5BU9A

Crystal structure of beta-n-acetylhexosaminidase from beutenbergia cavernae dsm 12333
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
338
structure length
338
Chain Sequence
ADLSLEQRVGQLFMVGTDAATAEQVTLDAITASHVGNVFLAGRSNAGVDATAAVVEQLTAAVTDEATGGVPLLVATDQEGGNVQVLRGPGFSDIPTALDQGALDPATLQADATTWGAELAASGINLNLAPVMDVVASPEAAAANPPIGYFHREFGYDAETVASHANAFSAGMRASGVETVIKHFPGLGRVTENTDTTAGVVDDVTTADDASVQAFAAGIDAGAAFVMTSTAVYSQIDPDAPAAFSREIVSDLLRGQLGFDGVVVTDDVSAAEQVQAWSPADRAILAIEAGTDIVLVSADPSIAAEMVAAVVAKAQADPDFAAIVDDAARRVLAAKGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333
rcsb
source organism Beutenbergia cavernae (strain atcc baa-8 / dsm 12333 / nbrc 16432)
molecule tags Hydrolase
molecule keywords Beta-N-acetylhexosaminidase
total genus 124
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5bu9A00
3SQMA 1J8VA 4ZODA 4IIFA 3U4AA 4IICA 1EX1A 5FJJA 3GS6A 5FJIA 3WLPA 3WLJA 3WLLA 3ZZ1A 4GVHA 4YYFA 3WLRA 3WLOA 1X39A 4ZOEA 4ZO9A 4ZOCA 3WLSA 1TR9A 3ZYZA 4G6CA 5JU6A 3GSMA 4I8DA 4ZO7A 3WLHA 4IIGA 1X38A 5G1MA 2X42A 4IIBA 3USZA 3WO8A 3WLTA 4ZO8A 2X41A 3WLIA 3TEVA 4IIHA 4GVGA 1IEXA 4GYKA 3WLQA 5IOBA 1IEWA 4I3GA 3U48A 3WLKX 4MSSA 4HZMA 3LK6A 4IIEA 4GVIA 4GNVA 5TF0A 3SQLA 5BZAA 4ZO6A 3WLNA 5BU9A 4IIDA 1LQ2A 3BMXA 4ZOBA 4ZOAA 3ABZA 3WLMA 2OXNA 2X40A 3NVDA 5C0QA 1IEVA 1IEQA 4GYJA 1Y65A 3RRXA 3AC0A 4GVFA 3UT0A
chains in the Genus database with same CATH superfamily
4WDTA 3WLPA 1OCJA 3L0GA 1E55A 4EXBA 1BG9A 1DHKA 1P1XA 5FACA 3THQA 4LRSA 1S5MA 1WZLA 5BCAA 2FZNA 1KCZA 4QDPA 1OX4B 4L4OA 3CL6A 1RD6A 1EA0A 2HV5A 1KFJA 2XGBA 1LG2A 3A9IA 2J8TA 3WNNA 3BVJA 3AIRA 2Y0FA 3O7UA 3FN9A 4R9OA 3VGBA 5M5DA 4HU3A 1TTJA 4HQVA 3MSGA 1DQUA 3WSUA 4O0KA 3HJZA 2Z4GA 3WF2A 4XKYB 3WNOA 1Y5XA 3OHIA 3WH8A 2Z1XA 3M7WA 2JF7A 1CB2A 2Q01A 3PN8A 1BYAA 2E9MA 4IQLA 3COTA 5AYYA 2CKSA 4ICCX 1BEUA 3Q65A 3UQNA 4HOXA 4K68A 3T0BA 1XIGA 4BZYA 4ML9A 4JTGA 2V81A 4EAYA 5FA5A 3KP0A 4Q32A 3C56A 5HJXA 2ASHA 4FF7A 2VEIA 1PZ3A 1SFLA 3L7RA 1M53A 3KVJA 1BSIA 1LG1A 2WKJA 4HHPA 2P8BA 1Y0EA 1R30A 2XTKA 4C6CA 4Q7BA 2AQOA 3AQUA 3B3DA 3TKFA 3SGGA 2I56A 4CNPA 4IL2A 5CSUA 3LU2A 1A3WA 1EC8A 4UFMA 8CGTA 3ZLGA 1Q8JA 1ZUAX 2DP3A 2R1NA 4Y8FA 4AMCA 1JI1A 3H8AA 1E0TA 3K13A 4P7QA 1W3TA 5BOEA 3EB4A 3GDRA 2QKFA 3PZMA 4N9BA 3EDEA 3PFMA 1DJIA 4ICNA 1Q85A 1CDGA 5C9UA 5TAOA 3UW6A 5E5CA 2VR4A 5CPLA 3VFLA 2OYKA 1VFSA 4IGMA 3TA6A 4BFAA 2JEPA 3CQ0A 2BVTA 3N13A 4H9UA 1KR0A 3G3DA 5AHLA 4XZWA 1UA7A 3QFEA 3S1UA 2CZFA 4ECLA 4IMCA 3V18A 5CC7A 4ZXOA 4AEEA 1HKMA 1SQ7A 1HQTA 3N3MA 4GD0A 4RR4A 3WQFA 5IRPA 4IL0A 4M8UA 3U57A 2VRQA 1U30A 4L6HA 3LHYA 5EY5A 4S3AA 1C7SA 2ZUUA 4QDMA 4C6FA 3L66A 1GYMA 4GQRA 3WQCA 4QLLA 5DCEA 4FEZA 4MPKA 3WX7A 4B3KA 4W84A 1OD0A 1JCXA 2G5WA 4I8DA 3TJ4A 2D2JA 1R6WA 3JS3A 1KQZA 4CD6A 3VOGA 3JZUA 3LHUA 3QOKA 3RU6A 5LA0A 2DGAA 1PKNA 3E49A 4HYVA 1TV5A 3CUXA 1GUVA 1CXLA 4PUUA 3BGGA 3WDRA 4LC8A 3CWNA 3BWWA 3SCVA 1B31A 5DXXA 5ECVA 3EOUA 3N9RA 3AMDA 3P82A 4MLJA 4NJKA 3W7LA 1R7AA 2X1SA 4JFUA 4AF0B 4Q8NA 3VVGA 3PVFA 5D9PA 1ZJIA 2XN0A 3G1RA 2ZTKA 5EMUA 3AIVA 4L9ZA 1CT5A 2YZRA 4UQEA 3W0KA 4O11A 4M80A 1K02A 3HQPA 3F4DA 4K39A 1YBQB 4O18A 3JR2A 2ZRVA 3EWZA 4RE4A 2WMJA 2C13A 2VDHA 1S46A 4UMAA 2J75A 3GVWA 3L5MA 1IIGA 3WG6A 2BNJA 3GX9A 8A3HA 2OCZA 4GQBA 5HMSA 1UWQA 1POJA 1OK4A 3UWWA 3TLQA 3AS0A 3ARQA 4R9XA 1MNZA 2QDGA 4CQAA 1PJ9A 1HZYA 2ZVIA 1BXBA 3KTCA 1V6YA 3BSHA 3EKZA 4DXXA 3KS5A 1OWQA 1DTNA 1GGOA 1NP2A 3D0CA 3R4IA 1B57A 4MJ2A 3BANA 1U22A 4H04A 1OZQA 4M29A 3N2OA 1K9TA 2CYGA 2PDIA 3ZIZA 1OIFA 4QCFA 1EDGA 1CEOA 2OEJA 2PGFA 3HZ3A 3DERA 4Q33A 4L1XA 2D3NA 2CWXA 4HMEA 4AWTA 2WV8A 5I24A 4KKXA 3RIKA 1A80A 2QCDA 2V3EA 2YB1A 3NA8A 1AD4A 3K4AA 3BW3A 4M6PA 4M19A 1M01A 2DDXA 1A5UA 2V69A 1GZ1A 5BOOA 3ARSA 3R6IA 3NOEA 4P2VA 4PGLA 5FL1A 3QQWA 4MWAD 3BICA 4AZ6A 4PUMA 3MUAA 1VFOA 4JGDA 4KQNA 3EX6A 2Y7GA 3IAPA 2HROA 3NURA 2CCRA 3HM7A 3WFLA 2E0PA 2AQWA 2ZE0A 3WH9A 4TUFA 4K8GA 2ZXQA 4GRSA 4PMVA 1KNWA 1Z89A 3LS9A 3GTIA 4B90A 3MI3A 1W3NA 2Y70A 2EQDA 3WBWA 3T8LA 3CQKA 3M47A 2YSWA 2A7NA 1Z48A 4MSSA 5G4HC 4MY1A 4GNVA 1XPYA 4JNMA 1T6MA 1XYBA 5E93A 2EKCA 2IW0A 2PWDA 3DFTA 1UWAA 3R0DA 3GAKA 4Z0JA 3REQA 4OKDA 4Z1DA 2ZX7A 3OPSA 1EC9A 1B1YA 4JTDA 3A4XA 1JUEA 4D72A 1JNEA 1QRQA 3ZVHA 3O07A 3M5XA 3NQMA 1BVWA 2WZEA 4G1KA 5I5RA 5TF0A 3F4WA 1E6RA 3T09A 1PZ0A 2HS6A 5C9XA 1W5MA 1O66A 1Q45A 4LCQA 2FZMA 1EYEA 3CUJA 4MB5A 4BQ2A 1I1XA 1MUCA 2D2GA 1FWIC 4J3ZA 2Q8ZA 3A9BA 2ZZ5A 1US2A 1O1HA 1YBQA 1ZY9A 1P0BA 1TV3A 1EXBA 3AISA 3KTSA 1IE7C 3L2IA 1JULA 4D2JA 3LENA 2PDKA 5KZDA 1U1HA 2XVKA 4RZBA 3OGSA 1QI4A 3WLRA 1W9UA 1GVSA 1DWFM 3W84A 4W9TA 5KETA 1XD1A 4AY1A 1CGWA 3ARPA 3VUSA 3GW0A 1MEHA 2JGYA 3H7UA 3PM6A 4L4MA 1A0CA 4IG2B 2Z7KA 4G56A 2C6QA 4CQCA 1C7TA 1LM1A 3N2XA 1WAWA 5D2XA 3HG5A 1E0XA 4F40A 2I1OA 2OSXA 4E0CA 4E4FA 4HBKA 4JX4A 1KGUA 1MMFA 1PO9A 2RH9A 2PF8A 3W2KA 4IQDA 3KCJA 1GKRA 4RUBA 1TSIA 1E70M 2GGJA 4PUKA 3TMLA 2I7GA 2FHCA 4O19A 4YJ5A 1PCWA 1JXJA 3VOIA 3TXZA 1ODZA 2Y8KA 1YE6A 3BLFA 1IXNA 1WDRA 3KVLA 1UUOA 3RILA 4V33A 2XN1A 3P8JA 4JY9A 2XIBA 1D3CA 3UR8A 4AF0A 4HU4A 4G7EB 3H23A 3WLLA 4M5PA 3FXYA 