5BW5A

Crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase d21a mutant from catenulisporales acidiphilia
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
219
Chain Sequence
b'KVLAGKKLTDLDPAEWAKAQASAERILVDVGTGDARTAYRQAIAHPEWLVVGVDPAWQRMTETAVRAARKPAKGGAPNLVLVSSAIETVPAALHGVADEVMVLMPWGKLLRGVVLGEADVLSGLRAVAKPGAPLEISIGTSIWREPIPLEIRDLPELTPETVVSTGLTDRLAALGWQVADVRLVPHTDLDTISSSWARRLGSGATETVLHLRAVAVDPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA (adenine(1408)-N(1))-methyltransferase
molecule tags Transferase
source organism Catenulispora acidiphila
publication title Functional dichotomy in the 16S rRNA (m1A1408) methyltransferase family and control of catalytic activity via a novel tryptophan mediated loop reorganization.
pubmed doi rcsb
total genus 67
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5bw5A00
3V8VA 5JUWA 4JXJA 2P8JA 4QQNA 1WXXA 4QVGA 5K0NA 5KS2A 2NP7A 2IGTA 4P7JA 5EKXA 2G71A 4GBED 5K05A 2BZGA 4KWCA 4AZVA 2PXXA 3EVEA 3P2EA 4G56A 5D1HA 3UZUA 3ELWA 3E23A 3FUTA 3CJTA 2PLWA 3DMFA 3HEMA 3KQPA 4LWPA 3OE4A 1L3CA 3EGIA 3BZBA 4E33A 4ATNA 1V39A 4CWAA 2VDWA 3A7DA 4R6WA 3FUWA 2YR0A 1R18A 5T67A 4AZSA 4EKGA 1NBHA 3GRRA 3LSTA 1R74A 3IHTA 3P2KA 5DM0A 2GLUA 5DM1A 4DMGA 4POOA 3NVKI 4C08A 3EGEA 3KQVA 4YUWA 1L9KA 3AXTA 3SM3A 2PKWA 2OYRA 3SGLA 4RV9A 3KQSA 3LCCA 2ZIEA 1VBFA 4EMSA 5LQRA 3CBGA 4Z2YA 4C03A 5DTQA 3PX3A 2PBFA 3X0DA 4RTPA 4XUCA 3T0IA 3D2LA 5E9JA 3G2PA 2OZVA 4PINA 1TPYA 3R0QA 4C07A 5KQRA 3GNLA 3I58A 3K0BA 2F8LA 1KPHA 1DUSA 1WXWA 1VIDA 1XCLA 2E5WA 3ELDA 4KIGA 4Y30A 4F86A 4ER0A 4R8SA 4K6MA 3UJBA 1YZHA 1X1BA 3TMAA 5LQKA 4GQBA 4XUDA 5F2OA 5LSAA 5C0OE 1FJXA 2IIPA 4QTTB 1KR5A 4LG1A 4PYOA 5DLYA 2PWPA 1Z3CA 2UZ4A 2P40A 2JHPA 2WA2A 3KPYA 4HC4A 4HRAA 4RYLA 5CVEA 3NMUF 3K6RA 4A6EA 3EVCA 3KQWA 1NW5A 5E9QA 5HFJA 1QANA 2EJUA 2FCAA 5DX1A 4BP1A 5GIPE 2HTEA 3TLJA 4C06A 1XCJA 4GC5A 5P8WA 2DULA 5ICFA 4AX8A 3UJCA 5BP7A 3GWZA 3R3HA 3C6KA 3JWIA 4MIKA 3QV2A 3UJ7A 3ER9A 3BWMA 2UYOA 2ERCA 2I6GA 3KPWA 1ZQ9A 5FWAA 5JR3A 5GINE 2ADMA 2LD4A 5FA8A 3REOA 2ZFUA 3KHKA 2ZULA 5LQAA 4AZWA 5DXAA 4RX1A 2O0LA 1WG8A 3E7PA 3LKZA 4IWNA 5K0FA 5K0EA 4OA8A 3FZGA 4FR0A 4FGZA 5D1NA 2ONYA 2IH2A 2AVNA 5DSTA 2ZBPA 3C6MA 4DKJA 2FPOA 1IY9A 2PXAA 5EIFA 3C0KA 3TOSA 1D2GA 4KDCA 3C3YA 1MJFA 4RVFA 4RTNA 3P9NA 2C7QA 3R6TA 5GWXA 1RJGA 2ZWVA 3B3GA 4PYQA 4X60A 2P7IA 5LR6A 3LDFA 5FADA 1KPGA 3B89A 5DTRA 2BR5A 3EGVA 3DXZA 4B17A 2HWKA 3A27A 2AR0A 4DQ0A 5DX8A 5K0BA 2C7RA 3KQYA 4BLWA 5K01A 4O29A 4GF5A 3MB5A 4FZVA 1VP9A 1G38A 5C9ZA 2JJQA 2PWYA 1SKMA 3UJ9A 1AF7A 3EVZA 3HNRA 5K8VA 4X1OA 3VYWA 3G7UA 2G72A 5CM2Z 5E1BA 4ZTBA 3TKAA 4DZRA 1ORIA 2QE6A 5EOVA 3GO4A 2PY6A 4H0NA 4BY9E 2AVDA 2ZIGA 3IEIA 1VPTA 4BLUA 1ZGJA 2G8NA 3HVIA 3KR9A 3VC2A 1KP9A 5DWQA 2P41A 4NECA 3MCTA 3U81A 3UJ8A 5LQUA 3KQTA 5EHIA 1UIRA 2A14A 5E1OA 3G2QA 4LECA 3BGVA 3SSMA 1R6AA 1N2XA 4E32A 3I5UA 2EG5A 1YFJA 1G8AA 3PFHA 2ZBQA 2ZWAA 3LX6A 5EG5A 3THSA 4YV1A 3FPGA 4DM3A 3B3FA 2Y1XA 3KQQA 1YUBA 3QOXA 1YB2A 5HIJA 3MTIA 1BOOA 2ZZKA 3QOWA 3GU3A 5FTWA 1AV6A 1G8SA 2P3LA 4M36A 3BKWA 3DULA 3LBYA 4EK9A 1JR4A 1SUIA 1QAOA 3ELYA 4DCMA 3HCAA 5LQJA 2B2CA 3FUUA 1VL5A 4X41A 3FTDA 2VZ9A 4DCGA 5DRYA 3KQOA 3BGIA 2C7OA 4WVLA 2P3QA 4PYJA 2YX1A 3AY0A 5CCBA 3FRHA 2UYQA 4PONA 3BWBA 2OB2A 4P7GA 5G02A 4P7FA 1X1DA 2H1RA 3EVGA 2YQZA 3PLAE 2R3SA 3C3PA 3OZSA 2H11A 4ISCA 5EC8A 2AOUA 3G8BA 5FCDA 1NV9A 3G89A 3SR4A 2ZCJA 3HM2A 5ICEA 3HCBA 3O4FA 3CJRA 3S68A 2G1PA 2O06A 2OO3A 2G70A 3KPJA 4M37A 4OBWA 2VDVE 4RTOA 4E31A 2CMHA 1MHTA 1N7IA 1YF3A 4LWOA 1NW8A 3MGGA 1P39A 2Y1WA 1EQAA 4CKCA 4ER5A 1KYZA 3RIEA 4PCAA 1RI5A 5K0JA 3LBFA 3HA7A 2XBMA 3MHTA 2YXDA 3EEOA 2AN5A 1NKVA 2ZSUA 3FTFA 4DA4A 5DT2A 4YUZA 1RJFA 2HMYB 3PFGA 3HTXA 3GXOA 5EEHA 1L1EA 3GCZA 5HIIA 2HNKA 3M33A 4GC9A 3DH0A 4AUKA 2XYVA 4MHTA 3UBTA 3T7TA 5E1DA 4YV2A 2OKCA 4RTKA 2PX2A 1JQ3A 1D2CA 3OU6A 3GJYA 4RTQA 4MTLA 3FUVA 1X1AA 2OB1A 2JG3A 3DLIA 3P71T 4RWZA 2QY6A 2IBSA 2JH8A 3B5IA 2JHCA 1NV8A 4PGHA 2HR1A 1KHHA 1WZNA 3MCZA 2CWWA 5E9WA 1R8YA 2BR3A 5DPMA 1JG1A 4HH4A 3DP7A 2VS1A 5CVJA 1BHJA 1KPIA 3NDJA 4PYIA 3UFBA 3LPMA 4OQDA 1VP3A 3OZRA 1XVAA 3GRZA 1IM8A 4HTFA 2AN4A 4M38A 4OQEA 4CXMA 3M6WA 2PJDA 3UA4A 2YUIA 4C4AA 1SVUA 1HMYA 1RI2A 4KVZA 1Q0SA 5DSXA 2QM3A 5EMJA 4EKIA 4HGZA 1XDSA 5DX0A 1EJ6A 1EIZA 5DTMA 3IYLW 5E2AA 4CKEA 1BC5A 2QRVB 4GOMD 2Q41A 4U7TB 1JTEA 4HSGA 3JWJA 3CJQA 5FHQA 3E05A 3NWEA 3SSOA 3HP7A 1VQ1A 1VE3A 3KR0A 4KDRA 1FP2A 4RVHA 5EQJB 2YTZA 4GUAA 1SQFA 2NYUA 3HVKA 1VLMA 1EJ0A 2AOTB 4YUYA 3HVJA 1D2HA 2NXCA 2YXLA 2YVLA 2B9EA 1NW6A 3G5TA 3NWBA 5ICGA 5HOQA 2XVAA 4IKPA 2BH2A 4XCXA 5E1MA 2AOVA 4PIPA 3THRA 4Y2HA 1P1BA 2QRVA 4FS8A 4RVDA 2O57A 3Q87B 2KW5A 3EVDA 1G55A 3MAGA 5CVDA 2AS0A 2P3OA 4YUXA 3DUWA 2EFJA 3B3JA 3FRIA 3M6UA 1JQEA 3O31A 3R24A 4PGGA 5HEKA 2IDJA 4R6XA 3UA3A 5KVAA 