5BU9A

Crystal structure of beta-n-acetylhexosaminidase from beutenbergia cavernae dsm 12333
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
338
structure length
338
Chain Sequence
ADLSLEQRVGQLFMVGTDAATAEQVTLDAITASHVGNVFLAGRSNAGVDATAAVVEQLTAAVTDEATGGVPLLVATDQEGGNVQVLRGPGFSDIPTALDQGALDPATLQADATTWGAELAASGINLNLAPVMDVVASPEAAAANPPIGYFHREFGYDAETVASHANAFSAGMRASGVETVIKHFPGLGRVTENTDTTAGVVDDVTTADDASVQAFAAGIDAGAAFVMTSTAVYSQIDPDAPAAFSREIVSDLLRGQLGFDGVVVTDDVSAAEQVQAWSPADRAILAIEAGTDIVLVSADPSIAAEMVAAVVAKAQADPDFAAIVDDAARRVLAAKGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-N-acetylhexosaminidase
publication title Crystal structure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333
rcsb
source organism Beutenbergia cavernae (strain atcc baa-8 / dsm 12333 / nbrc 16432)
molecule tags Hydrolase
total genus 124
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5bu9A00
4G6CA 4GVGA 1EX1A 3ZYZA 3SQLA 5TF0A 4ZOAA 3RRXA 1TR9A 4IICA 3BMXA 3WLLA 3WLPA 4ZOEA 4I8DA 5FJIA 2X40A 4GYKA 3WLQA 3U4AA 3WLTA 1X39A 2X42A 4ZO7A 3WLKX 4IIDA 3WLIA 4GNVA 3ABZA 3WO8A 3ZZ1A 3WLMA 1IEWA 4MSSA 4IIGA 1J8VA 4ZODA 4IIHA 4ZOBA 3TEVA 5BZAA 2OXNA 3U48A 4IIBA 3WLHA 4GVIA 3WLJA 1IEXA 4I3GA 3WLOA 4ZO6A 3NVDA 3UT0A 1IEVA 4ZO9A 3GS6A 5C0QA 4ZOCA 5IOBA 3WLSA 5BU9A 1Y65A 4YYFA 1IEQA 2X41A 3WLNA 4IIEA 5JU6A 4ZO8A 3SQMA 5FJJA 3USZA 4HZMA 3WLRA 4IIFA 3GSMA 3AC0A 1X38A 4GYJA 4GVFA 5G1MA 4GVHA 3LK6A 1LQ2A
chains in the Genus database with same CATH superfamily
3FA3A 3AQUA 1K7XA 3WN6A 3H24A 4ERAA 2F38A 2WNWA 4PR4A 3AISA 3M64A 3E0VA 2ZZ2A 2UWFA 1RVGA 2VEIA 1BVZA 3IVSA 4MTVA 5BWFA 3II1A 1MUCA 1WBHA 3VIKA 4BQ2A 3RPMA 1AVAA 2CFFA 3QTPA 1WKDA 4L80A 1XJBA 3KVMA 3UVAA 3MCOA 4IJRA 4CNPA 1Q63A 1REQB 1W1IE 4IIGA 4HHMA 2NUYA 4ZODA 2W66A 4IPLA 5B7YA 3DG3A 3VMNA 3DG6A 4ECLA 1MVYA 3WMBA 2VRJA 4MY8A 2QCEA 4IFKB 3TOYA 1V0KA 2OOGA 5JBEA 2ZCGA 1AMKA 3VCRA 2WV8A 1PCWA 3PBYA 2UBPC 5HK4A 4DF0A 3SRDA 5RUBA 1YXYA 3I68A 3ECQA 3W0KA 4UMBA 1X7FA 2CPUA 4Y9AA 3BMWA 5MHBA 2WJEA 1MW3A 1GOOA 4RCXA 3ZS4A 3O05A 2XZ7A 4D6JA 1BRLB 5AHMA 3PP7A 1TZZA 3CV6A 4GC3A 3UJRA 3ZLGA 1N2VA 5HQEA 2R1MA 3SY5A 3HB9A 3YPIA 1SZEA 2JALA 2CLIA 3DHPA 4TVUA 3WLTA 2JFEX 4RJEA 3HF3A 1OG6A 3TJLA 3AMDA 2O4QA 4PMNA 3H2CA 1J6PA 4JKLA 3KP1A 2EG8A 2CZ5A 4TX6A 1IT8A 1QUMA 1DOSA 1LJYA 1N8IA 3LCLA 1C3FA 3AHTA 3RX2A 4H9ZA 1A49A 1XIBA 2OPJA 2PTXA 4GVIA 1W37A 3CUJA 3BOXA 2G97A 3M6DA 2ZXQA 4PUUA 4M29A 3O15A 3GYEA 1H49A 3S9ZA 1FWRA 4REQB 3UWYA 1E9LA 4Y8EA 4MWAA 4ZOCA 3E0WA 3AMCA 3LMYA 1LF1A 3NPVA 1QASA 3FFSA 5BROA 4ZO8A 1OINA 3MDUA 3VUPA 3M1ZA 4PZVA 1XKYA 1A5KC 1TV7A 2Z1XA 3GIQA 3GNOA 2ZRUA 6A3HA 2CXEA 3NG3A 1EOKA 2A21A 4IP7A 1BSIA 4PB5A 1AW1A 3VO0A 1K3UA 1E56A 4PA8A 2G50A 3B8IA 2OZ0A 4JNYA 1J4EA 1QBBA 2Q3OA 3AIQA 1ZCOA 2QQ6A 4GA8A 2ZZ7A 4UTWC 2ZBTA 3WD3A 2AKZA 2D2HA 1P43A 4IGSA 4YXGA 2X2YA 3JZUA 3WDQA 1FHVA 1QPNA 4B5XA 2QEZA 4JQ1A 3W7CA 5DXYA 3XINA 3LG3A 1BQCA 1POKA 1V3LA 2Z29A 4A8LA 4JAWA 2GJPA 2H9AA 4MSSA 2VFDA 1DTNA 4WJ8A 4NZ5A 2Z6JA 1CXLA 1E71M 4CN1A 4L56A 4XD4A 1F6YA 2VWSA 2F2KA 5LIUX 1VR6A 2EO7A 2BODX 2OYLA 3P8IA 1KLZA 5AYYA 1QI0A 3WJZA 4R53A 3KRUA 3K4DA 3UWUA 1AODA 2NX9A 1DPMA 3GU9A 3S8HA 2XIIA 4E3VA 4UUIA 1UC4A 3WD1A 4YTQA 3Q37A 1UP2A 3W7KA 4UTMA 1KGXA 5HATA 5JMUA 3PZGA 2DU2A 4POCA 2FHFA 1UD3A 4W85A 3UJEA 1XLLA 2HBXA 4XZ9A 1BVNP 3AC0A 5I3HA 1G4EA 4ADUA 3KBMA 2PEVA 3LCFA 1NF7A 1XKJA 5CPNA 1J9YA 3F03K 5DXXA 5EMLA 1PZ1A 4X2PA 3FHQA 1TA3B 2FTWA 3OYXA 1F4AA 2DT1A 4AG0A 1WV2A 3WDHA 1SJCA 3W70A 4Z2LA 4UXDA 1SR0A 4UQDA 2BNJA 1A3XA 1XYZA 1ZZMA 1WE5A 2V67A 3LQLA 5HINA 2VFGA 3QQ0A 1XSJA 2DZPA 2D2GA 1MQPA 3G1XA 4TX8A 2INZA 3P74A 3EX3A 1GVEA 4WVXA 3KOFA 3RJYA 1XCXA 2ZICA 3DZ1A 1S5TA 1C93A 3SCWA 1FH8A 1BQGA 1XLHA 2XH0A 4J3TA 3WH8A 1DJIA 1NWUA 4YU1A 3RLHA 4UFLA 3MUZ1 2DZUA 2J7FA 2DJLA 3BH4A 4I3GA 1C90A 2CHRA 5C2CA 2Y7EA 2AQWA 4DWSB 1H7OA 1HG3A 4LPCA 4UTLA 4CNSA 3PNZA 3R13A 3P8JA 4C7FA 4U28A 3L4TA 4O0ZA 4YYFA 1IEQA 4JIRA 3ITOA 1V3IA 1BAGA 4NT0A 1OGSA 1OY0A 5A6MA 1BPLB 2ZUMA 4H2CA 2G4JA 4MNMA 3URNA 5I06A 2QAPA 2XVPA 3M16A 4J9JA 2HVMA 1LT7A 3BDKA 2DIEA 3HGSA 3SGUA 3G1VA 1DV7A 4HSHA 3I10A 4S3EA 1MEHA 3H12A 4ML9A 3N34A 3ZIZA 1W1PA 1E6NA 4AX6A 2ZWZA 4HPJA 2YLLA 3I6RA 2ANUA 3BLEA 2CKRA 4JY8A 2VWTA 4DYKA 1FX6A 3W85A 1TJ0A 4FXFA 3TYEA 4A3RA 2V5BA 2NX3A 3AJXA 4D6EA 1RY8A 2OYKA 1V6UA 7TAAA 1D7KA 2IQTA 4ACYA 1A5CA 1TRDA 3C6CA 1R85A 5CC6A 1HF6A 1O5XA 4JFSA 1XQLA 2FQIA 1UHVA 3TNBA 2QNEA 4NVTA 4RDWA 1KNWA 2PDQA 4HOWA 4O54A 1TCDA 5HNTA 1BG9A 1WB0A 2PDUA 2VEMA 3U2EA 1TJPA 2O7SA 4L65A 4O50A 3MI2A 3QEZA 3TIMA 4HIBA 2AL2A 2XFRA 4LVGA 1HKIA 4RKAA 3S1VA 3NZ1A 4C91A 2W92A 3VNDA 1G94A 4AD1A 2Y85A 1TE1A 1H2JA 5EFFA 2HE5A 1DJNA 1X38A 2VZTA 2YDQA 3S46A 4OE7A 2EPKX 4RDVA 1BG4A 2XISA 1LQ2A 1UBSA 3KVLA 4M81A 3E5BA 4KF1A 4F2UA 3CHEA 2GQ3A 4FXJA 4W89A 1TTIA 1DWAM 3WFLA 1I6NA 3GYCA 1S2VA 1TVPA 4KGJA 4GI9A 2TAAA 3QF0A 1JRCA 1OADA 5IHSA 4F9DA 3W2NA 1YRRA 3E2QA 1KCXA 3O6AA 4Z2IA 4BEUA 4GYPA 1QHPA 4UCGA 2WZEA 1MXDA 1HKVA 1Q85A 3UCDA 5KETA 4PCTA 3TKFA 2CBUA 1OFOA 3Q94A 1EO5A 4IPNB 4GQGA 4DAFA 3S2MA 5LA1A 3PBGA 2C1HA 3OVRA 4PRTA 