR0A 2VZVA 2G3IA 1B3XA 2C13A 2ZX9A 1OCBA 3GU2A 4R27A 3LLXA 4XZWA 4IISA 1UH2A 4S3AA 3VMPA 2X05A 2XTKA 4WSHA 4J3VA 2E5BA 3B8TA 3SN1A 1VHCA 3OOQA 5I7GA 1JUKA 2FHCA 3MQTA 5D33A 3JZEA 1DTNA 1UR1A 2ATMA 4HU3A 2YXGA 3RO8A 4EXAA 4E3VA 3L67A 4HNCA 4UB9A 1QBAA 1XYMA 2ZUUA 3M0HA 3AIWA 1M7PA 1XBVA 5G1MA 5FF2A 4EF8A 1SO4A 3AXHA 3I4KA 3TEVA 3HTWA 4RV3A 4TMCA 2ZRZA 4IIHA 1Y5VA 4H9XA 4FF5A 3W1XA 4MDPA 5MF5A 3HV9A 5D2VA 1B1YA 2A85A 5E93A 2WV8A 2XN2A 1A5LC 1XH0A 3ZT7A 5HULA 2BX7A 4C6QA 3C2EA 4A8RA 1S5MA 2C71A 1P7TA 4GYKA 4Q8QA 6XIMA 1R9XA 1FH9A 3IJDA 4NYUA 3LTYA 4TX8A 1MWOA 5F4XA 3UWEA 3JRKA 4PRRA 5XINA 1E4IA 4L80A 1HVXA 5LSMA 1H1ZA 3GYEA 5FAGA 2CBVA 3P0XA 5M17A 2VR5A 2DIJA 2H3BA 1QNPA 1IEIA 4O0QA 3UESA 1OYBA 4LUIA 5CJMA 1HL2A 3S2CA 2QJIA 4BFAA 3AHZA 3TYBA 3TZFA 2XVKA 1BXNA 4MZ1A 3NQVA 4RE3A 2GGHA 2EPLX 3FJ6A 4MNJA 1WKDA 2PF0A 1ELSA 3GXMA 5GJPA 5I00A 7REQA 2QPUA 1XISA 5G4WA 3ABRA 3WLMA 4PH6A 3WDRA 2Y63A 2W3ZA 4DZHA 3L0GA 3DI0A 4ZENA 2H6RA 3CZ8A 1IWBA 3MHGA 3COTA 3HB9A 2HK0A 5C2XA 5HA7A 9RUBA 2OKTA 3W83A 2Z2AA 1BQCA 4C5YA 3U2EA 1JL8A 2VGIA 4YCOA 2C0HA 3PN8A 2BMBA 3MPGA 1XQLA 1CDGA 3DECA 3B4UA 1EB3A 3RDKA 4UTKA 1QW7A 3SJNA 4I8YA 5HQMA 4FP1A 4IJRA 3TOPA 5C6MA 1CIUA 3EDKA 1V0NA 1HJXA 3GLCA 4WDWA 2JGQA 1KV5A 5EU9A 5LHEA 4G7EA 5HMSA 1W91A 1PIGA 1MO0A 2NWSA 4LT9A 3ORWA 3LG3A 5E9XA 5JIWA 1PV8A 4Q7IA 2QW5A 4JHMA 4AX6A 1VHNA 3VKBA 5I06A 1RLDA 1W56A 3KBSA 4QM1A 3WQ5A 3KX6A 3WZ0E 3H55A 3HFYA 3Q2DA 3QKZA 1GUVA 3HO8A 5J04A 1C8QA 3VC6A 3QC3A 2E5DA 2WMJA 5LIWX 3WMBA 1FWRA 3HGJA 1DWAM 3C61A 2W91A 3L4ZA 1EZ2A 3GHRA 2HJPA 1XF0A 3T4WA 2QULA 3UJRA 4W7VA 5I2UA 3LNMA 2J7GA 3BICA 4ZB0A 4HBKA 4ACZA 4O57A 6TAAA 2GFTA 4YVXA 1E43A 3W26A 2A3CA 4I7VA 4K8EA 2QEZA 3MUZ1 3P81A 2Z6JA 2W0UA 4GA8A 