4ENLA 3I7QA 3M0KA 7PTDA 1WZAA 4N9DA 2F38A 4CNOA 3DI0A 3GTXA 3R43A 5HR7A 2ZZ6A 4JS3A 1U1UA 1ME8A 3A3XA 3MCOA 3GXFA 4XZHA 3KBVA 5I79A 4UMBA 4DLFA 2CW6A 2J77A 3IJDA 3WD4A 3H55A 5BRPA 3NVTA 1TZZA 3QC0A 2E28A 3SFKA 5H2ZA 3U2ZA 3BV4A 5IOBA 5TBOA 2A3BA 1EJWC 4HYRA 4LUTB 4HNTA 3VOFA 1XFBA 1UMYA 4GA8A 4E2DA 2V8ZA 3CIVA 4OOUA 3U5YA 4XD4A 4FA3A 2Z6IA 1IWPA 4B5TA 2D69A 2VCBA 2QCHA 3KLLA 3DFNA 3R89A 3KZSA 3A23A 3U4AA 3TAOA 4PODA 4MJ4A 2ANUA 4MNKA 3BC9A 2WMIB 4PL2A 1Z6KA 5EL1A 4EPEC 3KL3A 4NNCA 4Q8WA 2BVDA 3F1QA 3MV11 2YZ5A 1M65A 3IAQA 2XM2A 2XVGA 1R47A 3ZT5A 4IJRA 3ORWA 5GQBA 1WDQA 4DAFA 2X0HA 4TX6A 3LTSA 4I8YA 4Q7NA 3WQ5A 3F2DA 2CKRA 4JX5A 1Z9AA 4GQQA 1ZP3A 1UA3A 2HPIA 4OHQA 5BXPA 1QW9A 5FF0A 1V0LA 4ATWA 4FLOA 3W1NA 2Z2BA 2VX5A 1A5SA 2DIJA 3EGJA 1LLZA 4C5YA 1LBLA 1DEDA 3QF0A 2YA2A 4W89A 4W8BA 4O1EA 1K8ZA 2VVSA 1FDYA 1LTDA 3R12A 2CWNA 1GJUA 1IEQA 4ZB0A 3CEPA 1RUSA 1U83A 2GJRA 2WMFA 1WQ5A 1YRRA 1FWTA 2PCQA 3KRZA 2QF7A 4IG2A 4N2YA 3C2FA 1NF0A 3CH9A 1VQTA 1ENUA 5CH9A 5M17A 4RDWA 4ZQNA 3RXZA 1M5WA 5FF4A 3OU8A 5XIAA 4ZOAA 2VC5A 2W9MA 5CJNA 3UZWA 4JTCA 3P93A 1RQEA 1ZAIA 2YL6A 1UR1A 2ZUMA 2EG7A 3GLCA 1TG7A 4B4HA 3WJWA 2GDVA 3AO0A 3WD3A 3S6DA 3OQ8A 4JAWA 1Q65A 5LNSA 4ZL1A 3MT1A 1YPFA 4PYSA 1WDDA 3T1GA 5HNRA 3RX3A 1AMYA 4PB5A 1XLAA 2YPIA 1KFWA 5EMLA 4IT1A 1ZJAA 4NJIA 4XSMA 2GUUA 2OVLA 4RJEA 3LBCA 3TAKA 1CENA 4NAEA 1W9PA 5I07A 1R3QA 3T78A 4GVHA 5IHRA 5LNUA 3CYJA 4LJ3A 2AOSA 4OVXA 4AEFA 4P5UA 3CV6A 4U2ZA 4FLRA 4HNCA 3VIPA 3SY8A 3MMWA 1QNPA 2CC0A 4QEHA 1EJXC 2VEFA 1H60A 4EXAA 2GGHA 4L9YA 1FWJC 3TDFA 1NOWA 1QNOA 1VFMA 5CZSA 3U6WA 3PK7A 3ARUA 2ZQ0A 1FKXA 2CBIA 2A4AA 2FZ8A 3N04A 1W5QA 3W27A 2NXHA 3F5LA 1PUDA 3N6QA 1RCXB 1LT7A 1QPOA 1UG6A 2G96A 3OA5A 5I09A 1WX0A 4POCA 2YLLA 1TO3A 2ZZ1A 3LN3A 1C91A 5JIWA 3BXWA 1EXPA 5E0KA 4QR6A 3HMCA 5EYWA 2TSYA 2WHJA 4AW7A 4C6MA 4UQBA 4S38A 3SRHA 3KCLA 1E40A 3LCHA 2J6XA 3SFWA 2OFJA 1L2QA 4L4PA 1JRBA 3TE9A 1H1NA 2YBVA 2XSAA 5DMMA 3HIJA 3E2QA 4QG8A 3OG3A 3WH5A 1EGZA 5DCBA 4DHGA 1XH1A 1M7PA 3K4DA 2YCLB 2QF8A 3UERA 1P0NA 1KM4A 5EB8A 4JIIX 3SIMA 3OLIA 3THUA 4R33A 3AOFA 1TPFA 1N8FA 3N11A 3HN3A 1UOKA 2DW7A 1R86A 4LF1A 3FYYA 2ATSA 3NPVA 1CB7B 3F4CA 3ONBA 3MYOA 4QIUA 3IACA 3W4RA 1NEYA 5BU9A 4QP0A 2OWWA 3H4WA 3UPBA 1JDEA 1WKFA 3WBYA 4WSJA 4MKSA 2XGIA 2J8FA 4W8LA 3H2FA 4PBGA 7ENLA 5I3FA 2XIMA 3WMLA 4JTLA 2NQZA 3F2CA 2B7QA 3ARZA 4LVGA 1TKKA 4TIMA 4KCTA 5T9CE 4UB9A 3DFOA 3S9YA 4U10A 3ZO9A 1AA1B 4PCPA 1XICA 2JGQA 1CLXA 3S47A 4MADA 4RK8A 3C2EA 5H6HA 1IHIA 3KHJA 1K9EA 3OJGA 1RPKA 4HSOA 3IJ7A 1JCNA 4GZ7A 3KOFA 4CNNA 5K4ZA 1XINA 2G3IA 1LORA 2RDXA 4ZCWA 4GBUA 3ZR6A 1H3GA 2XYLA 1H1YA 1W0MA 2PURA 3VC6A 4AD0A 3W6YA 4GMEA 3PSVA 1Q66A 3GIPA 3N1AA 2X1IA 4Q4PA 5D02A 3BCDA 4M7TA 3QC3A 4Q6JA 4AEOA 4C1LA 2FVMA 4O50A 2VGGA 3PUOA 1FCUA 3WH7A 1EX1A 2QMJA 4G9PA 2R8WA 1T0OA 1XH0A 3LBOA 5HMDA 1Q6EA 4MDOA 4TV5A 3TZNA 1ONRA 3DFHA 4PCNA 4KH2A 2CLHA 2Z26A 1GVEA 3SURA 4UTTA 1UBSA 3WJYA 1EGVA 3LV5A 3WNLA 3TN3A 5AHFA 4XAYA 4G1NA 4J3XA 2J7HA 5AYZA 3ZLHA 5I3HA 3STFA 2GDUA 3EWXA 3WLQA 4DBEA 5A69A 5CLTA 4LCRA 3MA8A 4PB4A 4LWWA 5G2WA 5CG0A 5HNNA 3K8MA 1QHPA 4IXHA 1JVNA 2XDFA 4FX7A 1A5BA 2WJFA 4UNKA 3AIEA 1DE6A 3FEMA 3W81A 2R14A 3IGUA 3LLDA 1ZZMA 2IQ0A 4I7WA 3NWRA 1XYZA 3NQDA 4GFSA 1XLKA 5CG7A 4RX0A 4QROA 3RM8A 4Q3MA 4BI5A 2PP3A 1AW5A 1DTUA 1EJRC 4JTJA 2VX6A 3URNA 3L21A 4XAGA 1HGWA 2IPFA 3TVAA 4JFTA 2QNEA 2PPGA 3RR4A 1Q6DA 2OSWA 3UA3A 4GIYA 3ITTA 2VVNA 3WYZA 4K36A 4CEXC 3RPDA 5C7VA 1MUMA 3BTNA 4UQCA 3VNZA 2QJMA 2AMXA 2XIQA 2J27A 3L0KA 4J3SA 3IJ8A 4L56A 3PPGA 2GGGA 1BGAA 1Q7QA 3TC3A 2VCCA 3LX9A 2ALDA 3B0PA 2WKLA 2DZSA 3PNUA 4GXPA 3UCCA 3KZPA 3E1F1 3FAXA 4FI4A 3QTPA 4E8GA 5EMKA 3CHCA 4DPPA 1TPWA 3I3DA 3AHVA 4Y6GA 2FTWA 3H4GA 4H9XA 1UKQA 3RGTA 3VKAA 5AHIA 1KXTA 2VO5A 2ZRXA 3DGBA 1JZ3A 2A0NA 5GNYA 4HNNA 3QGVA 2OO6A 1X8CA 5DT5A 5HNUA 3GXPA 3W1XA 3MP5A 3K8KA 3WLOA 2PS2A 1E5NA 2E25A 1UD8A 2ZXAA 4XTDA 1HNYA 5EGRA 2DORA 4BQ4A 4LSBA 2PDQA 4QISA 4DEFA 5JBFA 4Q8PA 3VX1A 2XN2A 4AY8A 1ZPTA 3OODA 1EJVC 2G4FA 1TV8A 3WEMA 4LUSA 2Q3OA 4Z1CA 4QTGA 2DZPA 4ZO7A 3EKGA 1UKTA 1OC6A 2RDTA 3GTNA 2F6XA 4IFOA 1JYWA 2ISWA 1AW2A 1F05A 1XLFA 3OVQA 1J0ZA 4GO9A 3TYAA 1HJSA 3E2VA 3GBEA 4Y8EA 3ARYA 2GJXB 3WDPP 4ZOCA 4ZOEA 3IJLA 3CZJA 3F7JA 3CQJA 3MDUA 2AL2B 2Q09A 3W2MA 2WZHA 4DNMA 4DZAA 2G37A 3W7KA 1V93A 4IZGA 4S1FA 1OFBA 3RM4A 3C52A 4UOJA 6ALDA 2V63A 3HOJA 5HUPA 4JEQA 3NL3A 4QJ5B 3G5EA 4Z1YA 3RFAA 5HULA 1KM5A 3WDHA 4C7DA 1VHNA 3POCA 3TOPA 2PC4A 3A3WA 1BSLA 3R8HA 2O92A 2FJUB 3LRMA 5MKGA 3G1AA 3ITXA 2I16A 3PG9A 1F3TA 1PB0A 4TMCA 3CIXA 2IS7A 2O9TA 5H8UA 4NZ1A 3U3HA 1EOMA 3FJLA 3ZJKA 3DHUA 3UPWA 2R6OA 2XFFA 4FXRA 2PWGA 5LZLA 4UCFA 2EHHA 4L6OA 4D8ZA 1GHRA 4XSLA 3PZOA 4QLJA 4MB4A 3GTHA 2D0HA 5DT7A 4Q8TA 4O53A 1UIOA 4MG4A 3VIKA 1R3VA 5AY7A 1K7FA 3TONA 3NQEA 4UWMA 3EKLA 2OG9A 5HUOA 1JUBA 1W3IA 2PDXA 1GORA 1C93A 3OLDA 1XD0A 4DBWA 4REQA 4DQWA 1A4MA 3TN5A 1QATA 4WKFA 3B0XA 3ALGA 3B0VC 4GNKB 4MNJA 1SJAA 1A5LC 4YPJA 1Q6GA 4UZSA 4JIHA 3RUBL 4IUOA 4IMEA 2O55A 1KWGA 1UWUA 2Z0IA 2R1PA 1MXGA 2J88A 3EZ4A 3VKBA 3SCSA 2V2DA 2VEMA 1FHUA 4AG0A 4P7LA 3UWEA 1KO0A 