5DM2A 1P91A 2VDUE 4FT2A 4HTFB 5DM4A 2NXNA 3UJDA 1KIAA 5FULA 4CTJA 4MQ4A 4DF3A 3SVZA 1ORHA 3KPVA 4XUEA 3DR5A 1RJEA 3MERA 5E8RA 4PYKA 5EPEA 1JG3A 1H1DA 2I7CA 3AJDA 5E2BA 1N7JA 2FK8A 1XTPA 4KRGA 5K0LA 1FPQA 3EVFA 1RI1A 1Y8CA 3WSTA 4E2YA 2CL5A 3GDHA 5EGSA 1WS6A 2PGXA 2ZW9A 2PV0A 5K0GA 1SG9A 5GOZA 5T64A 2GA9A 1M0EA 5GP1A 1X19A 1X1CA 2B3TA 4X63A 1B42A 3OE5A 3LL7A 4P58A 5DXJA 4AZTA 3LCUA 5BW5A 2XVMA 2BM8A 1KXZA 1DL5A 3MQ2A 2PSSA 4C04A 2NXJA 2V74B 4OBXA 2IH5A 3DOUA 2ZIFA 3BXOA 3ANXA 3A26A 4RTMA 4GOOD 3GRVA 5FQOA 3BT7A 2Z6AA 1PJZA 4PYLA 3HCCA 4GOLD 3KU1A 3PB3A 3Q7EA 2OXTA 1JG4A 1JTFA 3CCFA 4CKBA 5M5BA 3SX0A 2AOWA 4A6DA 2IP2A 3TKYA 1L3BA 4PCLA 4FSXA 3FUXA 1QYRA 4QTUB 4PWYA 1HNNA 2FK7A 2YXEA 3FPHA 5CUQA 2PX8A 1XJ5A 4QVKA 4X61A 5KYGA 3LDGA 3R9XB 3GGDA 3HCFA 4WXHA 4E2XA 4YV0A 5EZQA 4EVIA 2AOUB 4RTSA 1DCTA 3KR2A 4GEKA 4QQKA 1R8XA 3P9IA 3FTCA 2P1DA 3G2OA 3OU2A 1SUSA 3A25A 4R05A 4ER3A 5EMLA 2K4MA 3FPEA 1IXKA 1M6YA 1I4WA 3GRYA 3L8DA 1OR8A 3AXSA 1AQIA 2BR4A 4BLVA 5EIWA 1G60A 2EJTA 3B7PA 4QDKA 5MHTA 2IFTA 3TM4A 3OFJA 3BGDA 4KW7A 2PX4A 5EMMA 4E70A 1JQDA 2PXCA 2IH4A 1JSZA 2NNWB 2ONZA 3LHDA 3BKXA 3EPPA 3NVMB 4P7KA 2OY0A 5BXYA 5KQSA 3DLCA 4RTJA 3KPUA 5K09A 3PX2A 1ZG3A 1NBIA 3MTEA 5E8JA 1PRYA 1ZGAA 3ME5A 2ZVJA 4FSDA 5K0CA 3OPNA 1RJDA 2FYTA 4KIFA 1XXLA 4IV0A 1U2ZA 4E30A 1O9HA 3EEYA 1YZ3A 3V97A 5FHRA 4C05A 4PYMA 2WK1A 1O9GA 2FRXA 3ELUA 4RTLA 3TM5A 2BM9A 3UJ6A 3T7RA 5DRTA 4E2ZA 4F85A 4YMGA 5CVVA 1QZZA 5FQNA 3SSNA 5FA5A 2FHPA 2ESRA 3JWGA 3KR1A 3P9CA 5GM2A 5U4XA 3NTVA 3PVCA 2I62A 5HIKA 2P35A 3T7SA 3TRKA 1WY7A 3FPFA 3PTAA 2AOTA 3I64A 5EHGA 1QAQA 1TW2A 2XYQA 2V7EA 2Z6QA 2NXEA 3P8ZA 5ICCA 2O07A 2UYHA 2B78A 3EMDA 2JHAA 1L3IA 3OU7A 3P2IA 5FUBA 1XDUA 2B25A 1RI3A 3VSEA 3EVBA 4RTRA 1QAMA 3M4XA 4QDJA 3HCEA 2WA1A 5C1IA 3LECA 3TFWA 4PIMA 3GIWA 2ZBRA 5EZSA 2Z6UA 2UYCA 5HZMA 3LDUA 2IBTA 8MHTA 1Q0TA 5BW4A 3DXYA 3ID6C 4M7RA 4IV8A 5LQCA 2PX5A 2N47A 4PNEA 1O54A 1EAMA 4HG2A 1F38A 3ORHA 5GM1A 3SMQA 3HA3A 3FPJA 2H00A 3NW9A 3NJRA 4HGYA 10MHA 2IPXA 3G88A 5EVJA 3F4KA 1M6EX 1F3LA 5B1SA 1UWVA 2IDKA 4RVGA 2XYRA 3JWHA 4OX9Y 3HCDA 2ZLBA 4CTKA 3LGAA 3G2MA 3PS9A 3DTNA 4U7PB 1NT2A 2OBFA 4R8RA 1XDZA 1NW3A 1ZHFA 4L7VA 5HILA 3UWPA 2AOXA 1BKYA 1JG2A 3CVOA 3SXJA 2C7PA 3OCJA 3A4TA 1P1CA 2AZTA 1SQGA 1I9GA 3G5LA 1UFKA 3BWCA 3HVHA 5LQNA 2GPYA 2PT9A 9MHTA 4V0RA 7MHTA 2ZTHA 3IV6A 5EKUA 5CD1A 2DPMA 4F84A 5GIOE 5EMKA 1NW7A 2R6ZA 2ZZNA 3UJAA 5ERGB 1JSXA 3EMBA 2CMGA 1RI4A 3M6VA 1FBNA 2ZZMA 4FT4A 4V0QA 3NDIA 5CIYA 4PYNA 2AN3A 3TQSA 3LCVB 5FWDA 5H02A 5K03A 4GOND 4BP3A 3A7EA 3CKKA 3H2BA 2VP3A 4QPPA 2GS9A 3KKZA 3AWIA 2GH1A 3I53A 3GRUA 1G6Q1 1NE2A 4YUVA 4YMHA 4ER7A 1KYWA 3FYDA 5IKMA 3HA5A 2PVCA 3M6XA 3OFKA 3P9KA 3M70A 2OPBA 2PT6A 5HIMA 2NP6A 3EVAA 1AQJA 4MWZA 4FP9A 2QYOA 1ZKDA 3BUSA 3RODA 2P7HA 5CCXA 2I9KA 2EX4A 3BWYA 3DMHA 2HV9A 3ERCA 3O7WA 3DMGA 5EEGA 4EQZA 1TW3A 3CGGA 2ORED 3E8SA 4QPNA 3FTEA 1I1NA 3KQMA 3RW9A 2GAFA 1INLA 3P97A 5IH3A 3FYCA 3OZTA 4ER6A 3TR6A 3DXXA 3ER8A 4UOEA 4OA5A 5F2KA 3PT9A 1R00A 2JH9A 4RSRA 1FP1D 1YFLA 3I9FA 1EG2A 2GB4A 1T43A 2O05A 3VC1A 4E2WA 2CKDA 3TPZA 5CVUA 3CC8A 5T6BA 3G8AA 3LKDA 5F2NA
chains in the Genus database with same CATH superfamily
1OREA 4BDSA 1MORA 2AQIA 2WWWA 1RFLA 4IGFA 5FOUA 3Q5EA 5IRCD 3HGMA 1VE1A 1JR6A 3KUKA 1H8HA 4KVFA 1VLHA 2P9BA 1DKMA 5HVNA 5JZSA 9ATCA 3EHDA 2CJPA 3ZWQA 1XMIA 2JGEA 1H85A 2BFCB 2AZMA 2GHTA 4I81A 3IALA 1NXWA 1L3CA 4XJVA 4PGMA 1JT9A 5C1DA 4GAEA 3P2YA 3GNSA 4RVNA 1Y42X 1NFRA 3MJVA 5ALZA 4DWJA 1P19A 3MN1A 4KQIA 4EJSB 2PQ2A 4LXUA 1SBQA 2VYVA 3I5YA 4GKKB 1NZDA 1KK2A 3ZJYA 4BMCA 1KS2A 3JXEA 1ONNA 4ZVOA 2LBPA 1DBSA 4H3KB 1WCXA 1WMSA 4HNRA 1XL0A 1KARA 2TECE 3AEUA 3B48A 3DKIA 4HF7A 1NJ1A 3TCXB 2HMSA 2QRGA 3H5RA 4FOLA 1DC5A 4PC1A 5T4BA 3GZTB 5DYIA 4XUCA 2A9KA 3LLMA 5CK4A 4ZARA 2QN9A 3GOHA 3DW3X 3LGXA 2CCKA 4FKBA 7ABPA 4P4SB 5KBYA 3H3XA 3JVEA 2FE4A 1J00A 1IB6A 3BFPA 1JBKA 1A2KC 2FETA 5D2CA 4OQMA 2YV1A 3AERA 3FHJA 4ND1A 1UOEA 2R1TA 2ZPTX 2W9XA 4IPTA 4ZYXA 1HTBA 3QIAA 2YIJA 3I34X 1P0IA 1Z5ZA 4JOBA 1Y8RA 2ERYA 4DLUA 1KYYA 1VGVA 4Z86A 3WG9A 2G28A 1ZD4A 1VYTA 3PU6A 4ALNA 1EXWA 5BMOA 1OZFA 2A88A 4UU8A 1DIHA 1KEWA 2EJBA 4MAAA 4QFDA 1TCCA 2EJUA 2HFJA 2PGLA 3H9UA 3F3YA 4XWGA 1UJ6A 4BP1A 3M2TA 4UUAA 5HKKD 3OOSA 4CR6A 1NNUA 4GGPA 4CLRA 4D8VA 2OHHA 1YB6A 4M7OA 3EC2A 4CM9D 4WH0A 5B2FA 4BBZA 3IPCA 2DHRA 1UMBA 1QE5A 2SICE 1AGNA 2AXQA 2FPKA 4XI9A 2QWXA 4RZSA 3TLMA 1SXJD 2ADMA 1Y81A 2NN3C 3REOA 4RLQA 5C52B 4E7PA 2GXSA 2PSJA 3QGMA 2WJPA 1L4MA 4M9ZA 4CLEA 1ENYA 1PZMA 2NYAA 3RYHB 4DDVA 4HRVA 1O7JA 1T8TA 2QX8A 2V7XA 3FPLA 1J9EA 4RY9A 1R3DA 4QT0A 2OFXA 3C3EA 3C6MA 3SFZA 2YJGA 1VB3A 2QUHA 2PVPA 1O8CA 1U0NA 5TMBA 1U0TA 2P2SA 3VV3A 1L5OA 1RWOA 2E1RA 2J67A 1DZIA 4HWPA 1LQUA 3ZW8A 5KYWA 1P5ZB 1FDVA 4DV2B 1N1MA 1V96A 2QT0A 4C6SA 3DAFA 1BGXT 1K4YA 4YRMA 