2W9MA 1F76A 4GK8A 1ZJBA 3QVQA 2OX4A 1DXIA 3TJXA 1C91A 3CIXA 4BR1A 5FJJA 1F6YA 2VZOA 3B0YA 1A3XA 1NDYA 1R3TA 8XIAA 4Z2IA 3USZA 1OT2A 4B5XA 4DZAA 4MFEA 3DFPA 5LYRA 4AC7C 4Q4QA 2GJXA 5D2YA 2WVTA 3GB6A 1ZAJA 4YL2A 5DT5A 4K7VA 2X16A 5M2FX 3E0WA 4RKAA 4JZ5A 2PDMA 1E6XM 1TO3A 3CGTA 4OV9A 5FOOA 4PMNA 3DGBA 1VLIA 3PS7A 4KWVA 4YTSA 4IG2B 3LMYA 4WX2A 3AWNA 2QAFA 3BO9A 3DG6A 4KT2A 3L9CA 4F2TA 2WB5A 5HMEA 2C91A 1UKOA 1EJUC 2QPSA 1FY6A 4HNTA 4DUVA 1Q6QA 3A4WA 3UG5A 5AZ0A 2EPOA 2WMFA 5JMUA 5CPMA 4I8DA 1MZHA 4MY1A 2FDSA 4S3FA 4A05A 1NOWA 1CI1A 5CAHA 1XIGA 5DBTA 1JRCA 2EGZA 1WUFA 1P48A 1T40A 1YDVA 3GFYA 2G0WA 2CNCA 4KQNA 1OD0A 2YPIA 3C56A 1KWGA 4D6GA 1ZBCA 1UIOA 4US6A 2VC6A 5IDIA 1H7RA 1P0EA 1DORA 2A3HA 3N13A 4HP5A 3WLIA 1EPXA 1QK2A 3WJWA 1HTIA 2VQTA 3G1AA 4HJFA 5D04C 1AQMA 1RZMA 4K38A 2YDAA 2YL9A 4UQ9A 3VA8A 1TMQA 2E7FA 1O60A 1KBIA 1EWEA 4J3UA 4IX0A 4LS2A 3CAVA 3FYYA 2CWNA 4F4RA 3HBLA 1KWKA 2PWGA 3UT0A 3UG3A 3UWYA 1DWFM 1BKHA 3Q65A 1V77A 1IF2A 1JYVA 1YXDA 1TVLA 3CUJA 2DZWA 3NPWA 1LWJA 4GQQA 4AD1A 4B4HA 4CLMA 3EA3A 3VC5A 2I5QA 4IJCA 1AQHA 2E25A 4QISA 1ZPTA 2W6RA 3MU7A 3GNRA 3T8LA 4G8TA 5AYBA 3SZ8A 3V1PA 4Q4PA 4I90A 1Y5WA 4QE4A 3BW4A 1Q2SA 1VJIA 4MIMA 3WLPA 1XBZA 3AYVA 4W8BA 3BAJA 5I3IA 1LCOA 2WCAA 2CFFA 5E9AA 4ZOAA 1TPDA 3IK2A 4Q22A 1D2KA 4GLEA 3WDJA 3PUGA 4LF2A 2UY2A 2BXYA 4C6NA 1Y65A 2CBIA 1Z9AA 1OYCA 5AC5A 3FIGA 1EF3A 4IIGA 4KCTA 3BW3A 1E6PA 7TIMA 1HKKA 1RD5A 3LLFA 5BXTA 1YLVA 2HBXA 4ZFCA 4OBRA 1XH1A 3K1DA 1E55A 1EC8A 1W8GA 4XSMA 4G5DA 1NVMA 5FEPA 1YTDA 1CZ1A 2Z25A 3GXNA 1W1PA 4FNRA 3UZJA 3LI0A 2NWRA 1YE4A 1ZAIA 3UWZA 5BNKA 3BLDA 2NV9A 4BF5A 5HNTA 1X8FA 3K8LA 2YDQA 5DANA 4C1NB 2J74A 2BTMA 1GVOA 1OD8A 4MADA 1LYXA 2UV8G 1I8JA 4HNVA 1CXLA 2BODX 4DJDC 4G6CA 