5BU6A

Structure of bpsb deaceylase domain from bordetella bronchiseptica
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
264
structure length
264
Chain Sequence
PDPDDGLTFRVLSMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNPISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLAAFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSAHLIRHHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVALTQIRRSLVDYEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BpsB (PgaB), Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetyl
publication title The Protein BpsB Is a Poly-beta-1,6-N-acetyl-d-glucosamine Deacetylase Required for Biofilm Formation in Bordetella bronchiseptica.
pubmed doi rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Hydrolase
total genus 78
structure length 264
sequence length 264
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.1.33: N-acetylglucosamine deacetylase.
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 5bu6A00
3S6OA 4HD5A 1V6TA 1W17A 4NY2A 3CL8A 4NZ4A 2XU2A 2Y8UA 3VUSA 3RXZA 1Z7AA 3QBUA 3HFTA 2C71A 4U10A 2IW0A 5JMUA 4F9JA 2C1IA 1XW8A 2QV5A 4NYUA 3CL7A 4NZ5A 4OUIA 2J13A 4M1BA 4NZ1A 3WX7A 2NLYA 4NYYA 2C1GA 2DFAA 4L1GA 1W1A1 2I5IA 4F9DA 2W3ZA 2CC0A 4NZ3A 4LY4A 2VYOA 2E67A 5BU6A 2C79A 1W1B1 3CL6A 4WCJA 1NY1A 4V33A
chains in the Genus database with same CATH superfamily
3L4UA 3EWZA 4QG6A 3GHUA 1X1ZA 4E5TA 3KOFA 1RAKA 4PMRA 2IKIA 3QLDA 4XSMA 3TSBA 2A4AA 3T1GA 3H53A 3IV3A 1V0NA 1WXZA 1R3VA 3L4TA 2QNEA 2XIOA 3TSMA 3WY1A 3W7DA 4AWTA 2V8ZA 1DJIA 3T07A 2XIMA 3DHFA 2NQ9A 1DJHA 1QDSA 1H2JA 1HXJA 3P62A 3BURA 4QS6A 4Z1CA 2XIBA 1LWHA 1RPXA 3GZAA 3URAA 1WKDA 4WJ8A 3NPXA 2GVJA 3BJTA 5DBTA 3AS0A 1MWOA 3AJ7A 1YBQB 1QO2A 3PPGA 1A5CA 1FH8A 2ZXQA 5C9RA 1M04A 3F4CA 1VBGA 3NZGA 3DUGA 1EKOA 4L1WA 3GR4A 3PUOA 1W3LA 2GSEA 1PKLA 3UZWA 3DEQA 3IARA 2C71A 1A5NC 2CLPA 1E71M 2BMBA 1JRBA 1W0MA 4FX7A 3SI9A 4RV8A 4BK9A 7TAAA 5K9CA 1XLGA 1AUSL 3W26A 2VYOA 1LT7A 1SYTA 5C71A 3GH4A 1T99A 2GJNA 2PTDA 1CXEA 2DV0A 3S9YA 3GXIA 4L6DA 3W7GA 5I3KA 4KWVA 4LS0A 4XBSA 1DWAM 3BGJA 3VGDA 3W7QA 2V3GA 2PEVA 2RDXA 5BOOA 1M7JA 2F2KA 4O10A 1BPLB 2W0UA 5AOUA 4MTVA 3Q2DA 3FA3A 3H21A 3MB9A 3MVIA 3GS6A 3O9NA 4R34A 1MRQA 1US2A 3ATZA 1JNDA 4GYKA 2PLMA 1XIMA 1AJZA 2YDAA 3VFCA 3FEQA 4QNWA 2D2HA 3IJLA 2PTWA 3BAKA 5I3FA 2VR5A 1NEYA 2PSNA 3W1UA 2PODA 4HJWA 2V9DA 4JR5A 1FXPA 2PDIA 3PBVA 3OBAA 4RKAA 3T8LA 3VOIA 4LB4A 2CBIA 1JCNA 5CZ0A 2PDKA 3PTDA 5XIAA 4KW2A 4UTIA 1GNXA 3WUBA 4DO5A 1ZP3A 1E73M 3AYTA 3CQKA 3T7VA 5JIPA 5C9UA 2BXYA 2D3NA 3XIMA 2EPMX 1F3EA 3DHDA 3CAQA 4NNAA 2Q8XA 2QF7A 4FX6M 2H8XA 3MV01 3M0LA 3PZIA 3ZVHB 2C19A 1I2PA 4GCXA 2E6YA 1GZJA 3ZT6A 4XD6A 1VFSA 3TCEA 3OLGA 5D9NA 2ZZ2A 3AJXA 1EC8A 1JRCA 3EOOA 4HSNA 2VHLA 3G0XA 3NL5A 2PDPA 3M0MA 1OZQA 3CT2A 4CQ9A 1GKPA 1B4KA 2D23A 3MUIA 1DP0A 2YBTA 2O9OA 4N42A 2IUZA 1Q13A 4QE1A 1S3HA 2RDUA 2V2HA 3INPA 1QAPA 1V6YA 4UCFA 1S3TC 2PDUA 3EXTA 2O7QA 1E40A 1MI3A 1Q66A 1EJRC 3ZS4A 4HA4A 4XX6A 1YEYA 1JCXA 3MANA 3N13A 5ABFB 1O5KA 4LUTB 4MZ8A 3BMVA 1XGDA 4D1JA 2J25A 2BY0A 1QI2A 5C9ZA 2ESCA 2OX4A 3Q58A 4PR4A 4HPGA 4EWND 3E0FA 5H8PA 2R6OA 2DZWA 1HG3A 5F2MA 1VFHA 1E0UA 3OVQA 3F5JA 3CZEA 3MJMA 2PDNA 4DJDC 2BY2A 1UWIA 3LK6A 3OZYA 5LNSA 4W8AA 2YW3A 2JKPA 3GYEA 1PHWA 1DORA 5HOSA 4EF9A 3KRBA 3VD3A 4A2SA 1LT8A 6PTDA 4ENLA 3BLFA 4XKMA 4BF7A 3H4XA 3T6CA 2NXIA 4RK8A 4I8YA 1CXFA 1X39A 3G77A 2ZOXA 3R12A 4LEFA 1RJQA 4Q4KA 2OFJA 2Z2UA 3EKLA 5D05A 1XIDA 4S3AA 5DT5A 3VKBA 4GPNA 2W27A 5AVNA 2GDVA 3LCGA 3W74A 5C7VA 3CWOX 4LF2A 5BOFA 3BLDA 3B04A 5FJPA 5EFDA 5LNRA 1FCQA 2VRQA 1US3A 4DBSA 1K77A 2D24A 2TPSA 3RR4A 4ZB0A 5EBUA 1JYNA 3IS4A 4NJGA 4Q7BA 1OD8A 4P7RA 3UYIA 2YCIX 2CLMA 5MKGB 1NF0A 1UR8A 2OYMA 4R9XA 4CNNA 4ZO6A 2PI6A 5CQ1A 3L21A 3GDRA 2WMIA 2DJXA 3WLLA 3WBXA 1FQ0A 4UNKA 3ZZ1A 4LY4A 1JGMA 1NQKA 3UEQA 4WDWA 3P84A 1U30A 4FI4A 3THAA 4H8NA 4QTGA 3UT0A 1RA5A 4NJKA 1Z7AA 4ZVJA 4U10A 3DXIA 3N04A 2YKKA 4O19A 1EGMA 3DI1A 1H0GA 3G1RA 3HTWA 3CUIA 7TIMA 4S23A 3T0AA 3CU2A 4FNUA 1SW7A 1M01A 3WSUA 1MEIA 3JU2A 2A6NA 2QGYA 4N7QA 1XC4A 1P0BA 3Q94A 2R8WA 3H7RA 4UTJA 2H90A 3BLIA 1VPXA 3IAPA 4IZGA 2Z1SA 2CWNA 4LNCA 3W38A 2WVSA 3ENLA 3ITVA 1Z41A 5I3IA 1VKFA 3GVVA 3W87A 1RSCA 2YCEA 5DN1A 4MB4A 3HJZA 2BODX 2X1RA 2NV1A 4Z2GA 1IWBA 4YTQA 1TX0A 1JULA 4AZ7A 1HJSA 3CT7A 1H7PA 1QU4A 3NQ8A 2V3EA 1XLEA 3W75A 3KL3A 5HDRA 4EE9A 4EP8C 4YTUA 1Q3NA 5LXEA 2HK1A 3S6DA 1J96A 3SCOA 3B0YA 1CXIA 2NVCA 1W3HA 3WQFA 4MB5A 3PJUA 2QDEA 1SO4A 4OU1A 1WQ5A 4RE4A 4UOQA 4LJ3A 3KDNA 1RY8A 4J3VA 3PNZA 3ZR5A 1JAKA 1B3WA 1EGVA 2Q3RA 3WN6A 4P8XA 1KXQA 3WLHA 2F6KA 4CLMA 3HPXA 4GZEA 4XTIA 3CZ8A 1V5XA 4IGHA 3MZNA 2Y8UA 1R47A 2CBJA 1TPC1 4MKNA 1Q6CA 3O0FA 4GZIA 1XRSA 1CZ1A 3EOUA 3VCCA 2REQA 4MNKA 1RBOB 3BG5A 1LQAA 4ILSA 1H7WA 2GJPA 1KM5A 5LHEA 2D3LA 1O95A 4BS0A 3JZUA 4X0NA 3SRKA 1RZMA 3P67A 2ZX9A 2YR1A 3CB8A 1SFJA 1KFEA 2CWXA 4JCLA 2GQ3A 4Z17A 3GLCA 5LKYA 5T9CE 2JALA 1FBAA 1KD0A 2JFEX 4UFHA 1UR4A 3C2RA 1C93A 4JFWA 4M82A 1VBHA 3WDJA 4HN4A 3TC6A 4W7VA 1P6WA 4F0HA 2FZNA 2ICSA 3IPWA 1EPVA 3V7PA 3V5CA 4LVDA 3JR2A 3H7UA 1WDSA 3ICJA 