1P1JA 2C57A 2W6ID 3B89A 3DBHB 4EB6A 3QEBZ 3PHGA 3FCYA 5AK5A 1DJQA 2VKTA 1A9PA 4UVHA 3WQQA 4QDOA 1Q44A 3KBOA 1CUDA 3U6KA 3OIWA 1TIKA 2GD0A 2WTNA 4X1OA 1Y48E 4R2IA 4ZTBA 2B4TO 1NI5A 4R83A 1NVFA 4PFQA 4I2VA 4JQOA 4QEDA 3TD9A 1XSEA 3QI2A 1YS9A 4H35A 3OQNA 4YDSA 1NJSA 3V4PB 3PXUA 4O4JF 4TLEA 2MJLA 5B3AA 3KCQA 4D4IA 3QPUA 2A0XA 2A9JA 4LTDA 4HYYA 4Y2YA 1HLGA 4BYMA 3CLSD 3D43A 2WIAA 2BFBB 3O83A 4YQZA 3RU9A 4BNVA 2JKVA 2PYZA 5FLEX 2EG5A 4B82A 1XOIA 1E9RA 4L2IA 1SEVA 1VYUA 2FPRA 2CL7X 4B31A 1IN4A 3HCWA 3CLVA 2XCIA 2O2DA 3C70A 3FPGA 2B1GA 1EUDB 2WABA 3MMXA 4BP9A 3VZRA 4E09A 1H23A 3HXMA 1J1ZA 1LUAA 3RNLA 2RGRA 2HDNB 1X1SA 2P78A 1SZCA 5C3MA 5AJXA 3ET4A 5IZ4A 4RMIA 5JD4A 2ACEA 3BKWA 3DULA 2J6HA 5JG7A 4G25A 2OLEA 4UUOA 4EARA 3BSSA 1YL7A 4CQJA 2PUJA 2FLVA 4OBBA 5A5GA 1RRVA 2V7UA 4FZ3A 4RE5A 4TX1A 2PRYA 3ONVA 2EZ9A 3OZWA 2YWRA 4PZDA 3SR3A 4O2LA 3GGSA 1GRVA 3TR0A 1HLDA 2I2FA 2N0SA 1ZS9A 4ETIA 3T3EA 2KMLA 2GYUA 2QXTA 3PKZA 4KDEA 4DJDC 3BICA 3SJ7A 3H5AA 2VDOB 2A3NA 2XAAA 3STHA 1X1DA 3BB4A 1IN5A 1NF8A 3I52A 5MN6A 3AESA 2R3SA 2R8OA 3BFVA 3DZDA 3IQDB 3ZTTA 1J22A 4X1KB 3VR5A 1E2NA 4CCYB 4RK5A 4YLYA 5ICEA 5BSRA 3O4FA 1E62A 2QD2A 3IEVA 1USKA 1E3WA 4ZXFA 2Z57A 1LWNA 5L8VA 3KC2A 1JMKC 5FUWA 3I0NA 4OAQA 5CA0F 3INYA 4MCIA 1DC4A 1BW9A 2CDBA 1G2QA 3QMVA 4IFBA 5FO0A 4TRMA 3NM5A 3U1VA 5JEDA 4EI2A 3JY6A 4B3FX 1FPMA 3WL8A 1ZN8A 3QF4A 3TECE 1PUIA 3OFNA 5CDYA 1VCNA 2VAVA 3MHTA 1PGNA 2FZ4A 3WJ2A 4BMXA 2WINI 4G1EB 1FX0B 3REFA 3D7RA 1WETA 1Z88A 3ZD7A 4L02A 4LJLA 1E5TA 3LXMA 4FYXA 5EEHA 1L1EA 3GCZA 3G2IA 3O82A 1QS0B 3KBBA 4FHCA 2DLCX 4IMJB 4ZZ1A 4E03A 3TINA 4HS9A 2O9JA 1ZJ4A 4DG9A 4IW3B 1XD8A 2C4HA 4N7MA 1G41A 4HZUA 4MTLA 4HAZA 3GG2A 3TEJA 1I0ZA 3U7RA 1T6NA 3I6ZA 3V8QA 2I4MA 2QR3A 3QNMA 1M2GA 3GLUA 1MABA 4J0GA 2GO7A 4RJLA 4V38A 1ZCBA 4FDAA 4OHOA 4LEIA 1KXJA 4X24A 1V16A 3NAMA 2OR3A 3GJQA 2HMUA 1LPMA 2FMKA 3AO0B 3TF5A 1V3UA 4UMVA 1ANKA 3T52A 3EG5A 1Q19A 1RPZA 3HPQA 1FFWA 1Q1GA 3QEKA 4WL0A 1MQ8B 4G67A 2Q8PA 3V55A 3L2OB 1PT8A 2R60A 3OZGA 4HLNA 4TUYB 3NG1A 4Y9DA 1PU2A 4II2A 1K4KA 3VR6A 1YTUA 4U7GA 3ZJVA 4LC1A 1G3RA 1OX5A 4BE9A 5G4LA 1I6MA 3IYLW 1ZL0A 3RBZA 4EEKA 3WAGA 2VDQB 5DT9A 3IQXA 2L19A 3GN1A 5H0IA 5T4FA 4F8JA 2P0YA 2J5KA 2JHFA 1MRNA 1VLZA 1JTEA 4W5TA 5L3QA 3WWCA 5KC8A 2FKAA 3GLIA 4KQ2A 2G80A 2R5FA 1O97C 3CEJA 1OAAA 1Z5VA 3VOTA 2D5CA 3DCIA 1WMFA 1VQ1A 3HYSA 3NPMA 3NM6B 4RVHA 3WXMA 3VNAA 1S6YA 3P0FA 4UU1A 4A8JB 3HVJA 5KVCA 1U3VA 3QPCA 3ZE9A 5K8JB 5LLSA 3JQ9A 4JLKA 2GNPA 2PRZA 5DV9A 1L6IA 1ZJZA 1JUDA 3P0HA 2AD5A 2IPLA 3QJYA 4K9PA 3NRBA 4W99A 2XVZA 3CT4A 1NMXA 3AR9A 2ZTUA 2V4ZA 5KNBH 1EX6A 1RYNA 3A3KA 3FRIA 3G5AA 1QFMA 3NOQA 4H7PA 4LFCB 2O3RA 4PNHA 4PQYA 5DM2A 1MV5A 1ONOA 2VDUE 3NONA 3GFQA 3WP1B 2NXNA 5H5JA 2R2GA 2OBXA 4ASUA 2O59A 3E9EA 1A1SA 3CO0S 2ZJ5A 4WY2A 4PO3X 5H80A 2ZR0A 1W73A 1ORHA 2CC2A 4RUKA 3O8QA 3RVJA 1RRGA 4MI6A 5KO2A 5JAHA 1XQ1A 1XEXB 1Y9AA 4WEQA 1QKIA 3DLAA 2VT2A 1OKKD 2PGXA 3AFGA 1P0QA 1QGDA 1X1CA 3CNNA 3K0HA 5K0SA 3ABIA 5EJ2A 3NEYA 4DTCA 4ZQEA 2D2EA 3QYPA 3DBRA 1DCKA 2K5UA 1Z6ZA 4AZTA 2ISCA 2X9QA 2ODTX 3PP8A 2IYLD 1E3DA 1NU8A 3DDHA 1JW9B 1HYBA 2NXJA 3LDHA 2I5PO 3N2GB 4I8IA 2DUJA 3DWGA 2X2PA 2CFCA 3DOUA 3NETA 1PS9A 4BWGA 1WCIB 3NHUA 4FYWA 3MW8A 4HQNA 9LDBA 2A94A 1M2VA 1TKAA 4OHCA 3JRXA 5CLHA 5I9BA 4NENA 2JJ1A 3P0JA 5IBPA 1NQAO 4JDUA 1DTWB 2ASVA 2DT5A 3EIWA 4MDFA 4E5NA 4I1SA 4DVJA 1IZ7A 1TMOA 5LCXA 2J30A 4PS1A 1C29B 3N58A 4X61A 1E94E 1XJ5A 2PLNA 2F4VB 2YV5A 5BQOA 3DD1A 1OT3A 2DTDA 3GGDA 5EHQA 4EM6A 3OG9A 4HN4B 2Q1WA 2R1VA 1O95D 3BMCB 4AS1A 4O4JB 1Z7GA 1J07A 3G2OA 3HR7A 3LPLA 4XTRA 2R9VA 3RHZA 2RK6A 4ARIA 4LXHA 4KXMA 2UUAB 1DO8A 4TTPA 5G3YA 3CRRA 3WXBA 3K31A 4MS3B 3R6WA 4NJMA 5FUVA 1E5XA 4FDMA 4GZ5A 2NVWA 2H51A 3EYWA 2P2ZA 3CB4A 3O93A 1QU2A 1DWUA 3CZPA 3SICE 2JLAA 3QKUA 4EG4A 4H1HA 2GCEA 2X23A 4E2FA 3PJRA 3CF2A 1ECLA 1QK5A 3UHAA 3B70A 4A5SA 1JECA 1R7RA 3Q0IA 1KQPA 1TJ5A 4GVPA 5ECGC 3F2IA 1P5JA 4JP1A 5AHWA 3CYFA 3WB2A 1E1YA 1D2RA 3WYGA 4GI3A 5KYXA 1ADFA 2Q5JA 4H16A 4ZQCB 3H5WA 3QU9A 3SD7A 4CEJB 1XIVA 1QR2A 1JXAA 4D9IA 3S1SA 5FP0A 5KCZA 3BF8A 1VHQA 2WVGA 3DB1A 2NM0A 1F2UA 3MS2A 5JQWA 3PXEA 2HF9A 2Q3BA 4F7WA 2GF9A 2RARA 3VPAA 1J4AA 1EM8B 2FFHA 3KS9A 3M1LA 4HAVA 1EWYA 3AYZB 1UXGA 2QLTA 4XD7D 2RFLA 3KR1A 1E0DA 5KYKA 2JGLA 1RXSA 1KI4A 3X1MA 4B7AA 5CA1A 3G17A 5AP9A 3VSDA 3UTCA 4MI1A 2SKDA 4X44A 2CXXA 4ISBA 2FDRA 2P5YA 3CEAA 3HC7A 3LFUA 1EFDN 3S27A 4QIHA 1T1RA 3ZI0A 3KL2A 1IN1A 2CNLA 1TB4A 3WR5A 3J81A 2HT1A 2EP7A 2X9GA 2V5AA 2C9OA 1D4FA 3ML1A 5CGZA 5DW3A 1COWA 3GOQA 4QDJA 3W05A 4O08A 1F0PA 1V26A 3MUNA 4A2CA 4TXMA 1Q0TA 5BW4A 1T91A 2GBLA 5JSKA 1IEQA 5ELXA 1ZZEA 2L82A 4QO7A 1UK8A 1P6XA 2OK7A 3ORHA 5TS3A 1SOAA 4DWOA 5ILOA 1GTSA 3ZCXA 3QEAZ 3V1TC 1MX5A 4LY0A 1PR3A 4JROA 1N7HA 3HI6A 3ADBA 5KVQA 4CF5A 1W581 4J1NA 3VNVA 2Q29A 3KOWA 4QSMA 