4UR7A 1C3FA 5AKQA 3WLTA 1K6WA 2R1KA 1SFTA 3MCNA 4WSJA 3HIJA 4JBRA 2OQLA 1G5AA 2XIOA 2FZNA 3IJ6A 2V81A 4PMDA 3RXZA 2XINA 5AVNA 1NELA 3TR2A 4F2BA 4U2YA 1UH4A 1B5TA 2Y6ZA 1LOLA 1XX1A 5KINA 3DYMA 2CITA 3SEPA 1VYPX 4S39A 3KCJA 3RK8A 1TPWA 3AOFA 4B15A 1UB3A 3LUTA 3SCPA 1RY0A 1W1TA 2VRJA 3QGKC 1L6GA 3A3WA 4D1IA 3HJEA 5FF0A 3SRKA 4ZR8A 3WEOA 1RJPA 1NDVA 4NT0A 3KOWA 3UWVA 3H2OA 4PRTA 5HUOA 2PZ0A 4IUGA 2PLMA 4C1KA 2CXGA 1CXIA 1B90A 1O5XA 1B57A 1LBMA 4UFHA 4EXQA 2ATSA 2XIBA 1WUEA 3ID7A 5GNYA 2D20A 1EEXA 4V15A 1G7VA 1TWWA 3BH4A 4OKDA 3GXTA 4F79A 4AVNA 3E5PA 5D8ZA 1AUSL 3CQKA 1FCVA 2XSBA 4UQBA 3V1HA 1AMYA 2RDXA 3S1UA 1VFLA 4K39A 3S1VA 1EJWC 3T0TA 4DJED 5DCEA 3H22A 5HPOA 1TCMA 4F0MA 4ATLA 1NFPA 4M51A 1E73M 2ZWYA 3TUUA 1E51A 3QRHA 2BDQA 2WBGA 3PC0A 3GW0A 1JD7A 2CKSA 1F4HA 4V2XA 2TYSA 1A5OC 1TKKA 5E5CA 3W1QA 2CZVA 2HE5A 3GNPA 3VNLA 1G01A 4QAIA 3IJIA 2CHNA 2DQWA 1SW7A 3IUIA 1I2PA 3VM7A 3UU0A 4GY7A 4DWSC 4B3LA 4Q4OA 3PZUA 2UY5A 1HN1A 2C3ZA 4PYSA 3QW3A 4W84A 1SJDA 3WQGA 1B3OA 1JZ6A 4DUXA 1TWZA 1XYBA 3C0SA 1KCXA 3BLKA 1YRRA 5U7SA 2PDUA 4B9ZA 3Q94A 1QI2A 2Y89A 1AL8A 4MDOA 3UY8A 4MYAA 2R14A 1V3LA 3BZJA 2TRSA 1ITXA 1PTAA 2J9ZA 1UYQA 3INPA 2E09A 3W27A 1W9BM 3LY0A 4CUCA 1XINA 2DU2A 3E9AA 3LPPA 1W3LA 2Z2BA 3DFNA 3N34A 3MP4A 3QY8A 1J6PA 2EEXA 4CQCA 1QPKA 3F4WA 4XTIA 4GMEA 2P88A 4YHEA 4BY3A 3NPUA 3M5ZA 4IUOA 2E5CA 3GY1A 5IHRA 1QR7A 4FOJA 2J27A 1OCJA 4H83A 1JF5A 5BOFA 3F1QA 2A21A 3LHWA 4J40A 4O8AA 4ZEPA 1A47A 3WLOA 3ZO9A 4V28A 2Y1HA 4Y8FA 3W6MA 3GAYA 1AJ0A 3BV7A 2PDLA 3CASA 3T05A 3H2NA 4H7VA 1UKPA 4DM1A 3APTA 4PUEA 2V63A 3WNKA 4NX0A 4A21A 1S2VA 3PG8A 4M7TA 4LJ3A 3CYJA 3VGDA 4PFMA 2DSZA 3BAWA 3W1LA 2PTDA 4GPNA 3G5EA 1PKYA 5HMDA 1K77A 1TE6A 3D47A 3STCA 1W9DM 4OWGA 3WLKX 3W2LA 