1WUEA 3B9AA 1Q2SA 2PGRA 2PWVA 2VR5A 3DHPA 1PPIA 3R7MA 3CH0A 1XBYA 1UUMA 3C4UA 4C6KA 5D03A 3OIHA 2BB0A 1EBGA 1GQNA 1LOLA 3ANYA 1NOFA 1WP6A 4ACYA 4RPPA 3UWUA 2NVAA 3ARWA 1R87A 3QOMA 1F4HA 5CPQA 3WFZA 3N9KA 3QZ6A 3BJSA 4AXKA 5I7GA 1X97A 1YDYA 4FR6A 4KBXA 3R11A 3V1PA 5GJPA 2IKJA 4NJHA 1XLIA 3FEQA 4Y9PA 3W2UA 1PTAA 3A4WA 3U5UA 1WZKA 2W66A 1ONWA 1VYRA 3FY1A 2H8XA 4MFDA 5FEZA 3GIYA 1TQJA 2VFGA 3NZ1A 5A5WA 1C8VA 1PWLA 1P7TB 1H41A 3WQWA 3TWAA 3LDVA 4DIAA 3H6OA 1QK2A 2BY1A 5IXEA 4WK9A 3SAZA 3M4HA 1T40A 4B16A 1LT8A 1XF0A 1CPUA 5L6UA 2DV0A 3MCMA 3W28A 2CLMA 1D9EA 1RJQA 4O57A 4DI8A 1H61A 4R34A 1MZRA 3NCOA 1PX3A 1XGEA 3RM9A 1QUMA 3TH6A 2GGEA 1HF6A 3G1SA 1TPH1 3FS2A 4P8WA 3UZJA 1O4UA 3NQVA 4I7VA 3AYVA 4NT0A 1T7LA 3PFRA 1UR9A 4H9ZA 3TTOA 4S3KA 3L4ZA 4HMNA 9RUBA 4DJDA 4MUPA 1W3KA 3G0XA 3NXFA 4KGLA 5EBUA 3W07A 2A5HA 3M0YA 1W6TA 4PMUA 1BYBA 1E4LA 3AHXA 3LXBA 2Q02A 2VFDA 3P60A 5F1VA 5BROA 1D3HA 4AB4A 3WK1A 1UUQA 1K8XA 2CESA 5D09A 2ICSA 5G1MA 3TYUA 4NZ3A 1X7FA 3VK5A 5D9MA 3VPLA 2VFEA 3O06A 5E70A 1W5PA 3P3BA 1L6YA 3PG8A 1QI5A 5CJMA 5D04C 4BEQA 4AZHA 3PS7A 3BLIA 2RJGA 1H11A 2ZRYA 1HO4A 1DWJM 1DP0A 2MNRA 4L1GA 1OFOA 1R3SA 2PFHA 4D6GA 1QASA 1YPXA 3QQ0A 1L6GA 1NWSA 1KBKA 5F2IA 3M6DA 3WN6A 3QFWA 2EKGA 2Y1HA 5HQLA 3N6HA 1DHPA 3DC0A 2J7BA 4UQDA 2I5IA 3G24A 4JHZA 1KGWA 3L4TA 3PTQA 4AHQA 2EAWA 1E4IA 3WO8A 2W3ZA 4C6OA 3DYMA 2WHKA 3N15A 2PDUA 1MDLA 2WJZA 3TJXA 2FH6A 2Q71A 1W3HA 3GG1A 4BF5A 2BASA 4HNUA 4JIEA 3VKKA 4IMDA 1L0PA 1P6BA 2EF9A 1J0HA 1WOAA 3SY5A 4LT9A 1JNDA 2VOMA 2DU2A 3G3MA 2PP1A 1MEIA 3GK0A 2RDUA 1F6KA 2EJ1A 4AHPA 3KEHA 2C16A 1MQPA 1GJPA 1XGZA 2H3BA 3MC5A 5AC8A 2BVYA 4FSAA 4A3QA 1RA0A 3CT7A 3TLLA 4AYGA 5FD0A 2WVVB 3S6OA 1UD2A 3AICA 4YTSA 4FPSA 5HMFA 4O28A 1UR0A 1W31A 3NIYA 4G8TA 3SCWA 1SYTA 2IPWA 3RG6A 2VELA 3NPWA 1F8IA 3CM4A 2JIEA 2PDJA 5HDRA 3W1AA 1H0IA 4K6AA 1V6VA 2UY3A 3BLDA 1C9DA 3NDOA 2D2HA 4DF0A 2WSYA 1UOZA 1V51A 3BARA 5AZ1A 3FLUA 4C6NA 4JCLA 3VD9A 2NLYA 4Z2HA 1MWOA 1P48A 2QDDA 2I5QA 1S2AA 1NWTA 3S2NA 1Q6QA 2VC7A 1MW0A 3W7GA 4HA4A 1DJQA 5A6MA 3DH7A 1T5AA 1IQ8A 3W83A 4RCXA 3D3AA 4UR7A 2YA0A 3TW9A 3VD5A 1U5HA 1CXIA 4V1YA 4K2SA 2XWEA 3TMQA 1DJWA 1J0JA 1HTIA 2ZE3A 3VIGA 4EPKA 1YDNA 2ADAA 1E1CB 2XVPA 1K3UA 3W2LA 3W53A 3KM8A 2XZ7A 3NZGA 5CAKA 1FHDA 2WHMA 2HXUA 3NDYA 2CPUA 2DT1A 3C6CA 2DZAA 5CLWA 1MXSA 2E4TA 2DIKA 1UWIA 2OLSA 1U33A 4UOZA 3S3GA 2Z24A 4E4UA 4GNJA 4C60A 3O9NA 2H8ZA 1D7KA 3V5OA 2GDQA 4D6DA 5HAOA 2ZZ3A 4J27A 4ERAA 3MS8A 2WC4A 1B4EA 3H7RA 1HJVA 2BZNA 2CZ5A 1T8XA 2DEPA 1OADA 2PF0A 3QMTA 4Z2IA 1UZ4A 3T55A 5KITA 4GY0A 2VJXA 4UNLA 1VRDA 5I23A 1JCTA 4KEMA 4JPGA 2YDSA 2B0MA 4YLWA 2FDMA 3P74A 4PTXA 3MZ2A 3M43A 2JKPA 4EWND 2AAMA 2DSVA 2PCEA 4QG9A 5D9NA 1LQ2A 4A2SA 4KFOA 3ZWSA 4UUIA 4F0HA 1QHZA 1YNPA 2Q6ZA 2PTWA 1WYIA 4WJEA 3W7OA 3WMSA 1GG1A 4UOQA 3USBA 2BY2A 1V6UA 2ZDSA 2VGFA 1V77A 4GYKA 4W7UA 3FVMA 1KR1A 3W85A 1GVOA 2G50A 4K1WA 1UZHA 3GR4A 3PUDA 1JZ5A 3RLGA 1JGIA 4EKJA 5DBTA 1JXKA 1GQIA 2H9AB 1JCMP 1VJZA 2PGEA 4AVOA 3H4XA 3LCFA 4IPIA 3GHRA 4GO8A 1FCVA 2DQWA 3ZM8A 5LIUX 4JEJA 3VC5A 2PBOA 5C2CA 7CGTA 4XBSA 1XC4A 4W8AA 1XKYA 1VBRA 2BX7A 5IDIA 1FHVA 1TPC1 3Q67A 3INPA 1BKHA 4DO5A 1LRTA 5DMYA 3QW4B 4MZ1A 3P7YA 3PTKA 5K9CA 2DFAA 2V2HA 2WNWA 1M6JA 1PEZA 4JCMA 3AJ7A 1JD7A 4A8RA 4ACZB 5HBFA 1NDZA 4YHEA 3IJ9A 1SW0A 1VC4A 2ZYFA 1AD1A 1XG4A 4FMVA 3P81A 2Z1WA 1OM0A 3HG2A 4WGXA 1ADSA 1KM6A 2NVDA 3ABXA 2GLKA 1IWBA 3L4VA 2HBVA 1PX4A 3TC7A 4GKTA 1J2WA 4KRUA 1W1PA 1JYXA 1JDFA 2OX1A 3VDHA 3C0SA 3EX3A 3MB9A 1ME9A 2DSZA 1TIWA 3H22A 1RBLA 2WOQA 3UY7A 3C2VA 2FKPA 2FH8A 3CAWA 1DIOA 4PCSA 1XRSA 4I9TA 1VD6A 4DYJA 5FIPA 3RPTA 1TWDA 4INFA 4LGXA 4JTKA 4HA0A 1YDVA 1FBAA 2VP8A 1UIPA 3IGXA 1HGYA 1REQA 2CLEA 6ENLA 2C0HA 3W7NA 4TVUA 3WNPA 4Z2GA 2EPMX 4HK7A 5M03A 3M0XA 2A2IA 4B4FA 4US5D 5DANA 3R58A 4HKPA 2F9RA 1CXHA 5G1TA 3OIXA 1PKMA 5HJYA 3UY8A 4DJDC 3KFTA 3PWAA 3UR2A 1W5NA 3MI6A 2H3DA 2PTXA 3AXHA 3KBWA 1R3WA 1ZRQA 2P76A 4L4LA 1TVPA 1EB3A 3RLHA 3FIGA 3EMCA 3UG3A 1QO2A 2RDWA 2C3ZA 3QPEA 5FF2A 5CPSA 2C79A 2J66A 3SUSA 3TWBA 5A6KA 4GPNA 3EX4A 3NR0A 1VP5A 3QGAC 4F3HA 3GH4A 1N82A 5F4WA 4I5UA 5D37A 4JQ4A 4O54A 4CQ8A 5A6BA 1BTMA 4YVVA 1FH9A 3UXDA 1YDOA 4WLCA 5DCDA 5ABGA 4AYSA 4F79A 2YFOA 1Q6RA 4KFNA 1XSIA 2HVNA 4BHYA 5E09A 1ZNNA 2G3NA 3EA1A 4C6EA 1A49A 1RH9A 2OJPA 1W1ZA 2ZVRA 1WXZA 2YLAA 4L6DA 4DJDD 4AXNA 1EHAA 1XPGA 1XX1A 1TR1A 3C8NA 4H01A 3L0NA 3PPCA 2WJEA 2GQAA 2IQTA 2V5JA 3IVTA 1DVJA 1OK6A 3VYLA 4AZBA 5KMYA 3BSMA 4MWAE 3B9EA 4D6EA 4CD5A 4BS0A 1GOIA 5I78A 3NQ6A 3MVTA 4KWWA 1QI3A 2CXEA 2H9AA 2VQUA 3VNDA 2H90A 2Y8UA 1WE5A 3MUY1 4J4KA 5MHBA 1HIZA 4ZGYA 5DY3A 4QLKA 4QJ3B 3V5FA 4C1NB 4W7VA 3ABZA 1D3GA 2QGYA 3QHOA 2BXZA 1LLWA 3F5JA 3A3HA 3HU7A 4K7VA 2PB1A 5IM51 2O4MA 2TRSA 3SM0A 2QIWA 5I6SA 3DHFA 3EXSA 5D33A 3MWCA 1XUZA 2NWRA 5LSMA 1SU5A 3PB0A 2BS9A 2VEGA 1XDJA 2TYSA 1R2SA 4L61A 3AU2A 2FZDA 4KWUA 3WQ8A 2WVSA 3ZVIA 1R2RA 2PDCA 2A3HA 1XGDA 5HOSA 2BHYA 2RGMA 1U2YA 1JR1A 3AXIA 3ECQA 3YPIA 2ZC1A 1UBPC 3V36A 4Z2KA 2YDQA 1GQJA 2O9PA 5I02A 4ZR8A 2EBNA 1E9LA 4J35A 2PTDA 3VCNA 4E8DA 4XZIA 1L2UA 1W2PA 2FVKA 1Y5VA 4O13A 4Z42C 4GZJA 