4AIUA 5FD0A 1PKYA 1W1VA 2D0GA 1YW1A 1UA3A 3S4TA 4O10A 1NARA 3C2OA 2W27A 2Y61A 3AMGA 3HPAA 4V27A 2HVNA 4DY1A 2AGTA 1GZGA 1XW8A 3DFOA 2ZZ3A 4FLSA 1QR7A 2FZ8A 1MFVA 2PZ0A 1HVQA 2J9YA 1LZOA 5BRPA 4TTUA 2WMFA 4TMCA 2PTDA 3CPRA 1XFBA 3NL5A 1UH3A 2AQOA 4ADSA 1W3NA 3G5EA 3G0UA 2WZIA 3IIPA 1HX0A 1EJUC 1US0A 3GTFA 2FLIA 5E0CA 4MAVA 3VKDA 4E2VA 5GQBA 2NSXA 1FHUA 4ONVA 5KZDA 3TSBA 4J3ZA 4EPDC 5CSYA 4LNCA 4EIVA 2CERA 4DIAA 3SQLA 3OEXA 3GG1A 3RR1A 1SMAA 4H04A 1TPVA 1WZMA 1ZLPA 4WDUA 1M6JA 5DT7A 3UPWA 3AYVA 4LBSA 1N8WA 2PU0A 3HQPA 4L9XA 4ZXOA 3GIPA 1KRBC 4HCHA 3W00A 5AC5A 4JIQA 1CLVA 4F0SA 5FESA 2NXIA 1A5NC 3CL7A 2G41A 1BF6A 4HU3A 4LB3A 4GPNA 2GPTA 5CSUA 2IS7A 1NWTA 3R58A 4ZA0A 3KS5A 3UXKA 1XH0A 3PAOA 3WK0A 4YCOA 2VENA 5HUOA 1UZHA 2PSNA 1JCTA 3CV2A 1RJPA 1KFEA 5FEPA 1GNXA 2YXOA 3SO7A 1DIDA 5EPDA 3G3MA 4AWEA 3ARUA 1ML1A 4W9TA 3AXKA 3PPFA 4QXIA 2E7FA 3VOHA 2OQHA 2PS2A 1OK6A 2YCLB 4K1WA 5JU6A 2G96A 4DBWA 1HGWA 3B03A 1F6KA 1IR2A 2W5FA 4N7QA 1REQA 3K8KA 2ACRA 3LTPA 3W1RA 4AFYA 2BMBA 3E0IA 5GVJA 1UP0A 4DJFC 1UMLA 4PULA 3GDMA 2OODA 1X8FA 3VMOA 2BDQA 3N17A 3LN3A 4BQ5A 4ES4A 4H9YA 3VZYA 2R9RA 4HHPA 3SN4A 1PE1A 3ZMRA 4IFKA 3WJYA 5DT5A 2NVDA 1NU5A 1HXJA 1VGAA 4KRUA 4P5UA 5D38A 3BSGA 3U0HA 1MWOA 1FH7A 4PUWA 4IGNA 1CGUA 3U7BA 2V8ZA 4BI6A 1CWYA 2PRMA 1EF3A 1RH9A 4M82A 2GQAA 1DTUA 3AZSA 5DY2A 4MVAA 4C6JA 4ZFMA 1BKSA 4V1XA 3DI0A 3QHMA 3BAJA 1TWZA 3MB9A 4YNGA 3SDOA 1FHLA 4ZOBA 3WL0A 4NNAA 1XLFA 4LGXA 2YL9A 1EJXC 1KCZA 3QBUA 3U48A 2FH6A 4IFOA 4NJHA 4ZQNA 3FY1A 2WHLA 2UV8G 3EWDA 1QHOA 5K3VA 5U4NA 2O56A 4WDWA 1JUEA 3AXMA 3E1F1 4BF5A 3HFTA 3GH4A 1JCJA 3N14A 2CLEA 3Q2DA 2XFFA 1XLMA 5I6SA 1QNPA 1HJQA 1EBHA 1A5BA 5BOEA 1TVNA 3COTA 4LYKA 1LBMA 3SUTA 3VKJA 2D3NA 4OBRA 5BNKA 1LQ0A 3IIXA 4ZB2A 3B06A 1UPMB 1JJKA 1VRDA 1CGWA 1DQXA 2PAJA 1TPEA 3JS3A 2PGFA 2PTZA 4W88A 1EX5A 1GTHA 4MM1A 5FJRA 6TAAA 4EXQA 4HPHA 2QMKA 2NW0A 1N7KA 1CZ1A 5ECUA 1EXPA 4L5ZA 5XIMA 1RCOB 4RE4A 1XLGA 3U5UA 3UCQA 1RAKA 4BEQA 1DWJM 4KFOA 1TIMA 3G0XA 5FOOA 3DHDA 3LV6A 5A95A 3GLCA 3N18A 2Z7GA 1G67A 1A47A 3TC7A 4HSNA 4W4QA 2IPJA 3WEZA 5H2ZA 3M46A 4A05A 5I00A 1EFZA 3VTRA 3PWAA 1AMYA 1OCBA 1TUFA 1F3WA 1WOAA 3MCMA 3T55A 3IVUA 3HV9A 1CXFA 2HXTA 1DJYA 3OZYA 1V6YA 1EJTC 3TSDA 3NZRA 2GWGA 3M0XA 3QFWA 5DX7A 3R94A 5JIWA 2G95A 1LLWA 3ITYA 4O18A 4PRRA 3UXIA 4NUWA 3GM8A 5DBTA 3BAYA 3C0JA 3HG3A 2VP8A 1E0WA 1XRTA 1I0BA 1CNVA 4M6UA 2D69A 3EA3A 2Y5SA 1SU5A 3KBNA 3S5SA 1XH1A 3TQKA 1J79A 2OT0A 4QBXA 2VZVA 3R0DA 3QPZA 2Q71A 2ZA2A 4U2YA 3IGXA 3R89A 2CIPA 3N1AA 3MWCA 3N15A 2ZIDA 1Y8BA 3M0IA 4GUHA 3THCA 3RM9A 2QUTA 2ZDSA 3BSHA 4XZLX 3PPHA 5EMJA 1J96A 2IMRA 1V6WA 3GE7A 2VURA 4D6DA 1FBAA 4EWJA 1UPPA 2DIKA 4FALA 4X0NA 2VZOA 8A3HA 1CI1A 4W5ZA 3Q4DA 5CPSA 1Y0EA 1VBRA 3V3WA 1JR1A 1Z44A 5E93A 3KTXA 4J28A 3R79A 1VD6A 4KT2A 4NHVA 3N73A 1ZENA 3ARYA 4O1CA 1XWYA 5DCEA 3E2VA 1XIIA 2FZNA 3VMPA 3IACA 2YLAA 3PPGA 1R7AA 5CG0A 1O6IA 5G2HA 4D8ZA 1E51A 3STCA 3W86A 4GKTA 1TWSA 2VDIA 4NJJA 1DJHA 2NWSA 1TSIA 3OOQA 2QXWA 1E15A 1EZ2A 1SZNA 1F5ZA 3UJSA 1TPUA 4RV3A 4PC8A 3TWBA 4UTJA 1WAWA 1TWDA 4KWSA 1XISA 3BV4A 1JCLA 1J10A 3GNPA 4DUXA 3UZ5A 1ONRA 2VT0A 4CGTA 3MWAA 3I3DA 4ZSUA 3D46A 1ZP3A 3IJ9A 1ZUAX 2VKZG 2DSUA 1XC4A 3O3RA 1XIFA 1C92A 2AAMA 3RITA 4KMQA 1ELSA 4WJXA 1FDZA 3RMEA 1F2JA 4XO6A 4HZ6A 2HISA 1ICQA 5CBJA 4FF5A 1QNQA 3BG3A 4EAYA 2CITA 1YXDA 4DWSA 2Y0FA 4U5IA 1JF5A 4EF8A 4XVEA 2ACUA 4N9BA 3ZT7A 3ZR6A 2HWGA 2ZA1A 4XIMA 1YE6A 1M68A 1BWVA 1XIJA 3OODA 1OGBA 2WAGA 1EA0A 4HNVA 4DJEC 5EBAA 2BOGX 3IK2A 1KWKA 2YFOA 1PHWA 1EP1A 4TVDA 3OW1A 4B16A 4DQWA 5G2IA 4RPPA 4BWLA 2QCLA 1UASA 5BRQA 4CD8A 3IGHX 4ATWA 3L0NA 3NZQA 2HCVA 4HNNA 4FB7A 3W25A 3AYSA 1IT7A 5XINA 1L2QA 2CLLA 4XK2A 1V3HA 2BY2A 1T7LA 3PZMA 4K7VA 3GXNA 1QMLA 1OFQA 1HJWA 4XD3A 4S38A 2JQXA 4GBUA 3SFKA 3HG4A 2DT2A 1VEPA 3THDA 3VD5A 2QUMA 1O66A 1KRMA 4H6KA 2Z26A 5H8PA 5FJTA 1EC9A 4GK8A 3VE9A 2ZX7A 2HSAA 4QIUA 4GYFA 3OQEA 4AMCA 1IGWA 3FOKA 5CC7A 1QHZA 1JPKA 2PDCA 1QAPA 2CBJA 3VA8A 3LENA 5HMDA 2EHHA 3FA5A 4PUMA 3LBOA 3NZPA 4I5UA 4H1ZA 1G7UA 3M0HA 4K7YA 4MNLA 1Z3NA 5HWJA 2FVMA 3DX5A 4LUTB 3SQSA 1EWEA 5DMYA 4IMGA 1TPFA 3ZZ1A 1IEWA 1XV8A 3K46A 3B8SA 2QVNA 5K4XA 4TIMA 4YWIA 2UY2A 3CB3A 5H1WA 1V6XA 5IM51 5AKQA 3KTSA 3IEBA 1O5KA 2E6DA 1SO4A 4HU8A 3TCEA 4HNTA 3TFCA 4ZZ9A 2VQUA 3HU7A 3MV01 1RA0A 1JPDX 3LI0A 4Z0SA 3UG3A 5A6BA 3WBWA 4DYEA 1OG0A 1XCWA 4FNRA 4Q8QA 3R8RA 1AQMA 7TIMA 2EJ1A 3GBEA 2DZVA 3CLMA 4RE2A 3MW7A 1J0ZA 4V28A 1LUCA 2EPLX 1TFVA 5LA2A 4GIEA 4LVFA 3SGGA 4ENLA 1W3TA 1GOMA 4WHBA 2GK1B 1SZGA 3SCUA 4QP0A 1R0MA 4ZENA 3BV7A 5LKYA 3FVMA 3K1DA 5CPTA 2WCAA 4J35A 4C90A 3P0XA 4BR1A 1MRAA 4I9AA 4C6DA 2C15A 4NU7A 1CB2A 1V93A 4AEOA 3SR7A 3T0BA 5CZ0A 3BGJA 1F05A 4J40A 1A3WA 2B81A 3CQJA 3CLWA 3STEA 2Q3RA 3CH0A 4MJ2A 4CQCA 1ENUA 4GFIA 4AY8A 1FWJC 2HJPA 2PWDA 1Q6EA 1F8IA 1E6XM 4JX4A 3N4FA 4HJFA 3MSGA 4DZAA 2XH4A 1F3EA 3W22A 3QQWA 2I57A 3CMJA 4PL1A 2WZMA 4QFUA 1CDGA 2XGIA 2W79A 2OT1A 1A4MA 2P3EA 3NQ2A 3S6DA 3TYBA 1J0JA 3KWXA 2WCGA 1SFSA 2TPSA 2H6RA 4AVOA 3NL2A 1LWIA 4WGHA 2EKGA 2QJNA 4NY2A 2H3BA 3OLDA 4KEZA 3DFHA 4YLWA 3ICJA 4A4AA 4JDBA 4CLMA 1AD1A 1OB0A 3KL5A 