3NQMA 3R13A 3O8AA 2BV9A 4OT7A 4C6MA 3UETA 4IICA 1UKSA 4DPPA 3LXAA 5AB3A 5CPTA 1YDOA 1UHVA 3MI2A 4O1FA 1HJWA 5AHLA 1EP2A 2AAAA 4QJ3B 4UTMA 4H9YA 3IVUA 3CZEA 3KWXA 1Y7VA 3FV9A 4GHRA 3FXGA 3IAPA 2G37A 3N4FA 1YEYA 1JEZA 2IW0A 4C6CA 1V79A 1GT8A 4MPQA 2QAPA 4PMQA 5EMJA 3ALGA 3MMTA 2WJZA 1EQPA 1J12A 3MC5A 3CIVA 3GTIA 3OEXA 4HSNA 1FUYA 2D0HA 1UP0A 4KMQA 1XRTA 3W2NA 1ITUA 5M3WA 4GH3A 4B91A 5AYXA 3QMSA 3W37A 2CEQA 1XBYA 1F9CA 3RLUA 2ZRYA 2Q3RA 2IPJA 4FX8A 2DT0A 1G69A 1OFQA 3A6OA 1BSLA 3CQ0A 3RYSA 3ITLA 2Y7EA 3PWGA 3SDOA 2FGZA 1KD0A 4YTRA 2FFIA 3S3GA 5EYWA 3U5UA 1U2YA 3VCCA 2DT3A 1CEOA 3SRFA 3WMLA 3VKDA 4A35A 4A4AA 3A4JA 1TZ7A 2ABAA 3WL0A 3N4AA 3AS1A 3DFQA 3ABXA 3GVQA 1W3KA 3THQA 1JPMA 3MHUA 2QMKA 2ZRXA 4NSBA 3NVDA 2D1ZA 3AHYA 3AYTA 5C71A 1EO7A 1JVNA 1DXEA 1EEPA 1K7FA 1IEWA 4LSBA 3R8HA 3R79A 1EOMA 1GOWA 2ZDRA 3W1AA 1WDPA 1TA3A 1A3HA 1JYNA 4ICMA 5PTDA 4M82A 5CG7A 3GZ3A 3R1ZA 3R2GA 3TN5A 1Q8JA 2QNEA 1RXOB 2BGSA 3GG0A 2C6QA 3QPYA 5I6SA 2FTPA 3QMRA 3S42A 1J9YA 1Y0EA 5HQLA 4NG3A 4XVDA 2WZEA 2VEGA 4Q8UA 2ZFAA 1E4MM 3B9NA 1GZ1A 2XH2A 4CEXC 1K8YA 3SR7A 2BFGA 2J7BA 1X1NA 4OUEA 1JI2A 4IPJA 3JW7A 1XL9A 3M0IA 1TV5A 3ZJ6A 1E6NA 1O1ZA 1TJ1A 5KITA 3EOOA 3O1NA 1J0HA 2DW6A 3TFXA 1JDEA 4WVXA 3B9DA 5D02A 7XIMA 5AHMA 3VCRA 1MEHA 1W2PA 1V3HA 4HK7A 3UYCA 4F40A 3G1DA 2VWTA 1NH6A 2C15A 2R1NA 2V3DA 4LS1A 3TMQA 1EIXA 3TAOA 1KXQA 4EX4A 1TUXA 3M7SA 2QCLA 2Q8XA 2VC7A 2WKLA 1JJKA 1MNZA 2AL2A 3EMCA 1KM4A 1M04A 3EDDA 3SURA 4JTHA 2ZA1A 1YQ2A 1RCOB 1NQ6A 4JN8A 2R1MA 3LBCA 2PWUA 3VIGA 2H8ZA 3LCXA 3IV8A 1RCQA 4DJDA 4F0RA 4X9YA 5G2IA 3T0AA 4HPJA 5LNUA 4J3SA 3TONA 4Z1BA 4WF7A 1UMYA 3SGGA 1OYAA 1TMLA 1P43A 4ZMGA 2GWGA 1E71M 1IT0A 4ACZB 2A3EA 3CPUA 3MJYA 1M03A 3FJ4A 3E0VA 2NX3A 4DRSA 3LEPA 4QITA 