3EB2A 4HPNA 3KBMA 3C2FA 3CZKA 4LUYA 1AW5A 1W9BM 4F2BA 1E4IA 4HZ8A 4ZB2A 3WK2A 5FI8A 4IUGA 4X63A 4IFKB 2UZ9A 3L0NA 4LT9A 2J7FA 4JY8A 4P8VA 4PB4A 1NDZA 3BV4A 1BWLA 2ALRA 3BMWA 5K7JA 4K3ZA 2ZQ0A 1MXGA 3T0BA 2ZX8A 2R1KA 1G69A 1R3YA 3J7HA 3SDOA 1ELSA 1FKXA 4PSPA 3PFRA 3PZUA 3VD4A 1SR9A 3AZRA 3VMOA 1ME7A 3GE7A 5C2XA 3F03K 1VB9A 4MZ1A 4OBRA 4X9YA 1C9WA 3WG6A 3NQ2A 4AD5A 4KCTA 4IMGA 3KCLA 5A6AA 1XIHA 1MRAA 4J3ZA 4ZL1A 2X2GA 5E1QA 5FL1A 4QSFA 2QV4A 3MSYA 3RF9A 4FF7A 1TIMA 3OQEA 1WX0A 3LZ3A 1Z3NA 1TWIA 2E40A 2NT1A 3PULA 4MWAC 1AJ0A 2PFHA 1BWKA 3T08A 1TFVA 3QZAA 4PB5A 4WY0B 2VKZG 5I24A 4IJCA 3RHGA 4IHCA 5A95A 3V75A 2F61A 2ZE0A 3S5OA 3LDVA 3NL2A 3TWBA 2RGLA 3C0SA 4L64A 4PYSA 4Q22A 4UTUA 2EKGA 3UY7A 2VVSA 1A0DA 3DERA 4C91A 3ID7A 1E4NA 3OO2A 3P74A 1FRBA 3SUVA 3SN1A 1O1HA 1VH7A 1H7NA 1W2VA 2V68A 1XINA 5TIMA 1H1NA 1E5NA 1TQXA 3ARQA 1YMYA 4K8GA 3CPRA 3HA1A 3UA3A 4DWSB 5ECVA 5FA5A 1VYRA 3W1RA 3WNOA 3N4FA 4JXCA 3T0CA 1XYAA 3MCOA 3TC3A 1WKYA 1EF3A 2OLHA 2DUZA 2QCGA 4MMWA 3A6OA 1VJZA 1EWEA 2UY3A 2BG5A 2XVLA 1Q45A 4C5ZA 2NZLA 4NF7A 5A6BA 5CSSA 3BW2A 3C2YA 3S42A 4LVFA 4JTKA 3RLVA 1AH4A 1E6ZA 1U5JA 3LOTA 4HNVA 2PGEA 3TXZA 1X8FA 4HKPA 2W9MA 4NL1A 3M41A 4HJFA 1GVIA 4RPPA 1S5TA 4JDYA 1JL8A 4IG2B 4NZCA 4TTUA 3W9ZA 3MW7A 4FLOA 3PY2A 5CBJA 2XH2A 2INEA 4EANA 4ZOCA 1OB0A 1FY6A 4AZGA 3P80A 2O4QA 2JEPA 2Y24A 2DSVA 1VLWA 3KM8A 4ACZA 2J47A 4DUOA 1XW8A 2GVYA 2Y2WA 2HE5A 2XJ7A 3ORWA 1YPIA 4GE8A 3RPMA 5G2HA 4C1KA 1G4TA 3WBYA 3TEVA 4TU1A 1M7XA 1NTHA 3AIWA 2GPTA 3WLTA 3W7EA 4GGBA 1XLMA 3UJEA 1E3ZA 3CH0A 2HRWA 2Y89A 3NAVA 1K6AA 4OUEA 1H61A 4KRZA 1WDQA 1VPYA 1KV8A 3CH9A 3TNOA 3NUKA 5D4YA 4JYDA 3W2KA 3AIQA 3EA3A 3QSRA 2PS2A 2YXGA 2ZUSA 1SVDA 1LBMA 2NT0A 3LS9A 4NXSA 3TW9A 1H1YA 3OVPA 4CU6A 3UNDA 5JBEA 1H51A 1HJWA 4U5KA 3TN5A 4D8ZA 1LRTA 3IVTA 4GVIA 2XH7A 4BR1A 3LXBA 4ZOAA 3N73A 4KWUA 4AEOA 2ASHA 4X9SA 4BQ2A 4OZOA 2J6XA 3V0SA 5CZJA 3R4IA 4M81A 4KFPA 2VGFA 2QCEA 3UGVA 3OOQA 3JW7A 1B30A 2POZA 8XIMA 3F7JA 4ZODA 3VOCA 1GOIA 3FFSA 1CWYA 2CLKA 3GIYA 3MYOA 4H9UA 2DH2A 1EC9A 4MKVA 1XS2A 2I9EA 1F8IA 2YJQA 4AIEA 2QUMA 2X1UA 3BCDA 2WM0A 2XWDA 3AHZA 2FJKA 2YDSA 4WGXA 2VEKA 4IFRA 2ZZ4A 4FXSA 4NZFA 5G4WA 1FCBA 1CPUA 3KOXA 1PEZA 4GJ1A 3QOKA 5D2YA 3HPZA 1ZBWA 3VIGA 3BCFA 1BYAA 2ACSA 1B5TA 2V67A 3UERA 3L2MA 4MB3A 4XAYA 3BOFA 3KL5A 4O1FA 5CAKA 3KUMA 3DDMA 4UTWC 1LUCB 1TQJA 1FWAC 2YFOA 1WBHA 4DBWA 3OGVA 1S39A 1J01A 3ZJ6A 3QV6A 2PWUA 3FJLA 1GVQA 4UMAA 4H7VA 4MDPA 1M6JA 4IIHA 1G9HA 4C1LA 3FYYA 4IPJA 3R0UA 4A22A 1MYRA 2XIQA 2A3AA 1RCXB 1LROA 3DBPA 3R25A 4B90A 3RCMA 4AAJA 3W86A 1A3HA 1XYCA 2XN2A 3TR2A 2P8BA 4TTGA 1GTHA 5AHEA 1E4MM 4H9XA 3W71A 4GUFA 1YNPA 1SO6A 2C18A 3NEHA 3TP4A 4E2VA 4WDXA 4XZHA 3L4VA 5DFAA 1GHSA 4BWLC 5DO8A 5D2XA 5AN7A 3RLHA 2WPGA 1ZY9A 3N6HA 2BV9A 1LG2A 1E15A 4HT3A 2CBVA 3UWVA 1IGWA 1HW6A 1UKPA 3NYDA 5BMXA 3W1MA 1UQYA 3ITTA 1SJBA 1XM3A 2FDSA 3M43A 3RG6A 3FEMA 4PL1A 4M6QA 1VIWA 1G01A 5REQA 1XDJA 3KBNA 3S2JA 3SGUA 2HZGA 4V15A 4IQJA 2E28A 2WNWA 4BHYA 2C16A 1REQA 3B8UA 3EOSA 3OU8A 2VVNA 4P8UA 3H2OA 1G7UA 2E5DA 1CIUA 8CGTA 1O5XA 2C1GA 3VMNA 5GNXA 4XD5A 1X6NA 1Q2RA 2V82A 4IH3A 3WO8A 4YTRA 1VFOA 3MO7A 3C5QA 1JZ7A 3WQCA 3DFYA 1IXNA 1EHNA 3R43A 4Q32A 1UR9A 3NDZA 2RDWA 4LS2A 1CDGA 4OV9A 1RP8A 1KR0A 3GNXA 3G3DA 4A2RA 1E6QM 3PK7A 2GVLA 1TV8A 1EHAA 3VXGA 1TWDA 1V02E 1DJQA 1GW9A 3GH7A 4DJEA 1HL8A 4AY1A 2J7GA 1KBJA 3BE7A 1T6MA 2PF8A 2E6FA 3LPPA 2A3BA 3PTQA 1WKFA 2CEQA 3QY7A 1VEOA 1P43A 4UQDA 4B4FA 4LY8A 3N17A 1MQPA 2J27A 4V27A 4U4MA 4DWSD 4KKXA 2AL1A 1RUSA 2Q02A 3E38A 3QN3A 4FB7A 1RVKA 3K1DA 2WOQA 5FL0A 3NM3A 2VELA 3KZSA 4OOUA 4AH7A 3UPMA 3WMBA 3L7RA 3TLQA 3MP3A 3IUIA 1SZGA 1UOKA 4S3BA 4HPHA 1GG0A 3BAWA 1CTNA 2J7CA 3H2EA 1C92A 1V93A 1BG4A 4JEJA 2HJPA 4JIEA 5AFDA 3W7LA 3WJWA 3GXFA 1KFCA 1EIXA 4IX0A 3MBDA 5IBXC 1KBKA 5CPSA 2G4FA 2O9PA 3S6OA 4HYVA 5DXYA 5CPQA 4CU8A 4J1OA 2REQB 2YB4A 3ZJ7A 1H60A 2VDHA 3FVMA 2DFAA 1V08A 3FSUA 1J18A 4GQBA 4QAWA 1VFTA 1JDFA 1CEOA 1KFWA 2ZC1A 1ZRQA 1E1CA 4DYKA 1JIBA 3TYDA 1KKOA 3RYSA 2ZRYA 4AIOA 2QGHA 1TZZA 3LXAA 2XDFA 1QWGA 3GX9A 4LVBA 1VYPX 2QCDA 3GM8A 1DWJM 4IQLA 1XYFA 3NQVA 4HVXA 4Q8PA 3LRMA 4YIWA 3K13A 3AICA 3PBUA 1E51A 2C8NA 2GJXA 1BXBA 3CV1A 4BI7A 2DZAA 4F9DA 3FJ4A 5G2WA 3STPA 3QMRA 3ZSSA 4XV0A 1SMAA 1N7KA 4B16A 5A94A 4QJ5B 5E5CA 1OADA 3IIZA 4YVPA 4H9ZA 3DAQA 3G1HA 3AIUA 3GHSA 4O1CA 4QLLA 3E2SA 1KW1A 2CESA 5CCZA 4LUIA 1XIFA 2FQIA 3LRKA 2X7WA 4DBDA 4XISA 4QGCA 2YX0A 2VOMA 3VIHA 3I3DA 5ABTA 3K1GA 1F6PA 4LAZA 1Y5WA 6REQB 5G2IA 1W91A 2O4MA 2E5CA 2FZ9A 1IHIA 5A8NA 4M5PA 3U2EA 3IANA 3SURA 5EBAA 4DBUA 5I3JA 1U5VA 3WNMA 2IPJA 3A4WA 5D2WA 4GQQA 5ABGA 3CV7A 4D72A 5BU9A 2QQ6A 3P82A 3CMJA 1KBBA 2V2DA 1F07A 3OTRA 2D2JA 3OP2A 3WJYA 2HV5A 1YLVA 2ZRWA 3CASA 2HCVA 1V0LA 3NGFA 5A8QA 5AC4A 2VD9A 2ZFAA 1GORA 2QW5A 1R3RA 1DKWA 1OT2A 5E09A 3CV6A 1XLHA 3NWRA 1UWSA 1P0NA 1XLIA 3P5YA 2CHNA 3U9IA 3OZOA 4DY1A 3OVRA 4PCPA 2ADAA 3UBPC 4ZA0A 4M3PA 3CL6A 3F2BA 1KLYA 3SM0A 3P3BA 4GI9A 3NG3A 2VC6A 5GQBA 4C7FA 2ZZ1A 3LTYA 3D3AA 1OINA 1KM2A 1YXDA 3UGRA 2OX1A 1ZS2A 5HJLA 3MA8A 1KV5A 2ABBA 3NQMA 3E0WA 4LYPA 2OLSA 3TJLA 3A5VA 1LCOA 2XINA 2FPTA 3TMLA 