5C9RA 2VEFA 3UZZA 2VCCA 4NZFA 1JL8A 2OJPA 3KRBA 1E1CA 4ZVJA 1XUUA 4FLRA 2ZC8A 1H1YA 2W0UA 1UB3A 4RW5A 5TNVA 5E09A 2VDHA 3DG7A 3FAXA 3V18A 1EDGA 3ARWA 2D1ZA 4MY9A 4O1DA 1TB3A 3T4WA 2PGEA 1RVKA 2DUXA 3W23A 2FHCA 2XIOA 2J79A 1MW1A 4G5DA 1J2WA 2OKOA 6XIMA 4G1KA 1LG1A 3TA6A 4H01A 3FGCB 2J9XA 3LQGA 5T8GA 1V6TA 4UQEA 4G56A 3FJ6A 4UNKA 1B31A 1C91A 4O4VA 1A3HA 2X05A 4HTBA 2OGYA 3QH2A 3UYIA 3G1RA 4YMZA 2OFJA 4NKCA 2A3HA 2VGBA 3WLHA 3W2JA 5D04C 1V0NA 1DWIM 4JZ5A 5IDZA 4NXSA 3A3XA 1QO2A 4GUFA 1CT5A 4JIEA 2ISWA 3JVAA 3QHOA 1VQTA 1U30A 2WYSA 2CBIA 3BQ5A 3TW9A 5A8MA 5LXXA 3JRKA 4PMDA 2PWFA 3KWSA 3EBVA 4O13A 3H7UA 2X30A 1S5MA 3RDKA 3WF2A 3W82A 2E9LA 3GZAA 2OCZA 3T4CA 3TP4A 1F6PA 3H55A 3QY6A 4B3ZA 5JXQA 3KLLA 1NDYA 2VX6A 5G1MA 1AJ0A 1J5TA 1JAKA 5CXPA 1JD7A 1Q6RA 5FF2A 1QI3A 2O4MA 3IJ8A 4OIFA 4AXNA 2BFGA 2HEJA 3DECA 1UR2A 1YBQA 3MUAA 1DIOA 4IG2A 2I5IA 3UA3A 1E9ZB 4GBDA 4PTNA 4FX6M 5I09A 1OFPA 3GDTA 1DVJA 3WUBA 2QVHA 3OLGA 3APTA 1UJQA 2CU0A 4A3QA 4PUJA 4HCDA 3LSCA 5TIMA 1GVRA 4GQQA 4DXVA 3BJFA 4N02A 2OMAA 5CH9A 3I3EA 5A8QA 2R8WA 2NQHA 2CZVA 1PUDA 2DSZA 4IH3A 3F7JA 1G1YA 2VI0A 2QUVA 5JBFA 4RDZA 1GYNA 4Y8FA 3IK4A 1QNSA 4R7WA 4LRTA 3QQ1A 2WLYA 1SO3A 4NNBA 3NO5A 3S2NA 3PHAA 5HANA 3WUGA 4US5D 4NRSA 3CYVA 2WKLA 4PCPA 2VR4A 2X09A 3CEPA 3PTQA 1XGZA 4B91A 3QY8A 1V0LA 2BVDA 4WOZA 3W2MA 7A3HA 4Q32A 4ERIA 1PDZA 1FWCC 1JQVA 2VFFA 5DY3A 1Y5XA 3FYYA 3GVVA 3OU8A 5LGXA 1O4UA 4I8YA 4O1FA 4F48A 1Z41A 1O5QA 1W32A 2QDHA 1M3UA 4K8EA 3GAKA 5G1TA 1WKFA 2J6VA 3BL3A 2GJLA 3UR5A 3AUOA 3ABQA 5D2TA 5LNUA 3HMJG 2P10A 4TV6A 3WUFA 1WZLA 2YYUA 4BF7A 4EPEC 4F40A 3PG8A 2IXVA 1CCWB 1LBFA 4Q4RA 3ARZA 3EEZA 5HPOA 3L9CA 3GBDA 3NQDA 3ME3A 3INPA 4BQ3A 3T8QA 1VPXA 3PBMA 3EMCA 4I7UA 3GTIA 3RF9A 3V1PA 3W7JA 1JZ4A 1HUVA 5A94A 3RN6A 4X9YA 4K39A 4HSOA 3QGVA 1OYBA 5C55A 1W5PA 1C9DA 6PTDA 1W0MA 1FWFC 4KIRA 1SFLA 3LX9A 3WBEA 2Q02A 5A6AA 4UR8A 3H7RA 5A6SA 5EFDA 3I7RA 1W17A 1OK4A 4WUIA 3B9EA 1V4YA 4B92A 3M4HA 3OYZA 4OECA 1JDCA 4ROQA 5AYIA 4YVPA 1JD9A 1A0CA 4DXXA 5FAJA 3PNUA 1VCVA 1C8QA 4GX8A 1FWBC 4G7EA 1H5VA 1JPMA 4J3WA 5C9UA 4GYJA 5FCZA 3DFQA 1QXLA 4GVFA 4N2YA 3OBKA 5EU9A 4IX0A 4B5UA 3MBFA 3MHFA 3W7HA 2ZRVA 3GG7A 5C2XA 4GINA 4ZOAA 3VNKA 1HO1A 5M5DA 2QDEA 1YADA 3C4UA 5LNWA 3BLFA 4AU0A 1UD5A 5D2WA 4NASA 4N6FA 2B31A 2R24A 4HPGA 2X40A 4L6DA 3C56A 1VBGA 2A85A 1OD8A 1PIGA 2A1YA 2F8QA 1K02A 3BZJA 3DHUA 3UA4A 5D02A 3O16A 3THUA 1HKWA 1G5AA 3SRHA 2PDGA 5I24A 1XYCA 4L1GA 1HKMA 3RMJA 1KA9F 4IP4A 2BHUA 3PS7A 3PUOA 4RXGA 2YA2A 1Z42A 3VNYA 4QJ4B 1VBHA 4PMYA 5K9CA 4MJMA 3DYPA 2QCFA 3W07A 1AK5A 4DZIA 2C1IA 5FJUA 1TRIA 3I3BA 4DJDA 3RCMA 1Q13A 3WQFA 1W5OA 4GJIA 2OZ3A 1LL7A 4M80A 1HJVA 1PXGA 1C8VA 4AH7A 4ZSTA 1RBAA 4U10A 5LXEA 4R33A 3WFZA 1PZ0A 2OB3A 3CZGA 1OC5A 3KAOA 2J47A 3O6CA 5TAOA 4DJFD 2BASA 4NAFA 3VNJA 4Q4OA 3UPMA 5DCDA 4KEUA 5BMXA 3QR1A 1KW1A 3OQ8A 1F73A 2Y7FA 4MZ1A 4L7ZA 4K1GA 4A8NA 2E3ZA 2V0TA 5M03A 2JGYA 1HO4A 1ZBKA 5E70A 4HMNA 3W7NA 4NF7A 4WKFA 2POZA 4H8VA 4FI4A 2J13A 4B2DD 4Z2HA 2DEPA 4ZQMA 3BW2A 2ZZ4A 1XIMA 1X6NA 1QW7A 4MZYA 3EKLA 2A7RA 4UZSA 3WSUA 3TONA 3PFMA 2DSWA 3QXBA 3WY1A 2REQA 2Y6ZA 1WDPA 4U33A 2A6LA 4LUSB 5I3GA 2VD8A 4YS1A 1ZS2A 3LZ5A 5HR7A 3DGBA 1FVPA 3CJPA 4JTIA 4LC6A 2DQWA 4FLQA 1XICA 5D9MA 2BZNA 4MJZA 3UBPC 4AF0A 3L4ZA 2XN2A 1NDVA 1WX0A 1HZYA 3ZT6A 3NCOA 3E3HA 4AISA 2GQ9A 2J7GA 3LHUA 2OLSA 2NVAA 1ZJIA 3OP2A 3VOGA 4C6KA 3RAOA 3QW3A 2XH2A 3RCNA 3STGA 2C6QA 3LPPA 1OFBA 3RLVA 1L6YA 4PODA 4LJ3A 3IUIA 4LUTA 4TR9A 2HMCA 2WKJA 4QRNA 4GI6A 4IWWA 1RR2A 2FJUB 4B5WA 3W1PA 1GOIA 1Z32X 3QZAA 2YSWA 1M7XA 3NVTA 4M51A 2PRHA 5DCBA 1PV8A 4WKAA 4Q3MA 4G8TA 3CIWA 1T41A 4UWMA 1W8GA 1PKLA 1P0DA 1KFCA 1UA7A 2RDXA 1JZ8A 2DPEA 2RDUA 3NQ8A 1JZ2A 4FPSA 4XAZA 4LCQA 3OLIA 2RJGA 4D6GA 2DZAA 5AHFA 4LFYA 1X6UA 2R91A 3HGRA 4UTIA 3H22A 1XDJA 3IAPA 3OO2A 3P3BA 4UTHA 1B1YA 2OR2A 3TVAA 3W72A 4ACZB 1P7TA 4U3CA 3MUY1 1IF2A 1XLEA 2GK1A 3W7OA 1HL8A 4K3ZA 5JUVA 3GU2A 1C8YA 2Z2BA 4QG8A 4JEQA 2I5QA 2SFPA 2PCQA 2ZFAA 4W7UA 1I2RA 3V36A 3A9IA 1M1BA 4ILSA 5LNRA 4OQVA 2V9DA 3SADA 4DF1A 2PD9A 3UT0A 3HQ1A 4WQ6A 3TJXA 3KDNA 1BYDA 3H23A 4V1YA 4LVBA 3MKVA 3BLPX 1H61A 1VFMA 3NNTA 2MANA 1LYXA 2JKPA 1NOFA 2GVEA 3R43A 4INFA 2VRKA 4CEXC 5M3WA 1JZ6A 3M0YA 2C8NA 3RO6A 5DLCA 3LEPA 3ZLFA 1FHDA 1UD4A 1KV8A 1UKPA 1K1DA 2XYLA 3HURA 2PWEA 3NZGA 3W24A 2CHNA 3BMXA 4M56A 3B8WA 4BA0A 3BVJA 3FNDA 4LAZA 7XIMA 3GG0A 4XUYA 2OWWA 2NSOA 3NO1A 4HVXA 4WDTA 2GL5A 3G8EA 2ZX6A 2HTMA 2EJAA 3KZSA 2VEPA 3NEVA 3WD2A 4LALA 1JXKA 2PLJA 4GGBA 3WQOA 3WQ6A 1ZPTA 5A8OA 4OUEA 2CETA 3VFCA 5F4XA 3M0MA 1RQEA 1Q4NX 1QOQA 1W56A 2C0HA 1IIGA 3UWWA 5KEZA 2DSVA 2BOEX 2FB3A 4XSMA 3ABRA 2NX1A 2D20A 1OFEA 4UTFA 1EQPA 5CPQA 4HPNA 5HXMA 3UWVA 1BXCA 1UKQA 3E38A 1FP9A 3PSVA 3FGCA 2YL6A 1E6ZA 4MWAE 4UQAA 4C1NB 1P0NA 2MNRA 2ZTJA 2C0AA 3NSNA 4JQ3A 4QDMA 4JOMA 4J7RA 1W3LA 1S2UA 4ZB0A 3CHFA 5KINA 4X22A 1E1EA 2NLYA 3IAQA 2WWDA 4PFMA 2ZUVA 2ISDA 1V51A 5B7ZA 1ESWA 2FMNA 4LVAA 4LX4A 3UNDA 2FZ9A 4S3BA 2GFTA 5GJPA 2BVYA 3N29A 2XN1A 3ABZA 3R8GA 4EVZA 4DBDA 1TO3A 3BXWA 3GW3A 4D71A 3H70A 4KFNA 5E9AA 4MYXA 1LDCA 4C7DA 1CB7B 1SVDA 3E02A 4NJIA 2J24A 