2XZ9A 4ROPA 3LPOA 3NM3A 4IQEA 4Y96A 2ALDA 3TZNA 1ODUA 2POTA 1KW1A 3GHSA 4TO8A 3UWUA 1MRQA 2VX6A 1GHRA 2DT2A 5K9XA 3T8QA 2EPHA 3AIVA 3G0UA 3CV7A 1TIWA 2NLIA 3CK5A 2YL8A 2CXEA 1ONRA 3RMJA 3R0KA 1NJJA 2PTZA 5U4NA 5IXEA 1EQCA 2PPGA 3B8IA 3TLLA 1GJUA 4NZ1A 3FEQA 1W1ZA 4Z0JA 3H23A 3MS8A 4ZBCA 1KB3A 3P2VA 3TDFA 3RIKA 2GGGA 4CCEA 4PUKA 1W3TA 2YFNA 4B2DD 4ICCX 3ZSSA 5IOBA 2FPTA 2Z24A 4JHZA 1OM0A 3BJFA 3ITXA 2PUZA 4DWDA 1UD4A 2PWFA 2DIKA 4GISA 5I78A 1F4AA 4HU0A 5IDZA 1SZFA 1OK4A 3SCOA 3WQPA 1M65A 1C9WA 3CWNA 2FHFA 4O53A 3A9IA 4FX6M 2VZTA 2DGAA 2O55A 2PP1A 1GG1A 2DJXA 2ZC1A 4N2YA 2B4GA 1NFBA 4FA3A 4O13A 4W93A 2OYMA 3T08A 1FCUA 2IKGA 2J88A 1O6IA 3HQOA 3VNIA 3NSXA 3R89A 1S5WA 2V2HA 5LGXA 2YA0A 1F3WA 1XC6A 1H51A 3ZLHA 4LALA 3FJNA 2F6KA 3Q67A 1LRTA 3V5FA 3NQFA 6A3HA 5GJMA 5BU6A 4RXGA 4U28A 1CXHA 1C7TA 3GHUA 2HK1A 4DEFA 3MVIA 3UZ5A 1UOKA 2QCMA 3QFWA 3T9PA 3GK0A 2BY1A 3SFWA 1UD3A 5HJXA 3UG4A 4N9BA 2BVYA 3RHGA 4DZ5A 1JCXA 3WK0A 5IM51 3L4VA 3PFRA 4WKAA 3EYPA 1PDZA 5C7HA 3VFLA 4PL1A 2R6OA 4IIBA 1LUCB 3OZOA 4PMYA 1XLMA 4PTVA 3RCYA 3SSZA 5FJIA 3M64A 2E3ZA 4F2UA 1KCZA 1LDCA 5KTLA 4O0KA 4HOZA 4M6QA 4QROA 1W54A 2J25A 1MW1A 3SCVA 3T4CA 1YDNA 2Z1VA 3DC8A 4ORMA 2FJKA 1IQ8A 5A6MA 3PJXA 3MWAA 5C9WA 1R3YA 2Z6IA 3PB0A 3KTCA 3ARSA 1G4PA 1YXCA 3RLGA 3THAA 2XFYA 2Y62A 2GK1B 1ITQA 2ZX5A 2PAJA 5AHIA 4N9CA 4DF2A 3N2CA 3S83A 2VVSA 3VNZA 3W6LA 4X22A 4BF7A 1CPUA 1M1BA 4O12A 4PR4A 3GNNA 4ZO8A 3R8GA 2H3DA 5I5RA 2XGZA 1GVFA 2XVNA 3EX3A 2Z29A 3PZTA 4NZ4A 4MB5A 3MZNA 1F8IA 3KOFA 4ERIA 7ODCA 2PDGA 4XAPA 3NPXA 2JKAA 3U2ZA 4MJZA 3MUY1 1P7TB 3W1NA 1NY1A 2VRKA 4OJYA 2DZVA 2QUMA 1UBSA 2BGNE 4OFCA 1SO5A 1A5CA 4QG8A 5REQA 2Z1XA 2OYKA 1E70M 4Q3MA 1JG9A 1O1HA 4P8VA 1RBLA 4HPGA 2VFHA 1C93A 4BKNA 