2E6FA 2X7VA 1FDJA 3PZ9A 4IGNA 4LH8A 1J12A 1BWKA 2CITA 3R1ZA 3TQ0A 2OKTA 2F8QA 1OCNA 1YXCA 1Q4NX 1JPKA 5CZJA 3QZAA 4YIWA 3RCNA 4DUWA 5LNRA 4WZHA 2GSHA 3S1WA 1K1DA 2WANA 5IHSA 3EB3A 1W1IE 2P53A 3GU2A 4N42A 3W1RA 3RX2A 1RQBA 1QCWA 1Z8AA 2V5LA 3BAIA 4OFCA 1G7UA 3HFTA 1E73M 1FWNA 3LQGA 5CEWA 2INEA 2Z28A 3EDFA 4WR3A 4NUWA 4KCWA 3WY1A 2X0SA 1HKIA 5FSDC 1NFPA 3UWZA 3PANA 3SUUA 3C2RA 3SN1A 2QCFA 2FZBA 2EEXA 3OYZA 1QPKA 3ABQA 3B8TA 4LNYA 3NL6A 1VLWA 2Y8VA 3VIHA 3RPMA 4O1FA 4AISA 1ZP4A 1YMYA 1A3XA 3VMNA 3MSYA 2X0YA 4ZO6A 1OX5A 1FFRA 1H7PA 2CLLA 4LV9A 3I4KA 2OZTA 3F4VA 4KT2A 4MB1A 4QSFA 1DORA 1GOXA 4ILSA 3ARTA 4JICA 4DJED 2F6KA 2J7GA 3P0WA 1Q13A 1X7IA 4HU8A 4Q6XA 2Z2UA 1BXCA 2W4XA 1TWIA 3ZSTA 3EPMA 2HNEA 3UJFA 2QGHA 2AL2A 2DUAA 1RK6A 4GWEA 4A35A 4Y2WA 4HVXA 2DT3A 2GJXA 4ZQRA 3FSTA 3PBGA 4PBFA 4S3GA 1NDYA 1WXYA 1XXXA 2GVYA 1XYFA 4NJGA 1TX0A 1KXQA 3UVIA 1T41A 5AHNA 1GYLA 4WOZA 4LYPA 3GC2A 3LMYA 3Q37A 4H2CA 1J6OA 4YYCA 3CWOX 4XZ9A 3UNTA 3ZFHA 1FCQA 5M1TA 4JTRA 2PA6A 2GVEA 4JDYA 3LK6A 1AW1A 6XIAA 4U28A 4UTKA 5IDZA 3CS2A 4GABA 3HPXA 1EJ7L 5CBJA 1C8XA 3G1DA 4U3CA 3DESA 2WPGA 5TQLA 3BLLA 1RQHA 3QN3A 2BV9A 7A3HA 1XIMA 2HRWA 3OZOA 1KXVA 2OX4A 1QWKA 4H6QA 4GINA 4MWAA 1CGTA 2QUTA 3CHFA 1M1BA 2CZVA 3UR5A 2FDSA 4JTHA 5EKYA 4R53A 1TWSA 2GFTA 4ICMA 3N2MA 2B7OA 3STEA 1RPXA 4QQ3A 1TRDA 1X8FA 4HT3A 1YTKA 3AZRA 3B03A 4C65A 2PDWA 2Y85A 3LCLA 4W4QA 3V0UA 3LA4A 4AAJA 2G3JA 5TNVA 4HCHA 2V6AA 3DEQA 4F9DA 1MYRA 1IYXA 3FHQA 4G7FA 3P62A 1PX8A 3SUVA 3RAOA 3MW7A 2PDGA 3BUVA 4GH3A 3ZS4A 3CWHA 3CU2A 5D2TA 4F2UA 2QAPA 3IPWA 3W7PA 2PSNA 4MZYA 1EP2A 2WZIA 2A79A 1KFKA 3GG0A 3IEBA 2CETA 4IP4A 3ZT7A 1VLIA 2DIEA 3AXMA 1GKQA 3URAA 1L9WA 3EWYA 3W1PA 4GIAA 4X61A 1R2TA 3TOYA 1JEZA 4XZMX 3WEZA 1LUCB 3BMXA 2OT1A 5GVJA 1JDCA 4CVWA 4L1WA 2XH2A 3M5VA 4ZB2A 6REQA 2RHGA 1C29A 3VIOA 3GDLA 3ZJ8A 1GHSA 3VZXA 3CUFA 1ADOA 3ABSA 4LTSA 4LAMA 3WLNA 5CXPA 1PTDA 1TIMA 3RNDA 1JCJA 2Z1BA 4MNLA 2HMCA 2V5DA 1B54A 1CX9A 2PGWA 2ALRA 1KCXA 3EWUA 3EMQA 3N3TA 1NFGA 2G97A 4PMOA 2DT2A 4GZEA 4M1RA 3AZSA 4IHCA 1ADDA 2PTZA 3AUJA 3W00A 3DYOA 2VI0A 3NFUA 3EYPA 3AWNA 4NZ5A 3IK4A 1NAL1 3BK0A 2E9LA 4K8HA 2R1MA 4KWOA 5IBXA 4D6JA 2VRKA 2E67A 4M7SA 4DVOA 4E6MA 4C6IA 1WBJA 5I03A 3A6OA 5DX7A 3UXKA 1ISVA 1XCXA 1ONXA 1FKWA 4DELA 1G94A 5DY2A 1E71M 4NP7A 3L23A 1DJZA 1P6WA 4P7OA 1EJSC 4FIRA 1BAGA 3EA3A 2ZIDA 2VKZG 2ESCA 3I10A 4XAFA 2W0UA 4N9CA 1Z32X 3TYEA 2QUVA 1BXNA 1TTQA 4JTIA 1H7NA 4ZA0A 2D0FA 2VDGA 4DJFA 2PC8A 5CPOA 3C3NA 3A13A 1YKWA 2QT3A 4Y96A 2F7FA 1H09A 3W02A 2G0WA 1VENA 3PJXA 1RZMA 1SFJA 4ZTYA 2OGYA 3IV8A 3O0FA 3TQVA 5FSEC 3KTXA 4NYYA 1IT8A 3AYTA 3UESA 4XIAA 1SJCA 3MO4A 3UCQA 2E5CA 3AZTA 4GI6A 3GC5A 1XR2A 1DQXA 1J8VA 3GYEA 2GWGA 2XVNA 3EMZA 1MSSA 4ES4A 3HB9A 1EA9C 7REQB 4QS5A 5CKSA 4CVUA 5LA1A 1W5OA 1JL8A 1MW3A 4QDWA 3W82A 1F3XA 2Q3RA 4UC5A 4MGGA 5LIYX 4HJWA 3W7MA 2PTYA 4ERGA 1BYDA 4LXFA 4RNFA 4DF2A 4GIRA 5KTLA 4PEEA 2PMQA 4D8AA 3GKFA 1UQZA 4YS1A 1J79A 1TFVA 1E1EA 2SFPA 4KS0A 3M0LA 1AH0A 2G3MA 2PD5A 5EFFA 1TJRA 3OZYA 1BTCA 2O7SA 5CGTA 4I9AA 3A4AA 3DFYA 1ZL1A 3CC1A 4WUIA 2QYGA 5I06A 4LANA 3T0TA 5ABFA 1OFRA 3NQAA 2CBVA 4DBUA 1Q4WA 4GZIA 3EPNA 4MIMA 1J6PA 2VDIA 4O4WA 2QPSA 2Z1SA 1EWEA 3W2JA 1XRTA 2Y7EA 4QQUA 2V3DA 1B2YA 1R85A 1B3OA 4XUYA 2VC6A 1KD0A 5FJPA 3M07A 4DJEC 1MI3A 2YL8A 3RHGA 5LIWX 1XH2A 4J3TA 2ISFA 4EANA 5AC4A 4GUJA 2OQHA 4HPGA 1ICSA 2NVCA 5EMYA 3U7VA 1RR2A 1F4AA 2W5FA 7ODCA 1TR9A 3E2SA 5JU6A 4KMQA 2YXXA 2XIOA 1TWWA 1D8WA 2VTFA 3EA2A 3H26A 4DNHA 3WUEA 4YTQA 4J3WA 3RCMA 1XCWA 5FJTA 3B9NA 3ICJA 4UTUA 3ARXA 5FF7A 1E4MM 2GUYA 3GR7A 2E5BA 3IUDA 4UTIA 3AS3A 4W87A 4HN4A 4NYUA 2NLIA 2KAUC 4JR5A 4NI8A 5A3HA 5JH1A 1U5JA 3UWQA 3VA8A 2VRJA 2RFGA 3PC0A 4ROQA 1KV5A 1CBGA 1UH2A 5MKGB 3T7VA 1ZU8A 1AZ1A 2WAGA 3GRIA 1CW2A 1W54A 5CC5A 2J79A 3BMWA 1VCGA 5E9XA 3IV3A 4RE2A 1B90A 2ZA2A 5JIPA 3VNLA 2B4GA 5JH2A 3DKLA 3O2LA 3S2MA 3D3FA 5K3VA 1B9BA 3FAWA 4O14A 3TUUA 2EPLX 3VNJA 3WLSA 4K38A 1TPB1 3B9DA 4CN1A 3BAYA 1JI2A 2DVTA 4WDWA 3P14A 4R7WA 2X7WA 2A1YA 5XIMA 4LAZA 1EO7A 5M3WA 3HMJG 1OGBA 1EEPA 1XQKA 1A5NC 1G4EA 1C8QA 3H12A 1OC5A 1SSGA 1LDCA 4G7EA 1S1PA 1PXGA 4H8UA 1FWGC 2VEPA 3WCZA 4FALA 2QEZA 2WVTA 3T0AA 1BWLA 2FYMA 1G67A 4O17A 4DBSA 3TW7A 1AQMA 2NV1A 3VOJA 1VYPX 1MQRA 3BG3A 3PTDA 1AQ0A 1FWWA 1NTHA 3LPOA 5I3DA 4DX3A 4Z1BA 2GGIA 3UVAA 3ISIX 3SECA 4U4MA 5A6JA 1WV2A 1XISA 2BVWA 2V82A 1WDPA 3VM5A 1A5OC 3I7RA 1PVNA 4X9YA 4OT7A 5LNWA 4FXFA 3EWCA 2PDFA 3PZUA 4A22A 3VX0A 2NQ5A 3G6MA 4KW2A 2W63A 3DECA 9CGTA 4Q4RA 2ZUSA 3L4WA 1PBGA 4XX6A 1GPFA 3SCUA 4H7CA 4FOKA 3WF3A 1HVQA 1FWAC 3FGCB 1Z3NA 3QZEA 4EXQA 1VGAA 1QI2A 4BI7A 4AZ5A 1B3WA 3VUPA 2OR2A 4CD7A 5LHFA 3S1XA 1UWTA 1FDZA 3KDOA 2V3FA 3V7PA 3DG6A 2PDNA 2ZX5A 3V35A 4B3LA 1TJ1A 4HPNA 3WEOA 5BXTA 5CZTA 3KX6A 3F4NA 2OMAA 3UJSA 2VD8A 3TP4A 1JZ2A 1V4YA 3UZXA 4HZMA 3F03K 5B7YA 1JD9A 3NVDA 2X40A 3CXOA 3QY8A 1KRAC 5C55A 3DFQA 4B91A 3P84A 5A6TC 3PBMA 1J2BA 1JGMA 3B8IA 1Z42A 2D22A 2ZUTA 2DPEA 5D2YA 2ACRA 3S2LA 3WLMA 2TMDA 3BSGA 3H21A 4FNTA 4IP5A 4Q4OA 1I75A 5C5YA 1V3IA 3MVIA 2V0TA 1P4CA 4KCVA 3QBUA 1PSCA 1BGGA 1EPVA 5CBBA 3W1LA 3WQDA 1FCBA 