2SHKA 1C8LA 4JB2A 3K1TA 2VH1A 4K05A 4MP3A 3OQ1A 2H57A 4TSRA 4QOSA 4I7EA 4B2IA 1XTZA 2I1QA 1S02A 1E79D 2WWYA 2ZYDA 3F0TA 3CVOA 3R3SA 4WESA 2NUAB 1IXZA 2H1CA 1UBJS 3LPCA 4WJZA 3UATA 4LDAA 1J5EB 1N3LA 2FMUA 1YMVA 5JFOA 1T9HA 2YICA 5BURA 3S1AA 4KQ9A 4HKTA 3S2UA 3AV3A 2I33A 2VT7A 2DPMA 5B7PA 1KRHA 1ZRMA 5IDWA 3MMPA 5A0TA 2R79A 4ZO7A 1L7PA 4XIJA 3U13A 3VOBA 5KYYB 5AVSA 3B6MA 5A4IS 1FBNA 4F9FA 2CSXA 1W75A 4H4CA 4IG9A 1QVRA 3MJEA 1NGSA 4X5OA 3TQSA 2R44A 3DGEC 3GAMA 3G8CA 5JAUA 1SC1A 1S2DA 3H2BA 2XZOA 2NTVA 3AWIA 1C7QA 3FFAA 2IIQA 4N18A 3GAAA 3X2FA 4EZEA 1K9VF 5GZ6A 1QIEA 3FR7A 3HY6A 3M6XA 3A8TA 3RUAA 5CCDA 2AUMA 3WIBA 4MV0A 2R8EA 5EE0A 1UKVY 3ZLUA 1VI6A 1T5TA 3IEKA 3BUSA 3M49A 3OH8A 4YRPA 4A0GA 5CCXA 3ZDXB 3VU9A 1PR2A 3N2KA 4U3JA 1ZUNB 1LLCA 2MTBA 4A8HA 3VA7A 3CGGA 2ZB3A 1IBRA 2Z95A 3I2KA 4EUNA 4F06A 5JLJA 4DE5A 5KWJA 5BRNA 2BFEA 3WGTA 5L3SB 4UFNA 2XA2A 4FU0A 4IIYA 1ZVJA 3UICA 1E9CA 4ACAA 5IVPA 2RD2A 1U2GA 2A78A 3T06B 3Q72A 5JSFA 2G1KA 1YASA 3GUCA 4JJ7A 1HDCA 3U6BA 4D6YA 1K5PA 1H5QA 4C3ZA 3O21A 3HHPA 1NRXA 2ATIA 2JAOA 1IN7A 1XNHA 3I9FA 4FUQA 5FL3A 1MW9X 1P0CA 2GB4A 5EJ4A 5I9LA 5H7XA 1L7DA 2I1WA 4ARVA 5TE9A 1QYWA 3CC8A 2PUVA 2WJ3A 3NTUA 2HCJB 3TLGB 4Q9LA 4LF9B 2ILVA 4DYDA 2ZE7A 3HDYA 5KX5B 4XVRA 4KGDA 5EIAA 5JAIA 4AP6A 2YKGA 1GA1A 1OI4A 2IOQA 3OPXA 1HTTA 1XVVA 3HUFA 4TYYA 2C98A 1G19A 1U2RA 3BGSA 3EEFA 3I6YA 1RWXA 3PWTA 3RSCA 1VPWA 3AOEC 2BRUA 3C3AA 1SXJA 4ARSA 3EZ6A 5LZ2A 2O7VA 2H1OA 4RD6A 3EQ6A 4MQEA 4MLCA 3PA8A 2Y71A 1E6KA 1T29A 3DR3A 5ALLA 3IQWA 3JSXA 4Z99A 1DXHA 5JRJA 4DMGA 4TVKA 5HOEA 4ZVKA 1A9XB 2YWDA 2RGNA 5JSHA 4Q6WA 4PAOA 3LWZA 4IJQA 3ETGA 2EVWX 1KJJA 1MIOB 3IJRA 4GRIA 2ZIEA 5BYBA 3GWGA 3PC8C 4R9SA 4C03A 5HSGA 3GJZA 1W88A 1II8B 3SEFA 4G0XA 4BMNA 1YRHA 2JH3A 1GVHA 4XDYA 3TB4A 3KQLA 2RI1A 1P9NA 1I4DD 5CT9A 5DE3A 3R7WB 4IYRA 4C07A 5FLYA 2ZKLA 4XQGA 5K3SA 3B3QA 2Z3ZA 3L8GA 1DUSA 1XCLA 1SM4A 2Z8YM 4N4AA 4PR3A 3Q8XB 5JH7A 3L6UA 3D02A 3A9RA 3LVRE 3EZ2A 3E2PA 2PGJA 3IODA 4MVWA 2I4OA 2Q9AA 4B8WA 1U8EA 3C98A 3HXPA 4CETA 4US1R 4XUDA 5G0UA 3FSJX 3QX8A 4QTTB 4IHKA 2FE1A 2JIPA 2FPIB 4QARA 1Y1PA 3IPRA 1WZIA 4GWLA 4WN9B 3EBLA 4AU1A 4DV3B 5DF1A 2YWGA 3BTVA 4MTCA 4PHCA 4M7PA 4NPAA 1KJZA 2OWEA 1BRMA 3BILA 1T4MA 3QEMB 3EPKA 1OLUA 4DIDA 1P5FA 2J9FB 1SCKA 2EV9A 4QDZA 3A2LA 4H0FA 2XNJA 5CNKA 2QQGA 1WKVA 4BJ3A 1F0YA 3CLRC 2B5WA 4MIOA 2OCAA 1T4CB 4MS4A 2AJDA 3HY3A 3F6SA 3UJ7A 2V6JA 3GYBA 3P32A 1TIBA 4AX4A 4CTMA 2FW8A 3UMJA 1J5XA 2ZQYA 3WYCA 2FB9A 3GUHA 1BEZA 2R8PA 5KNCD 1WF6A 1BDIA 1C3XA 2VTBB 4JA0A 4TS1A 1MO2A 4TT3D 3MJTA 3F8SA 5DSZA 3T3HA 4JJAA 3T12A 4TLLB 2J09A 2HCRA 5AOAA 4JSTA 2Q6TA 4L72A 4UVDA 1E8MA 2O0MA 4OQZA 1P3Y1 3LK7A 2VJLA 3QENA 3B9RA 3KCNA 3UANA 1KMHB 2BJHA 4O4IF 3JQQA 2XKKA 2WZDA 3K0SA 1IY1A 3BE8A 4BEVA 3LKBA 2IE0A 5JVDB 1C3OA 2MSNA 4F1JA 4F9GA 2TMDA 3HACA 4G9EA 4LZWA 4M54A 4EDFA 3LO8A 3S5UA 2E49A 3FNIA 4WLEA 4RDIA 3GP5A 1UPBA 4TMZA 2EBFX 3ITKA 3DZIA 3YASA 3EGWA 4NYMR 5HP4A 1I13A 2XT0A 1DG9A 4FDUA 5A05A 5K01A 2B9VA 3OZBA 4FZVA 2WJWA 2C9CA 2DSTA 2H31A 2BFFB 1UQRA 4HDAA 5E3HA 4UM5A 2CUNA 4AWAA 1THZA 4ZAYA 3ONEA 4DLLA 1DEHA 2J0SA 4HNVA 2ODBA 2ZJZA 3CW9A 1LBIA 3HBMA 2I34A 1WX1A 3HV0A 2ZR7A 4H0NA 4ID3A 3VR2A 4HUTA 2HJWA 4Q34A 3DG9A 5EE9A 6PFKA 5J1SB 3FWYA 3WO0A 2QRPA 3CX4A 1H2WA 2ZXUA 1PCXA 2XE8A 1WU8A 4BMVA 2O8BA 5A3JA 2B2NA 2DBRA 1P9RA 4D9HA 2EU8A 3AL0C 5I7EA 1GTL1 1P4HA 4CMAA 3WL4A 1T9GS 1XDDA 2D7JA 2IPAB 1TUBA 4MR9B 3SSAA 3GLGA 3HV2A 1TLTA 3FYUC 5DYWA 5KYUA 1X14A 2CCGA 1WCIA 2XKBA 4OB7A 1BFDA 1CUCA 1QO0A 3EE6A 1L7NA 3K2IA 2QV0A 4M36A 4P2GA 4YJFB 3RFCA 1IZYA 2NZ8A 3CUVA 3EF0A 1BHO1 1PG2A 3UG7A 3CWCA 3ELYA 4BKPA 4DCMA 1B8NA 5EMHA 4PHGA 1EVEA 1VL5A 3EUAA 2IOYA 1PQWA 1KFJB 2QZSA 3GLRA 3FR8A 3SOZA 4EG6A 4F8EA 2QD4A 1PKEA 2WUWE 3M83A 4F2WA 3NHPA 4ENTA 4JJIA 4MV1A 4P7GA 1SELA 4LRYA 4RO0A 3OO0A 3CLUD 1GFSA 1JYEA 3N05A 5D8DA 1W4AA 2ATEA 4BN4A 5HX7A 2NU7B 2QN8A 1YR1A 2JF0A 5CT5A 2AMLA 3AP3A 1ENPA 3O8DA 1X3SA 1LNQA 2FEMA 4L57A 3U4IA 3VYRB 3ODGA 4DR7B 3FWHA 1NKTA 5IN4A 5FEUA 4ZT4A 2BGTA 1QTNA 1YBHA 5IDXA 1YRAA 3Q9SA 4WCFB 4K86A 1XYVA 2AZDA 1E1LA 1J99A 1WM1A 4TXNA 1DQNA 1RKUA 2V5UA 4P54A 5ESDA 3RIEA 3WRXC 3HA7A 4N6GA 5EGNA 2Y1DA 2GPJA 1EK5A 1OUMA 3F8WA 1Z2OX 5DT2A 4TV8B 1P4GA 2IYPA 3KV1A 3LHSA 3ZD8A 1WNTA 2WWTA 1JA0A 4EFDA 3MRXA 2J4DA 3ISVA 1A7KA 1X13A 4IH1A 3K4PA 4Y1RA 2BSXA 3E9QA 4YV2A 5DK4A 4OGFA 4MEBA 4WNCA 2OHIA 4AKSA 3L84A 4W7IA 4BVLA 4R31A 1PGQA 4IH9A 4CVNA 5CR9A 3ZHYA 1I30A 3PFFA 4JLUA 4I3GA 4F3CA 4YXWD 2JG3A 1W4LA 3PDWA 3DE6X 3W7AA 2Y6VA 4JYBA 1F7VA 1NVWQ 4UQPA 4EYEA 1BX1A 1OJ7A 1OPXA 3IBCA 1FNBA 2D1SA 1OYWA 4OQQA 2ZRGA 4WMLA 5FBQB 1YE8A 1M34E 2P2GA 1V47A 2XVXA 1GHTA 1ISHA 3CY6A 2PEYA 4J1QA 1BHJA 2GK6A 3RTCA 4AJ1A 3LPMA 3OZRA 1K8YB 4YC7A 2Q9CA 3W4JA 1IM8A 3L5KA 4M38A 4O5OA 2HPZA 4OXQA 4HDNA 4M9UA 2HQSA 2JAUA 