2QUUA 1J12A 4DLMA 1W1A1 3ME3A 3WLOA 2BOFX 4Y8EA 2NVDA 3CTLA 2IS7A 3S5ZA 4V1XA 3AHTA 5AHMA 1U22A 4IL0A 3I3EA 4XIAA 1FWEC 5EB8A 3EB4A 4HTYA 4ZR8A 2E9LA 4LGXA 4J9JA 3C2EA 4GQRA 1KCKA 1QO5A 4ALDA 1Q6RA 4PN2A 3VNDA 1K4HA 4YXGA 4O15A 5FEPA 4NY2A 4PODA 3WQVA 1HP4A 5I03A 1ITUA 4UXDA 3SQLA 4LEQA 5KSWA 1VC4A 4DJDA 4GNVA 5DRCA 1MW2A 1S46A 2OEJA 4AX6A 4NZ3A 3U0HA 2ATSA 1FWIC 4JNYA 3ARWA 4IIBA 3NO1A 4YHEA 3VTRA 4U3AA 3ECQA 3KTSA 3B05A 5DCDA 3QYQA 5JUVA 1KBIA 2J4GA 3COTA 2VP8A 5FACA 4XZIA 5I2UA 3VM7A 1WAWA 4GVGA 8RUCA 4DUWA 3MHUA 4WZHA 1ZTVA 5LGXA 4RZBA 3CUHA 4E2OA 2RFGA 3NZRA 1ECQA 3U57A 2P3EA 2WHLA 2OT0A 3GU2A 3RU8X 5CEWA 5AHFA 3WQPA 1PJ9A 1OGSA 3PTKA 4LBSA 3IACA 2HDJA 3QEZA 1D2KA 4PMQA 3SCWA 3NGJA 4LALA 3BVJA 4DRSA 3THDA 4AZ5A 5GNZA 2FHFA 3PZTA 2WM1A 4FNRA 4MUPA 4Y96A 4HP5A 2WNNA 4K36A 3OODA 2VEIA 4B5XA 3LM7A 5CJ5A 2YIHA 4BJHA 2BNJA 1LP6A 2NUYA 3QSTA 4UR9A 3NXFA 4TQTA 3GDTA 3B0PA 2OXNA 3TQPA 1DXEA 1HL9A 2DZPA 2WKLA 3VDCA 2J66A 5A8OA 5D9MA 5FF3A 5CC5A 1EJTC 4JTTA 4AWUA 4QEHA 3TAOA 2ZA2A 3T44A 1NELA 2NXHA 4RNHA 4TVCA 3WQ6A 1UR1A 5GPRA 3DHPA 2EPKX 4DVOA 1E5JA 4M1BA 2HSAA 4UFMA 5AHLA 1EC7A 1ICPA 3T78A 2E68A 3B8TA 3V0UA 3WLQA 4JL1A 5BU6A 2UY5A 2W91A 3VNKA 2JGQA 5BXSA 3UCDA 1Q65A 3W37A 4N0RA 3L4WA 3MMTA 1VLIA 1FFRA 3IVUA 1GYNA 1V7YA 4HHMA 4RZ6A 2I16A 2XN1A 3BZGA 2Z00A 4HD5A 3OQ8A 5EU9A 3NOYA 3PBYA 4S38A 4JNZA 2DZVA 2WCGA 4DJFD 1YYAA 5EYWA 5H8MA 1PCWA 3CB3A 3WF1A 4GZ7A 5FF4A 1X97A 5FOOA 4O0QA 3DOPA 3BZJA 3FAWA 4GXPA 1J9YA 1CXKA 3TTYA 1UH3A 3B97A 4MM1A 4F8XA 4INFA 1XH0A 3WD0A 1VRDA 3M44A 2A2IA 1UYQA 3F2CA 4AD2A 2PDQA 1QOPA 4ZQRA 2X09A 2HE8A 4TMBA 3RM9A 5DT7A 4OHQA 2JEQA 1TRIA 3FW6A 2I14A 4QITA 1XG3A 1J93A 2W79A 2P3ZA 3TZFA 2EGZA 5D04C 1H0IA 1CX9A 4V2XA 2ZUMA 2FJUB 4JEQA 2J8TA 1B9BA 1JCYA 5HNNA 2G4JA 1XC6A 4NNCA 2VMFA 5I06A 2VM8A 2BVTA 2ZUWA 1W5MA 3CL8A 4ICNA 1DTUA 3N9SA 3QFEA 4LAUA 3VKKA 2J74A 1XF0A 1XLJA 2GQ8A 3F4DA 1W9VA 5G1YA 3TJIA 1IZKA 2DIJA 3IJ6A 4UMCA 3PB0A 4NIRA 4YMZA 2PE4A 1T7LA 4PL2A 3TR9A 4M8UA 4A8NA 4LVAA 3KRSA 4OBTA 5EA9A 3UVAA 2FZ8A 1OF6A 4WJEA 4H01A 2PP0A 4XSLA 4E8CA 3WQWA 3SADA 3HBLA 2R94A 3CUXA 2J75A 2PGFA 4BFAA 3NQ6A 1O66A 4IIEA 3H12A 1JI2A 1TTJA 3IJIA 2G3FA 3LTPA 4CNUA 4JTUA 2J62A 2XHYA 3PR2A 2CKSA 3ONCA 4DO6A 2FYMA 1KWGA 1UH4A 4ZSUA 3HZ3A 3VGFA 4XZNX 3RDKA 2ZA3A 4CKQA 3W6LA 1KCXA 4DM1A 2XPKA 4JQ1A 2OEKA 3E0IA 1M1BA 3JUGA 2DVUA 3KVLA 4DLFA 1NM9A 4I7VA 4D6GA 4YCOA 1HVXA 3M5XA 4S3CA 4ZZ9A 3W2JA 1T5AA 1LM1A 2DZTA 5K9XA 3RX3A 4PCNA 3GNRA 3MZ2A 2YZ5A 1XPGA 2BXZA 4O13A 4KQNA 3PF3A 1LL7A 3LPGA 3MT1A 3R5EA 3HPFA 2X1IA 4PUJA 2QJIA 3DH7A 1U33A 1O7AA 2B0MA 4RLIA 2ZUUA 1UR2A 2FHBA 1HT6A 1IR2A 4JQ4A 3DYOA 4AZHA 1Z8AA 3NZ1A 5CAHA 1XICA 2W63A 3BG9A 4HHHA 5G1TA 1JCJA 2YL8A 4H8UA 2FIQA 4ECLA 2L5HA 2XFWA 3AI0A 3M0HA 4G2DA 4D6EA 5LIWX 3B40A 1TCDA 1XKJA 3M0XA 2G8ZA 4QG9A 2CNCA 3UP8A 1FKWA 4KH2A 2E67A 4Y9MA 4Q8QA 4JTQA 3V18A 3I68A 4Q8VA 2ZTJA 3GR8A 5KINA 5DBUA 4WXYA 2QCHA 2NXGA 1UWAA 2A85A 2GJXB 3S4TA 2FVLA 2GGJA 1TA3B 4IISA 4ADSA 2OYLA 3SUUA 5HR7A 4DF1A 3RILA 3A24A 3FNDA 2QCMA 3AHYA 2Y5JA 5H91A 4CQAA 3WQ8A 3MSDA 3C0LA 1CECA 1OCBA 5FKYA 4AZCA 4NKCA 1ZBCA 4PMJA 2FZMA 1M7OA 1Y8BA 1C8YA 2Z6JA 1JCMP 1B3VA 3MQTA 4RCXA 3P2VA 3VDAA 2QLYA 1RBAA 3P6LA 4Z0JA 3R79A 4JTIA 1XBYA 3EEGA 4C90A 5EMMA 4NAEA 4PCSA 3K2GA 5CSRA 1TX2A 4HK5A 3LHZA 1V3JA 1JD7A 1Q7QA 1JYVA 2X41A 3UCQA 4UNLA 5IRPA 3UR8A 3IVSA 1DJWA 3VM5A 3KP0A 4LF1A 2OSXA 4PH6A 1NDYA 3URNA 4IMAA 1P48A 4XD3A 2QYGA 1Z6KA 4GD0A 1AW1A 3C0JA 1E70M 2OZ3A 5CC3A 4G1NA 5AYBA 4F2TA 2QVNA 2VX5A 4OOZA 4N6FA 4J28A 4ICMA 2BHZA 2EHHA 3D6NA 4KESA 3WLSA 4AHPA 1Q6OA 4H04A 5D09A 3MWAA 2Z26A 4IMDA 5IHSA 4GX8A 5K9DA 5DMMA 2JKAA 1IZCA 3W7OA 2AL2B 1F4HA 1YQ2A 2XVGA 2ZIDA 1OCJA 3UG5A 1QATA 3FHQA 4HMNA 1BSIA 1CGUA 3HO8A 5CGQA 4XQ6A 5FJTA 1JPKA 2FTWA 3A3HA 1A0CA 5HNRA 2P0OA 1QXLA 7REQA 2P53A 1EIBA 1T8XA 1GPFA 2BLEA 1F61A 1ADSA 3PZGA 1QNSA 4HU3A 4MYAA 3ARSA 2J9ZA 1FDZA 1KFBA 5KEZA 3L12A 3FJ6A 4UTTA 4S3DA 3CJPA 3VCRA 2P76A 2DQXA 3USZA 4NXKA 3RX2A 4LANA 2PGRA 4J3TA 3QH2A 2HK0A 1I0BA 5M5DA 1F76A 1BAGA 3TOPA 1GKRA 4PBEA 5J04A 3UZYA 1CENA 1BTMA 3O07A 3M7WA 3LYEA 3VKJA 2C14A 1J11A 1NH6A 4MY1A 4FEZA 4EPDC 2HTMA 5C0QA 1GQIA 3BO9A 3PAJA 3UXAA 4DJED 1MXSA 4F4RA 3Q67A 3G8RA 1UC4A 4IL2A 3WNKA 4ROQA 4M6VA 4JTSA 2HISA 4WSKA 4U28A 2Z7GA 1UWUA 1LRNA 3FCPA 1KFLA 4CCCA 4A3RA 1L0PA 4LFYA 4DWDA 1X98A 3RR1A 4KEMA 4S39A 4H2CA 3R94A 1HN1A 8TIMA 4DNHA 2Q09A 1V3KA 4J40A 2ZXDA 4BQ3A 1KM4A 3W1NA 3R1ZA 4BWLA 3NDOA 4NHVA 3QC0A 4NNBA 3M7SA 2V30A 2VUYA 1R7AA 1EP2A 1VFLA 1QASA 1OSEA 2WAGA 2UWFA 3WDIA 3M9YA 5D9OA 4LCQA 2PP3A 3FOKA 4PCFA 1E56A 1QNVA 1XLCA 5C5YA 5C8BB 4UZUA 3VC5A 4GA8A 3PAOA 4PTNA 5F1UA 4B15A 4NI8A 1QHPA 4MPQA 1ESWA 3OVGA 3SUWA 3FKKA 3LENA 4NSBA 4H7CA 3GQYA 3PNUA 5CPMA 3QQ1A 4I5XA 4H2HA 1XGZA 1ZALA 1B57A 3ARRA 2VCCA 4YYCA 4EAYA 5FEZA 3NOEA 1RP9A 1L6FA 1ZSXA 1K9EA 1U5HA 1SFSA 3OBKA 3KE0A 3AXXA 1KBLA 3U3HA 1IEIA 3SY8A 4A8RA 3D5HA 4Z2LA 4WUIA 1UKOA 4PTWA 5DANA 3N12A 1GVRA 3MV11 3S5NA 4QDWA 1P1MA 4D8AA 1AL7A 3LZ5A 4QG8A 1RQEA 3LBCA 4MGGA 4Q8UA 1KKRA 1H41A 5HPCA 1W31A 1UASA 1DHKA 1D3HA 4NZ5A 1L6YA 1ZB5A 