1EP3A 4HK5A 4DZIA 3WFAA 3BGAA 3AUOA 4YWSA 3T42A 4FNSA 2QUUA 2XH4A 1P7TA 2V30A 3LMZA 1PKYA 1Z41A 3AI0A 3T07A 3CLMA 2NX3A 4I6VA 1R8LA 3SCQA 3SEPA 2WM1A 2PU0A 1V3HA 2OELA 3B06A 4LX4A 3GHUA 4C7FA 1E9ZB 2P8CA 2ZZ4A 1W9DM 1PCKA 2ACQA 2OZ0A 4NL1A 1EWDA 5LGZA 2XH7A 5A94A 4ZB5A 4MNMA 4OECA 3B8DA 4LS2A 3AAMA 3DHDA 1R9YA 4EK7A 2CHRA 2WJDA 4NILA 3QSRA 3VFCA 1U5VA 5C9WA 2HBXA 4F48A 2QDEA 2DH2A 4IIBA 2Y7FA 2RAGA 2OSYA 2VGIA 3PR2A 4U2YA 5CPMA 4V27A 4L9XA 4J2MA 2VZTA 2C1IA 5KINA 3CEUA 4KETA 5AVNA 1YNYA 3WQ6A 1UWSA 1UPMB 3N4AA 5D05A 4O1AA 3M5YA 3FGCA 1GPWA 5FEXA 1KXHA 4AVNA 2W79A 1GJWA 1AH4A 1Q2RA 2XVLA 1EPXA 3DUGA 1YYAA 3GVRA 3WJXA 5CGMA 4QAIA 1LOQA 4AD3A 4IPPA 4DRSA 2R91A 1UD6A 1A50A 3MHUA 5BXRA 3H2AA 4DAIA 1YPIA 3WMBA 4AU0A 4HYWA 2YYUA 3QYSA 3SI9A 5M2FX 2NV2A 2J4GA 3CTLA 4QJ1A 2NX9A 1FQ0A 4ZQCA 4FNUA 2A7PA 1SO4A 3M46A 3V5CA 1XIEA 2AKZA 3CMFA 3LPFA 3SW6A 5DELA 3TCEA 3O6DA 1XBXA 3ARVA 1V3MA 5C8BB 2D3LA 2E1DA 3V3WA 3KP1A 3O3RA 4X3ZA 3I7SA 1AVAA 4LVBA 5F2GA 4WSHA 3SIZA 3XINA 4H6RA 2PUZA 4CNUA 2XFWA 1C90A 1YTEA 4M51A 4A8LA 1FWHC 1V5XA 2E9BA 4DM2A 1SJBA 3T0DA 3S83A 5HPOA 2JK2A 1Y5WA 1G69A 1B5TA 1JQVA 4ASTA 1S2WA 4WSKA 4JQAA 3AYRA 3QLDA 4L64A 3TTYA 1BVNP 1UC4A 1DJHA 2PRMA 4BWLA 3WQPA 1WAUA 3S1VA 3WDQA 2OWCA 2XIIA 1H7RA 1B30A 3TYBA 3AS1A 2W27A 4ATDA 2CFFA 5AHMA 3BH4A 4NAFB 3CPGA 4CNSA 4HHMA 4P7NA 1VH7A 3PWGA 2WC3A 4GJJA 4ALDA 1G7VA 3GU9A 1OCQA 1OFDA 5BRBA 1XP3A 1GVFA 2FPYA 4PFMA 1OABA 1XHGA 4DLMA 1E0UA 1J11A 5LIXX 3KOYA 2Q8LA 4RE3A 2QJGA 2CHNA 1OINA 1GK8A 4IJCA 4JKLA 2HK1A 3U8GA 2QCCA 1LOSA 3GVGA 4OBRA 1KFLA 1XLLA 4IPJA 1NVMA 4IMAA 1TMLA 3M5ZA 3LXAA 4NZJA 5A8OA 3IIVA 1B3YA 3L2LA 5KZEA 2ZFAA 1GT8A 3S4TA 3S6TA 1EJTC 3EOOA 3FDKA 2HWGA 5I3JA 3ZQ9A 2G8ZA 3TYZA 3WLTA 1Z7AA 4IJBA 1G4SA 1AMKA 3S46A 1LWJA 2C71A 1JDDA 1P43A 4HK6A 2OQLA 4XVDA 2D20A 4CCDA 3C5QA 3VCRA 5HQEA 4D9PA 4HN8A 4RZ6A 4W7WA 4AD2A 3L5LA 2J78A 3E2RA 2INFA 1A3HA 4ZEPA 4I3GA 8XIAA 2V5BA 1KRCC 3VCCA 3K8LA 3T6CA 5AYIA 1K4GA 5FJUA 3L4UA 3IUIA 4DWSC 4HTBA 1PIIA 2VZVA 5G2HA 1TPDA 3PTMA 3BJFA 4KEZA 3G2GA 1FOBA 3RYSA 4A05A 2QV4A 3LY0A 3FK4A 2QULA 1EP1A 3BV7A 5D30A 4J3UA 3LCXA 3E0IA 4NHVA 1QI0A 4GI8A 3AIBA 2FTPA 2WM0A 3KRSA 3BDKA 3G22A 3N6JA 3HQNA 4UFHA 1GEHA 4YTTA 1EL3A 1TZ9A 4WHBA 1LZOA 4PTDA 4JQ3A 6CGTA 1NF7A 5AC7A 1YIXA 4HA1A 1ESWA 2UZ9A 4NU7A 2JF6A 4F8XA 4D6FA 1JAKA 4XZLX 1JAEA 4PUWA 3OW1A 3W7CA 2X2GA 4JL1A 2O56A 5FAGA 5K2ZA 4EWJA 4LRTA 4IH3A 4YU1A 3DIPA 4JTFA 1R0MA 4OZOA 1H7OA 3SSJA 3K2GA 3TSDA 3W3OA 1HG3A 4DWSD 3OGRA 5LHEA 2VGBA 1WDWA 3H53A 3GIQA 3PAJA 4X63A 4JY8A 4RNIA 3VZZA 4RKAA 1P0KA 2NXGA 2GQ9A 3GUWA 4B5UA 5DFAA 2REQB 1KBIA 2B31A 2KX9A 1E0WA 2HDJA 1TJ0A 5A2AA 2ZZ2A 1V7YA 3BAWA 2J62A 1EJUC 3SUWA 4C7GA 4GYJA 4DUOA 4JBRA 4GVFA 2ACSA 2J7FA 2OZ3A 1MXDA 2B7NA 5KZ6A 1EF2A 1HL2A 2XG9A 1TTPA 4ZVJA 4PUDA 1BG4A 5EU9A 4UR9A 1TWZA 3SB0A 3EWWA 3ZJ6A 4TV6A 1EQPA 1JZ6A 5BZAA 1VS1A 2QJHA 2A3AA 4CLMA 3MJYA 3LLXA 1RBOB 2DSKA 1YXDA 2JEQA 3WK3A 4F2TA 2NSOA 3E3HA 2GWNA 4V28A 4F0RA 4US5A 4E2VA 2EO7A 1N8WA 2BXYA 5BNKA 1LL4A 2FPTA 3OQEA 3R13A 2YCIX 1JQXA 4IF2A 2V9DA 2PE4A 3N2CA 1GG0A 3L5AA 1ZCOA 2D1ZA 1XSKA 4PE8A 4HA3A 3W7QA 4CNTA 6REQB 4FIQA 1R3YA 4JIQA 3L2MA 5REQA 1GZGA 2GYIA 1GQLA 1M04A 2R1LA 1Q5MA 3O15A 4MTVA 5XINA 3I68A 5T8GA 4M3PA 1ML1A 1M41A 4M6VA 4GUIA 3QR0A 3WK2A 3K4WA 1F3WA 1I2QA 4DM1A 1BYCA 4LF2A 1A53A 3CZEA 4ZFCA 5B7ZA 3FJ6A 1A4LA 3S5SA 3TQPA 3EAUA 4YYFA 1XLCA 4Y9NA 3NQCA 2DZVA 4H9YA 2FLIA 3PAOA 3WF4A 4C5ZA 3UR7A 3KBMA 4KWSA 3ANUA 3D46A 2NUXA 1KTCA 3UGRA 3L4YA 3Q2DA 1TA3A 1IF2A 4PB3A 4J2PA 4FK9A 4CU6A 1MW1A 2PRHA 1ITCA 2WCSA 1S3HA 5C9ZA 2GL5A 3VD7A 3FX4A 5DMNA 1DL3A 5F2LA 3MU7A 4O0ZA 2CHOA 4GQGA 3MP4A 2YGYA 4RDZA 2CEQA 4EPDC 2VOTA 3B05A 4M24A 1RLDA 2VXNA 3P5YA 2QCDB 3TC6A 2OPJA 3PUGA 1FXQA 1LYXA 4JNYA 1Q6FA 3GHTA 3NGFA 3W7EA 3DU0A 4KF1A 4NKCA 1QOXA 1UD3A 1BLIA 5C2GA 3VDCA 1BVZA 1UKSA 2FTYA 4QITA 3O05A 3ITYA 4RDYA 3HQOA 1R3RA 5D32A 3SQLA 1ZJHA 4HHLA 1IZCA 2ZA1A 5HR6A 3MSDA 2C14A 1T99A 3RDKA 4NG3A 3SADA 3TV8A 4R7OA 4B5XA 5BWAA 1GOOA 2QJJA 1KFCA 3WF0A 3AHTA 3MTWA 3TIMA 4IIHA 1E1FA 2X8RA 1N7KA 4JTQA 3NTYA 1PV8A 2ZUVA 5PTDA 1LQ0A 1NWUA 1AFSA 4CQBA 5JMUA 1ZHAA 3BL3A 3ZXWA 1QPNA 5DRIA 4QE5A 3LSBA 1UCWA 4S3DA 3SBFA 4UBPC 1H5YA 1OX6A 2YXOA 3NSXA 4GJ1A 3FYOA 4N0RA 1V6WA 2W6RA 4ZE5A 3NQ8A 1G6CA 5IFPA 4O15A 2XISA 3TJIA 3ITOA 2IUZA 1FWBC 2Y5EA 4HPJA 4LFYA 5HWNA 5K9DA 3DI1A 3CL8A 2XSBA 2D73A 4HOZA 3GYCA 3QLLA 3APTA 4CCCA 1UASA 3E74A 4MYXA 4XK2A 1MUWA 4XV0A 4FX8A 3NG3A 4P7RA 5AN7A 4X9SA 3HFYA 2BTMA 3MHFA 1P0DA 4PCTA 1OT1A 4AD4A 1D7FA 3T40A 1VJSA 3GDKA 1L8PA 4TMBA 3OGVA 4NNAA 1ECEA 1XCFA 1JPDX 5ABHA 5E0FA 5AYXA 2V67A 4JHMA 5F4XA 4QS6A 4LEFA 4MOZA 4CCZA 1BFNA 1W3JA 2TAAA 2DJLA 3S42A 2C15A 1W1B1 1E3ZA 3H2NA 5D38A 4F0KA 1LL7A 2QZRA 2O9OA 3EWBX 3GB6A 1PIFA 3QJAA 2CXGA 3LGGA 2UY2A 3NOYA 2C91A 1YHTA 4NSBA 1SR0A 2WMHA 3BLOA 3NQGA 4C6JA 4H3DA 1EKOA 2ZCGA 2GSEA 3I65A 2E8ZA 2OKOA 3I6RA 3SCPA 1XSJA 2I9EA 4Z1AA 3FYPA 3T2OA 2DVXA 1TZ7A 1KW1A 4JL2A 1IXQA 1Z44A 4J5NA 3VOCA 3WNKA 5AC5A 3H2MA 3LHWA 1QK0A 1R46A 5DEZA 3NEVA 3W1TA 1KBJA 3MPGA 4JTAA 4PUNA 1VEMA 3LTYA 