1PNQA 1P73A 3AY7A 1BAPA 3EH2A 4CZ2A 5KYNA 2CBZA 2IXTA 4OHBA 5IH7A 3LCJA 3MPUA 1WL8A 2HY7A 4PFSA 4UEJA 3IOCA 2EX1A 3VKWA 5JAZA 1U6IA 2H52A 3WLPA 1X15A 4JC5A 4JLVA 1KAOA 4JASB 3NWEA 3GLFE 1RJ9A 1YRQA 2PD4A 1ETHA 1TX4B 2F62A 2J48A 4JDPA 3ZU5A 2WY2D 4ZOLB 2Y1CA 1UMKA 2YXLA 2B9EA 5LDGA 1OT5A 3SX2A 2V7GA 2BUCA 1JS1X 2DUNA 4JKOA 3GLHE 1JKMA 4NZMA 4YAJA 1H4VB 2HK7A 3HU3A 1NVVR 5HRCA 1AKQA 4MRVA 1OSNA 1TAGA 4JJGA 1OXSC 3H87A 2VVTA 4PGGA 4WASA 5ALPA 4UE6A 1F20A 3MINA 3G5MA 1ND5A 2D7DA 1OPRA 1XEAA 4MV9A 4P5PA 3EVTA 3K09C 5FTLA 3EMKA 2DQYA 2FMTA 5GQSA 1I1QB 3RFXA 3AEXA 1ZX1A 3THXB 1I2CA 3ND7A 2W90A 2DPYA 3MMNA 2B3DA 2I7CA 3N6RA 5E2BA 4RULA 3EOZA 4KRGA 1HFWA 2EC5A 3G2KA 3DFMA 2FFRA 2LCFA 4JHLA 5IAKA 1DNPA 1TK9A 2YJ3A 3F46A 5ENDA 3W8NA 4XSHA 1M67A 2ZW9A 3LRTA 7AT1A 1M0EA 1ZVMA 2Y93A 1Y34E 4AMZA 4DUGD 2QIPA 1Z6GA 3ELBA 1V7CA 4W5WA 4QGGA 5FH9A 2H9YA 2Y76A 4O2BA 2PHZA 2G5PA 3HBAA 3WWPA 4BZXA 4HWRA 4Z0HO 3U44A 2NPOA 3KHTA 3S2ZA 2IZ1A 2ASEA 2MYUA 2BN4A 4EHBA 2XIJA 3BE5A 1UEJA 4EG1A 1KFBB 1LK5A 3K15A 4FQ8A 5HUJA 4KX3A 4HZIA 1LF0A 1CNFA 2ZUVA 5F5LA 2FV8A 1BQEA 1SOUA 3AR4A 1JP7A 2FG5A 2WV9A 4B32A 2GSDA 2VWGA 3OTOB 5JC8A 3D6FA 1PYOA 4OPMA 1U3TA 2LV8A 2UVPB 1NUTA 3H13A 2PS1A 4DGQA 1M33A 3OZEA 2XNHA 2R4TA 1E6CA 4EITA 5K2MA 4B79A 3SYRA 1VZ2A 4L8WB 1NW9B 2NZXA 1T2EA 3FUXA 3Q8WA 2EKQA 3MYYA 4QFBA 1TYCA 2GUGA 2BCJQ 3V42A 3FFTA 1H3EA 3SIXA 4YV0A 1RABA 4XR9A 1LV8A 1DEAA 2AFIA 1Z3IX 2EP5A 2PGOA 4J3FA 4RVSA 4TKMA 4Z2AA 2XD9A 2BWJA 3GCDA 2XUIA 4OGLA 4QJ5A 4QPCA 5EPUA 3K6SA 2QLNA 3QLVC 4JLNA 2UXDB 1XZDA 3DXFA 3NYWA 2W2VA 2PSDA 4KK4A 4PLVA 2F8MA 1A9RA 3GVCA 4MRNA 3UGKA 4M60A 1ZDMA 3LOUA 4AY5A 2GK4A 2P1RA 4URHA 3Q7SA 3CONA 3HB1A 5CLLA 1OYVA 3DDNA 1AS0A 3V46A 4HGQA 2IH4A 2V8OA 4AYWA 3NVMB 1GGJA 1ODCA 1E58A 2YYYA 3EXAA 3IKLA 4A5OA 2B35A 2R11A 5M2QA 2VRWA 4LYFA 1N75A 1ZG3A 2ZP1A 3AJEA 1ZGAA 2GKSA 3D5QA 4ROTA 5ELMA 2HK8A 2B69A 2VCYA 3M6FA 5JATA 3OM8A 1NIJA 3CRW1 4F4JA 4B1FA 2OC9A 2CZCA 1CIJA 2IYAA 4YLGA 1E96A 1O57A 2P9TA 3BPSA 3NIBA 2DR3A 4G37A 2FGKA 5CJ2A 3G49A 3VU0A 5JPIA 4ON9A 1DFIA 4FFPA 3BORA 1DRJA 4HTAA 4TLCA 1G1AA 1CRWG 3PPVA 1UPUA 2PZFA 1B16A 1EHCA 1M0SA 4UUQA 4ASUD 4BNFA 2BT4A 2FHPA 5LNK1 2DXIA 4CF6A 1PJBA 3UOWA 1M8KA 1DAMA 2G5GX 3SYMA 1YDWA 3TRKA 3MCAA 3C5VA 2YV2A 3DZFA 2I78A 4EELA 3RVRA 1XVLA 3LQ2A 1K86A 3M6MD 3U1BA 3LVFO 2FA9A 4Z1MD 2UUBB 3HCRA 1O6FA 2FEWB 3H17A 4MW4A 2AUNA 5FA6A 5LIRA 2PCJA 1YJCA 1LV7A 5LB2A 1K66A 1KTVA 2RHGB 3O1LA 1PW7A 4NOMA 4PTLA 3HCEA 5I7RA 4W7HA 3JAKB 3I9OA 4V2IA 1NI4B 3JYNA 4XIYA 2OFFA 3B2QA 3I8XA 1NBAA 2I4IA 3MYRA 3C3WA 1MAVA 4PNEA 1ZM7A 3NNDA 3W5VA 3SMQA 1LX7A 4MA4A 4PQRA 2PKQO 1NNI1 1PJSA 2X7XA 2I4RA 10MHA 5IW8A 1T13A 4IFEA 5HR5A 2D5AA 5JQGA 1I3OA 4FFLA 4LY9A 2GBGA 4YWHA 3NX4A 5B3KA 2IDKA 1C0PA 1CUIA 1VZ3A 1YB5A 2CKMA 2BGLA 4MR7A 3VNQA 3GLGE 3A6JA 4UBNA 3LNCA 4GX5A 3PFBA 4MDYA 5AFSA 4MW9A 4CEIB 1J2EA 3A1VA 5H3CA 2P2YA 4MWDA 1K27A 1Z6YA 3L3BA 5C53B 2R8ZA 1L7RA 2VA9A 2OAP1 1UBMS 3L06A 3ORRA 3U2QA 5DGTA 5LQNA 2QTFA 2GPYA 4C2TA 1H1LA 4D3SA 1PHRA 1ATZA 5EJIA 4F84A 4GS5A 4ZJZA 1ML4A 1V7ZA 3UJAA 2ZZNA 3O90A 1NDUA 3KETA 5BNFA 3WB0A 3UXHA 1RKQA 5UKDA 4OCZA 3EN0A 4A1OA 3FJOA 1AZWA 1G66A 2AG8A 2FP3A 4WTOA 1OC4A 1JPVA 1SMKA 1HG0A 3OSUA 3RC2A 5AW1A 4KXFB 4X6XA 1LRLA 4NAVA 1A77A 1ZNQO 1W76A 1LY1A 1M6VB 4L5BA 4ZKDA 3HA5A 3N0XA 4RSGA 2IPMA 1CTQA 3P0RA 4CMJA 1A50B 1DU4A 4PE5B 5CGQB 4G36A 4QM6A 4DC1A 2ZBDA 3B5JA 3MWGA 3QVLA 4ZVSA 3FOWA 2EX4A 1GAQA 3B1WA 3IXMA 4MMYB 1ECPA 4J0JA 2FU5C 3UMBA 1YBVA 5HQ3A 4K1LA 2BKAA 4Q3NA 1MB4A 5IXYA 1IXYA 1FUEA 1YZQA 3TX6A 3D4PA 1LPNA 3FYCA 4PRKA 1S96A 3L6CA 1PR5A 2VZLA 4V0SA 3SCZA 2DQSA 1P17A 2XDQB 2WIDA 1BS9A 4OA5A 4BJ6A 1XTBA 1FTQA 1JHVA 3BX1A 4KUGA 3L79A 4NDZA 1A8IA 3ST7A 3WIVA 2NTEA 1SBIA 3GT0A 1LPSA 1YAJA 3JR3A 3JATA 4BNDA 1JFLA 3NU1A 3QKWA 1TYDE 3WKAA 1S1MA 4JXJA 4YJGB 3IQGX 4AK9A 5AKXA 1K7SN 4GBED 3HCOA 4KWCA 4AZVA 1RQPA 3IB6A 4JUAA 2JEOA 2WG2A 1ADBA 2OOSA 3I28A 2ZVPX 3LOPA 2PA0A 5GZ1A 1HR0B 2GWHA 2F3TA 2JA2A 1W2HA 16PKA 2C7VA 3JAWB 2DJ5A 1YTLA 4KAJA 3WSWA 4DMKA 1U0BB 2CBXA 2NPFA 4K6OA 5F9FA 2JCBA 3OJFA 5AKEA 1WJGA 2QN3A 3P2KA 1KNXA 3H4TA 4JUIA 4AQYB 1RE1A 4CMEA 4EKEA 3NVKI 1Q0QA 1MJHA 3HDVA 3H2KA 3EGEA 4XJTA 1H94A 3V4VB 5B4UA 5I8ZA 4C0WA 3DVAB 2FPPA 3Q3IA 4AF7A 3OY7A 3PUXA 5KNCH 5AVVA 4NCXA 5EJEA 1CFZA 1N5DA 4MX8A 5C37A 1PL6A 1AGXA 4Y2SA 1B6RA 4BMZA 2FRDA 3ZQKA 3CBGA 3H83A 1RCFA 3E5NA 3EIFA 3KZNA 2VYND 3DBVO 2VT3A 2OUKA 3X0DA 1B00A 1U2EA 1ZP6A 3DYVA 2DM6A 1N7GA 4R69A 3CUEF 2W7TA 5DMXA 5L95A 4E21A 3QUSA 4LY6A 4TSFA 4YP9A 3E4DA 1FDWA 4PQFA 1GQOA 1WBJB 4K6MA 2VDJA 4MPRA 3H5TA 5CITA 2HSZA 2A0YA 3FJYA 4EA6A 3JD0A 5JXWA 3QITA 2NO9A 4GKBA 3TNFA 1U65A 3LIPA 5CYFA 1H05A 3TTUA 1W19A 2NZJA 1JAYA 3MJ4A 4MA0A 3CVVA 3RS9A 3E7DA 1UUFA 2C2OA 2ZYIA 1P61B 4P86A 1A9OA 1H22A 3L02A 3RIMA 1OTXA 