4REQA 1VCFA 5IHRA 3S47A 1H49A 1IEQA 1EYWA 1UB3A 3SO7A 2PC4A 1NARA 1UW9A 2POTA 2WMKA 4JGDA 1KM0A 2PGWA 5BRQA 2OQYA 4LRTA 4Q4SA 2J13A 1MDRA 4I5RA 2Y62A 4PUNA 2E9BA 5HANA 1ISVA 3B0XA 1T40A 4QNEA 3FK4A 2FHCA 4C6BA 2VCAA 4HHLA 1EFZA 4LVGA 3UZ5A 2VENA 2PDCA 1A5KC 3OBEA 3WENA 3CTTA 2WSYA 3L65A 3H70A 5HXMA 3MUY1 1ZENA 2G95A 5T91A 9CGTA 1SJDA 4GI4A 4ERAA 4K7YA 2CC0A 6TIMA 2OELA 5HK4A 4PMXA 2Y7DA 3KOWA 3QMSA 4CQCA 1H50A 3TTQA 2GOKA 2FVKA 3EX4A 2C13A 2ZZ3A 4KEZA 4KGLA 2WZEA 4CGTA 4DEFA 5M17A 4AD0A 4JIHA 1EQPA 4O11A 1WOAA 1JZ5A 4PUUA 3VVGA 4LBUA 2IPFA 3GO2A 3CHDA 1AQMA 1K03A 1WZMA 3H23A 1R0MA 1V02A 1TREA 3PWAA 4JS3A 1SFLA 2XSBA 1J6PA 1NDWA 1MSSA 2I5QA 2VOTA 4P5UA 3CEPA 3K4DA 5LIXX 1OABA 3PB2A 4MY8A 4DPQA 2CYGA 4UOJA 1S1RA 4CCDA 1AQ0A 1OVDA 1TELA 3TWAA 1IV8A 2H9AA 3GVQA 3SFKA 2HVNA 3R11A 2VQTA 3KW3A 4OV4A 1TJRA 1R2RA 3TQVA 3NSXA 6CGTA 2GQ9A 3W84A 1E55A 1MNSA 4H6RA 1VRXA 5IM51 1EEXA 2Z1BA 3A4AA 1K6WA 5KMYA 4DI9A 3S2NA 4G7FA 4HK6A 1QI5A 7ODCA 3R89A 4A21A 2ISVA 2QJJA 3TDFA 4B2DA 2QDGA 4HCDA 3HG3A 2FDMA 4N9DA 6XIMA 2YDRA 3A5FA 4FPSA 3II1A 4R3UA 3CAWA 3LSCA 1GOQA 1V3HA 3UNTA 3IGUA 5DX7A 1RQHA 4XZWA 1EDGA 1XKYA 3P7YA 3PN8A 4DJDD 4GQ0A 1J0IA 2BWGA 3PZNA 4K6AA 4MWAB 1HKMA 4FXFA 2OKOA 3ARPA 3P8JA 4WHBA 4RXGA 4B5SA 3U2OA 4JZ5A 2CKRA 2J7DA 1G6CA 3KVMA 4GUHA 4X2RA 4FOJA 4XBKA 1XUZA 1TUXA 1J0HA 4PRWA 5LA1A 4OT7A 4MOZA 1V6TA 1K7XA 1DVJA 2D1ZA 1KRMA 1ML1A 3W7KA 4HSHA 3EKZA 3ABXA 1IWAA 3VIKA 1JZ4A 2WZIA 3SGGA 3HG2A 1B3ZA 1LBFA 4IUOA 3WF0A 1FWJC 3KWSA 2WWDA 2OTDA 2CCRA 4ZFMA 2CZVA 4HMEA 4IMEA 2DT3A 3PUGA 3CIXA 3BCJA 4C6JA 4JQAA 4OE7A 3WNPA 1DWIM 1GPWA 3KOYA 5HJXA 1M9HA 3VZXA 4HNTA 3CQ0A 3MUAA 1UIOA 4F66A 1PDZA 3SN4A 3CK5A 2WC3A 4C1NB 2WZTA 4AD4A 1WV2A 4O8AA 5F4XA 4D6CA 4LS1A 3TW7A 4WDUA 2NUWA 3O06A 2SFPA 4E4PA 1B3OA 4NAEB 3VD5A 2ABAA 3H7VA 1W1YA 4H8VA 2A21A 3ZOAA 4E4FA 1EJWC 3EDDA 1GHRA 3WUEA 1A50A 4JBRA 3LU2A 1VBJA 3ZYZA 3IIXA 1YXYA 2PWEA 1W1PA 3TAKA 1CGXA 3H24A 3AS2A 1C9DA 2RHGA 4UCGA 1C29A 1JPHA 5DF0A 2HPMA 5FEWA 4L4PA 4ATDA 2PBGA 3W1PA 1UJPA 3ZO9A 5LNUA 4Z2HA 5C7HA 3PPHA 4BA0A 4TX9A 4XZ9A 3THQA 4RE2A 4E2BA 4GIAA 1YDNA 1PIFA 3M64A 1X7IA 1OT1A 3QXBA 3H2AA 2C0HA 4G8TA 3GHTA 3MKKA 1O6IA 3WMLA 1RALA 3GTHA 1IT0A 4EPEC 1Y5VA 2ACRA 3QJAA 1FOBA 2PB1A 5FCZA 1F3XA 4F2UA 1TE6A 1PIIA 2C91A 2AOSA 2AGKA 2EQDA 3BANA 3WDQA 4W5ZA 3GVRA 2CLLA 4F79A 2WQDA 1LJYA 1H4PA 2UY2A 1FWCC 1V03A 4FNSA 4A05A 4DPPA 1V6XA 4J7RA 1PTDA 4Q8WA 3WK3A 3CBWA 3MMDA 3PM6A 5DLCA 7REQB 2WPBA 3NQDA 5FJIA 4L6HA 1W5PA 1UQZA 4I90A 2PCQA 2I1OA 2OMAA 3UY8A 1FHDA 4O52A 3MSRA 3N2BA 1E9LA 3T9PA 1UD4A 4GWEA 1B2YA 4IGSA 4IXHA 1TWWA 1OX4A 2QULA 3S2CA 1MZHA 1ODUA 3AMKA 4RDZA 5D02A 3L5AA 2CHRA 5K2ZA 3WFAA 3R0DA 4C6NA 1ZUAX 3GD6A 4EXBA 4M56A 2YPIA 3CUFA 1N82A 3FDKA 1X96A 2GWGA 3KCJA 4H9YA 1BYCA 3MS8A 1TPWA 3M0ZA 3NQ7A 3VNMA 3V5FA 3SIMA 3DESA 3I6EA 3R7MA 4AEEA 4GKTA 1DJZA 4I9AA 4E3VA 5A8MA 2PTZA 1OYBA 1V51A 3ATYA 3KX6A 2Z1WA 4QEEA 3QVQA 4FAMA 3FS2A 3E74A 5F2GA 2J79A 1BRLA 3NPWA 1LDCA 4NI3A 3NPVA 2Y8KA 3N2TA 1AFSA 2PD9A 5LSMA 2P1FA 4MJMA 1GOXA 2XFYA 2X0HA 3MJYA 4ZOBA 2Y1HA 4GABA 3W4RA 3TE9A 4D2JA 2ISSA 4PMVA 2GGEA 4OJYA 4D6IA 4AC7C 2FLIA 4KWSA 4M29A 4TXEA 2ZBTA 5XIMA 3HMCA 1V79A 3H2MA 3EKGA 1TWZA 4Y6GA 4AVOA 7CGTA 1GJPA 1JVNA 3AIVA 4E0CA 4XVEA 3UWEA 3SIZA 3NIYA 1L8NA 3ABRA 1JDAA 2IKGA 4Y90A 1UD6A 3UXLA 1XH2A 4WRHA 2PUZA 1IWPA 1QHZA 4IF2A 2F8QA 4LV9A 4IP4A 5C54A 4JQ3A 3P60A 4IPPA 4BCEA 4ZE4A 4MVAA 3LMYA 1MW0A 3CS2A 1OGGA 4HZMA 1ZL1A 2BGNE 1RJRA 3HG5A 1KFKA 3P14A 3VIMA 1D8CA 1R86A 1AL8A 1WKEA 1HNYA 2GUBA 1EP1A 4NASA 1FWBC 4PMNA 1R5YA 4MWAD 3QR0A 1L2UA 2PPGA 1G7VA 5CG7A 1CGTA 1L9WA 2I5IA 1L2QA 3C2OA 3ITYA 1NFGA 4OIFA 2QIIA 1GQNA 3GC4A 1BYDA 4MLJA 3V35A 1J2BA 2RDTA 6ENLA 2E77A 4PC8A 4DYJA 1ITQA 4D6JA 4A6GA 3NSMA 3FGCB 1PHQA 8XIAA 4W5UA 1UMYA 3N18A 4R53A 5GJNA 3HG4A 5HA7A 1W5NA 3S83A 1JZ8A 1GK8A 1EZWA 4REQB 1E72M 2GQAA 5U7SA 2J88A 3CUJA 5H8UA 3V5OA 4PMYA 3TROA 3GU1A 1XBZA 1GJWA 4J3XA 3AIRA 5AVHA 3QGKC 1CCWB 5BRPA 1C91A 3SUTA 4CD6A 3D46A 1X1OA 3CMGA 4RDYA 4P7QA 5I23A 3GTNA 4YYFA 3VNYA 2ZCGA 1EJXC 3EOEA 4LSBA 4DZIA 4XZMX 5A6LA 4IWWA 4NRSA 1LOSA 2WK2A 1E4LA 2QJMA 1Z32X 3BTNA 4H3DA 1CBGA 1BQGA 4WOQA 2H3DA 4JPGA 4DAFA 1DEDA 3EOLA 4NU7A 2QCFA 3GDMA 4YU1A 3TMQA 1C3FA 1A3XA 1QPNA 4MDOA 3B9AA 2GDUA 5C9WA 5IDIA 3EMCA 3DYPA 3AXIA 3S1GA 2INZA 3WIJA 1M41A 1EB3A 4PULA 2W92A 3LBOA 4MFEA 1J5SA 4ML9A 2XSAA 4U5IA 5TF0A 5T8GA 4MLRA 3R8GA 4AU0A 1TTPA 4B5NA 2X1TA 1A4LA 2A7RA 1MZRA 4HU8A 4F40A 1R9ZA 5KZDA 5A6TC 1U2YA 3WNLA 1FH9A 3A9BA 1T96A 3W23A 3L0KA 3LI0A 3A47A 1GZGA 4IFOA 3DFPA 3PTMA 4FR6A 3EB3A 4FF5A 5IXEA 1EJUC 2E8ZA 3CWNA 4A29A 1LQ2A 5I79A 3FA5A 2PF0A 4W8LA 5LNVA 1Y7VA 1FDJA 2HNHA 1GW1A 3U6WA 5U4NA 4UOZA 1W8GA 3FXGA 3CLMA 2EJAA 1W8SA 5CH9A 4DBEA 1FWTA 5B7YA 1IEXA 2ZX7A 4MHBA 4ICCX 1QI0A 4AWSA 4AD3A 1LORA 1PX8A 4BF5A 3G5EA 4AYGA 5AZ0A 3BC9A 1US0A 2V81A 2QAPA 3LD5A 1KXVA 1JQVA 1GQJA 2DVTA 2YBVA 4QM1A 9RUBA 3E0VA 2VXNA 3CXOA 3VILA 2E9MA 1EX1A 3TJXA 1MMFA 1IEVA 3BW3A 1HJUA 3OG2A 1OFPA 3KLLA 2E5BA 3S1WA 3EWWA 1VFUA 1I1XA 3BSHA 4Q8NA 4ZQPA 3WH9A 1IXQA 2ZWZA 3LCHA 3W29A 5FJJA 1XBXA 2OG9A 