4GUFA 4RZ4A 4X0VA 1ZBVA 3LZ3A 4JN6A 4YTRA 4BK9A 5I2UA 3VNYA 2PWEA 3VU2A 4KRZA 2XWDA 5CZ0A 2WNZA 1DV7A 2BOFX 3E0WA 2FFIA 3M41A 3E5BA 3W74A 1CXFA 3MUIA 3RN6A 4MMWA 1DE5A 4LQ1A 3DCPA 4ZQOA 3CAKA 2BHUA 4I5XA 1XLGA 3WBAA 5HK4A 1RHCA 3LB0A 4PBEA 4AC1X 2HPMA 3ITCA 1CNVA 1DJYA 3PB2A 1S2UA 4PRTA 1P6CA 3ES7A 1UHVA 3TXVA 1XUUA 1MRQA 4IUGA 3BOLA 3TFXA 1L6SA 3TA9A 5LNVA 1LF1A 3GKAA 2VUNA 1KM3A 2NUWA 1RP8A 3QR1A 4P8VA 4ADSA 1FFQA 3TR9A 4IFKA 1JPMA 2OTDA 3OB8A 4WY0F 5EMJA 3OOQA 1JYNA 4ADUA 4C6PA 4ATLA 1LROA 3NPUA 4E4PA 4I90A 2P10A 1A5KC 4RXFA 1HKVA 2HVOA 4DUXA 3K1DA 4YHGA 4P61A 3PHAA 3DOPA 1ALDA 2E1WA 1OYBA 1MZHA 1XLEA 2NT0A 5ABTA 4U31A 4Q4SA 2XUCA 3FV9A 4RPQA 5IFTA 4TXEA 1KLZA 3CHEA 1W32A 1FUYA 3ES8A 4QX4A 4W93A 4AZGA 4IFRA 3SCRA 4UZUA 4PRWA 1M03A 1VCFA 2RJHA 3CGTA 4F9JA 4NX5A 4S3CA 3WL0A 5DXYA 4HOWA 8TIMA 1LWHA 3SDOA 3QR3A 3E38A 1ZBKA 3GVQA 1X6LA 3MANA 2TODA 2DZBA 3UG5A 5ABEA 2VEKA 3HPZA 4XD6A 3AALA 4D8LA 1RP9A 4GUGA 2P5NA 1TJ2A 2AL1A 3IJ6A 3MMUA 1VFFA 4E3TA 3HV9A 3VMOA 3SGUA 4C6LA 5CC3A 1QBAA 5TD4A 3L65A 1DQWA 1XLBA 3LCIA 3W7DA 3O6CA 3R0KA 5RUBA 3MKCA 3URQA 2BOGX 1W37A 2V38A 1I6NA 3S9ZA 1KFBA 1Q6CA 1P0EA 3AHZA 3NPXA 1N8IA 1JFHA 2WK2A 1ISWA 1TV7A 1LUCA 3L9CA 3Q58A 4PEKA 5LXEA 1TVLA 1BRLA 3CPRA 4CEUC 3M0ZA 1LBFA 2B7PA 5C70A 2ZRUA 4CU7A 4EX4A 5GJMA 3WH6A 6TAAA 1RCOB 2XFYA 3T4CA 1LJYA 1UP0A 3A64A 2Y7DA 2DSWA 4U33A 3STPA 3GC4A 3W73A 7TIMA 4XQ6A 2E6DA 3WUFA 5HINA 1VB9A 3SRKA 3TTQA 3VGFA 1I0BA 2P0OA 3GH5A 2GSJA 1OFAA 3WF1A 3UWYA 4EOUA 4PMJA 1CTNA 1GOQA 5JQ9A 1WXJA 4JKKA 4GLEA 2W92A 5JUVA 2VWSA 3SGZA 3VGDA 1ZSXA 3H24A 1K8CA 1UB3A 3UJEA 2VFFA 4LOCA 1KFEA 1EH9A 4H8NA 2C7FA 1OEPA 2QPUA 4REQB 5A8QA 4NZFA 3ZMRA 1RXOB 2FMOA 3VKCA 1IT0A 4JIRA 1XDLA 3VABA 3FCPA 1I60A 3TYDA 4DYKA 3OTRA 1LP6A 3FA5A 1YNQA 2FGBA 3AJXA 3B4UA 5CAHA 1GVYA 1V79A 3M0IA 5BWFA 3LM3A 4E2OA 3I6TA 5ECUA 4C6DA 3GXDA 3G0UA 1TB3A 4NXSA 3B40A 2WO5A 5LA2A 4CU8A 3EXTA 2HISA 1MW2A 4LVDA 3BMVA 2Y88A 1HW6A 4N4PA 3CO4A 1JCYA 3VTRA 1XLHA 4B15A 3G18A 5SWUA 1GEQA 1I1WA 4AIOA 3CLWA 4XO6A 3W1UA 3GTFA 1F07A 4H9TA 2PDPA 5LYRA 3W76A 3U7BA 2WMGA 3IJIA 1WBHA 1KGXA 3TZFA 1AK5A 1TV4A 3GAYA 1F9CA 2VR2A 1UD4A 2QMKA 4XAPA 4P8XA 4C1KA 3IJQA 1SJDA 4XIMA 3VD3A 1XV8A 4DJFC 4DJEA 5J5DA 2B81A 3HO8A 2PWUA 3MP3A 4I7UA 3W7RA 4GH1A 3GNOA 2PP0A 3RLUA 4NQ1A 5I0DA 2X05A 1SO5A 4XZBA 3AYSA 1E9IA 5C7HA 4LUYA 2A3CA 3A4JA 2AGKA 3I4EA 1GW1A 3NYDA 3UA4A 5DMLA 2PD9A 3RU8X 3EEZA 2WLYA 4W5UA 2Y24A 1G0CA 1DOSA 3QSTA 2D2OA 1JJKA 4GK8A 3H7VA 5FJRA 4R88A 4CUCA 4ZOBA 1IEVA 3CB8A 1H7XA 2J7DA 2WKGA 3CHDA 1AG1O 2F2HA 5JBDA 3UGVA 1QW7A 4JHOA 3VGEA 2H6RA 3DKJA 4FNPA 3NM1A 3T0CA 1NARA 5LIKX 2BGQA 2F6UA 3ZWTA 3E96A 4ROPA 4Q8UA 1F2JA 4FP1A 2V5CA 2BGSA 5U4NA 4TTGA 1FH7A 4JTEA 3KXQA 2WB5A 3OEXA 4LUTA 1ICPA 2ZICA 4FS9A 2QVNA 3CIWA 2Z7GA 1KQYA 4O12A 1UJQA 1E6QM 4OJYA 2IPGA 2VX7A 1THFD 3AMLA 4Q7IA 5EFDA 5GNZA 2PDHA 1G01A 4UTTC 1WDSA 2CLOA 1IZJA 3LQLA 1EQCA 1DWIM 4LAUA 1UROA 1XL9A 4GISA 1EYWA 2DSUA 4S3JA 3E02A 2NQ9A 3CAQA 1UZDA 5AHEA 4C6BA 3BAXA 3NSMA 5EPDA 2ZWZA 4DBDA 2ISVA 5TIMA 3G0SA 4R85A 4Q8MA 4A8IA 5FKYA 4NY2A 3BCFA 4JNZA 3IIPA 3ENLA 1V02E 2YL9A 3SQSA 4ZO9A 3E9AA 4GI9A 1A5MC 1V6TA 1PAMA 4CD8A 3TN6A 1V08A 3W29A 3B8VA 4ZZ9A 2FB2A 4KRTA 3NO1A 3P2VA 5AB3A 4LYQA 2YL5A 3I6EA 3NZRA 5DBUA 3CASA 3RJYA 3PBUA 2GVGA 2AAAA 2YR1A 2O7QA 2VYOA 4HJFA 1QT1A 1NH6A 3FKKA 1KV8A 3W6MA 3IGSA 3GQYA 1B3ZA 1PZ2A 1UYQA 2YBTA 2J47A 4GG9A 4RLIA 4Q4MA 4N9EA 1DXFA 3XIMA 1R9XA 2BOEX 1AH3A 1KWKA 4H4IA 1XQLA 5HPCA 3UP8A 1AJ2A 4LUSB 3G8EA 3IRDA 2OQYA 3IIOA 5FF3A 3BAKA 1I2OA 3APYA 1GTEA 3MKKA 1DPMA 3N14A 1K8YA 1OYAA 3ID7A 1V3KA 3CZ8A 4B9ZA 1R5YA 4TVCA 1POKA 3HG3A 3M0HA 1X1OA 3QEZA 1VBUA 3HG4A 4US6A 2Y4SA 3VOHA 4NZ4A 3DC8A 1B3VA 3N17A 3RMEA 2XSXA 1NSJA 1OCBA 1ZCCA 3ARRA 4U5IA 2HZGA 4LBSA 3GU1A 1O7AA 3GR8A 3H2OA 2JFEX 4LYKA 3MUZ1 3QXBA 2Y62A 1O5RA 2VM8A 4PSRA 1KKOA 3HQ1A 4PMYA 4MM1A 1SGJA 3GFXA 2ZUNA 4DXVA 3STCA 5EMMA 2I9UA 2VFIA 4AIBA 1R38A 4N4QA 3ZSSA 3VDAA 2QLYA 1OBAA 1V3JA 3MQTA 5AOUA 2Y63A 3GM8A 1P5BA 4F0SA 4KFPA 1JZ4A 3QPYA 3NUKA 1OY0A 3WLKX 4IMGA 2QUNA 3THAA 2WVUA 5KSWA 4BF9A 2GJLA 2JKAA 5I3GA 3IANA 4NVTA 2VZUA 4M6QA 2V3GA 1V3LA 9XIMA 5BW6A 4CQDA 3LRKA 2FJKA 4MWAC 1O12A 1OT2A 3XISA 4TX9A 2ZZ7A 1IR1A 1FWDC 3QKZA 3WQEA 2EXOA 3LRLA 2E6YA 2CBUA 3VE9A 1ISYA 2PU1A 1XWYA 3LI0A 3WIJA 3V0SA 2MUCA 4XBKA 4LCSA 4UFIA 5HJLA 4LBRA 3M0MA 4RV8A 2A3EA 3A47A 4EVZA 1PZ1A 1KCKA 3T08A 4OBSA 3AFBA 4A8NA 1KA9F 4GC4A 4FXJA 2IMRA 1H63A 3W38A 2Y6ZA 1H2JA 3DZ1A 4MKVA 1M7OA 1E51A 3ABRA 3DENA 5AC6A 4TTUA 2WCGA 3JUGA 3PSWA 1AODA 2HE5A 3GD6A 3CZGA 4Q4KA 3KW3A 1XYCA 4DYEA 4MY8A 2BXVA 1H5VA 1K70A 4UFLA 3URBA 1QNSA 4AY7A 2BDQA 3KOXA 1WB0A 5A8PA 4DJFD 3LV6A 1EZ2A 2IQDA 1CCWB 2Z6JA 4X0NA 2ZOXA 4PZVA 2BSLA 3R2GA 2E6AA 2WSPA 4KERA 3BAJA 2TPSA 3M0VA 3GNNA 2OLAA 4O4VA 4WRHA 1ECQA 4NF7A 1DIEA 2PLCA 3T05A 4R5EA 1I2PA 4OIFA 3FFSA 3BZJA 1SZEA 3K30A 1TJPA 3QH2A 2DZUA 3IRSA 3GNPA 1W8SA 3NL5A 2OODA 3CMJA 3P0XA 1KBBA 3ZR4A 1K03A 4DUVA 4FXSA 4YCOA 1W9VA 4GBDA 5F7UA 4LY4A 4KPLA 4K7YA 1SMDA 4B5NA 1I45A 4QJ4B 1MFVA 2OEMA 2OO0A 3BQ5A 4JD4A 4HP5A 3AU6A 3IWPA 4N6EA 