1GK8A 4JQAA 3TH6A 3CAVA 4F0RA 3WLJA 3WBXA 1A5SA 3WF3A 2Z00A 3BQ6A 4K2SA 2Y88A 4J2PA 6CGTA 4O1AA 1OFAA 4DZHA 5CQ1A 4JIHA 2AMGA 4KRTA 4IT1A 1T0OA 1OZMA 3VKCA 2O9OA 3N9KA 1US3A 2YCIX 1VPQA 1EYEA 3F4WA 3WDIA 2CLHA 4CNOA 4XZNX 4GQ0A 4J3SA 2WJDA 3W7QA 2EAWA 1C7SA 3VGHA 4JFVA 3SW6A 4X63A 1NJJA 3QZEA 4DNHA 1KXQA 3GHUA 3R25A 1IR1A 1THFD 3SCQA 4FNPA 1TV3A 1W9VA 3VINA 3EWBX 3WQVA 1PTDA 5ENLA 1DQWA 1U1UA 4ZTYA 1XINA 2W67A 4U31A 4NL1A 5AY7A 2RGLA 1NFPA 2DUZA 5K7JA 4KERA 4J3XA 4GIRA 3U5YA 4A8RA 1UKOA 1G4PA 5HQMA 1JUBA 3NAVA 4OBSA 4IMCA 2Y8VA 1JIBA 1LG2A 1QW9A 2DV0A 4HJWA 4PSRA 3ZQ9A 4P7LA 3W1LA 1BD0A 4JTHA 4CQ9A 5DRCA 2INFA 5HAOA 4MKNA 1PHQA 3NJ3A 3SSZA 2IXUA 2LLEA 2BGNE 5E5CA 3O0FA 4MKVA 1B3XA 3L5LA 5FSDC 1VBJA 3IUHA 3MT1A 2CNCA 1VIZA 3WF1A 1W3KA 1Z69A 4M6VA 3ZSSA 4QJ3B 4K8HA 3D0CA 2X7VA 4R88A 2WJFA 4AHOA 1A53A 1JZ3A 1MRQA 5EA9A 3AWNA 3L21A 4NZ1A 2Z0IA 3WH7A 1F3TA 4CN4A 3B4UA 4MADA 3VDCA 2Y62A 3EWYA 4ZB5A 3VNLA 3WQDA 2EG6A 2YB1A 3L2IA 4QAIA 3UZXA 4PCSA 1OC7A 1UBPC 3S42A 1RSCA 4JX5A 3GXMA 4UQ9A 4Q8UA 4OFCA 3MP5A 2C19A 4W84A 5AHLA 4LYRA 5ABFA 1V7AA 3R7MA 4L1WA 5L6UA 2RFGA 1I75A 3AIEA 1ECEA 3TNOA 3CO4A 2TRSA 4FOJA 3HTWA 1KXVA 5LIXX 5HULA 1IZKA 2FKPA 2JKEA 3GB6A 4E8CA 2BP1A 4Q8VA 2OOFA 3W29A 3U4AA 5KTLA 1RZMA 4JR5A 4NX0A 3WYZA 5K9DA 1OFRA 4YTUA 4GUIA 5TD4A 3FSTA 1VFLA 1HP5A 3WDJA 3I4KA 2ZXAA 1I1WA 3E0FA 2I1OA 1EL3A 3B9OA 3HPZA 1PDYA 4WIWA 5AC4A 1RQHA 4HNUA 3V4BA 3AHXA 3G6LA 4AMAA 3L67A 4MAZA 4I7VA 3EWZA 2ISFA 4FK9A 3EZ4A 2CLPA 3AMLA 4BZYA 3TFXA 3HPFA 4UTWA 3USZA 2C91A 3W73A 3W9ZA 4OZOA 1GOXA 5GNZA 4XD6A 2ZKMX 3W76A 2XGZA 5D4YA 1JPHA 4C6PA 2YB4A 3W02A 3VIFA 3LDVA 2BBFA 3O1NA 1LRQA 2J7CA 4R7JA 1I1XA 1IIHA 1SSDA 5CEWA 4FO4A 3WD0A 4MLRA 1PCKA 1VC4A 3AXHA 3P67A 1VFHA 1ISVA 4O1BA 3CIVA 3USBA 1EYWA 3PZUA 1JXJA 1PEZA 2DDXA 3C86A 1UOKA 5D32A 4PFHA 1F7BA 2F61A 3GNRA 5JQ9A 5I2UA 4E38A 4GACA 1J8VA 1I2NA 4XKYB 3S9IA 3VD9A 1G4SA 2CKSA 3A64A 3V0TA 1ZJAA 4B5TA 1E0VA 3ERPA 2A7PA 3IIVA 2PRLA 3FK4A 3W7PA 4WJEA 1OYCA 3TAOA 4O15A 4ML4A 4TU1A 4I9JA 2YIHA 3QGAC 2BXYA 2GUUA 2QDGA 4O14A 1BTMA 5C7VA 1QVBA 3KM8A 1UWTA 4MG4A 4GH1A 2VEGA 1K8ZA 9CGTA 1JULA 2Y5EA 1GHSA 3GFZA 2Y89A 2P8BA 2GLKA 3TYAA 1V3KA 4IIEA 1H1ZA 3B9NA 3EXSA 4AC1X 2FGZA 1J0YA 2R6OA 5HJLA 2QCMA 1JCXA 3PZNA 3C2YA 2BVWA 2VRQA 5LIYX 3TOPA 3AIVA 3IARA 4DO4A 2CLKA 4XWUA 3WL1A 1WKYA 1B54A 4HNCA 4OTKA 5D30A 5JVLA 4JEJA 1UZ1A 1XBXA 2ZRYA 2WBKA 4RR4A 3A24A 4LXFA 1R9ZA 1WDQA 4JN7A 1A5LC 3C2EA 4DZ5A 3ITXA 3M47A 3CB8A 4E8DA 1G69A 1UWUA 3B05A 3VIOA 2C1GA 3LTYA 4XVDA 1YLVA 2HE8A 2GJXB 2V5JA 3TX9A 3BAIA 1XF0A 8TIMA 4HCLA 4MMWA 1JUKA 4GY1A 3FDKA 1GJUA 2E4TA 2QCGA 2VUNA 3KVKA 3E49A 3K30A 1T5AA 2ZXDA 3GC4A 2GDQA 4S1FA 1RJRA 2OXNA 1K8CA 2E09A 1OYAA 4PMOA 3OHMB 4L4PA 2PU1A 2QHAA 4NRRA 2QCDB 1ONWA 1H50A 1J11A 1TR1A 3OIHA 2JEQA 2WB5A 1TJ2A 2DUAA 1Z8AA 4IMDA 1E3ZA 1PZ3A 3SBFA 7CGTA 3VCCA 2BY0A 3FHAA 5FL0A 2TODA 3B9DA 3T78A 3CS2A 1U1HA 1HGYA 2VXNA 5CJMA 1GORA 2E5CA 2ONEA 1H62A 4JCMA 4F0HA 4N0RA 2XPKA 1EUNA 4LWWA 4W87A 4Q8TA 1TYGA 1FFQA 3UXLA 1B0IA 4UBPC 3AU2A 2E68A 3TV8A 2WSYA 4V15A 3KBSA 3MMWA 4AD5A 4F4RA 3THAA 1YPIA 1R3YA 3Q45A 3SCPA 4C5ZA 2ABAA 4KBXA 5F1UA 2OQLA 2PLMA 4QAWA 1LLOA 4LB4A 1XG4A 5BU6A 3W1UA 5D09A 3K2GA 3TTOA 4OKDA 3EEGA 3AJ7A 4R7OA 3MO4A 3E2RA 3BG9A 4B9ZA 4P7NA 3H26A 3RLGA 3REQA 1BKHA 3TXVA 3NSMA 1FXQA 4NZCA 1EJRC 1ZBCA 3CZEA 2DW7A 4U4MA 4QEHA 1TTJA 2F7FA 4F9JA 1F61A 3TUUA 1DEDA 1PO9A 3S1XA 2Y7DA 3SJ3A 4RZBA 1Q6CA 1US2A 5FI8A 1PX4A 3U9IA 1SJBA 1PX8A 2Y4SA 4CEUC 4GJJA 4QDPA 3CWNA 4P8WA 1C9WA 3EOSA 3EKGA 3ITLA 1O94A 1FA2A 1YQ2A 3KE0A 4C7GA 5CZKA 3IGUA 5HPCA 1T6MA 4GCAA 1X97A 3DIPA 2E9MA 4WK9A 1T99A 2VC5A 1KM5A 1MDLA 3VYLA 1BWLA 3W87A 1GVYA 4XD5A 1DIEA 3QV7A 4O17A 3BC9A 5C54A 3ZYZA 1GWJA 1ZAHA 1KB3A 4TTGA 4L4OA 3C3UA 2X1TA 4GO9A 3VC6A 2D22A 2J25A 4RW3A 3VU2A 2X2GA 4P7RA 1JCMP 4L61A 4RK8A 1KR0A 3KHJA 4CD4A 4Q4SA 3K8MA 3PULA 2GGHA 2WCSA 4HYVA 4WXYA 4IXXA 5HNUA 2G37A 3V1HA 1KM3A 4S2BA 3P5YA 1LROA 1W8SA 4D6CA 1FKXA 3SFWA 1Z9AA 3IJIA 1FWEC 3GZ3A 3QTGA 4PB4A 2V3DA 6REQA 3UJFA 4UZUA 2J88A 4W5UA 4ZQPA 2OZ8A 2F84A 3TEVA 1MO0A 1JI2A 1LM1A 1H7WA 2YR1A 1RP8A 4NSBA 4JTKA 4UOZA 3NO3A 4OV9A 1LBLA 3UGVA 3DAQA 1R38A 1MW2A 3CQIA 1ICPA 2WPGA 2E8YA 3L5AA 2WMJA 3LLXA 1S2WA 3ZVIA 3ALFA 8CGTA 5CLTA 1B3ZA 1ZAIA 4R9XA 4CQBA 3CQHA 1ISYA 3SCNA 1JVNA 2JIWA 4LEFA 4ERGA 5I02A 3SQMA 1E4MM 2YKKA 1GUVA 1YX1A 4JHMA 2D0HA 4RDYA 2YL8A 1XBYA 2AL1A 3CTTA 3AFBA 2VQTA 4Z1AA 1G4TA 5FEWA 4GZ7A 4JN6A 1OCNA 1BYCA 5FEZA 3UCCA 3MC5A 1S1RA 1W5NA 4OU1A 5CGQA 2A5HA 1KO0A 3EPNA 3S5ZA 3GWQA 2ZUWA 3N2MA 1SO5A 4OVXA 1ZJHA 3AALA 3URBA 1I0DA 3AAMA 2Z25A 3K1GA 1UWRA 4PUKA 5AYBA 2JGQA 1E9YB 2VDGA 4LS2A 5F2IA 2VC9A 4M6PA 4U5KA 1EPXA 1GKRA 3GDBA 2PDXA 1QCWA 1W9UA 2X1SA 4A6GA 1V3JA 4Q8WA 3VM5A 5I79A 1A5UA 5REQA 1W1A1 5M1TA 1T8XA 5BZAA 1AQHA 1BEUA 3LHVA 3L4WA 3RJXA 4JTGA 4YTTA 3NUKA 1SZRA 2DQXA 3BWWA 1KKOA 3UZWA 4ZQOA 3EOOA 1P0BA 3GXDA 4MUZA 3MJYA 3FEQA 3POCA 4WF7A 3GR8A 4D6HA 4PBGA 3VX0A 2W4XA 4AWUA 1JYXA 1SFJA 4HT3A 4JS3A 4HB7A 3VGDA 1ZL1A 4H7VA 1E40A 4IMAA 1LOLA 3EKZA 3NXFA 4A3HA 1GQLA 3W7IA 1D9EA 3D5HA 4OJYA 3GHSA 