4TQTA 1J0YA 2OGYA 1WYIA 4GXMA 3OBEA 1ZP3A 3OLGA 2OWCA 3DFSA 5DRCA 4LRTA 3MCMA 3BPWA 1R86A 3FOKA 2YCLB 4ZOCA 3W1MA 1JFHA 1X7IA 4PUMA 5BRPA 1DWHM 3MSGA 1SJCA 5C9RA 3STPA 4AWEA 4DB7A 2I1OA 3M5YA 2RDWA 2RAGA 4NRSA 3GFZA 5CCZA 1TIMA 5A69A 2A4AA 2WJDA 4L9YA 1CGWA 4K68A 1KXHA 1SFSA 4AW7A 2QDHA 3ITCA 3TN6A 1PEZA 1SO6A 1WNOA 1JYWA 1QVBA 3OO2A 1GJWA 4PTMA 2F2KA 3GXFA 3ATZA 1CENA 4INFA 3BDKA 5FCZA 3BG3A 3GUWA 5L9FA 4XWUA 1CX9A 2PWHA 4EWND 4S3KA 3KXQA 1B4EA 3MDWA 2XM2A 3KDNA 1B54A 1IT7A 4NVTA 2GJLA 1UR4A 2WC3A 2WNQA 2EPMX 4E8GA 3HMCA 4YHGA 5A95A 3EWDA 3WUFA 2YCEA 1S2CA 5FESA 1V4YA 3CAKA 4HGXA 3UPWA 2VUYA 3EX6A 1HUVA 2GDVA 5T26A 1MQRA 2E77A 3WLQA 4U3CA 2ESCA 3ITOA 4PODA 1GKQA 3GIYA 1E9LA 4REQB 3CUIA 3V3WA 3WQFA 3M41A 3UR5A 4AQLA 1RA0A 2GJXB 4H6RA 3FNDA 1X96A 1GOXA 4AZCB 3VD7A 3N29A 1IXQA 3NQGA 4AZBA 5MHBA 3L4XA 2O7QA 3STGA 2OWWA 3MWCA 3V0SA 4LYRA 1IYXA 1H1YA 2IKHA 4HZMA 3DU0A 3RF9A 3PPHA 3S9ZA 1TRDA 1O94A 4AYSA 3F5JA 3PR2A 1LLWA 1PWMA 1J11A 2IXUA 1HKJA 2BY3A 2O56A 3RR1A 1EJXC 1R3WA 1P6BA 3ANUA 5I3KA 1B3VA 5AYZA 5CGMA 4ZQMA 3WQDA 4IGSA 1OEPA 2WMIB 3DFYA 2PC8A 1E9IA 4RW5A 3ISIX 3QOKA 2Z2UA 1DJZA 4AD4A 4C6KA 2OB3A 2QKFA 3ZLFA 3CZLA 4IMAA 2OVLA 3HPXA 4X9SA 4Z1YA 4GO9A 2VURA 3WL1A 3GYCA 1YHTA 4IT1A 4N02A 3VGEA 2F38A 5CLWA 1UQYA 2PBGA 4YJ5A 2BY0A 3IIVA 3FY1A 3T09A 3NCOA 3HF3A 1IZCA 3WKZA 3CO8A 5C5YA 1OZQA 4LNYA 3RFAA 1SFLA 3E2VA 3HQNA 2WVUA 3KCLA 3WK2A 1UIPA 2ZC8A 3OLDA 3W84A 1K4GA 2FPYA 4M8UA 3SCTA 2V67A 4D1JA 4NZJA 5CSUA 3NYZA 4LAUA 4WXZA 3QHMA 1DHKA 1OZMA 1PX8A 2WW5A 1FWAC 2OLAA 1GWJA 4JTUA 3AWOA 4LS0A 1PZ0A 1HQTA 4FEZA 3NL3A 4B5WA 3BXWA 4UTJA 4UC5A 1OGGA 4PUWA 4KGLA 2V9DA 2QCGA 3BLOA 2G96A 3VMNA 3GDRA 2FMOA 1TPEA 2W79A 2IQDA 2QV4A 4LPCA 1CW2A 1TWDA 2G4JA 4B3KA