3E58A 2A1UA 2PSEA 5ALEA 4LBWA 2FR1A 1QANA 1LC3A 4RAOA 4RS3A 5JZ9A 3DAHA 3RD5A 1EP2B 3WL5A 2XXBA 1QQ6A 1ZEJA 3NLLA 2AI3A 1KZ9A 1E7YA 3LHFA 3LLCA 4FNMA 4JC0A 4ZI2A 3W7BA 1E2IA 1KF0A 2ZSDA 3ER9A 3ZD9A 4OIFA 1LRJA 1E61A 5FWAA 3OX2A 1R9GA 1GJRA 4FBGA 4RM2A 1JXOA 3KHKA 4BU1A 4E08A 2PAFA 3WLAA 3EULA 4G8CA 2AV6A 5A9SB 1NMZA 3E7PA 4IWNA 3OBBA 4IF6A 4PC7A 5K0EA 3RSHA 3KZMA 3W8RA 3RIGA 2VK8A 4EGJA 2OG2A 4FR0A 1C2TA 2ONYA 3FTQA 2H2IA 4DNXA 4BGVA 2IZ0A 3H1TA 1SD2A 1RT9A 4NZPA 4KFUA 1T35A 5E6SB 5C8ZA 4FFDA 2J1LA 3S2YA 1XALA 3C3YA 1GWNA 1KY2A 2I6FA 2OBMA 4P8RA 5EKTA 5LQDA 2AXPA 3QKTA 1EFKA 5LMCA 1U2TA 1E3TA 2PSHA 2Q5IA 3R6TA 4ESHA 3SWWA 1BN7A 3QXXA 3K20A 3SLKA 1XEWY 3U48A 5HK8A 2C03A 4Q3LA 1FXSA 4Y0NA 4MNTA 4KOEC 4BQPA 3R3VA 3H42B 2C7RA 5KOJB 4DTIA 3VH3A 4KR3A 1QBGA 1NXPA 2PT7A 1G7RA 4OMDA 3QEOA 4D8WA 3PZBA 1AF7A 3OCZA 3KYDA 4YY3B 1SCBA 3RV3A 5THXA 2VF8A 2V6IA 4B2PA 3CVUA 4DV0B 3EW7A 3ED5A 1TEXA 2HQBA 3TFOA 1J09A 2SCUB 1AHPA 4DV5B 3FF4A 3TQCA 3FN4A 4RPGA 1SC9A 1AGYA 3P9YA 4HATA 4JXZA 3HDTA 2P41A 3MCTA 3TNJA 4CN8A 2R47A 2B21A 4P31A 4TZ6A 4OKIA 1ZCFA 1N2XA 3D81A 4MRRA 3V2GA 1PVOA 2ID8A 3IMFA 2VHXA 3KSMA 2RHDA 3HKBA 5EP1A 3MWJA 4D3DA 3ILSA 3GRFA 3WGHA 1DWOA 5FI1B 5BR8B 3DE1X 2HO5A 4J07A 1UZAA 4CV2A 2GBFA 4H6PA 4CF7A 2LIPA 3L93A 3H4MA 4PO9A 3CPJB 3RTAA 2VKQA 2XCTB 2IBMA 2FP4B 4B09A 3FGPA 3RT9A 4V1CB 3ACCA 1X7ZA 4NE7A 1A98A 4U8HA 4XKJA 3W6PA 3MAAC 3JS5A 2FEOA 3BGIA 3ANTA 2DHEA 4YHHB 2X2EA 3V6LA 4XEUA 3DE4X 5AH0A 1DOHA 2RK4A 3DYBA 4LOIA 4NYIQ 1CUJA 2QJRA 1M6HA 2HBRA 2LW7A 2C77A 2H1RA 4V2UA 1SBNE 2I3BA 3C3PA 3ZHCA 1UPAA 2AOUA 3D8TA 2VFAA 3I5XA 1T8UA 1TRHA 1T3HA 1U1FA 3IILA 4LA4A 1CQZA 3BMNB 4GGMX 2JLWA 1J0EA 1FMLA 4AO6A 1YS2X 1KOLA 4L7QA 3SR0A 1ZRSA 4M1WA 4PPQA 1EQAA 1OWNA 4WFIA 2NX2A 1YGPA 3ENWA 4ABTA 5HCIA 1IM5A 2GEBA 2IYNA 4I8XA 3O73A 4S24A 5THQA 4MPDA 1M1YA 1U31A 4COKA 1DFHA 4PBRA 4RS4A 3U16A 2GEFA 4B0OA 1EUZA 2QRZA 3HTXA 1Z6TA 2ALJA 1WQ1R 1CY0A 1CD5A 1Z07A 4FNGA 1FDUA 2EFEB 1EDEA 3LIIA 4QRHA 2H1IA 3DKVA 3H19A 1QIJA 1H1LB 4L5AA 2ONJA 3PG5A 1BDHA 2V0CA 4P3NA 2ZIZA 1GYQA 4BMSA 5IULC 3P71T 4HBZA 2XCQA 2EFCB 1DJOA 2AFVA 3KAQA 2JH8A 3GJTA 4GGOA 4JAVC 1C81A 1V3TA 4YAOA 4PGHA 3S29A 2J5QA 1AZTA 4PZAA 5DW0A 4CEIA 1KHHA 4F3YA 5HJ5A 4L6IA 3L7IA 3E0QA 1T3LA 2GPBA 2D0PB 5JD5A 2Y0PA 3THOA 3DO5A 1R2QA 1H5NA 4R1NA 4W82A 1XD2A 3UFBA 5B12A 2ZRFA 4AJLA 4F4HA 1C0EA 2AG1A 1FFAA 3DPUA 5AKKA 1WEHA 1WUHS 4H1WA 3UJPA 4Q5IA 1XZPA 4WUVA 1U0FA 2EJVA 3R9WA 1URPA 2P11A 2ZUFA 5BMVB 3EDCA 2GJ4A 1FX1A 1VC2A 1W59A 4B5LA 1Z22A 4HVAA 2DFNA 3K9NA 4I8DA 3FNHA 1T0IA 4CKEA 4X45A 3KQKA 4XRGA 1RXVA 1J56A 1JIIA 1NMEA 3AM4A 4U7TB 2COEA 3CUWA 3CNBA 1J90A 4LJSA 2Z58A 4WK4B 3DV9A 1UWKA 1PEKE 4MP6A 4RMJA 3L1IA 2QGZA 2F3PA 3CJQA 2RGWA 3Q9LA 3DDUA 4HDKA 2GPSA 1JKJA 2C3UA 3UAXA 2IOHA 1WDMA 3K05A 2FFQA 1EJ0A 4A27A 3ZI4A 3QFHA 1TM2A 3AI3A 3F7TA 1MKYA 3IAM1 2J3QA 4MUGA 4MQFA 4RZHA 5DEIA 3RTEA 2EAUA 3H3FA 1OB2A 4JI8B 1VL1A 1YO6A 2YS6A 5B4TA 4FEYA 2HPAA 4TV8A 3L0OA 1GT91 4KYIB 3THRA 2RG1A 2WMYA 4FS8A 4RVDA 4BFTA 3A6DA 3DBIA 1J9GA 3CN7A 4ANFA 4YRBA 3ZCTA 3DHYA 2AS0A 2XMQA 4LPKA 5BSWA 1WCWA 4YUXA 1Q6ZA 1VIVA 2EFJA 3M6UA 4RZUA 1JQAA 2SECE 3AIMA 3FX2A 3UA3A 4D1YA 3H2SA 4LJ7A 1IZ0A 4OHXA 4EPTA 5BQXA 1CHNA 1FU8A 2QRKA 1VRCA 3TK1A 1R10A 5HE8A 2HC9A 2QJFA 1C1XA 3A3PA 4G5YA 4PZZA 5GONB 4CTJA 5LXTB 4Y6SA 1Q74A 4DF3A 5L4LA 1ZHOA 1EE1A 2NSLA 3QOYA 2XEDA 5FOWA 2P2LA 3ZCSA 3NYRA 4B4WA 1H69A 5JMOA 2QHXA 3VJMA 1YDFA 1XTPA 4JT4A 1FC0A 3FGZA 4KSBA 3QWIA 4R3UC 3RWOA 3HEAA 3K0EA 2GR9A 2KS6A 3ZR4B 1IG0A 1QF9A 1SU7A 1UDCA 3DDZX 1J33A 1VE5A 1GNSA 5F1OA 4CFZA 3WMGA 3GVHA 4HNQA 1OIWA 3DKPA 1JQ5A 4XGKA 1ZWKA 1M8PA 3HKCA 2GJ9A 1F0KA 2DFTA 4ZT3A 2AI2A 3L0SA 3ZOZA 1TZJA 1AN0A 1JDTA 3IPLA 2OHXA 2IY7A 1O5IA 1W6UA 4H7EA 3OLVA 4MYHA 4UFPA 3OQMA 1MIHA 3KDPA 2BM8A 3HBLA 3N8NA 3F2VA 4JITA 4QNMA 4RIIA 3K8OE 1A8PA 4TS9A 1ZMTA 3V2UA 4FK8A 4PWZA 4RQUA 4HNUA 2UZ0A 4RQBA 3OQHA 3I6BA 1TLFA 2WM2A 3NKVA 4ID9A 4P98A 5D87A 2I8CA 1F6WA 3UMFA 3GLGB 3MTQA 3UY4A 4UXHA 3GFOA 4IDOA 4UUPA 4CKBA 4AY2A 5JS1A 4NK5A 4C2BA 2HDWA 2J8ZA 4Y3UA 5DGIA 3BH0A 1G0OA 2VF7A 3NHFA 821PA 1U0RA 2EATA 4QECA 4G41A 2IHVA 4PWYA 2RIPA 1OGIA 4QGFA 1GV0A 2GJSA 2NG1A 3FVRA 4IQ4A 2HA5A 3LDGA 5LC1A 4C30A 1N33B 1BCSA 4DMMA 1P4AA 2X58A 3G1TA 1G5QA 5EZQA 4EUHA 3NBKA 4EVIA 1CZLA 4RTSA 2WHPB 3D1JA 3IP3A 3INTA 3MQFA 5BT9A 1LTHR 4CTNA 2NYRA 1JQBA 4BQNA 2G9NA 3QLUC 3PR3A 1I4WA 4HB4A 3L8DA 1EA7A 1VDMA 1KQGA 5TARA 2X14A 2BFDB 2DTEA 3IGFA 3B7PA 2X4GA 4ZO8A 4FYPA 3TS1A 4ZRMA 3VYSB 3UV7A 3UMGA 1YCGA 1YC2A 2ETXA 3R6DA 2PBLA 3TXYA 4ZQGA 1J6UA 1Y7TA 2XECA 2OZEA 3PI6A 2IYOA 2QL9A 4FGWA 5BXYA 3DLCA 3AILA 3HU5A 1EFVA 3O7MA 3O2SB 4FJ2A 5EWLA 5KWEA 5I4BA 4QVIA 1Z16A 2NU6A 3L41A 2AW5A 2V6MA 1ZY2A 4IXDA 2JDID 4O4HB 5JFGA 1NPYA 1PGOA 2XYHA 5CDHA 1G291 1P2BA 1H4TA 2XRZA 