2X1UA 3GVWA 4IISA 5ABTA 5EKYA 4PMJA 1OBAA 1AZ1A 2E5DA 4EK7A 4MWAD 1VFSA 3CHDA 1JGIA 1O5RA 4BS0A 2B7QA 2WMKA 2GSJA 4LVDA 3SRFA 3OVPA 3SCTA 5HMEA 3G1YA 2DVXA 1YNQA 2HQAA 4KPLA 2QT3A 1ME8A 1HFBA 1V08A 4N4QA 1G0CA 3BLKA 2BXVA 1JFXA 3H53A 3NPUA 3TN5A 1IXNA 1W9XA 3E2SA 3EX1A 1KV5A 4CN6A 3MQTA 1CGTA 1AUSL 3MANA 4LU0A 2Z27A 4AWTA 2OWXA 3SY1A 4G1NA 4PBFA 4IQLA 1MNZA 3EDDA 3W01A 4TX9A 3V5OA 1E3XA 2DZBA 4M7SA 2EF9A 4S3GA 4O28A 2C13A 3CUXA 3ANYA 3M7SA 3MUXA 2FPTA 1F4HA 4A22A 4AZCB 1PS9A 2WOQA 4HZMA 4QQUA 1RPKA 2A3LA 2PLCA 4GUGA 1U22A 3TXZA 3UFYA 3WNPA 4GQRA 3HN3A 3ZVHA 1V5XA 1UR9A 1TPWA 5LSMA 1BGGA 3AIBA 2PDFA 4QEEA 5A6LA 2VFIA 3W7EA 3LU2A 1R86A 1VHCA 1DJZA 5DMMA 3FYOA 4EF9A 1A0EA 3EXTA 1XLIA 2OX4A 3WJSA 3KHDA 1PYFA 4KWUA 1DWFM 4IGMA 3O8AA 2PDYA 3W53A 5AB3A 1L6WA 3PB0A 1UR3M 4XQ6A 3VOIA 4E2BA 3G1SA 4JTAA 4ICCX 3RK8A 3VABA 3VIHA 2YCEA 4BJHA 2EGZA 1EJWC 3UR7A 1DHPA 2WVVB 3FA4A 4HP5A 1MYRA 4CCEA 1YDYA 1XXXA 4OOZA 4PTMA 2PUZA 4WSKA 1XYLA 1O1HA 4UMCA 3WENA 3TSMA 1B3WA 3EDEA 4NJGA 2WO5A 3PTMA 1OHLA 5HWMA 5F4SA 4PMRA 4UTUA 3EWWA 4QQ3A 3V35A 4UTKA 1WCGA 4IMFA 1KFBA 4PL2A 1OM0A 3KTCA 1KR1A 2F6KA 1NEYA 4FLOA 1HTIA 3T2PA 4JYDA 2BHYA 3CBWA 1QRQA 4CQAA 1H4PA 3IJLA 2YZRA 3LNMA 4G7FA 3LOTA 2WSKA 4NILA 1R7OA 1QO5A 1UUMA 3FVDA 1KD0A 2Q09A 3WEMA 4NZJA 3LERA 5F7UA 3CHVA 4PMQA 4B3LA 3N2BA 1QPRA 1XLKA 3JZEA 4JYEA 1ISXA 2ALDA 3AYRA 4FX7A 3VKAA 3WQWA 2PLKA 1NELA 3ZXWA 4EACA 3O63A 5A8NA 3W1AA 4UFIA 4GY7A 2B0MA 5FL1A 1WDDA 3TN3A 3GDRA 3H4GA 3LXCA 5HR6A 3GKAA 5DQPA 3S6OA 3TN6A 3MHGA 4C60A 5AZ1A 3SUSA 2GQ8A 2XH7A 5DRIA 5IRPA 3VIMA 3P82A 3S3GA 2XSBA 3M44A 3Q58A 4ZMGA 4LCRA 3AYTA 3O6DA 3TLLA 3BE7A 4BHYA 4B9YA 2Z2UA 2NQ9A 3FJNA 4PBEA 1ONEA 3NQ6A 3C2RA 1B9BA 2GJXA 4UFMA 3R6IA 1MW0A 1W31A 1M9HA 2Q8XA 3DI1A 4RZ5A 2DZTA 2PURA 4KFPA 1TJ1A 2C18A 1IV8A 2BXZA 1LOQA 1ITXA 4V2XA 4MIMA 3A4XA 1R47A 2OTDA 1PTGA 3F1QA 1XRVA 4H7CA 3ITTA 4NX5A 3T07A 3T0AA 3BCJA 2J4GA 4DJEA 1QI2A 4ZE5A 4Y7EA 2VR5A 2G8ZA 2Y5JA 1WDSA 2PDBA 1PWMA 4AD4A 4WLCA 1PB0A 3MA8A 2CZFA 3L5MA 4IL0A 1ISZA 3A13A 1XC6A 3E0LA 4L4MA 4FIRA 4J4KA 2YA1A 1P6WA 4AIOA 3G0SA 4AZHA 4LY4A 2XDFA 4I5RA 3DHFA 4MUPA 4F8XA 1XBVA 1Q66A 5ABGA 3LCIA 4Q4KA 3MVTA 3LS9A 2D73A 4FIQA 5LYRA 4H8HA 4LF1A 4V33A 5ABHA 3CZ8A 3CZLA 1RUSA 4FMVA 4Q8MA 4CD5A 3L4VA 1P4CA 1IEVA 1OF8A 4JFUA 2W91A 4AY1A 3VD7A 1FWIC 3NSXA 2WANA 3LHZA 4O1EA 3SN0A 1D8CA 1AH3A 1A5MC 2PDPA 2BHZA 3U2CA 4G9PA 4DXKA 4NG3A 2CLFA 3FLUA 3RU6A 3EOUA 3SIZA 1UR0A 4BCEA 3CV1A 4H2HA 4M5PA 1YTDA 1OT2A 2VX4A 3KZPA 3T44A 1NOUA 4RL3A 3SUUA 2P0IA 3W84A 2P76A 1QPKA 3WLQA 3WG6A 5JIPA 4KEMA 4RNHA 2OELA 1CLKA 4DN1A 4GABA 5HMFA 3S2CA 5FJOA 4JTTA 1QOXA 3BICA 5MKGA 4FZIA 5AYXA 4JCLA 4CCDA 3GKFA 3TMQA 5IXEA 1PTAA 4QE4A 5CGMA 1K6AA 2YW3A 5I07A 4DUWA 4IXHA 3ZJ8A 1OABA 5H91A 2FGLA 4QNEA 2QULA 4K8GA 2O9PA 1D3GA 1AJZA 1UZDA 1IEXA 2PTWA 2VELA 3TCSA 1LWHA 1DBTA 1AJ2A 1SZFA 3NGFA 2TYSA 3W2LA 5LHEA 4X0VA 2JEPA 3S47A 3DESA 3GXPA 2QIIA 3PBWA 3LV5A 3UY8A 4WDXA 4DO6A 1TZ7A 2WQPA 1XBZA 2R1NA 3N2OA 1DP0A 1J0HA 2GOKA 2PDNA 4M7TA 5DMLA 1W2VA 4PYSA 4NXKA 4QJ5B 3BK0A 3WMSA 3JW7A 3W7GA 1XPYA 4DBSA 3KCLA 1AL7A 3V0SA 3WLLA 2H9AB 5CAKA 3QY7A 3TQVA 1H0GA 3WNMA 2R82A 4DJDC 1HL2A 3DOPA 4QDWA 4R27A 3S2LA 3UG8A 3B0UX 2X42A 3P5ZA 1HJSA 4ZO7A 3WLKX 3AS1A 4IIDA 1YDOA 3KCJA 3WELA 3M43A 1Q6DA 4HK7A 2IQ0A 1Z6KA 1XYBA 3ARTA 5HJXA 2D3LA 5BXRA 1EO7A 4XUGA 3LXAA 1SFTA 3AXIA 4N9DA 4Y9NA 1V3MA 1KTNA 4L9YA 1GEHA 4UFKA 4Z1YA 3XIMA 2V3GA 1XQKA 2PDMA 1EHAA 3S2JA 3IPWA 3MTWA 5M2FX 1R9YA 4IGHA 4GJ1A 1WO2A 2PODA 4CCZA 1VHNA 3DUGA 2WNNA 4F2BA 3W2KA 2P88A 3EOLA 3LTSA 5A2BA 3GAYA 2PWHA 2J74A 3MI6A 5GJMA 2E6YA 3V0UA 1XM3A 2O92A 4GMEA 3GFXA 1TMQA 1A0DA 1B57A 1IWAA 1VENA 5DELA 4CKQA 2VHLA 4G6CA 1VP5A 1FWNA 1KM6A 1UMYA 2NZLA 2ZVRA 3GG8A 4KCUA 4E4FA 3R8HA 2XN0A 3NURA 4YJ5A 3VFLA 3VE7A 4GIAA 2V3FA 2DZXA 4QLLA 2KZHA 2VC6A 3LCWA 4C6EA 1BRLA 2P3ZA 2OSXA 1PX3A 4LT9A 2NWRA 1OQFA 3FN9A 1O1ZA 3MMUA 3PZQA 2XIMA 2CYGA 3QPYA 3VK5A 3NQAA 1RLCL 3NWRA 1CW2A 1XDLA 2QJJA 1WXZA 1R3VA 3F2DA 1R46A 4PRWA 2VGGA 4K6AA 3ARPA 2ZX5A 4UTTC 2E40A 3WBYA 2R1KA 3WD4A 4WKHA 1KXTA 4ZO9A 4H9TA 4E0CA 3GD6A 2ON3A 4GI8A 3WMLA 5H8UA 4AIEA 3DFNA 3DEQA 3P84A 2ABBA 3AZTA 2NQZA 3TYUA 1XYFA 5FF4A 1IWBA 3HBLA 4EP8C 4GISA 4CU7A 4REQA 1KTCA 2E0PA 1ZNNA 2ATSA 2FH8A 2V82A 1E6SM 3QHNA 3Q67A 3FW6A 4AQLA 3GXFA 1Q7ZA 1ZJBA 1YTKA 1PKNA 1NP0A 3SN1A 4Z0JA 1KM4A 3W7RA 4AXKA 4Y9MA 4JNZA 5U7SA 3BURA 2FZMA 2VGFA 3KW3A 1MMFA 3PUEA 3B8TA 4B15A 2Y2WA 2V5CA 1XSIA 3AIRA 2E67A 2J8FA 4UQBA 1N82A 3EPMA 3PPCA 2QF7A 3PJWA 2A3BA 3AO0A 3FXGA 3QC3A 2G3FA 3O9NA 2EG7A 1QTWA 1RLDA 3SCVA 3UY7A 1H41A 2XVGA 3QMSA 2VZSA 1Y5WA 3EYPA 4MB3A 1BLIA 3F4VA 3BUVA 4AIBA 3QLLA 1DYSA 1K6WA 3BAXA 3LUTA 1FCQA 2DVTA 4DB7A 4C6BA 1W2PA 5HMSA 1VCFA 3SECA 4KH2A 5BXTA 3A23A 1DWGM 4PMXA 4PN2A 1UJPA 4DNMA 4HPXA 4HZ7A 1H60A 1SJAA 3HV8A 1RY0A 3NEHA 1MSSA 5FEXA 3MI3A 3LA4A 4CUCA 1FUYA 2DIJA 1JDFA 1VIWA 3H2AA 1D2KA 4HYWA 4O8AA 3U6WA 1RBLA 2J78A 3MO7A 3RLUA 3AROA 2CLMA 3ABOA 1RALA 3HPSA 3CMGA 2HK1A 2A3EA 2PC8A 4C65A 4QITA 3PK7A 3P81A 2E6AA 3LLDA 3NOYA 3IJ6A 4BKNA 4GD0A 1JNDA 1XI3A 3PN8A 1V79A 2XIQA 