3NL3A 4RW5A 1Y65A 1BHGA 4GI6A 1PE1A 4F3HA 1XQLA 2VWTA 3AHVA 3GFZA 5DMNA 3WJXA 3NZQA 2PLKA 4YCPA 4Q33A 2HBXA 4XVDA 3FSTA 3IGXA 1W3KA 4KCWA 4NZJA 4QJ4B 5A2CA 3KTCA 3T42A 3L9CA 5IDZA 5AYIA 3QTPA 4IQDA 2Z6IA 3W70A 4W7UA 2XZ9A 4JHMA 3TW6A 3WMSA 1ME8A 2WNQA 2EJ1A 2UBPC 3S9ZA 4H7ZA 2Q8LA 1VQTA 5JH2A 2XFRA 4GKLA 3QGVA 4YLWA 4RL3A 1FUYA 4ZB5A 1QHOA 7A3HA 5C2CA 5F4SA 4X3ZA 3WLMA 3P81A 2VT0A 1DQUA 2BY3A 2ZYFA 3GSMA 3W22A 1W3IA 3GG7A 4FNQA 1R3WA 2IQTA 1XLKA 3N2MA 4N02A 3K8KA 2CZEA 1QCWA 1WUFA 3T0TA 3EXSA 2Z25A 3MUZ1 3UZJA 3ZMRA 1W6TA 1I2OA 4WR3A 3C86A 1ZJAA 2XGZA 2XG9A 3GKAA 1ZHAA 2ISWA 3WMCA 1Z89A 1A3WA 1KM3A 4L4MA 1JZ3A 5I3HA 4HZ7A 5LHFA 4E3TA 2NLIA 5E6ZA 2Y85A 1XLAA 2OODA 3WUFA 1W9PA 3W7MA 4G5DA 3T2PA 4R9OA 1UIPA 2D73A 3GH5A 2PRLA 2Z27A 2VC7A 1MW3A 4KWOA 4OECA 5CPOA 1EO7A 1VCGA 1JFXA 3EEZA 5E70A 1L6GA 3VNZA 1V8EA 4PB3A 5EFFA 4DAIA 3U8GA 4NZ1A 4DELA 3G6MA 2ATMA 1G4PA 4JYEA 2BHUA 2F6UA 1QPOA 2DW7A 3SW6A 5BXPA 3PVFA 3TYBA 4C65A 1NY1A 2OZTA 4BF9A 4KIEA 3H4GA 3DECA 1K7EA 5AC6A 1LTDA 4IMFA 3STEA 4AYSA 4Z2JA 2Z29A 1TPFA 4M6UA 2PD5A 4RR4A 4FK9A 1ZU8A 4KCUA 1J0YA 2GK1A 1UWTA 1XCXA 3RMEA 1GVOA 5HUPA 3UXIA 1O4UA 1KO0A 4C60A 5I09A 3W76A 4DM2A 3VGEA 3EPMA 5JBFA 4QROA 3VA8A 5L9FA 1OX4B 3DC8A 1TG7A 4ZCWA 2NLYA 1TWSA 3VUPA 1EQCA 1ECEA 3VX1A 3EYPA 1TSIA 3W7RA 1NU5A 2BS9A 4W8BA 3ZM8A 1TTIA 3HOJA 3RO6A 3VPLA 3NA8A 3QV8A 1XPYA 2BSLA 1LYXA 2V2CA 1W32A 1UROA 3KWXA 1Q7MA 2A7NA 2F38A 2OSYA 1WOBA 4OKDA 4FALA 4O17A 2BX7A 2OOFA 3G3MA 3BLKA 2G41A 3MBFA 3ZT5A 1LOQA 1N8WA 4ZO7A 4OQVA 3IK2A 4LUJA 1EJVC 1PYFA 1W1B1 4P8WA 3SZ8A 1KNWA 2WZHA 4H9VA 1OG0A 1QNRA 3VX0A 2ZRVA 4CEUC 4HYRA 2DSUA 5JH1A 1HP5A 2VL4A 3AROA 2RGMA 4JL2A 1ODZA 3K8MA 2TRSA 4W4QA 4UFIA 5D2VA 2EO7A 3DFQA 1SSDA 1HKKA 2VGBA 4GC3A 5B7ZA 3W0KA 1RVGA 3MKCA 2FB2A 4OFCA 3DC0A 2WMFA 1F3WA 2J6VA 3NVDA 4E8DA 2PURA 3MY9A 1NOUA 1MFUA 2ACUA 3GB6A 1SW0A 2Y8VA 4D6DA 4MUZA 1XJBA 1YBQA 4BEUA 3T0DA 2H6RA 1PZ1A 1QTWA 5TNVA 3VKDA 2QMKA 1R3QA 3GG0A 3TYUA 1JPIA 2VURA 3I6TA 3NQBA 4F9JA 3B8VA 5AECA 3EWUA 4B2DD 3VKAA 4CN1A 3TIMA 5A2BA 3NDYA 5HWJA 4QBXA 3WLIA 1Y0EA 1J2WA 4ZBCA 1K8ZA 1EJSC 3UG8A 3MSGA 3RXZA 3WH6A 1QUMA 4WQ6A 2DT0A 1M68A 4XZLX 2WHJA 4C6OA 1C90A 1Q6EA 2X1SA 2E09A 3E96A 2QXWA 3R8RA 2XWEA 2C3ZA 4V1YA 1J6OA 2Y7EA 4NX0A 3CQHA 2B7NA 1Z42A 2G3IA 3GRIA 4M80A 1FH7A 4CCZA 4CUCA 4EACA 4CD8A 1A4MA 4A4AA 1XQKA 2AMXA 1MO0A 3PWIA 2PZ0A 1IQ8A 3LG3A 4KFOA 3WEZA 1ISYA 4JIPA 2PWFA 5HR6A 3HGOA 4PEEA 1IIGA 1XD1A 2FGBA 2VCBA 4HA0A 3EZ4A 3T2OA 2X05A 4H00A 5AYXA 4WJXA 1CXHA 1MDLA 1TR1A 3SRDA 4GFIA 4WGHA 2G96A 4YVVA 4C6EA 3KXQA 4TV6A 4AWEA 1OM0A 1FFQA 1AQHA 2BOEX 1K1DA 2C0AA 1K8YA 1YW1A 2R91A 2R1MA 3N25A 2EF9A 3TC7A 2WXDM 1KB3A 1OK4A 3W2NA 5LIKX 4C6DA 4AZIA 1J4EA 1Z44A 4V28A 1ZAJA 3W7JA 1OFBA 3LHWA 1KR1A 2PCEA 2ZX6A 1S2VA 2R1PA 2ISFA 3ZVHA 2ON3A 2FTYA 3IGHX 4WOZA 1KQYA 3AMCA 3DG7A 3PPFA 4IICA 1HL2A 4HA3A 3TJ4A 3V16A 5G4HC 1DWHM 1POKA 4ZQCA 1QBBA 1XLDA 4UQAA 3S46A 4H83A 3M0VA 4WF7A 4LCSA 3ZWSA 1AMYA 3E3HA 4KGJA 4JIQA 1VIZA 4LUSA 3EAUA 1AMKA 1DJGA 1RD6A 3GNNA 4GO9A 3ARZA 5FF2A 3AXMA 1CGYA 3RN6A 1R6WA 3G0SA 1CLXA 3I10A 3S5SA 2Y4SA 1TV3A 1ZNNA 1AH3A 4ROPA 1E0WA 5G4EA 1O1ZA 2BASA 3G1SA 1I9CB 2WSRA 1YKWA 3T05A 2DZUA 1WCGA 1F73A 1GOMA 3RFAA 5ABFA 1K8CA 1N2VA 1KXHA 2VGIA 1PPIA 4DB7A 1SZRA 2DT1A 1W54A 1XP3A 1LWJA 4JX4A 3TLLA 3EDKA 3GVWA 4PSRA 2E7FA 5CPTA 4KEUA 2PTYA 4P7LA 2IXVA 2ZUNA 3BQ5A 5E0KA 2GGGA 4UTLA 3ITCA 2J8FA 3DFOA 5CJMA 1G67A 3W53A 3N34A 1UP2A 3H54A 3PUDA 2GJRA 2TODA 4DIAA 1IYXA 3O1NA 4HYWA 5J5DA 5FF0A 1PIGA 2E6DA 5BCAA 2H8ZA 3APTA 3N29A 1IT7A 2B7QA 1RCQA 2O0TA 4LU0A 1GQKA 1DIOA 2DZSA 4HA1A 3K8LA 1RLCL 1NVMA 4O14A 2X0YA 3L4XA 1F74A 3GC5A 4UR8A 4JTAA 3GIQA 1A53A 5EMKA 5TBOA 3SSJA 1DXIA 3CO4A 2PLJA 3VE9A 2VFFA 2YZRA 4CNOA 4WX2A 1AD4A 1KC7A 3TUUA 2FGLA 5MKGA 3SB0A 3HV9A 3EXRA 1OGBA 3NVTA 4A3QA 2CU0A 4HMCA 2XIIA 4AW7A 2EG8A 4V33A 5A6KA 5CBBA 4NT0A 2BBFA 1OK6A 3WDRA 1ZP4A 4RDWA 3KL0A 3V4BA 3G1VA 3LPFA 1ALDA 3C4UA 5ABEA 2QUTA 1BGAA 1ZAHA 4TR9A 3S3GA 1L6WA 4GC4A 3QM3A 1EUNA 4UTTC 3QFWA 2C1IA 3GW3A 4C6PA 3MDWA 4JTRA 1JPMA 3PHAA 4I8DA 3OA3A 4GISA 3W7PA 4U3CA 2Y61A 3CZGA 1YE6A 2VR4A 3GR7A 4GNKB 3A64A 4O1DA 4PBGA 4AVNA 2JK2A 3N2OA 3HU7A 5D30A 1LG1A 1SGJA 3Q45A 1LLZA 3T4WA 3AS1A 2D2OA 4ZEPA 3KOZA 4M0XA 3OIHA 2QMJA 5PTDA 3H22A 1P0EA 2OOGA 4M7TA 4H9TA 4AFYA 2IXUA 2VZSA 3SCPA 1KWKA 2OWWA 1UG6A 2CZ5A 2Z24A 3QZEA 3TNBA 1TPDA 2NVAA 3LNPA 4WD0A 5A6MA 4PMOA 3LM3A 1AD1A 2FFIA 1NOFA 3HQ1A 3PSWA 5EMUA 3MI6A 3FDGA 5KITA 5D38A 2TMDA 1IXOA 1ZCOA 2BP1A 2Q01A 2VGGA 1PZ2A 4I9MA 1TMHA 4X60A 3O7UA 2YXOA 1S2WA 3ZJ8A 2BZNA 2OWCA 1H11A 1R87A 2YA1A 5KTLA 3QTGA 3AC0A 3NNTA 1YRRA 2WMIB 3QLLA 3RJXA 4MNMA 4TX6A 1XISA 4B5VA 1DOSA 2J7BA 1WZKA 1TJ2A 4EIVA 5CG0A 1TZ7A 4AD1A 2PWGA 1XIGA 1OFEA 1ZBKA 5HAOA 5AKQA 3NQAA 2D20A 4U33A 1P6BA 4ZO9A 2NQLA 4JDBA 3WZ0E 1P7TA 2J7HA 3OGSA 4GVFA 2VEFA 2HS6A 3W82A 2QHAA 1DIDA 4R7JA 4XAFA 4QIUA 3UPBA 3HM7A 4LV4A 3QPZA 3NFUA 3AIBA 1UP3A 1CGWA 3E2QA 1Q6FA 3KZPA 4GQGA 3WFLA 4UTKA 4IP7A 5EMJA 4R85A 2MUCA 2O56A 4PUWA 3MCMA 4HMDA 3KVKA 3LEPA 1L6SA 2AGTA 3WK1A 2GK1B 4AQLA 4FOKA 3SGZA 3WKZA 1AK5A 4H9MA 2WSKA 