4B6SA 2C2BA 1FF9A 2VP4A 3Q5DA 5A4JA 3PEEA 5DFAA 2QTVB 4LRUA 4AJ9A 3OOHA 1OROA 2X4LA 2CLEB 2XUHA 3H18A 1UK9A 1GAEO 4PYMA 1M8GA 2WK1A 1XKQA 4F5WA 3UOAB 3V2IA 4O2AA 5TVKA 4DCUA 4YMGA 5KMGB 2OZPA 4JX8A 1AXRA 3HHEA 2ATVA 2GCIA 2QGNA 2WUFA 1X7DA 5EHXA 4RF3A 2Q6OA 2ZRJA 3FFBA 3DUFA 4HDRB 3KLPX 5JTUA 4ZAGA 4D9MA 4C4PA 2BFOA 1TCAA 1D1SA 1NE7A 3EARA 3NHKA 1U94A 4BNXA 4TXJA 1QAQA 4C43A 1Q7TA 3D54D 3PPXA 2HRDA 3ZY6A 5HNKA 4R7GA 3JQ8B 2GPAA 2CLSA 4MV7A 3IB3A 5B6PA 1TQ6A 2B25A 4DC0A 2YS7A 1NSTA 4OLBA 1JL3A 3IPXA 4CMGA 1E4VA 5F73A 4E15A 1VHDA 4M8IA 3H7IA 4XWYA 5LKRA 2XD4A 1D6SA 2V4MA 4QUIA 1XCOA 5AW5A 1NOKA 2BEWA 2WFLA 2NOAA 1CRZA 1YA6A 4F72A 4RIEA 3MIIA 4BFLA 1W0KD 1F38A 1YU9A 2QRMA 1HZJA 1A5ZA 1EH5A 2A5YB 5I9TA 2Q5LA 3G88A 4IS3A 3UMVA 3WK9A 2ACVA 1CRLA 521PA 4F45A 4PZYA 5BQ3A 3R5SA 1BG6A 2GZ1A 2FNAA 4TV8F 1LDEA 2B2XA 4RPKA 1EFPA 2GFQA 3U7EB 5A3QA 4OX9Y 4OXYA 5SZJA 4IIBA 2F59A 3SVTA 3EK2A 2HDOA 3LH5A 4U00A 4WKGA 4BNKA 2A7XA 2R25B 3OA2A 3PS9A 1QV6A 3QVGB 4M9RA 1JE0A 4J7UA 1BKYA 2WLSA 5GADl 1GGKA 2QUIA 3D3EA 1UOQA 2E4VA 1BXRB 4B47A 4D56A 3ZPXA 1UPTA 1YK1A 1YMQA 2NACA 2FEKA 1MAHA 2JCXA 3JV7A 1LNSA 4PLGA 4GMDA 2AZ4A 2OG1A 1IJBA 2NTYC 5KHLB 3CRNA 1IIRA 2ZTHA 4TYQA 1S7GA 1XZMA 3AL2A 4FOOA 4QXAA 3WNVA 1P1HA 3Q9UA 2XY4A 5ER6A 1JI3A 3EXEA 2ATCA 1P7PA 1KL7A 1Y6ZA 1KGDA 4MCAA 4GOND 3M9WA 5K03A 4E0BA 3KKZA 4RZ2A 2HCFA 1X8XA 2F9LA 1XTKA 2AK2A 2Z30A 3MXOA 5AVYA 1F48A 1SC6A 3SI7A 1NQXA 4TMXA 5C2JB 3WBFA 4QZVA 1J0CA 3M8KA 5KQGA 2MHCA 2OPBA 1ZLYA 1P62B 1RLOA 2CF5A 2ZROA 4JL6A 4F91B 2DMRA 4XPIB 4AKGA 4HV4A 3WK4A 2MR5A 5KVSA 5GPBA 1P4SA 1SXJC 1YQXA 3KT0A 4U2GA 3WHLA 2I9KA 2QJTA 1D1PA 4IKEA 3ZQ6A 4PX2A 4B80A 2ORED 1XDWA 1P2DA 4UHKA 3USES 4BVGA 1YR6A 3IUNA 3RW9A 5KOIA 1AMUA 3TJMA 4H59A 1KTIA 4HB0A 3ZD6A 3MD9A 3BTSA 3ZH9B 4ZV9A 1T2DA 3AL3A 4EMTA 5JZBA 1UANA 4JSYA 3DMNA 5LA6A 3WDSA 1M74A 4BNTA 4PIVA 1V9SA 3PF9A 2I54A 4UE2A 4LKRA 1ORDA 2IVFA 4G5OA 2C4NA 1YVEI 1T43A 1NUUA 3UHPA 2AJTA 3A28A 4G6ZA 1PVVA 1YD7A 4Y6GB 4FCTA 3V8VA 4AMYA 4PQEA 1LRKA 3A9VA 3IRUA 1UBOS 4I1VA 5JSYA 3UK7A 1IEWA 1RBMA 2PXXA 4G56A 4C4OA 3RU3A 4DDWA 1EESA 4XCVA 5I7OA 2B8JA 2WAXA 4DGSA 1NWCA 1WSDA 3E1SA 2FSUA 2KX7A 2HK6A 1XZEA 5KQMA 5CX1B 4EHLA 4HXGA 3NIFB 5CNMA 5TGZA 1T5IA 4CWAA 2VRNA 1CRQA 3O9ZA 3OCCA 5F3WB 5B58T 4KSYA 3DONA 3AM3A 4FWBA 5JD3A 4IOLA 3S1AB 2A9RA 2GFIA 3N53A 3TTWA 1V6SA 3OC0A 2Z3VA 5KKNB 2C9MA 5JPDA 4AT1A 4EO7A 3BXPA 1G20E 1YHYA 2MMGA 4L3OA 4QGAA 5I5GA 4V0KA 1A9YA 3NDBB 4ZAVA 1KSGA 3TBHA 1L1QA 1W34A 3UW1A 2XQIA 1SCIA 2OGZA 4PXYA 3WRXA 5LQRA 3RHFA 5DTQA 2XNDA 3MEQA 2PBFA 1E1KA 3OCVA 1YE3A 3ESZA 3PV0A 2Y1KA 4B7UA 4KR7A 1QTIA 2NO1A 5E9JA 1UJNA 4RVUA 2X3FA 4AF8A 1PIWA 3U4QA 3PQ6A 1ZD2P 2AG6A 5DBHX 1NM5C 1X74A 4B83A 3VDRA 3NTXA 3GPBA 3T7KA 1YZHA 4N40A 4LMRA 2BVNA 5HKKA 1U11A 3NV9A 2FMHA 4GQBA 3H2YA 1ORWA 4QTZA 2HJSA 2IIPA 3HKBB 2CB0A 2XMRA 4L27A 1Z5OA 4O4HF 1G20A 2OCXA 3JCZA 1XNQB 3SFTA 1PJ8A 2AW3A 2PIDA 3BD8A 1K6XA 1YDGA 3RVLA 1C7EA 2X86A 4NBWA 3VX3A 4NBKA 4RA9B 2J31A 2ONKA 2R84A 3KE9A 4BUJA 1QRTA 1DDGA 3EXIA 1OC2A 4XD7A 2XQFA 2Z8YA 3HPRA 4KZKA 4LSWA 4H4EA 5KZMB 5GIPE 3LCMA 5JJKA 4NBLA 1MA3A 2GN2A 3DEYX 4JUCA 1RKVA 4NJEA 3UAZA 3WWZA 3C4QA 3OTHA 3A14A 4M9CA 5FF9A 3T9EA 5D3QA 3PTLA 3FSGA 1OFVA 3QA3E 1NP6A 4N82A 4REMA 5J2UB 5HHTA 1V35A 1XXHB 4LYHA 2ZFUA 4WKBA 3JWPA 1M5RA 3BCHA 3MHPA 2QORA 1WG8A 3EH1A 4WJLA 4D43A 1ZOPA 4QUEA 4DV7B 3ETDA 1LFDB 4FFOA 1GNLA 4QGHA 1DBRA 3FRJA 3HP4A 1R0BA 1LI5A 2FPIA 2JIOA 2Q1UA 2VHVA 1QYXA 4HDSB 4JBNA 2C2WA 3RADC 2FN8A 1FRFS 3L7CA 3C0KA 2KE5A 2QLJA 5IDYA 1TJPB 4NSNA 2G9QA 4WQMA 3O84A 5AICA 4G0MA 5FPPA 3TUIC 4C76A 1P5RA 3UCEA 5ARBA 3P9NA 5FWYB 3H7AA 4BUZA 1HDRA 1R0ZA 1JEJA 5GWXA 5JI3E 1Q11A 2WKSA 3DC7A 4PYQA 4Q24A 1J5PA 3VH2A 3SEZA 3TLXA 1GL9B 4GT1A 3MOSA 1D0VA 4RD1A 3A27A 3X1DA 4A0RA 2A0KA 1KI6B 2QG4A 2AGVA 3AK4A 1JHYA 5COAA 3TXXA 4YYZA 5LUAA 4AJPA 4U6QA 1G38A 4AXBA 1VP9A 4M1SA 3M1YA 5IM4F 3IUMA 3HNRA 3OICA 3QW2A 2X40A 4LMBA 5DCLA 5F9MA 3U4HA 4ZEVA 5DLEA 1L5FA 3DZBA 4IBOA 4J2OA 1M34A 4HY3A 4J4BA 5DU2A 5DEOA 4AJNA 4X94A 4ZI7A 4RGBA 4R41A 4UBIA 3D4IA 2B7LA 1E99A 4MW0A 2GT1A 3ZLVA 1B43A 3VC2A 4CHGA 1EKXA 4LHVA 3E3AA 1KP9A 2GSWA 1NVXQ 3UJ8A 1UT6A 3M6AA 4R1OA 1UFQA 4J2TA 1K06A 3P20A 3PQ2A 4H6VA 1SVOA 3UJHA 3EDMA 1R6AA 4OUDB 1Y4UA 1JX6A 3AQIA 1UBCA 3I4CA 4WINA 3RVNA 2ZJ7A 1D1QA 1GRCA 1Y3HA 3PFHA 5H4HA 3UC9A 4WA7A 1GZ7A 1U1CA 2AC4A 2R6AA 3ACBA 4JJEA 4YV1A 3OKFA 5BRAA 3LBHA 2GPWA 2XQGA 1YB2A 2FMXA 2H08A 2W2NA 3E3OA 4AIIA 2OUIA 3GU3A 2V58A 4BBAA 2CV0A 1SURA 2P67A 1ZW6A 2P3LA 3PDIB 1H9BA 3VI4B 3VO9A 1E7MA 1O3YA 2GWRA 3I9LA 1E5DA 1KA9H 3OX3A 1QYVA 3PSAA 2GTHA 3KUCA 1VSUA 4WK0B 1Z15A 3VAAA 2ZSBA 1W0CA 4WXMA 1M5UA 4YO7A 5BO5A 5JJCA 3H16A 4GYYA 4JNCA 2AN9A 4L75A 3X2SA 4EMBA 1UBNA 4IIDA 4NFYA 3WKEA 1C9KA 5TV2A 4WLOA 1FLAA 3LF2A 5CHEA 4DW8A 