3FHAA 3ZOAA 1JPIA 5G4EA 3P8IA 5A6SA 1HP5A 4CKQA 2P0IA 2FFCA 3KWXA 2I5GA 3IUHA 1JDAA 1MNSA 2WC7A 4N6FA 3ZT6A 2R82A 2VENA 3FA3A 1I2RA 1FTXA 2DW6A 2I14A 2VHLA 4XO7A 2O0TA 4NX0A 1NDWA 1YX1A 3IVSA 5FCZA 4DN1A 1JG9A 4D71A 1H62A 3V4BA 3PZTA 1YQ2A 1GWJA 4DWDA 4H9MA 1QAPA 1OGGA 3BLPX 3WD2A 2AQVA 3CZKA 5FEPA 2CLIA 4ZXLA 1F6PA 1L8NA 4B92A 5U7SA 4WJXA 2E09A 4GC3A 1VZWA 4WEVX 3PJTA 1R3TA 5JVLA 3UYCA 3RLVA 4QE1A 4MB3A 3GVVA 1RJPA 3DFPA 3PPFA 4S2BA 3AXXA 3MY9A 5A2CA 8RUCA 4UTWC 4ORMA 3HGJA 3SUTA 1TELA 3NL2A 3WD0A 4JDBA 1EF3A 3EX2A 4HCLA 1W1A1 1N55A 3G8RA 3QY6A 2JKEA 4CN6A 5C6MA 2ZX8A 1ZB5A 1QXLA 1HKKA 3MO7A 5D4YA 5HMEA 4WGHA 3S1GA 1KM2A 3W70A 2Y5JA 4GFIA 1PWMA 4Z2LA 4J9JA 1S5NA 5AVHA 3Q45A 3DBPA 3NQFA 1UH4A 1F3EA 1ZLPA 3UZZA 3V0TA 3TFCA 2YCEA 1PIGA 3USZA 3BPWA 2J25A 3U2CA 2BMBA 4IX0A 3WUGA 2W61A 1UWRA 2BY3A 4DWSA 1TPUA 4LNCA 3FJNA 3TYCA 1KBLA 4O52A 1IT7A 4UTHA 2XU2A 4RXGA 3SJ3A 1XW8A 4J7RA 4UFJA 1WCGA 3PPHA 3W24A 3ATZA 4PULA 4PTWA 3UEQA 1FRBA 1JPHA 1OZMA 4Z0SA 4NI3A 1NIUA 2PRLA 4MHBA 4PR4A 1CECA 3THCA 1S5WA 5FL0A 3PULA 4B5VA 2W67A 3T8QA 1IZKA 1JFXA 4IPNB 3LTPA 5GPRA 4MDPA 3V1HA 2V68A 3VIMA 2PWFA 4AZCA 2P1FA 1SZRA 4UXDA 7REQA 1E6SM 1M7XA 2DVUA 4U5KA 1X1ZA 3DFSA 1YE4A 3EBVA 3L68A 1LCOA 1E4NA 3RK8A 4KIRA 4RNJA 1WKYA 3QM3A 4RL3A 2GVLA 3C3UA 3LHVA 3KL0A 1GOWA 2EGZA 5FJIA 1MQQA 1VFTA 1PL9A 1V0NA 1M7JA 1HUVA 3KRBA 3OVGA 3G77A 4V1XA 4C6QA 2FHBA 3TTEA 2ZWYA 4AVFA 2EG6A 4BY3A 4F2BA 3M7SA 2UBPC 3K1GA 4UTWA 4WKHA 3ZYZA 1XKJA 4BEUA 1HX0A 4WJ8A 2QCNA 4XBJA 1SO6A 4O16A 1HJWA 1DJNA 3BZGA 1VBJA 1ZQ5A 2PDMA 1QW8A 1J5TA 3LGEA 1GTHA 3OBKA 4GY1A 1IEIA 4UNIA 5D9OA 4YTUA 1J01A 1LWIA 1NM9A 4IISA 2DZTA 5DO8A 2X41A 3VIFA 1OX4A 4H6EA 2WWCA 2Y89A 1G9HA 3LUTA 4LV4A 1C92A 5ABFB 1KM1A 3CO8A 2VURA 5BRQA 1CLKA 3TK7A 4JQ2A 3T4WA 2QJNA 3VZYA 3GS6A 4RE0A 2YCLA 2QV5A 3WQ4A 1IWAA 1DXEA 4KWVA 4AWEA 4QSHA 4QM1A 3W6LA 1BQGA 2YB4A 1FH8A 4FLSA 4I5RA 4IM4A 4ZFMA 2QCEA 4GYFA 3CYVA 1VPYA 1B9ZA 4PTMA 3UXIA 3C0LA 4HZ8A 1J0YA 5BU6A 3E5PA 3BO9A 3OA3A 1LRQA 3WJZA 4CCEA 4LS1A 4XD3A 1IEWA 1EX5A 3AIUA 1F6YA 3AMCA 3T2QA 3VILA 2GJPA 3KAOA 4O8RA 4J3VA 1TVNA 4HPXA 2OWXA 2XZ9A 4IIFA 3GE7A 1EZWA 1QPRA 3QRHA 2JBMA 3G1HA 1WA3A 2Z00A 1NDVA 1VFHA 3TX9A 3II1A 2CERA 4K37A 4ZSUA 3UU0A 1VF8A 1GNXA 5H8MA 4OOZA 3WBXA 5C54A 3NQBA 1SZNA 3EOEA 4L80A 3M1ZA 2YW3A 1MRAA 5I3KA 4Y9MA 1SFTA 3R10A 5JXQA 5HXMA 3EPOA 2QCMA 1O5QA 1YADA 1XI3A 2JE8A 3WLIA 3QMRA 2FGZA 4YVPA 3F5KA 7TAAA 4WCJA 2ZTJA 3BCJA 4MAZA 5HNTA 3PUEA 1AZ2A 1C8YA 2AGTA 3MUXA 3OVPA 1B3XA 4UCGA 3RX4A 3LERA 3WDJA 3O63A 3H2EA 5DRCA 1DWHM 3CJPA 4J1OA 4LBUA 1TQXA 1XLDA 3C61A 3GH7A 1I9CB 1O68A 2D24A 3CV7A 4JKMA 3OLGA 3SQMA 1B4KA 4DO4A 4MWAB 1HL9A 5LKYA 3QVQA 4PTVA 2NUYA 3BOXA 4DZHA 3VINA 1AL7A 4X22A 3AHYA 4HPHA 4EAMA 3UD6A 2J7EA 4A21A 1A5AA 3QV7A 3U2EA 4GGBA 1CWYA 4A2RA 1HN1A 1XG3A 3ITLA 3ZR5A 1OFPA 3OVRA 1DBTA 3LNPA 1OF6A 4PMNA 4V15A 4GVGA 3LI1A 5GJNA 3CUGA 1S38A 4YMZA 3PNZA 1E6XM 1J5SA 3PWIA 2HSAA 4KEVA 5IBXC 4MLRA 2OLHA 4NJJA 1TE1A 1PTGA 4JZ5A 2Z1KA 4LVFA 3MYPA 1H1ZA 1SUXA 1BWVA 3GWQA 1UC5A 4OGZA 1OF8A 4PC8A 2ISSA 3SCOA 5AFDA 3TEVA 3WDIA 4IGHA 2CBJA 4DPQA 2C0AA 2VQTA 4AUBA 1ITXA 1SFSA 1OHLA 2JIWA 3HGOA 2WPBA 3ELFA 4H7ZA 4XKMA 5FJJA 4WKAA 3KOWA 3WQOA 4A3RA 3NO5A 4Q8OA 5CZKA 3RO6A 3UNDA 2EJAA 4E38A 4AH7A 2XH0A 2YDRA 3VE7A 3KHDA 6XIMA 1JZ7A 4GUHA 3E12A 2Y61A 1F61A 2HEJA 2DZWA 1TE6A 4QRNA 4KEUA 2A21A 2WBKA 1WO2A 1Q6LA 2D23A 1EDQA 3KRUA 1GYNA 2R1KA 3AIWA 4ZENA 2PBGA 3AXKA 1NOUA 2POTA 3O0KA 3EB2A 4DY1A 1VEPA 2VL4A 3QMSA 1XLMA 3MI2A 1QJWA 2C8NA 4IMFA 3P80A 3MKVA 1AUSL 1SPQA 4WOQA 2OU4A 4FNRA 5C71A 6PTDA 4NNBA 4YWIA 3W01A 1RVGA 3OZPA 4TO8A 1CGVA 2REQA 4OV4A 4WY0B 3UF9A 3KDNA 4XISA 2HK0A 2VMFA 3SO7A 1GCYA 1CI1A 1XYMA 5CCZA 1DXIA 4MKNA 4D6HA 3GHSA 5KZMA 1IIHA 1EIBA 1X96A 4QNWA 1E3XA 2PAJA 2ZDRA 4GOAA 1BKSA 1QWGA 2C19A 1I0DA 1FVPA 4XD5A 3GSMA 3GZ3A 4L5ZA 4XVEA 3LYEA 2Y5SA 1G4TA 2YOCA 4NAEB 4J40A 3NO3A 4QFUA 1UZ1A 4S39A 2VNCA 4OV9A 2E8YA 2CLKA 2FZ9A 3AC0A 1ZAHA 3PZIA 3NZQA 3V16A 4Z17A 1U1JA 3ABOA 3FDGA 3R79A 3P6LA 4AFYA 2WHLA 3N12A 4FZIA 4XB3A 3THDA 1LL6A 1UKPA 1ONEA 4G5DA 4A3YA 2QXWA 3QW3A 1BD0A 2NWSA 1S2TA 1TREA 1WKEA 2GOKA 3PP7A 4A3HA 4AX7A 1Y65A 1QFEA 4Q4QA 2WNNA 3N18A 3PBYA 4D6IA 3ZZ1A 2WSRA 3QGKC 4G6CA 1UP3A 1W17A 1K7EA 2X16A 4HTYA 3A24A 3GDTA 2BODX 5CPNA 2P50A 5FJOA 4DWSB 3NNTA 2E40A 3GZAA 3CAVA 4AIUA 2XPKA 1NQ6A 1HFBA 2NT1A 4ZODA 1E6PA 2YA1A 5D8WA 1CXEA 4IPLA 4PTNA 2Z2AA 4EIVA 4TU1A 4BJHA 1LRNA 3AMKA 3DBNA 2GOUA 1VAHA 1EEXA 4OE7A 1FWFC 1K7XA 5A6BD 3JU2A 3S8HA 3FW6A 2F61A 3TQKA 1KRMA 3SN4A 1QHOA 2PODA 4GVIA 3MJMA 4ZQMA 3LGDA 4PRRA 1X98A 3OZMA 3S9IA 4W5ZA 4PCFA 1DIKA 1OB0A 3QYQA 4LPCA 1QNQA 2EPOA 2PZ0A 3DAQA 1O60A 1MFUA 1UR8A 4H8VA 1ICQA 1ZTVA 1LQAA 2WSKA 3N9SA 4Y9OA 3JZEA 2IKGA 1H51A 2WSQA 4OUEA 4ZQPA 1GOKA 4QBXA 1RCQA 4M0XA 3BJTA 3TSMA 1VRXA 2ACUA 1D8CA 4WDUA 2Z1VA 3LNMA 2UY5A 3LCWA 3M0JA 1KLYA 1XC6A 2WMIA 3NM3A 3NZPA 3BE7A 3ME3A 1JZ8A 1ME7A 4HCDA 4PN2A 3N25A 1TPVA 1SR9A 3C0QA 1W9XA 3LPGA 4X2RA 3GFZA 3U2OA 4A4AA 3B8WA 3VDGA 2DQXA 4HSNA 3TN4A 1TUFA 3O1NA 2VD9A 1OFQA 4I6KA 1OYCA 3PZGA 4C91A 1QDSA 