2O9TA 1TV7A 3FKRA 4MJ2A 1E0VA 3WQ4A 4LOCA 3M46A 3SCQA 1JXKA 4WKAA 4Q6XA 2QAFA 3RUBL 2Z0IA 3WCZA 2AKZA 5A69A 3AMGA 5FF7A 5A3HA 3DFSA 2CHOA 1EJ7L 4PFHA 1HKJA 2DSKA 2VFIA 3BAXA 1OC7A 3AHXA 3NR0A 4LH8A 2D2GA 1VD6A 1Q63A 4FA3A 1YTEA 2A7PA 4QCEA 4GYPC 1WDPA 3SJ3A 2WVVA 2DDXA 2PU1A 3VUSA 3GC2A 3S1VA 4JTCA 1OFAA 3AWOA 1R30A 4GIYA 1FCUA 1CNVA 2B4GA 5CZSA 3TONA 7ENLA 2I57A 4AMCA 1QMLA 4AIUA 1JZ2A 4N9EA 1DXFA 2ALDA 2R9RA 4WXZA 1FTXA 4CEXC 1MNZA 3A23A 1UWQA 3KHJA 4I3GA 3RIKA 3B9EA 1I8JA 4WY0A 3O6CA 5MF5A 5FSEC 1PV8A 3VIPA 3LGDA 4LQ1A 4C6MA 5JQ9A 3EX3A 4Z1YA 4IT1A 3ABQA 1OIFA 2J7EA 5HMEA 3ARUA 3HF3A 1B9ZA 3TN3A 4DHGA 1S2CA 3GUWA 1QI3A 4G7EA 4JTJA 4JYFA 3AOFA 1TPUA 2O9RA 1UCWA 4MAVA 3Q37A 2CLOA 3QR1A 4DWSA 3VYLA 3N4AA 4X2PA 3CUZA 1ZLPA 4UFJA 4ZE5A 4J2MA 1XG4A 1VJIA 4H19A 4M7SA 5DY3A 3VABA 4GXMA 3TFXA 4I6VA 3QQWA 1XIJA 5I6SA 3EBVA 3QMTA 2W66A 2EPHA 2J78A 5H1WA 1MFVA 3RU6A 2QDDA 1JCLA 1X6UA 2OVLA 4OTKA 1CLVA 3REQA 1U1UA 5I02A 2ZX5A 3EPNA 2GGIA 1R85A 5C9XA 4D6FA 4IG2A 3WLPA 3UVIA 1P0DA 1VHCA 5M3WA 1JDEA 1L8PA 4G9PA 5LA0A 4CQBA 4D6HA 3VNIA 2ZXBA 4GZJA 5BW6A 4LB3A 2FH8A 2WLZA 4S3JA 3L23A 3WFZA 3RMJA 4YNGA 4BY3A 1BTCA 3PANA 3WF2A 2NQJA 1R38A 5HMDA 2ZICA 1B31A 3A22A 2AKMA 1GYLA 1UUOA 3NXLA 3E49A 5CC7A 4ZXLA 5C70A 3SQMA 1UJQA 4H1ZA 3ANVA 3O6DA 1TVPA 4UFLA 1T8QA 1XHGA 3IV8A 4Y9OA 1HGWA 3QPYA 5HULA 2V5KA 3C61A 3UXDA 1ZBVA 3I4KA 1WXJA 1YNYA 1FHUA 1GOOA 4CNSA 5BZAA 2JE8A 5IFTA 4R7WA 1E1EA 1GEHA 1M65A 5HQLA 5ENLA 4AXNA 5KZ6A 4GUGA 2Y63A 4L65A 1TJ1A 2Z2BA 4JICA 3NQEA 2FMOA 5C2GA 4LUSB 4Y8FA 2I5GA 2QV5A 1XUUA 1TB3A 5GNYA 2BOGX 3ITXA 2F7FA 2HXTA 1UP0A 2YGYA 2IQ0A 3HPAA 1TMLA 1XLBA 3V1PA 4HNUA 2P5NA 4Q6JA 4GBUA 1SJCA 4JTHA 3RO8A 4AUBA 4WCJA 3BAIA 3V3WA 4AXKA 1YX1A 1W1ZA 5ECUA 3UWYA 1WZLA 3IWPA 1TV5A 3O6AA 3BWWA 3THCA 4NRRA 1SSGA 4HU0A 3OG3A 1I1WA 2PLCA 3ES8A 4N4PA 6ALDA 2NSOA 4NYYA 1IT8A 4QLKA 4M19A 4B5UA 4QE4A 3DZ1A 2OPJA 4O53A 3ZSTA 2ZTKA 3GTXA 2PDLA 3ARVA 4IMCA 9XIMA 3AYRA 4U31A 1KM6A 4X22A 4L9ZA 5D37A 1VS1A 4HCHA 4TX8A 3U5YA 4HGXA 2FGZA 3V1HA 3W83A 3W28A 1LUCA 4ACZB 3VO0A 2P0IA 3ITGA 1UPMB 3I7SA 2E8YA 1IXPA 3TCSA 3N1AA 1UKTA 3SR7A 4TVDA 3TYAA 3VK5A 3E5PA 3BGGA 3K4WA 3B0UX 4CVUA 1MUMA 2OO0A 1F3TA 2GUUA 2B81A 4MY9A 1QNOA 4H6QA 1SO5A 4EOUA 3DI0A 3WBEA 4O18A 3AO0A 1XDLA 4N2YA 3UQNA 3N14A 1A5MC 4YWIA 3SCUA 1MUWA 1SR0A 5LYRA 3BJSA 2ZRZA 3WX7A 4MPKA 1H7OA 1LZOA 1EA9C 4JY9A 3U7VA 4J3UA 1VEMA 4O57A 4YPJA 1DPMA 1KFJA 4F0LA 1GOKA 4J2PA 3HMJG 1EX5A 1DQXA 5I5RA 4GY0A 3OYXA 4DXKA 1JF5A 3EDFA 4U2YA 3W85A 1PZ3A 3CLWA 4NP7A 4S2BA 1WDRA 4WSHA 3KFTA 4EX4A 4CNPA 2G0WA 1EGZA 4DN1A 2XN0A 2BVWA 3G1AA 4GINA 2V5LA 4KMQA 1RK5A 2ONEA 1EUAA 1F7BA 3AALA 3GG1A 2VO5A 1PDYA 1WP6A 3SCSA 3VNLA 2DH3A 4O4WA 1D7FA 1O12A 4YTSA 5XINA 3W2MA 2NX3A 3OGRA 4KS0A 4GIRA 4BEQA 7PTDA 2A3EA 5F2IA 4KIRA 2F6XA 2GVEA 1DJXA 1R2SA 1NP2A 1XRVA 3TQ0A 4JD4A 2WMGA 3N19B 4GH3A 2GUYA 1V4YA 1Q5MA 1WUEA 2MANA 3CO8A 3M6DA 3LNMA 3EX2A 1Q8JA 3O16A 2QJNA 3L2IA 4GFSA 3S5YA 1TR9A 2J77A 3URBA 3PZOA 1XCFA 1WBJA 5LA2A 1RV8A 1XYLA 5A6JA 1OIMA 3KRUA 3WH8A 1QVBA 3UFYA 2GJLA 3CZLA 3MHFA 3OZPA 5B80A 1K3UA 3WYZA 1RXOB 1GEQA 4I9JA 3GUGA 3C8FA 4RV3A 4WVXA 4FSAA 1P0KA 4GCAA 3NM1A 4H4IA 1R3TA 3ALFA 3ZFHA 4J4KA 3LUTA 3VFLA 2WJZA 1QOXA 4BKNA 3GTFA 3W2UA 4R5EA 1E6NA 4IJRA 3AFBA 3IJQA 2EPOA 1R7OA 3ANUA 4ZXOA 1GVEA 1I75A 4PRRA 2UV8G 1W3TA 3HGJA 4W87A 1DBTA 2D0HA 4IX2A 1X6LA 2F2HA 3TN4A 1SM9A 5CZKA 1K02A 1PUDA 5LXXA 4JX6A 5CXPA 2WCAA 3K5XA 3IEBA 3BQ6A 3GG8A 2CLIA 3G6LA 4GH1A 2CETA 3CHCA 5RUBA 3G2GA 1Q6LA 5REQB 2WVUA 1P4CA 4PE8A 3A4XA 5M2FX 1RA0A 2WKJA 3LI1A 5DXXA 4UQBA 2YLAA 1REQB 1VFFA 1P7TB 1TPH1 4MWAE 3FHAA 4UTFA 3LXCA 1FDYA 3G18A 3QW3A 1G1YA 1LL4A 3UW6A 2GLKA 1RK6A 1W9XA 1KA9F 2PDMA 2YA0A 2IKHA 2VEGA 3EWYA 3KRZA 2OYKA 3WUGA 2NWRA 4CNTA 4M51A 3TOYA 3B03A 4ASTA 1WDWA 4UQCA 1OCNA 1TMQA 1MEHA 4J27A 2AAAA 1TVLA 3H2CA 1I4NA 2XU2A 4RE0A 4C7GA 4J5NA 2AAMA 2ZRXA 3H55A 3SJNA 3BUVA 3IIVA 1P6CA 4Q4OA 3APYA 4MG4A 4B91A 5JU6A 4GIEA 1SO3A 5LIUX 3USBA 3N6JA 4LRSA 1AZ1A 1FWWA 3UYCA 4O1BA 1GWJA 3M5VA 4C5YA 3FN9A 1SZNA 1DIEA 4O1AA 3WD1A 5AY7A 3POCA 3QHOA 4X61A 3VINA 4AY7A 3FX4A 4JHOA 4DZHA 4GNJA 1KLZA 3BK0A 4EVZA 1EYEA 2YBUA 5AC8A 4AHOA 4HNOA 3C52A 4DJFA 2VEPA 1K8XA 2J9YA 3W3OA 4P2VA 4K38A 1EO5A 1QPQA 3ABOA 3W1XA 1WYIA 1QK0A 2A6LA 3PG9A 3U48A 1KRAC 5A6BD 4E8GA 1OFOA 3AS3A 1W1IE 2XVPA 3W2LA 4IIGA 1IGSA 1AJ2A 2I9UA 3PZMA 1EWDA 3DG3A 3OHMB 1EBGA 2WVVB 1MVYA 4RXFA 2CITA 2R82A 1MXDA 6REQA 4CN4A 4JFVA 3VDHA 4MJZA 1BKSA 4XAPA 4E38A 5CSUA 4UIOA 3QHMA 5IOBA 1PWMA 3LPOA 1VGAA 1B4EA 4E2DA 3WLKX 4JN8A 3ES7A 3FLUA 2J24A 3CIWA 3H8AA 1S5VA 1HJVA 2PZNA 2C15A 3R13A 2CERA 2WYSA 3T4CA 1M7PA 1QW8A 3BAJA 1BWVA 4BQ4A 5E6YA 4XUGA 1GJUA 4TO8A 3SCNA 3WJSA 2NUXA 4ZGYA 1SJAA 3B9NA 2VZVA 5CSYA 3LCWA 1W3JA 2FPVA 4AF0A 1H5YA 2WBKA 1E1CB 4ZQNA 3PZVA 1CYGA 2UY4A 3RRXA 4IXXA 3Q4DA 4A35A 2YCKX 4UTMA 1ZJIA 3DIPA 3I7RA 2TSYA 4IJBA 4FZIA 1T41A 4G7EB 2QCDB 3NYZA 2OT1A 2IPGA 3C2VA 1PBGA 2Y6ZA 5C6MA 3TK7A 3IAQA 2OLAA 2DUXA 1AZ2A 2RKXA 1QPKA 1CT5A 3WH7A 4PUKA 1GGOA 1UKSA 3BSMA 3MP5A 2YCLA 1O68A 1TE1A 5FSDC 7XIMA 2Y7GA 1JJKA 3NQFA 3REQB 4OBSA 