1XYAA 3CUFA 3BSMA 2ISVA 1L6FA 2VR2A 4N6EA 4IL2A 3KRZA 3H2OA 3JU2A 1NVMA 2ATMA 1UR8A 2BTMA 5CSSA 4KIEA 3R0KA 2AAAA 1TA3A 2O7QA 2QGHA 3CPGA 3CUGA 1DE5A 4G2DA 4GNVA 5J8LA 2XVKA 1VFFA 3W1QA 6XIAA 1WXYA 4FNSA 3FX4A 1U33A 3BGGA 1MFUA 1DJQA 3QKEA 4MB5A 2F9RA 3IRDA 1GEQA 2Q8ZA 3A9BA 1QBAA 4RNIA 3DYOA 4LH8A 2ZZ6A 1DORA 2G3NA 1EPVA 4HBKA 3W37A 3H2MA 1JYVA 3T09A 2E9BA 1J0IA 1LCOA 3UQNA 2CESA 1CECA 4M24A 5E6YA 4DWSD 4R3UA 3N6JA 1R3RA 1VYRA 3F2BA 4ZE4A 5G1YA 1XD0A 1EIBA 3EDFA 4R34A 4LANA 3GXIA 1SW3A 3HQOA 2PP3A 2ZUTA 3VDGA 4H9MA 1UOZA 3W3OA 1NFBA 3ONBA 1TPH1 1ISWA 4AYSA 4IPPA 5EMUA 5KITA 2WHJA 3H2NA 1CX9A 1YDNA 3EA2A 3OGRA 3AXXA 4GOAA 1HW6A 3DFSA 3N3MA 3QR0A 1VEMA 3MYOA 1KTBA 1ZGDA 4UR9A 4KETA 3TK7A 3RYSA 4OWGA 1UIOA 2GOUA 2O9RA 5C9WA 4O19A 1TVLA 1EF2A 1B3VA 3BW3A 3CEUA 4I8DA 2J9ZA 1Q2SA 2ZRWA 3C2FA 4U2ZA 1J93A 1MNSA 2X0HA 4M8UA 1RPXA 3B04A 2E1WA 3EWCA 1MXGA 5CCZA 4W8AA 4UNIA 4FF7A 1G9HA 3QV8A 1P0EA 1JYNA 4DVOA 3GK0A 5IHRA 3ENLA 3RXZA 4CCCA 1IWPA 2PP1A 4JN8A 4TVCA 4RNFA 2WHKA 2Y8KA 1QI4A 4ICMA 4Y90A 4K36A 3VPLA 4H19A 1WOBA 3VILA 1O95A 1PWLA 3QKZA 4AZIA 2PBGA 1DE6A 2CXGA 2PCEA 1GPFA 1YYAA 3FJLA 2VC7A 3M0VA 1ITCA 2QIWA 4CVWA 1TG7A 5E6ZA 1OSEA 3NGJA 5CPLA 4L64A 4D9PA 4ATDA 3N6HA 2DVUA 4FEZA 1FWDC 1GW1A 4FA3A 3OZPA 4AHPA 1EC7A 2HNHA 1NDWA 4QG9A 2ZUSA 1PPIA 2OU4A 2FZBA 4LOCA 2ACSA 3UJ2A 1ZBWA 1FKWA 1LLZA 5GPRA 3Q65A 1XIGA 1YKWA 2XSXA 4GZEA 1C29A 3QOMA 4LUJA 3EOEA 4IPIA 4RZ6A 3MPGA 3GQYA 2PD5A 4AYGA 2PDHA 2BWGA 1FOBA 3H2FA 3GVGA 5A6BD 3BLDA 1Q8JA 5I3DA 3U4FA 4X60A 1AA1B 3B4YA 4JTDA 3T2QA 3THQA 3W71A 3WCZA 1TTPA 1Z89A 1SJDA 3ES7A 1EGZA 3TQ0A 4FP1A 1NWRA 1LT8A 2RAGA 3MBDA 2H90A 3ITVA 3C61A 3GO2A 2FHBA 3QC0A 2J8TA 4ZO6A 3DENA 1FCBA 3UVIA 4F0LA 1KGUA 3O7UA 4KWVA 2GGJA 2R1LA 1GOQA 2YA0A 1UROA 4GRSA 4LRSA 4XZHA 2FYMA 1AQ0A 1MUWA 1K8YA 2FZDA 2ZX9A 4ZL1A 2Q01A 1SSGA 3NQCA 3PF3A 3VIJA 1FQ0A 1R3QA 1TV4A 5IBXC 3OJGA 3VOJA 1GVSA 2V5LA 1J01A 2FFCA 3GDLA 1EOMA 2QCHA 4JDYA 3WIJA 1KBLA 2G4FA 1FWTA 1F76A 4WD0A 1EX1A 1WDWA 2ZYFA 3RRXA 4IICA 1GHRA 4S3CA 1OD0A 1I8JA 2V2CA 3HIJA 3W7LA 4JTRA 2HPIA 5G2WA 4UR7A 3C52A 3WFAA 2P50A 1EUAA 1WXJA 5EGRA 2OO0A 4QTGA 3VZXA 3MJMA 3MSRA 3SEPA 3UU0A 4B5NA 3UZYA 1K8XA 4X61A 2ICSA 5A69A 2EPHA 1K9FA 3PUGA 1XDMA 3GC2A 3SSJA 1E55A 2VUYA 1GZ1A 3PSWA 4LAMA 4XB3A 4C6CA 2J66A 3QV9A 5J5RA 3IANA 4AVFA 1PJ9A 1VAHA 1NH6A 3WLOA 3NYZA 4QSFA 5M17A 3T9PA 3AU6A 4RE3A 3LGGA 1HP4A 4GNJA 1I45A 1ZQ5A 2VD9A 1JDEA 2YX0A 4C1LA 2UY4A 2YJQA 3I65A 1EGVA 1VS1A 3SAZA 3BCFA 1M5WA 3E74A 2OKTA 3HPXA 4ATLA 2AKMA 4GXPA 4A2RA 3WLRA 4P7QA 2PZNA 3K4WA 1XLCA 1WUFA 4Q7BA 4WSJA 5BXPA 4YL2A 2YCLA 1RCXB 3FS2A 1DWHM 4KW2A 2ZUNA 3KEHA 1GVQA 2AMXA 3ZT5A 2PP0A 3N6QA 3T1GA 3L4YA 3W28A 1X96A 5FJIA 4K68A 3SCSA 4XTDA 1TWWA 2EXOA 3MMDA 4WEVX 3P2VA 1R2TA 4FAMA 3TTQA 5E1QA 1RD5A 4NZ4A 4DAIA 1NQKA 4S3FA 1IHIA 1XYMA 3M0JA 2GYIA 1RP9A 1ODZA 1SYTA 4EOUA 2WXDM 2Q8LA 3GFYA 4MB4A 1L8PA 1ZHAA 1KBKA 3ATZA 3PWIA 1M65A 5H6HA 1I2PA 5C0QA 3HJEA 4XTIA 4PSPA 4F79A 1BXBA 2V3EA 4RUBA 2FB2A 3ORWA 1V8EA 1B4EA 2YXXA 4DX3A 3AOFA 4JL2A 4XAFA 3TR2A 1TKKA 1VZWA 2Y24A 4QE1A 1HQTA 3FSUA 2Z1VA 4S39A 1SR9A 3VDAA 3WNOA 1OVDA 3W88A 3GHTA 1ZRQA 2RHGA 3D3AA 3BPWA 4LF2A 3M5VA 1TR9A 4TQTA 3FYPA 4MNJA 3ZFHA 2A3AA 3KOZA 3KL0A 2I9UA 2PC4A 4M1BA 1IXQA 1M7OA 3GH7A 4LAOA 3BGAA 1AW5A 5I7GA 3LYEA 2XFWA 3BLLA 7ENLA 2VX7A 5FF7A 1AFSA 1RBOB 1W6TA 4YCPA 2DFAA 4JTQA 1GQKA 1TMHA 1R3SA 1IT0A 3FAWA 2GGEA 1VLIA 3AS3A 3WX7A 1V6VA 2VFEA 1Q65A 2OEKA 3BZGA 4KCWA 1JGMA 2WMGA 4XZIA 2VCBA 2OSWA 1QK2A 1ZCCA 4H6RA 1BFNA 3SGZA 3V5CA 1X1NA 2OX1A 3C5QA 3OIXA 2WM0A 5TQLA 3NL3A 3UYCA 3TZFA 4NAEB 4YIWA 3POHA 1RCQA 1K7EA 2V81A 4N9CA 1TIWA 5CG7A 3MZNA 2HROA 4Y2WA 3BANA 3N04A 4GWEA 3S0CA 3EGJA 4JYFA 5FACA 2C7FA 1TPB1 3UXAA 1QWGA 1DXFA 3P93A 1GOKA 1JDDA 5KZ6A 1VRXA 2VO5A 1MQQA 1WNOA 1M01A 1XIHA 1EQCA 3FKRA 1XIDA 5GNYA 3L66A 1WZAA 1MQRA 4HHLA 1CXKA 3DCPA 1KBIA 2C71A 5EY5A 3RCYA 2HXUA 1WPCA 1U1JA 3T0CA 1EBGA 4TMBA 3EB3A 4UC5A 1TWIA 4RPQA 3ONCA 1S38A 5C9XA 4E2OA 1FXPA 3NA8A 5HDRA 3ZWTA 3GTNA 1K03A 4C6NA 4NYYA 1LQAA 1KXHA 3CUIA 5DEZA 3CGTA 1W1ZA 4UOQA 1IYXA 2VGIA 2X1IA 4W86A 1PSCA 3DKJA 3C0SA 1O7AA 3EAUA 4XSLA 4S2CA 3ARVA 4RLIA 4CNNA 2Z7KA 1LUCB 2A7NA 4UNLA 1XPGA 3OB8A 2ZQ0A 4YHGA 1LL6A 4D6FA 5ECVA 4DI8A 3TLQA 5ABEA 1EZWA 2RKXA 4IP5A 3LRMA 3TE9A 4ZXLA 4HMCA 3QZ6A 5HWNA 1B3YA 5BW6A 2FMOA 3LBCA 4Q4QA 1ECQA 1P5BA 5I78A 1ITQA 2ZXBA 3S9YA 2EPNA 2QV4A 3ITCA 5T9BG 3G2GA 4M6QA 2NV1A 1UKSA 5HBFA 3LGDA 3WJXA 2XVNA 1XRSA 1WZKA 4OOUA 1P0KA 2DT0A 4WXZA 3SURA 1ALDA 4MF4A 2GVJA 2PFHA 4DJDD 4AZ5A 4ZTXA 4KKXA 5B80A 1ZFJA 3B8DA 1JRBA 2KX9A 4H6QA 4ICNA 3CIXA 1UW9A 3BMVA 2PDKA 5EMMA 3W7DA 2NXGA 2MUCA 4D1IA 3UETA 1VJZA 3DBNA 1FDYA 2CW6A 1Z7AA 2XWDA 3R5EA 1UYQA 1V02A 3CUHA 1X8CA 1E0XA 2IUZA 3O2LA 2V68A 3GNNA 4HK6A 1YHTA 3K8LA 2GJRA 4UCFA 1EEPA 2GDUA 4Q22A 1S2CA 1UP3A 4DO7A 1E1CB 5DO8A 4JY9A 1WYIA 1UH2A 1W9DM 3BTNA 1T96A 4JPGA 5LIKX 1JDAA 4M19A 1HIZA 4KWWA 4Y9OA 3O0KA 3NQMA 3CNYA 3SCOA 2GGIA 1RD6A 2RUSA 3G8RA 3S83A 3R11A 3BLOA 1BYBA 3IV8A 4EKJA 2XM2A 1NOWA 1K4GA 2J27A 1PVNA 4L1XA 1OEPA 9XIAA 1L8NA 3STPA 1Q3NA 3G3DA 4UFJA 