3CTTA 5E9AA 3LBMA 1CXKA 3O16A 3P61A 1FP9A 4WY0A 2GZXA 1R9ZA 3KWSA 5A6AA 4XKYA 3BW4A 3PZVA 1VR6A 1MDRA 3EEGA 1P1MA 1CIUA 1GONA 4AQLA 3R5EA 1HJXA 2R24A 2X2YA 2KZHA 2QCGA 5BOFA 3NSNA 4WDXA 5A1AA 4RV3A 3BURA 1GVQA 2WCAA 1J18A 2JALA 1OD8A 3UBPC 1G5AA 2DT0A 2CIPA 4PFHA 2HNHA 1Y8BA 2P3ZA 4PUJA 5DLCA 2NQHA 3U9IA 3TU9A 3W37A 3NXLA 1DWGM 1WUFA 1WZMA 3WELA 1K6AA 2DZXA 2A6NA 1ITUA 1NP0A 1EUAA 1JF5A 3N4EA 3BLEA 3UYIA 1CGXA 3JW7A 3B9OA 2E68A 1A0DA 4S3FA 1X6NA 3R94A 3QHMA 1Z69A 3N34A 3VXGA 4J28A 4RW5A 3UETA 1QR7A 4LAKA 3N29A 4EACA 2VCAA 1XBZA 3APGA 4PSPA 2FPVA 1MO0A 3A5FA 4QAWA 3WL1A 1VHCA 3LM7A 2HS8A 3QKEA 4IIEA 5BMWA 1RLCL 1IGWA 1K4HA 5HANA 5REQB 3JVAA 3S5YA 4FR1A 1ISZA 1NELA 1CZ1A 4GIEA 1FWRA 3T81A 2VC9A 4DF1A 2DH3A 5G5IA 2ZA3A 4S23A 1GKPA 1H4PA 1REQB 4X2PA 2YW4A 4WXYA 2J9XA 3M64A 2OXNA 1C9WA 3S0CA 1V0KA 3AMGA 2NQLA 4D1IA 5J8LA 1J10A 5I77A 3GDBA 3A22A 3WZ0E 1JUKA 3SSZA 1E0VA 2WZTA 3KBSA 4AZIA 2NZLA 2ZKMX 3KBJA 4EF9A 3P5ZA 2CU0A 5MF5A 3GUGA 2WQPA 4WX2A 3UG8A 1TMHA 1KC7A 5CGQA 5C9RA 4YL2A 1LLOA 3U0HA 5K4XA 3VD4A 3VAVA 5E6ZA 4UQAA 3VGHA 3J7HA 1F7BA 1BRLB 1VFLA 2NXIA 4AHOA 4JX6A 2QVHA 3TJLA 2WQDA 1HT6A 2IPJA 4BF7A 4IGSA 1DIDA 2GUBA 3MBFA 5C0QA 1TV2A 2V5KA 4K1GA 3REQB 1PE1A 4HZ7A 1X1NA 3HPFA 4Y90A 1S3TC 2OYMA 4HMCA 4FOJA 4OU1A 4U3AA 3U48A 1J4EA 2GVJA 4YNGA 3TNOA 1M3UA 4PMXA 5K9XA 1W56A 2A3LA 1EBHA 2DJXA 4FOUA 1IV8A 2J8GA 1OFEA 4HD5A 2BY0A 5D2WA 3ANVA 4W88A 1O5XA 1XIJA 4URIA 3B97A 1HO1A 1NWRA 4B2DA 3W22A 3GFYA 3GNXA 4LY8A 2FGLA 3P67A 4B5WA 4P8UA 3LZ5A 3UXAA 3CPUA 3DGRA 1HL8A 5EA9A 4W85A 1OG6A 3W2NA 1NFBA 2G41A 1DYSA 1TRIA 2VWTA 2CLFA 3LEPA 3HJEA 4EP8C 4HMDA 3AS2A 5DF0A 1GQKA 1J0IA 2O9RA 2WVVA 4N7QA 4LEQA 4FB7A 3OHMB 2FVLA 2OZ8A 3PF3A 3UXLA 2I17A 1O5KA 1SZGA 2BP1A 1PS9A 2Z29A 1V02A 1S2VA 3STGA 1JRCA 3VKDA 3SCNA 1TUXA 4HGXA 3E0VA 1EOKA 4DO6A 4ZSTA 3PZNA 1S39A 3MBDA 2ONEA 1SMAA 1OGSA 2FB3A 1O95A 4PMDA 5G1YA 1K9DA 3FKRA 2OT0A 2R94A 2DUZA 2VX4A 3PBWA 1XIBA 1JCLA 4B2DD 3HGRA 3VM7A 4MAVA 3MCNA 4XG1A 1SZFA 1RJRA 5FESA 4IX2A 3WKZA 2D0GA 1DKWA 2NV9A 1E1CA 1QVBA 1QNVA 4GXMA 4K8EA 3CK5A 2QPXA 4HIBA 2GJNA 2YX0A 3KS6A 1CYGA 1UJPA 3UJ2A 3QHNA 4LALA 3PY2A 3GXTA 3T44A 1NU5A 4BWLC 1TCMA 2L5HA 3BLKA 5FOOA 3CUHA 1FX6A 4AD5A 2YFNA 3W88A 4QCEA 3VO0A 3G1XA 2BLEA 3C2YA 4M82A 3W1QA 3KVKA 1R7OA 1RY0A 3M16A 4AZ7A 3LHTA 4AD1A 3ERPA 1VYSX 4WVXA 4AWSA 1KB3A 5HATA 2Z25A 2HTMA 2QAFA 3KCOA 3EXRA 3VDBA 3WMCA 3AWOA 3PZQA 3MMTA 1RY8A 3D47A 2HXTA 1K6WA 2ZUWA 2F84A 4IIGA 1E72M 2HJPA 4A3UA 1EDTA 3LXCA 2EPKX 5F1UA 1TCDA 4BI6A 4D1JA 3A12A 2CNCA 3I3BA 3N2TA 1S2CA 2A85A 5A8GA 3QQ1A 1VBHA 2ABBA 4HNLA 5CBIA 3W75A 1V03A 5CC6A 3MWAA 3W87A 4XUGA 4LW7A 2PDBA 2I57A 1G1YA 3UCDA 1FP8A 1OJXA 4Z08A 1WPCA 1H50A 4XZNX 2J9ZA 3WQGA 1JF6A 3MHGA 2UV8G 5AECA 2EPHA 1VPXA 1CLVA 1X6UA 2AMGA 1UP2A 3I3EA 4F0LA 4UTMA 3DG3A 3D6NA 3CQIA 3GY1A 5CSYA 4ADTA 2Q8XA 4QNEA 4NIRA 1I4NA 4HHHA 1HVXA 1QPQA 2G95A 1W91A 5H91A 4HB7A 1YEYA 2RUSA 2CLPA 3W72A 2XINA 5I3IA 1ITQA 3UFYA 2GQ8A 3LPPA 3CT2A 1QTWA 2POZA 4K3ZA 2XM1A 1DJGA 1PDZA 5B80A 3PJWA 3BG9A 2QR6A 4PMRA 3HV8A 3WENA 2Z27A 1DWAM 1RALA 1W1YA 4YCPA 4FX6M 1IXOA 3FVDA 6A3HA 3O6AA 2ON3A 4UQ9A 4A6GA 3Q94A 4NRRA 4JYEA 4OWGA 2WW5A 3CMGA 3CUIA 1VIWA 1SM9A 1RV8A 3GXIA 1BPLB 1RAKA 1K9FA 2YCJA 4LYRA 2OGJA 4O1DA 3F2BA 5F2MA 1W8GA 5H8PA 5LXXA 4GACA 4CQ9A 3W7HA 2PLJA 1J0KA 2ATMA 3M44A 4JFVA 3CUZA 1FWEC 3FA4A 2OYLA 4RNHA 5L9FA 1VBGA 3R8RA 3ZLFA 1F74A 1MVYA 3RRAA 2P3EA 3TTSA 2DUXA 3BGJA 1GOMA 3WLHA 1E56A 3C8FA 3L67A 4XTIA 2GQ3A 1EHNA 4MYAA 3BG5A 3ONCA 1O6IA 4LC6A 2NX1A 3E0FA 3DXIA 1UQYA 4JYFA 3E0LA 2EPNA 1AJ0A 2E77A 3FJ4A 3JRKA 2WMKA 3POHA 4D6CA 3TSBA 2WYSA 4QGCA 1B0IA 1HJUA 3WD1A 5A8NA 3GG8A 2GK1B 4GCXA 1F76A 3CBWA 2E5DA 4L7ZA 1ZENA 1QOPA 3NJ3A 3LSCA 4GGHA 1SW7A 3FSUA 3C0JA 4B5SA 1BQCA 1KTBA 3IGHX 4RDVA 3CV2A 2J6VA 4QEEA 4IICA 1SW3A 3BW2A 3ZJ7A 1W1TA 1MEWA 3W86A 1JIBA 1IXPA 2PLMA 3EWDA 1VPQA 4KIEA 1PYMA 4DI9A 4PA8A 4IIDA 4IQEA 2MANA 2X09A 5A6LA 2QHAA 1SSDA 3GW3A 1VEOA 4UIOA 3NDZA 1AQHA 4AX6A 4PL1A 3KE0A 3R8GA 2IXUA 2FHFA 4DB7A 4ZO8A 1E5JA 3G1VA 5AZ0A 1E6NA 3IVUA 2QUMA 1E9YB 3S5NA 2ZBTA 4JTTA 3QV9A 7XIMA 1EIXA 4R27A 4LB3A 1KRBC 4H1ZA 3TNBA 2CZEA 2PLKA 4TR9A 4JN7A 2JQXA 4GHRA 2PDLA 4IOTA 5E1QA 5BYWA 1ELSA 1A47A 3W25A 3RRXA 4BR1A 1QNRA 4Y7EA 4KCUA 3NAVA 2BGNE 4H8HA 4PH6A 1V0MA 2IKIA 4H41A 4GX8A 3SCTA 1EUNA 1T8QA 4TOQA 3L12A 4WIWA 3VMPA 1Q63A 3HURA 3GNRA 2HVMA 3UG4A 1XIHA 2XIJA 4R7JA 3CL7A 2WXDM 1VIZA 3VNIA 4H6KA 3RCYA 3SN0A 3KOZA 1GVRA 3GNDA 1E43A 2ZRWA 2INZA 3EOLA 4JYDA 1NY1A 4LVAA 4BQ5A 1I8JA 1I2NA 3DDMA 4IWWA 5C2XA 1HKWA 1AJZA 1US3A 2PEVA 1BHGA 2FMNA 4O0QA 3S2JA 3SRFA 4DZ5A 4UTFA 1XYAA 3NQ2A 3UT0A 1WNOA 1M9HA 3H54A 4GQ0A 1XYLA 2HCVA 5FAJA 4JIPA 1S5VA 3W9ZA 4MFEA 4YN5A 2OB3A 4OQVA 3MZNA 1UD5A 4I9MA 4GKLA 3CZLA 4JTSA 5HWJA 3NEHA 1W3LA 1Q6OA 2XJ7A 4M81A 5BXSA 1V7AA 3QTGA 2O4QA 2QDHA 3LD5A 3W7IA 3MDWA 1VJIA 5HQMA 4IFKB 3B4YA 4PMZA 2GK1A 2A6LA 4E3VA 4BKNA 5AYBA 3SZ8A 3CHVA 3ITVA 3SR7A 4ORIA 3VNKA 4M6UA 5H1WA 2C1HA 3N2BA 4WXZA 3FNDA 5T91A 1H49A 1C3FA 4O1BA 4ACZA 3OG2A 1US0A 3C2OA 1L6WA 1A0EA 1PDYA 3NGJA 4B9YA 1FXPA 2YYTA 1OQFA