1PS9A 4LYRA 1HGYA 5EKYA 5EPDA 3VIIA 2EG7A 4Z08A 2VZTA 2Z2AA 3O3RA 3SEPA 1R8LA 1UD8A 5CPLA 4DQWA 2G37A 3DGBA 1J10A 2QS8A 1I2NA 4QFUA 4GO8A 4HSOA 1QOQA 4QQUA 4CN6A 4FXJA 2WJEA 1XXXA 3AYSA 3M5ZA 1OG6A 1BVNP 4H6EA 3RCNA 1PYMA 4GHRA 1CB7B 1OCQA 1PO9A 4QE5A 5I77A 4QISA 3ZXWA 3O63A 3GFXA 5DY2A 3N9RA 1O5QA 4O50A 1G5AA 3ARYA 2C7FA 2VTFA 3LQGA 4QXIA 4RUBA 2HEJA 4JFTA 2VD8A 1PX3A 2KX9A 4LYQA 2F84A 3C3UA 1TCMA 1AG1O 4D8LA 5JXQA 5EL1A 1J0JA 5ABHA 3QKEA 1W17A 4JCMA 3HGSA 5DMYA 3GAYA 4Z2IA 5HATA 1U83A 1TJPA 4OUIA 3IJDA 5FEXA 1GTEA 3LBMA 4FLRA 3LHTA 2DZXA 3TTOA 1BD0A 3EX1A 2QT3A 3QF0A 4JIRA 1CGVA 1EZ2A 1VF8A 2WQPA 3HJEA 4EXAA 1VYSX 4L56A 4JKKA 3TKFA 3W7NA 3P8IA 1FWSA 2TYSA 5BOEA 1NAL1 1R2TA 3D0CA 1QK2A 4O8RA 3D3FA 4JTEA 4RZ5A 4BI6A 1XIBA 3PPCA 1S2TA 2PU0A 1DTNA 1UD5A 2PAJA 3RLGA 2PDWA 3MI2A 1A5BA 1I6NA 4ORMA 3EDEA 1WNOA 3H6OA 5E9AA 3M0KA 1OD0A 4GGHA 3CHEA 5CC6A 2WZMA 1XGEA 1S5MA 4Q8OA 2D22A 1BQCA 2HXUA 1JF6A 2NQZA 2OEMA 1KXTA 4UR7A 1W1VA 2R1LA 1EXBA 1I0DA 1S5WA 3TQKA 3RNDA 3NSNA 1OJXA 1BVZA 2JIWA 2HVMA 1Q6GA 1BKHA 1UZDA 2VJXA 4WEVX 3ZIZA 3GDLA 3MDUA 3JS3A 2CFFA 1BSLA 4RPQA 2BY1A 3HFYA 1HJXA 2EKCA 4L61A 2WMHA 3CGTA 3HFTA 1QJWA 4E6MA 2YDQA 3N3TA 2I17A 4B4HA 2GL5A 5F1VA 1UHVA 4DZAA 3N11A 1JCTA 1THFD 4ZTXA 2YSWA 3ZVIA 3W00A 3AZSA 3B9OA 1E9IA 4Y7EA 2R24A 1FXQA 1SMDA 2DSZA 5HINA 4KF1A 2EBNA 4OGZA 1QFEA 3DN5A 5EGRA 2WJDA 4D1IA 2QPSA 4IOTA 2C6QA 1NJJA 2GSHA 2Z4GA 1R9XA 1KRBC 2PP1A 2GZXA 4Q4RA 4JTFA 1NSJA 3AQUA 4UBPC 3WQOA 4DF0A 6A3HA 1H5VA 2NV2A 1FX6A 2PDHA 4XBJA 1OWQA 3WBWA 1YPXA 1NQ6A 1B0IA 3BLPX 2O55A 3OIXA 2CW6A 4CVWA 4HBKA 5M1TA 3L4ZA 1V77A 1MEWA 4KCVA 2BDQA 4JX5A 2NX9A 2V63A 4LC6A 5AHIA 1LLOA 3QV9A 1UMLA 3IGSA 3IJ9A 4ERGA 3SCVA 8A3HA 2XM2A 1DE5A 3DKJA 5EMLA 2JF6A 4FMVA 4DUXA 3GXDA 1LWIA 1Z69A 2XYLA 1E6XM 3M16A 4US5A 5AYYA 1JQXA 1YE4A 4WLCA 4Q8TA 2WKGA 2YFNA 3M07A 3RM4A 4JFUA 2OR2A 3LERA 1HKIA 3B8DA 4R88A 4GI8A 5AC5A 1A47A 1UBSA 3TVAA 1W2PA 2PWVA 4L7ZA 3TU9A 3F4WA 1E1FA 4R27A 4LAMA 3RITA 2B31A 1K7FA 3W6MA 1JDCA 2JKEA 1JYWA 3BARA 1TUFA 3OW1A 2Q6ZA 4FIQA 3DFHA 3PBWA 4EK7A 4JKLA 5HWMA 4E4UA 3CAVA 3FXYA 4AHQA 4JNMA 3BGAA 3VOJA 3EA1A 1VJSA 1N8FA 2FKPA 1UUQA 4RDVA 3WNNA 3MPGA 4GVHA 3UPWA 3O05A 1KQZA 3QRHA 1S5NA 2FTPA 2PDGA 5BNKA 4HCLA 3QKZA 1O5RA 4PTXA 3S0CA 1J0KA 3MC5A 4W84A 4GYPA 4URIA 3PS7A 1QW7A 5K3VA 3B8WA 3GHRA 3TTEA 4IGMA 1X8CA 5FJRA 2WB5A 2D0GA 4C6IA 4HQVA 3APGA 4MNJA 1EA0A 1GVFA 4C6KA 3UETA 1H3GA 3G1DA 3OA5A 3RLUA 3MWCA 5H2ZA 3G24A 4L5ZA 3WF3A 4XKYA 1UD3A 1FWDC 3ZQ9A 1ITCA 2VX6A 5D9PA 1O60A 5DRIA 3UXKA 1J79A 1RHCA 3E02A 4Y2WA 2BVDA 4O0KA 2G3NA 4AEFA 5TAOA 2W4XA 2DIEA 2OJPA 3B4YA 1TTQA 4UQEA 1AVAA 1OC6A 2PBOA 3GZ3A 1EDQA 3GXMA 3DG6A 2X16A 4PTDA 2XUCA 1PKNA 3RJYA 1CI1A 4XWUA 3AUOA 1VBRA 2X7VA 5J8LA 4DX3A 3GNDA 4W93A 3ZLHA 4ADTA 1JPDX 1YTKA 3GNOA 1BVWA 1NOWA 3WL1A 4Q8MA 1X1NA 3I7QA 2ZXAA 5CLTA 4B3ZA 2X8RA 4C6FA 3ARTA 1QNPA 1SQ7A 2ZWYA 3LLDA 1TA3A 4RNFA 1LRQA 1PTGA 3H2NA 3GU9A 3L66A 1J5TA 3RPDA 4FOUA 4GJIA 1KRCC 2WCSA 5FAJA 1ZQ5A 2PWHA 2QJGA 1VAHA 3L0GA 4ATWA 2BHYA 3DU0A 3S2LA 1IE7C 3CM4A 1BLIA 2WVTA 1M03A 3KS5A 1YNQA 3MMUA 1WZAA 2A1YA 5CJNA 3KP1A 4H41A 3DHUA 1XFCA 1TJ0A 3MU7A 3MI3A 1Q2SA 3KBSA 1UUMA 1ZGDA 1W3NA 3OLIA 4QDMA 1YXCA 1EBHA 3W81A 1AH0A 3VE7A 1YDOA 1NF7A 4D71A 3LCLA 1UC5A 4WY0F 1VR6A 2GVGA 4YN5A 1D3GA 3ZLGA 3HPSA 3VOHA 5I78A 4LBRA 4WK9A 3CHFA 3FYOA 4C6QA 3PUEA 2GFTA 3UWWA 3LLFA 3A3XA 4RW3A 3DX5A 4L9XA 4L4OA 1RCOB 4TIMA 5CZTA 4AF0B 1B3YA 1RLDA 2AQVA 2A5HA 2GDQA 1AQFA 2A3HA 4JFSA 3MUCA 1XBVA 1YDVA 4GRSA 4HU4A 2G3MA 4S1FA 3WD3A 1POJA 2WJFA 3WLJA 3SCRA 4JKMA 1BG9A 2BVYA 3ITLA 2O92A 3WELA 1UZ1A 1FWNA 4JN7A 2LLEA 3SBFA 1XV8A 2AL2A 2VNCA 4Z2KA 3NL6A 1V3LA 1JR1A 1NWSA 4P7NA 3RK8A 2XTKA 2VZUA 2NSXA 4F0MA 3LHVA 3BLEA 3CHVA 3STCA 3H4WA 4UFKA 3U2CA 1A5AA 1R46A 1V0KA 3E0LA 1YTDA 3AYVA 5FESA 2YCLB 1Q8AA 4QRNA 1ISXA 4ZTYA 4KERA 2NQ5A 3WEMA 1XIEA 2WSQA 4AZCB 2QUNA 2ZADA 1A80A 1R3SA 4XG1A 3C6CA 4JOMA 2CIPA 3YPIA 1UR3M 1NWUA 1EPXA 1PL9A 1HF6A 1KTCA 3RPTA 1U1JA 4PCTA 3QV7A 3R58A 3GTIA 5A8PA 1BF2A 3AZTA 1OY0A 4US6A 5DCEA 3UWZA 1OZMA 1UBPC 2YL9A 1RPKA 1E9ZB 1JEZA 2OZ8A 4MJ4A 1I45A 4ATLA 3VC6A 1PWLA 1ENUA 1V6VA 3CPGA 2FMNA 1PXGA 4MYXA 4G6CA 3UR5A 1XWYA 4QLJA 3BDKA 1A5UA 2Y5SA 4O4VA 3P0XA 4IQEA 3UR2A 4WDTA 3OLEA 4HIBA 3LLXA 5DMLA 1KGUA 5AZ1A 2WMJA 1FWGC 5CPNA 2HPIA 4C7DA 1LQ0A 3TN6A 2QCNA 3EWDA 3W6YA 4BI5A 1NDVA 3IK4A 3PJWA 2OGYA 1LOLA 4GUIA 1F4AA 2XFFA 2ZVRA 1VZWA 4DI8A 1FP9A 1Q6DA 2ODOA 4AIBA 4QS5A 4O28A 3VCNA 1OX5A 3VDBA 4ZOEA 2WNZA 1J0ZA 4RNJA 3NQGA 1E0XA 4P61A 1D9EA 1GYMA 3L5LA 2IW0A 3GNPA 1IZJA 1W9UA 1E6PA 3A13A 3ERPA 4W7WA 4A8IA 2NQHA 2J9XA 2NX1A 4FP1A 1C7TA 1GKQA 2W3ZA 3NQCA 4FS9A 4L9YA 4M24A 1PZ0A 3AU2A 2ZKMX 4PFMA 3CQJA 3FIGA 5HNUA 4NZ4A 2V5BA 3LCFA 3OEXA 2WC7A 3ISIX 3HQPA 4IIFA 5AC7A 3GIPA 4JHZA 4D9PA 1WDDA 4K7VA 4LNYA 2PTXA 1HO1A 2WW5A 2ISDA 1OYAA 2Q71A 3KBJA 3KCOA 2YA2A 2YCJA 3QHNA 1OYCA 4S3FA 4JTDA 1EEPA 1WAUA 4S3KA 4A3HA 3SN0A 4C6CA 1F9CA 5A6SA 1SW3A 1BFNA 2Z7KA 4G1KA 3F4VA 1G94A 1Q4NX 4Q4QA 5HBFA 2P10A 2E1WA 1G4SA 1HQTA 1K70A 2PC8A 1GOWA 3PJXA 3FA4A 3RM8A 1XYBA 2QZRA 2INFA 1V0MA 3FJNA 2DGAA 