1WQ5A 3GH5A 3DDMA 3V16A 3IJDA 1ZAJA 1PIFA 1YNYA 4C6IA 2KAUC 2J7DA 3QOKA 4LV4A 1R8LA 5BMWA 3OG3A 1UQYA 2V38A 2ZTKA 1H1NA 3OHIA 3SI9A 1HKJA 3F4CA 1DQUA 3LGEA 3N11A 2I5GA 4GLEA 3SIMA 5C71A 2JKAA 4O4WA 4H6EA 4JHOA 5F2MA 1V77A 1I2OA 4I9MA 1GCYA 1OF6A 3PY2A 1Q2RA 4GKLA 1JYWA 5IFTA 1L6GA 3C8NA 2D24A 5EBUA 1W54A 2OQYA 2WMIB 4P8VA 4Z08A 1TPC1 1XR2A 3LCHA 3B0PA 4D6IA 2F2HA 2IKIA 4D8LA 3K5XA 4PGLA 3CT2A 4ZEPA 3OA3A 4X2RA 3KFTA 3ISIX 1W91A 3QRHA 1W3HA 4AHQA 5FF0A 2PTYA 2NLIA 2VL4A 5K9XA 2WNZA 3A3WA 5LA0A 1P6CA 1H7XA 4D8AA 2GUBA 3WZ0E 1H7NA 1DIKA 4F3HA 2DP3A 2FVKA 3VZZA 2BSLA 2PBOA 2G5WA 4IFRA 5BRBA 3UR8A 1YBQB 3P60A 4AEFA 3DERA 1XP3A 1B9ZA 2FVLA 4IG2B 4E5TA 4MWAC 1LL4A 3A4JA 1Q6FA 2VTFA 1ZALA 4CU6A 3RM4A 4P61A 3I7SA 4O52A 3FIGA 3LRKA 3TDFA 3GNDA 2TMDA 3QN3A 4Z2KA 1ZTVA 3A21A 3M9YA 3UZJA 2ZZ1A 4N42A 4DO5A 1ITUA 2QJIA 1B3OA 1BGAA 2DW6A 4LYPA 2X8RA 1SPQA 5HA7A 4LQ1A 5G4WA 3TTYA 1HVXA 1CXHA 3DKLA 4BK9A 2Y70A 1B4KA 3E9AA 3H7VA 1BWKA 3VIPA 1NAL1 4HTYA 1H7RA 1P1XA 4BFAA 4HYRA 4F2TA 3QYQA 3RU8X 4DUVA 1KM1A 4O0KA 1OWQA 2XGBA 3K4AA 2ZE0A 3LBMA 2HBVA 4RE0A 1JNEA 1YEYA 4FNUA 3FKKA 2H8ZA 3E6EA 4DELA 3KLKA 3MSDA 3NFUA 4YVVA 3I6TA 2PB1A 3MHUA 4UB9A 4XBSA 2IPFA 3RO8A 3CAWA 3H6OA 2PDIA 4B4FA 3FXYA 1LORA 3A4AA 1RA5A 5I0DA 4A29A 1KWGA 2NXHA 3KBWA 3RX4A 4IQDA 1NIUA 1X7IA 1E1FA 5D33A 3M5ZA 3LNPA 2YDRA 4IX2A 1KLYA 4QE5A 2ZVIA 4GC4A 4J3VA 2WC3A 2RH9A 1WDRA 3EWXA 2GVYA 3F4NA 5I03A 1GVIA 4ZQCA 1E5JA 2QS8A 3KOWA 5TF0A 2VJXA 1V7YA 3F4DA 1GJWA 3HFYA 8XIAA 1VEOA 3D47A 3W6YA 3CYJA 1W9PA 1GW9A 4PUNA 2OYMA 4UOJA 3V7PA 1S5VA 2Y8UA 4IZGA 4JTLA 4Z1CA 4WGXA 3N25A 3WK3A 3WQPA 3QFEA 3HGOA 2P0OA 1MEWA 4DWDA 1FCUA 4GXWA 1YNPA 1E73M 2OLAA 3V75A 2PF8A 3MV11 4MHBA 4O53A 1VCGA 1P1MA 2XIJA 3I6EA 2WSRA 1KBBA 2O9TA 1OX4B 2YBUA 3NM3A 2WZTA 3WF0A 3W26A 5H8MA 4C1KA 4HD5A 4OUIA 3QJAA 4C6LA 1UD2A 3ZJKA 1K9EA 4QJ1A 2UZ9A 5DMNA 3HZ3A 5XIAA 3HQNA 2QLYA 1AL8A 4KS0A 2WZHA 2R94A 3A6OA 4AUBA 4G7EB 1K9DA 2A0NA 3L23A 3ABXA 2WNQA 1L0PA 1IXPA 1H3GA 3CV7A 1Y65A 1KBJA 4D1JA 2OWCA 1LTDA 3N9SA 4Q6XA 4WY0B 3GU1A 1VYSX 3ARRA 3AWOA 5SWUA 5FA5A 2QV5A 4MY1A 4GFSA 4WRHA 3TA9A 3BOFA 3GSMA 1XGEA 1K7FA 2JK2A 4Q8PA 2GDVA 2YDSA 2NQJA 5AHNA 3UWEA 3ALGA 4J3UA 4GVGA 3N12A 3QM3A 5CPMA 1Z48A 3DFPA 5D9NA 3MYPA 1ZP4A 2IKJA 1ZSXA 2XIBA 2WSQA 5LIWX 4D72A 5AHIA 2XWEA 4XAYA 1XUZA 1O12A 4JQ2A 4DLMA 5I77A 4ZGYA 1GYMA 2GSHA 4GZJA 1OC6A 4JHZA 3N2XA 4NNCA 1Q5MA 3KVJA 1OX6A 1C8XA 1TV2A 3WQ4A 4LS1A 3WJWA 3DYMA 1WUEA 2O55A 5C2GA 1NSJA 3VOFA 2VCAA 4MPQA 4IJBA 4E6MA 3OZOA 1EHNA 4QM1A 3EB4A 1E4IA 3GXTA 4O57A 5I3FA 5A3HA 3U8GA 3PWGA 4PTWA 3KL3A 4AB4A 1CXEA 1J18A 1EJ7L 3M6YA 3GS6A 5C6MA 1U2YA 1K9TA 4NAFB 3WLSA 3CAKA 4AC7C 3C2VA 1MZRA 2P5NA 3ARXA 3E12A 1X98A 3O07A 3RHGA 1VB9A 1OIFA 4QISA 1WBJA 1U5VA 4LEQA 2QR6A 3PUDA 4F0MA 1XH2A 2EQDA 4LAUA 3IGSA 1QI5A 3PJUA 1DJGA 2HK0A 1NM9A 3URAA 4GH3A 2YFNA 1L6SA 1OX5A 1I9CB 2V63A 1UKTA 3R10A 4R9OA 3TQPA 1OFDA 1AH4A 5CKSA 3T7VA 3SJNA 2REQB 3OG2A 3RNDA 4D2JA 4QNWA 1LP6A 2ALRA 3GVQA 3ARSA 1AQFA 4NAEA 4QLKA 2NVCA 2CHOA 5GJNA 1TQXA 1QWKA 3VD4A 4S23A 3ZLHA 4FNQA 4AF0B 1RK6A 2ZX8A 4JTEA 4ZR8A 1SW0A 2E25A 1IEIA 3C3NA 1I2QA 2PA6A 2WPBA 9RUBA 3MS8A 3L65A 2IKHA 1JZ5A 3G1AA 4AVNA 2HNEA 1SM9A 2V2HA 3LSBA 4GYPC 1BYAA 3F5LA 1CYGA 4LUYA 4Z1BA 2B4GA 4FR1A 3F5JA 2QPXA 3PJTA 2ZZ5A 5AVNA 1HKKA 4C6OA 1GG1A 1QU4A 4RNJA 4C6QA 3OVGA 3EB2A 4CU8A 3KBVA 3G22A 4PCFA 3PTKA 3LD5A 3I7QA 5AC7A 3E96A 3WQCA 3GX9A 4E4PA 1ODUA 2WC7A 4JX6A 2DY3A 3UPBA 1QPOA 1OZQA 4YTRA 3L68A 3TJIA 3UEQA 4Q4MA 2ZE3A 1NP2A 4DEFA 4OT7A 4F0KA 2GUYA 1GVOA 3GC5A 4CD6A 2YPIA 2X7WA 3RX3A 4P2VA 3NL6A 3WMCA 2J7BA 4S3AA 1KRAC 5FIPA 3N4AA 3TJ4A 1F74A 3TROA 2AQVA 4DYJA 1W5QA 2E5BA 4Y6GA 3VI2A 7PTDA 4AD0A 5A8GA 3CO8A 3MCNA 1P7TB 1TJRA 1UR4A 3VGEA 3N13A 3UWZA 1KCLA 3AS2A 3RGTA 3VKBA 3W6LA 1UD8A 1IZJA 3V5FA 4QHRA 1EP3A 2QJMA 1GOWA 2XFYA 3BAKA 4H7ZA 4UMAA 5HNNA 4JL1A 3NTYA 3TYCA 3IV3A 1KFWA 3DU0A 1QNVA 5BOFA 1V03A 2CWXA 1UWSA 3PZOA 4FSAA 1L9WA 4EX4A 1J12A 3IWPA 4JIPA 3UESA 1LOSA 3MP4A 2P53A 1UC5A 1UUQA 1OCQA 2PGRA 1DKWA 2HS8A 2VM8A 1C7TA 1CGYA 3NQ7A 3H54A 3S6TA 3GNXA 1ICSA 2YL5A 2J7EA 3WQEA 4K38A 2NUXA 1VBUA 4JIIX 1VFOA 3BG5A 4UQCA 2DORA 4PTXA 5EMKA 1UCWA 3VIGA 1XLAA 3PBUA 3CK5A 4U3AA 3LHYA 2YCJA 3CUZA 3FV9A 3AUJA 4IQJA 4DHGA 3ARQA 3EMQA 3S5NA 4LBUA 1Q8AA 2G3JA 1TELA 2QUUA 1K70A 3MUIA 2QJHA 2HZGA 5D37A 3EX2A 3NOEA 3GVRA 3BAWA 1E72M 1R2SA 1X39A 1K77A 1HL9A 3CQKA 2F6UA 4R85A 1W5MA 2ISSA 2J6XA 3NM1A 1WKEA 4DUOA 1JCNA 1BVWA 1XSKA 1EKOA 3TU9A 2FDSA 4BI7A 2QW5A 1TPDA 4P7OA 3T05A 1PAMA 3ES8A 4I7WA 5IFPA 3WF4A 5GNXA 3S1GA 2VVNA 3DN5A 1O68A 4OBTA 1TV8A 4MFEA 3W1XA 3HA1A 1I60A 3D3FA 4M3PA 3N4EA 3NVDA 4LUSA 3KCOA 3VOCA 2EBNA 2YDAA 5D2YA 5AZ0A 3CPUA 4IHCA 3VAVA 1E9IA 4H9XA 1FWWA 4AWSA 3F2CA 3GTXA 1Y5VA 3NQFA 1W1B1 2NQ5A 1ZB5A 4HNOA 2BY1A 3RILA 1LRTA 3OBAA 4RZ4A 1F8MA 3QVQA 2CWNA 3PR2A 1FWAC 1S3TC 3LI1A 1Q6GA 1TQJA 4HA1A 2WMIA 4DBEA 3UG4A 4E2DA 3N2TA 1J6OA 2G0WA 3LM7A 3L7RA 4Z1DA 3S5OA 2BLEA 1GKQA 3PVFA 3EX6A 5E0KA 1S2TA 4KRZA 4GE8A 3UR2A 1FDJA 3UP8A 3NQGA 3NPXA 5D2XA 2L5HA 2VVSA 3GTHA 5G4EA 1CTNA 3A47A 4AY7A 4MDPA 4IMEA 5FF3A 