3EMQA 3N15A 1XDMA 2VDIA 4GOAA 4NAFA 3G22A 2XM1A 3IJ8A 4Y9NA 6TAAA 1JUEA 4L4LA 3I6RA 3AAMA 3EWCA 2VWSA 2HQAA 3DYMA 3L2LA 2WO5A 4N4QA 4WIWA 5G1MA 4TVUA 5HWNA 3G1XA 2QCLA 2VR2A 1PVNA 2A3LA 2ANUA 4W86A 1PSCA 3GK0A 3PBGA 4HOXA 4PUEA 3S1XA 5E0FA 1F8MA 4O16A 4RX0A 4W89A 3QC3A 1UZHA 1W37A 2Y5EA 2QF8A 3PP7A 4QJ3B 4O12A 2OSWA 4F0KA 3LV6A 1ONXA 2ACQA 3D47A 3WL0A 1I60A 3NJ3A 1TVNA 5FIPA 4RE3A 2W5FA 3WBAA 3L4YA 4PRTA 1KGWA 1ONRA 2PDXA 3I4EA 4LX4A 3MO4A 1ZAIA 3R2GA 1IEWA 1S2UA 3KBWA 1TRDA 2OQLA 2ZC8A 1DJYA 5TD4A 3IIOA 4P7OA 1QBAA 3W7IA 1FP8A 3CUGA 4OVXA 1IIHA 4YWSA 3NURA 3VZZA 3AUJA 2ZDRA 3FYPA 2V6AA 3C56A 1JYXA 1F6YA 3B4UA 2EPNA 3UCCA 2FZDA 2VRJA 2QVHA 1GZ1A 1HO4A 4QHRA 4OWGA 2WC4A 4HTBA 3EX6A 3N3MA 3M0IA 1TKKA 4NG3A 2VI0A 3TXVA 3LX9A 2XZ7A 3ELFA 3VIFA 4AZ6A 4K37A 3W88A 3GAKA 3C0QA 1MUCA 3WF4A 3HB9A 2D69A 4J35A 3CYVA 3KAOA 3ZR4A 3UJFA 3ONBA 1XSIA 5BWFA 1ZPTA 4LYKA 2VFGA 1HTIA 2VQUA 5CGTA 3M1ZA 4CU7A 4S2CA 5LGZA 2NWSA 2I7GA 4JTLA 3VIOA 4LAOA 1DJNA 3M47A 1UZ4A 3WQDA 1ME9A 1T0OA 5KZMA 2PRMA 1N55A 4YS1A 2G5WA 1JNEA 4ZSTA 3NPUA 4ONVA 3CMFA 1JAEA 1UKQA 4AISA 4XTDA 3UJRA 2Z1XA 4LWWA 3WQEA 1GCYA 1QR7A 3R8HA 3HQNA 1OEPA 4FO4A 2FH6A 1VHNA 3LRLA 1JGIA 3PZQA 3PFMA 3BJFA 2ZDSA 2JIEA 3HQOA 4XAZA 3JZEA 3UR7A 1NWRA 3CWHA 3A9IA 3F5KA 1XH1A 3T2QA 3GXPA 3SFWA 3SY1A 3WK0A 4F0SA 3QGAC 3VD7A 4WSJA 3W72A 3C3NA 1OFRA 2EEXA 3Q65A 1DWGM 1H09A 1YIXA 5E0CA 3AWNA 4PTMA 2NW0A 4KEVA 2C1HA 3N2CA 4DWSC 4XKYB 4R33A 3U7BA 3QOMA 2DORA 4F48A 1PAMA 1RD5A 4MWAA 5G5IA 2X42A 4UC5A 3JVAA 3N2XA 1WPCA 3E2VA 3BG3A 4GUJA 3VAVA 3QY6A 1XX1A 3VOFA 3FY1A 2B7OA 4MF4A 1XYMA 3TH6A 4ZO8A 1ZFJA 2OB3A 3TSDA 3VD9A 1FWRA 4Z0SA 3TZNA 3W25A 5BROA 3OLDA 1NWTA 4KETA 3N4EA 1SPQA 2CLFA 3SECA 2Y0FA 2OCZA 4GJJA 4QJ1A 3LCIA 4AVFA 2WHMA 2WV8A 3E5BA 1X7FA 1GVYA 4QX4A 3U5UA 3WDPP 2V3FA 1GG1A 4LXFA 4CCEA 4FLSA 3L68A 1UA3A 4L6OA 3T55A 1YADA 1I2RA 2V38A 1V3MA 1LF1A 4RZ4A 4UB9A 3F1QA 5A2AA 3O15A 1C7SA 3DENA 4IM4A 1IR1A 1EDTA 1TV4A 1SZEA 1QPRA 5A1AA 2H9AB 3M4HA 3O0KA 3CV2A 4KRTA 3VNJA 3M0JA 1UWRA 3A21A 2X0SA 3MMWA 1M53A 3EPOA 1P1XA 2QCCA 4GBDA 4IPLA 4C1NA 2FFCA 3DGRA 4DYEA 5KZEA 4YVXA 3AXHA 4GMEA 4BQ5A 1W5QA 2PDJA 2Y70A 3L5MA 3I65A 4HOZA 2VEMA 3STFA 3RX4A 1WXYA 4PUMA 4UNIA 1A49A 2ZUVA 3LV5A 5T9BG 4HNLA 3I3BA 4MAZA 4AG0A 5BYWA 3TA6A 1FVPA 2BTMA 5BXTA 4WKFA 2XGIA 3AU6A 3EMZA 3K46A 1F5ZA 2VUNA 4XAGA 2IQDA 4NILA 3WLRA 5F2LA 1UH2A 9XIAA 1CW2A 4I7UA 2GSJA 3DFNA 1QNQA 2OZ0A 3ABZA 4ACYA 3K4AA 4UWMA 5HUOA 3P61A 3VMPA 1BEUA 3QY8A 1BF6A 4O1EA 3S9IA 4M6PA 3NO3A 3GXNA 2GGHA 1DHPA 3CYJA 4NX5A 4X0VA 1SUXA 5A5WA 3QBUA 1AA1B 2YOCA 1M3UA 5LNWA 2FZBA 2DW6A 1VPQA 1H63A 5HMSA 2QIWA 1B90A 6XIAA 1KCZA 4FIRA 1PKMA 4DUVA 3GKFA 2C79A 3UA4A 4JQ2A 3RGTA 4XB3A 2KZHA 1V7AA 5FD0A 2W61A 1EH9A 4CD7A 2BXVA 4PBFA 4UTHA 2DY3A 1XIIA 2V0TA 2E0PA 3SUSA 2RAGA 4NJJA 2FVMA 4KRUA 4H8HA 5FJOA 2ZZ6A 1XLFA 1A5OC 1OFQA 2V5JA 4JAWA 2PDFA 3F5LA 3TA9A 2Q3OA 3AMLA 1RBLA 4GX9A 5D32A 3W1AA 4L80A 2W67A 2HMCA 2IPWA 3S6TA 1FA2A 3W1LA 3WJZA 1EXPA 4NVTA 3MHGA 1WB0A 4HNNA 5SWUA 1QW9A 2Z1VA 3UD6A 3P5ZA 4YL2A 1I2QA 3OJGA 4QCFA 4N6EA 4K1GA 3VKCA 2OWXA 3BW4A 3U4FA 3V36A 1XSJA 4FR1A 3PWGA 2ZVIA 2VFHA 1QI4A 3W01A 1ADDA 1JG9A 3EA2A 1PKYA 4PGLA 1HKWA 3BSGA 1TV2A 1XSKA 3M5YA 4XK2A 3ABSA 4FNPA 4US5D 3GDBA 4UTWA 3GBDA 1RY0A 3BOLA 4NYUA 1ICSA 3PC0A 1E9YB 4QDPA 1TPB1 3T09A 2WBGA 2RJGA 4MNLA 3GWQA 4DO7A 4XIMA 2VC5A 3N9KA 1F2JA 2A79A 2P8CA 1AW2A 5HMFA 3A4JA 1WO2A 2O7SA 2W62A 3MUXA 4ORIA 4J3SA 4XO6A 5D8ZA 1W5OA 1U1HA 1X38A 1YPFA 3VGHA 2IMRA 3WLNA 4LC8A 1GUVA 1UR0A 2YL6A 5GJMA 3W73A 1NP0A 4N9BA 1XD0A 4Z1AA 1NFPA 3R0KA 2RJHA 3G8EA 1HUVA 1EF2A 3V0TA 4DNMA 2IKJA 4Q7IA 1AODA 3BAYA 3UJSA 3HGRA 3AIEA 1DWFM 2JF7A 3KLKA 4UQ9A 5BXRA 3T81A 1D3CA 1G0CA 3EWBX 1KTNA 5EMYA 2EPLX 2QEZA 2BGSA 5M03A 4N9CA 1JUBA 3BLLA 2R14A 2ZRUA 2TAAA 2DVXA 2XIJA 3THUA 5C55A 4I7WA 3SQSA 4RJEA 3CPUA 3NTYA 3VZYA 3ZR6A 4PUDA 2QDHA 3NCOA 2VFEA 4NUWA 2AQWA 3XISA 1S2AA 3B06A 3W02A 5AB3A 2FB3A 1KCLA 5I00A 1JD9A 4K1WA 1Q4WA 3W7CA 3UU0A 2X2YA 1ADOA 3LQLA 3OPSA 3BXWA 4CD5A 3WD2A 4S3EA 4AZBA 1HVQA 2OU4A 3KHDA 1K9TA 3ZWTA 1MQRA 3M6YA 4U2ZA 3M0YA 4B3LA 1CLKA 3VOGA 2DEPA 3GYCA 1FCVA 3O8AA 3DBNA 5DCBA 3VIJA 1PCKA 1QRQA 3MYPA 1TYGA 3UZZA 1WE5A 1W1TA 3BICA 2ZZ5A 4K39A 3QR3A 1M5WA 3WH5A 3B0VC 3FGCA 4NAFB 4CD4A 1JZ6A 3TTSA 1UPPA 4H6KA 4UMBA 4W88A 5L6UA 2WHKA 4CQ8A 1BRLB 2KAUC 1CB2A 4AY8A 1GONA 3B8IA 1BXCA 3SY5A 1A5SA 4MIMA 1XFBA 2G97A 4Z1DA 3VGBA 2YL5A 2E3ZA 2PDBA 3U2ZA 4Q4MA 4JTGA 1CXLA 2WANA 2E4TA 4HPXA 4KWWA 4MADA 4LAKA 1G4EA 3B3DA 3B8SA 5DQPA 4PEKA 1Y5XA 3G1FA 4JN6A 5CKSA 3O6YX 4HN8A 2EAWA 2GYIA 4NJIA 1B1YA 3LTSA 4UZSA 3GBEA 2VFDA 2XH4A 3L67A 4B9YA 4QAIA 2GWNA 1TO3A 4K2SA 1EP3A 3W07A 1P5BA 4C6LA 5IBXA 5HJYA 5GJPA 2YW4A 4PTVA 3W24A 3GY1A 1DE6A 2X30A 3PBMA 1JUKA 5E9XA 1NFBA 1RH9A 3CZJA 5H6HA 1SU5A 4RNIA 3BOXA 2XSXA 2VX7A 3TV8A 1JXJA 4FXRA 3A12A 4MKSA 1EOMA 1F6KA 1H7RA 3HN3A 3P93A 3STGA 3E1F1 2XH0A 4EPBC 3GVGA 3HIJA 2V3DA 1N8IA 2R1NA 1HX0A 2GOUA 4DJFC 3CIVA 2HNEA 3A3WA 3BPWA 3P0WA 5HQEA 1HIZA 4XO7A 2Z1KA 4HPJA 3LN3A 4Q7NA 2Q8ZA 4FHAA 5LZLA 1D8WA 1XCWA 1A5LC 3CC1A 2AQOA 2RUSA 5I0DA 5I7GA 1F05A