1UWQA 2W6RA 3AIWA 2JIEA 3H2EA 2ESCA 1UG6A 1UH4A 4O16A 1PBGA 2PDWA 2BB0A 4AW7A 2FPVA 4HNLA 2YOCA 5DF0A 1EA9C 4O12A 2G3MA 3FCPA 1H51A 2E8ZA 1G6CA 4HK5A 1QNOA 4N4PA 2V2DA 4KQNA 3LLFA 4Q8NA 2NT0A 1KM2A 2WJZA 3IVTA 1FWGC 5AC8A 2JF7A 5A2AA 4PMUA 2ACQA 2I9EA 1BTCA 1U5JA 3W1NA 4ACZA 2V6AA 3T42A 1WAUA 3HGJA 4PEEA 3TTEA 2QJGA 3TW6A 3CQ0A 6ENLA 5BXSA 3TYDA 2OVLA 1UQZA 1KM0A 3UWQA 3NDYA 2BVTA 5JH2A 5BYWA 4HOXA 5TBOA 1GZJA 5T9CE 2DJXA 4P8UA 1E0TA 1XLJA 5J5DA 2WQDA 3SY8A 4DLFA 5CC3A 2WSPA 2R1PA 3QPEA 3W1MA 1XHGA 3A4WA 4US6A 2PI6A 3EMZA 1XL9A 5F2LA 3VGFA 3BO9A 3W7MA 4GO8A 3H21A 1VYPX 4NIRA 1YTEA 2J75A 2YW4A 1TMLA 2ZRXA 1SGJA 3LM3A 4JICA 2ZDRA 3VVGA 2DGAA 1XLBA 2PWGA 3ZJ7A 2PMQA 4DRSA 4US5A 3PZIA 5CPOA 4BF9A 1HT6A 3A22A 1YDVA 2EPOA 5I3JA 4I90A 1YMYA 2W63A 4AZGA 6ALDA 4XO7A 4ADTA 3N2CA 3WK2A 3QYSA 4JTUA 1VFTA 3LCXA 3RIKA 4S3JA 3QV6A 3UF9A 4IIHA 3NPWA 2NUWA 4Z2JA 1XX1A 3CHCA 1GYLA 4YYCA 2YXGA 1R9XA 4XX6A 1GQIA 3VD3A 1F9CA 2GVGA 1ONXA 2Y63A 2CBVA 3PAJA 1BF2A 3M5YA 1YE4A 1H7PA 4CQDA 4JFTA 3AHYA 3CWOX 5ABFB 1QJWA 2DH2A 3VCNA 2A4AA 2QF8A 1VH7A 3CM4A 5FJJA 2POTA 1JG9A 3G1FA 2P8CA 3IJQA 1SQ7A 4MKSA 4QS5A 1NY1A 4QGCA 1OX4A 5AECA 3AZRA 3G18A 2IW0A 3IS4A 5A2CA 3BW4A 4Q8OA 5L9FA 2XUCA 1M03A 2XSAA 1NF0A 2XTKA 5G5IA 3UG5A 3GY1A 4CNUA 3RM8A 5DN1A 3LMZA 3W6MA 1XLDA 4C1NA 5EL1A 1Q7MA 3SZ8A 4BI5A 4AD2A 1X1ZA 3OBEA 3QLDA 4C6FA 3P61A 4OHQA 3GRIA 5KZEA 1DHKA 3P6LA 4WY0A 4YTSA 2CZEA 3T0DA 3MKKA 4HQVA 5I5RA 1J5SA 3WLMA 1PYMA 4LUIA 3URQA 1E6PA 2OZTA 1QOPA 2TSYA 3RRAA 2X1RA 3R2GA 3B40A 4DWSC 2VNCA 4FX8A 4TO8A 1VPYA 3EPOA 5KMYA 1DXEA 2XHYA 5JBDA 5LZLA 1EWDA 4PTDA 5CAHA 2OSYA 4XBJA 3FDGA 1SUXA 5EYWA 4JTJA 2YZ5A 4KESA 2QYGA 3AICA 3EXRA 1Q6QA 3OGVA 1E6QM 4JBRA 5JH1A 1DJWA 2XINA 2VEKA 4Q33A 5HQLA 2BX7A 4YWSA 1EH9A 2WVTA 2ADAA 4K37A 1QW8A 3QGKC 1GKPA 4GUJA 4BWLC 4GIYA 2PWVA 1S1PA 4BY3A 3TW7A 3W81A 1JEZA 4QS6A 5FAGA 2Z24A 3K13A 3M41A 3PG9A 5CJNA 2PWUA 3UW6A 2A79A 2CZDA 4CD7A 4XZMX 4Z42C 3GR7A 1Q4WA 3U2OA 3ITGA 3WH5A 1KQYA 4ZQRA 4AZ7A 3FJ4A 3PFRA 3E5PA 1OCJA 4WSHA 4ZOEA 1CLXA 3VNZA 1FP8A 2X16A 3DBPA 4XIAA 1M53A 2X0SA 1B90A 1GONA 1VF8A 2HS6A 1EDTA 3U3HA 3QSTA 2IPWA 1CENA 3P7YA 1NWSA 1FRBA 3ZR5A 4LYQA 1W3JA 1A4LA 3A12A 4W8BA 3NQBA 1D8WA 3MMTA 2O0TA 3B8VA 4KGLA 4DJFA 1NTHA 2QPSA 2RJHA 3EDKA 2VMFA 3LRLA 2Z1WA 4C6MA 1NDZA 5D8ZA 2RDWA 2D2OA 5HNRA 1TCMA 4B4HA 3MDWA 3UGRA 3ZSTA 4IJCA 1VLWA 5A6KA 4FXRA 3PM6A 1P6BA 4GGHA 3WKZA 2ZWYA 1GTEA 1FY6A 2ZUUA 4ZFCA 2BGSA 4B2DA 4UIOA 4O8RA 6TIMA 2UY3A 2Z2AA 3QSRA 1XIEA 4Q6JA 1UZ4A 2PDJA 2JBMA 2E6FA 4EXBA 4J5NA 3APYA 4FNTA 2H8XA 2WVSA 4S3KA 2C14A 3SUVA 1KKRA 3H8AA 2I17A 4FOKA 1YPFA 4PE8A 1ZY9A 4H8NA 4JKMA 3L4UA 3N9RA 2VX5A 3L4XA 2V30A 3NIYA 3ZO9A 3CTLA 2IPGA 2OG9A 3SUWA 2OLHA 1QNRA 3VUSA 1XRFA 1FWSA 1IQ8A 2F6XA 3M07A 4GNKB 2Z1KA 4PUDA 3PTDA 3TR9A 2WMHA 4QSHA 5F4WA 4FOUA 4FHAA 2PGWA 4IUGA 1HJUA 1X1OA 5AC6A 4UTTA 1FCVA 4IPJA 4JTCA 2NV2A 3MP3A 4H3DA 3EX4A 1GGOA 4CNTA 1E43A 7REQB 4QLJA 3OZMA 1JPIA 2IKGA 4RXFA 4N9EA 1S5WA 1GT8A 4GY0A 3T8LA 4J1OA 3HJZA 5F2GA 3ATYA 3R12A 5E0FA 5CZJA 3KXQA 4W8LA 4NQ1A 3ZJ6A 4NI8A 1U83A 4KEVA 5A1AA 1CIUA 4B3KA 4W93A 2DZWA 3L12A 4NYUA 1HNYA 3B0XA 5LHFA 4JXCA 3WNKA 2J8GA 3GUWA 5KSWA 1QATA 1GQNA 1T40A 4LAKA 4A2SA 1MEIA 4MOZA 1AZ2A 3B97A 2CCRA 4EWND 3KRSA 2AOSA 4UFHA 4MJ4A 3MVIA 1XFCA 2JE8A 3I4EA 1UD6A 3CL6A 2J7HA 3B0YA 4HGXA 3REQB 4MB1A 2XM1A 2ASHA 3TZNA 4LBRA 4QCFA 3KP0A 2WHMA 4BQ4A 1KQZA 2ZADA 5K4ZA 4J27A 4PB3A 3WBAA 4ORIA 1TUXA 5PTDA 4MGGA 1UIPA 1R5YA 1PKMA 5EMYA 4HMEA 4WZHA 2PDLA 2BS9A 3HO8A 4ALDA 4XAPA 4LNYA 2E28A 4W7WA 1M7JA 2QAFA 1EB3A 2WK2A 3U57A 4S3DA 4WY0F 3GR4A 1POJA 4QX4A 3ID7A 4LW7A 3GDKA 4KCTA 1EDQA 4L4LA 1G7VA 3AMKA 2I7GA 5DANA 1OT1A 1B2YA 4XKYA 3VDHA 3VGBA 2A2IA 1S46A 4J2MA 1UWAA 2A3CA 3EA1A 3OVQA 3UNTA 1XD1A 1SW7A 3AIUA 3OA5A 1M41A 2GVLA 1D7FA 3GHRA 2HDJA 4B5VA 5CZSA 2H3DA 3EWUA 4HU4A 4A3YA 3G1HA 1RV8A 1RHCA 3ANUA 2V5KA 4L6HA 2ZA3A 2QDDA 5AN7A 3LK6A 2NQLA 3BJSA 4IM4A 4H9VA 4ROPA 2YBTA 3PJXA 3UERA 3KOYA 1AH0A 1JFHA 2XVLA 3N19B 1ME9A 1CGXA 1K4HA 3IRSA 3T08A 3WDPP 4CQ8A 2E77A 3BCDA 6REQB 3MKCA 2J77A 2PF0A 4RV8A 2HPMA 4GYKA 1E0UA 3UD6A 1IE7C 5LGZA 3CZKA 3B0VC 3ELFA 3CT7A 5BOOA 3B9AA 1GQJA 4AD3A 3HM7A 1H63A 3RR4A 2VOTA 1E5NA 3BJTA 4F66A 4P8XA 3S1UA 4LC8A 3T2OA 1YIXA 4EPBC 7ODCA 3NQEA 1OJXA 4Y96A 3CL8A 2G3IA 1PL9A 3J7HA 3TN4A 2Z1BA 1GJPA 3ZR4A 4IUOA 5G4HC 4IIBA 3GUGA 3XISA 1JQXA 1MI3A 4M0XA 3QMTA 1UUOA 4DJED 1GVFA 2DSKA 1E4LA 2OGJA 3PB2A 3OGSA 3SRKA 4DPPA 1EJSC 1TREA 5CC5A 3G6MA 4XKMA 4AX7A 2QZRA 1VKFA 1KC7A 3M5XA 3B3DA 3WH9A 3DC0A 1ADDA 1MXSA 3CC1A 4H41A 2QCDA 1BSLA 1KRCC 3WH6A 1CXIA 1NQ6A 5HUPA 4MPKA 4PH6A 1Q7QA 3BOLA 4OGZA 1RK5A 2INEA 4DF2A 2GWNA 3BARA 3PZ9A 2Z4GA 3CZJA 3T40A 2C79A 1SO6A 2BY3A 2QKFA 1XCFA 1R30A 4A21A 2WW5A 5C8BB 4GQBA 3PZTA 4JTSA 2X0YA 1N55A 4B90A 2P1FA 9XIMA 5J04A 5REQB 5D2VA 5BWAA 1GPWA 5AYZA 3O6YX 1CGVA 3OPSA 4M1RA 1R3TA 5A6TC 2BOFX 5FJPA 3U7VA 3W1TA 3LHWA 4MZ8A 4I9TA 4IF2A 4KCVA 3LPGA 1F07A 3WO8A 1R3WA 1I4NA 3M0LA 3NDOA 1R2RA 4EANA 1QFEA 4KWOA 4URIA 4O11A 3LPFA 3T6CA 1OGGA 1D3CA 3ZOAA 1BHGA 3VDBA 4LSBA 4JD4A 3RFAA 4NP7A 3DFTA 1MZHA