5A6SA 5E9AA 1W0JD 1VSTA 2Q3HA 1CEXA 2XDAA 4AKHA 5CEFA 3Q5GA 1YE5A 1XTTA 2Z1MA 3VR0A 2PD3A 1OFHA 1IY2A 3MT7A 4L5CA 5IJZA 2PV7A 4DANA 9GPBA 1WIWA 2XH8A 3UK2A 3WRVA 5CT6A 4OBWA 3JAWA 4IJKA 5E0OA 3G8YA 3LAWA 2IU4A 2WVAA 2GK7A 4LXYA 1TF5A 2Y2VA 3DFFA 1U81A 2FHSA 3WTBA 3BTUA 2JFXA 3BRWA 4FKMA 2IT1A 4DB2A 1V25A 2LWIA 3BOSA 3OHSX 4LC9A 4QXRA 4X97A 1Z82A 3UQZA 1VMDA 3FTFA 1U9YA 1HL3A 2AWNA 3SG0A 2HMYB 2YYAA 3X1XA 4QC2A 4W1SA 5EXDA 1O8BA 1I4LD 1GTJ1 3AINA 4JCCA 4ZQHA 4DJ5X 5D84A 2BTOA 4JI2B 3H2ZA 4IS2A 1TJNA 1Z6AA 2FSPA 2WM8A 3ASZA 3M1IA 2LCQA 4MHTA 3NOXA 3K0KA 3KAJA 5BPHA 1B74A 1EI9A 2HSGA 3GP3A 1SIBE 2EW8A 2XDQA 4GR5A 3LI2A 2PCLA 4N39A 4TV9F 4OFZA 2XTJA 3MJHA 1J70A 4RWZA 4EYSA 2JGNA 1QSGA 2QT9A 2ZYRA 2WLTA 3R5XA 2OORC 4WOBA 1N25A 1M1ZA 2CWWA 2WJGA 2EERA 1E18A 2BUBA 2GESA 4KHZA 3IE1A 2Q5HA 3C85A 3IUEA 1VJ5A 5E6RB 2EFYA 3F74A 1IPEA 3AV0B 4MYTA 1Z37A 2YZ7A 4GZ3A 4NBNA 4PYIA 4W1PA 1C41A 3A6GA 3EFHA 3KSDO 3HXLA 4QAQA 1XTQA 1WHTA 1FTWA 3F9IA 1FJGB 1I4OA 3M9LA 3UB2A 1CJVC 4WK6A 4YDHB 4CT0A 4JGIA 3R40A 1B8OA 3LZ6A 4TMWA 3EDOA 4RWEA 2XGMA 4F4FA 5EE1A 5ALHA 4LJYA 1DPFA 3LTNC 5J4VA 4INJA 1WRBA 1GUYA 2R6GA 4L0MA 1KZYC 2CLHB 1VKZA 4Q4DA 1PV4A 2O5EA 5AW6A 2VEOA 2OV3A 2PBZA 2LNDA 3EAGA 4RA6B 3VPBA 1IQRA 3FPBA 4HPXB 5TR9A 2A67A 2QVBA 1NVDA 4EFLA 3HP7A 5IT9A 2C3OA 3PF8A 5F1YA 3GLFA 2BFWA 2HSWA 3G79A 1ISFA 2AOTB 3LP8A 4IDQA 4WY5A 1H8HD 3CPHA 3NRJA 2O1EA 1GKIA 1OFUA 3N2ZB 2GFHA 3AOGA 5DNEA 3T9BA 5C8YB 4NESA 1XP5A 1ZH2A 3DTVB 4M0CA 5CVDA 4KXNA 4QU8A 1QO7A 2Z43A 1FMTA 1NUHA 8LDHA 1R9MA 1ZK0A 2Q1XA 2GO1A 4E1VA 5KVAA 3RVPA 3DGFC 4N5DA 3O6VA 5IC5A 4QO8A 1NSFA 4R98A 4WBNF 4JBLA 1AMNA 1HY3A 1JLKA 3DT8A 3SFVA 2CLLB 4LQ4A 1N1GA 3GJ8A 4U5XA 1WB4A 2BAGA 2O14A 1V1RA 3RC9A 1EK1A 2RHHA 4PRLA 1BN6A 3AR5A 4D9BA 1OILA 4EF4A 5K0LA 1JE1A 2XUJA 1RI1A 1LQTA 4G4SP 1Y8CA 4PLPA 4EAQA 2CL5A 2RAPA 3GDHA 3ZU6A 5MGBA 1TTHA 3TL2A 1Q7EA 3P4YA 1SG9A 2KQUA 1IBCA 2UZIR 2GD6A 3OF3A 4NK4A 4YI5A 5GP1A 3I0MA 2CK3A 3I05A 5DYNA 1QH0A 3VHQA 2XB2A 1SQ6A 2WEKA 4BN0A 2MYTA 3IMCA 1P1KA 3LE8A 3TG8A 1TEZA 4P7BA 3S40A 4D0NA 1DL5A 1KMQA 1TADA 2AYXA 4JHXA 3T54A 3IDOA 5D6OA 3TQQA 2ZJFA 1HZZC 2IYQA 4HVTA 1WOMA 3AWDA 4WECA 2X4IA 3COYA 2A5FA 3NWJA 2HD4A 3PYXA 4XYGA 4REQA 4I1RA 3T99A 2XIQA 1XI2A 2WKRA 1JBQA 3V48A 2QKYA 2X0IA 2HFKA 1IUNA 3CUKA 1H1TA 1F8XA 2QUJA 421PA 5EIXA 4MDEA 1GGMA 4ND4A 2KM1A 1L5NA 2VTEA 1U2GC 4DR2B 3R9XB 3T3OA 2CE2X 2QUZA 2J3EA 2YFQA 3KLBA 4GXNA 4D2IA 2AN1A 1JN0A 2G5CA 4NCKA 1M2VB 1WNFA 1ZPDA 1UEXC 1R8XA 1QK4A 2QXYA 5LXTF 4HNAB 4RHYA 2C9BA 2Y1GA 3QY0A 5CXUA 2P4EA 3GLVA 3GVXA 3PKJA 1BD4A 1GPBA 1Z06A 2C2MA 3BAZA 4ILKA 2H0QA 3H1BA 3UPDA 4IFIA 4PPYA 2BR4A 1UBKS 5DIFA 4C0JA 4JR2A 4ZI3A 2B6NA 2IW3A 2OHGA 4KACA 2REQA 3DBRB 3TM4A 2AG0A 2XQVA 2YHIB 3HJRA 3KWLA 4IAOA 2J7PA 1XTJA 3BGDA 3KZXA 4MUMA 4O3FA 1JLHA 3WZMA 4NQZA 1E7RA 3MSXA 5IK2D 3I72A 2WYUA 3O4IA 4W9NA 3SEAA 1G7TA 2GHRA 1G3QA 2OY0A 4HB3A 3GD5A 3AT1A 3RS2A 1OXUA 2Y05A 3K0AA 3ZEIA 1KJWA 2JEZA 3HYRA 2OE2A 1C4KA 1YVRA 3JTMA 4FMBB 3GA7A 1RAEA 3SZOA 3R09A 5FWXA 2QSYA 4FLFA 5FPQA 1EIWA 1B6TA 4P0TA 1O96B 1YZ3A 3I73A 1WDLA 3ELUA 2FZVA 3IAM6 2BM9A 3QKIA 5DRTA 3HM9A 1UBEA 2HMTA 2VHWA 1ZESA 4ME6A 1EM6A 4IHJB 1T26A 3CU5A 3V6MA 2V54A 2NO5A 3FZNA 3C74A 3LFHA 1ULZA 2PPVA 3RASA 1M7BA 4F6CA 4Q03A 4Y7CA 5SZIA 4E6EA 1AUVA 1IH8A 1ZHHA 3S44A 1VMIA 2VQFB 4FX5A 3I2FA 3ZXXA 4ZDKA 2JJMA 4K9NA 4I66A 1C1DA 3R9KA 3IDAA 2AZXA 3FROA 2IDZA 1TJ4A 3U31A 3GJ3A 5EJ6A 3MGAA 1FDSA 1AVTA 5K3BA 3MVEA 1Y8RB 4JUDX 3TMYA 4HWGA 2UYCA 3KG2A 2PU7A 2QNIA 1BE6A 1X7YB 4PSAA 5D51S 3AFIA 2DR0A 1OXMA 4M7RA 2FG6C 3R0JA 4Q9NA 4KTVE 4R01A 1L5LA 3TAXA 3T4UA 1M7GA 4HG2A 6REQB 1D9XA 2PZKA 3CWQA 4NARA 3FBGA 4ZGWA 4QG3A 2CLIB 2O0JA 1TMGE 1JIVA 4B6FA 4EGSA 3KSAC 1JH9A 1M6EX 1L8AA 3K0CC 4QXOA 4MK4A 4DLTA 3HK2A 1G5TA 2H4ZA 4G86A 1FS6A 4X20A 1RVV1 1YQQA 3EGDA 4ZHSA 1Y8QB 4CM4B 1TCBA 4E14A 1YZYA 3EZLA 4NEQA 1DG3A 3H2HA 5K5EA 1XDZA 1W7AA 3U80A 5DHRA 2GNAA 4MVYA 5TGDA 4EH1A 1PT5A 5D3ZA 5CB4B 1UXKA 5JPCA 1OAOA 3FDZB 2IA5A 3FOEC 5F4BA 4ACBA 4QWMA 3HVHA 1GN9A 5F1PA 5KC9A 2WIKA 4KMSA 1KK0A 3BXZA 3HXTA 4NG4A 2FQYA 4G4SO 4TYWA 2VQSA 1MG5A 3NHMA 2OOKA 1TKBA 2E6KA 1MZPA 3W2FA 4F7DA 1U28C 1ACJA 1RI4A 4DR6B 3ROQA 1F4LA 4JBIA 1QIMA 1XV5A 5HDBB 1OD6A 3N76A 1GD1O 4PYNA 2X0KA 3U9TA 4QGBA 2GETA 2O20A 4QPPA 1KNQA 2VN8A 4B6PA 4N0EA 4E3ZA 3KZCA 4UJ5A 3E35A 2H5JA 1R5JA 4EGAA 4C7VA 3W2IA 1YZTA 3OTIA 1TUEA 1QDUA 1FMCA 4X8OA 3ZHQA 3OFKA 3Q8MA 1MUUA 1DE0A 2RAUA 3GEDA 3CVXA 1B23P 3HMQA 4NH4A 1RZUA 4D8YA 3L7BA 1XO1A 4ITRC 4ZYTA 2JGDA 5DZSA 3DMHA 3SOPA 4OJQA 1SCJA 4UHJA 2G7MC 4Z0NA 3RBAA 1FYXA 5C8YF 1QH1A 3UH0A 1GXSA 1TM4E 4ZZ3A 6ADHA 4A36A 3QYAA 2P2CA 1LI7A 3IMGA 4ENPA 3DXXA 4TWBA 1PJ4A 4LX8A 4AG6A 4ZREA 5HFAA 1Z5PA 3IAS6 3MMSA 5IMSA 3FDJA 1ABBA 3PT9A 2B8NA 2JGDB 1A4IA 2ORIA 4WBNB 4OM7A 5JNSA 5CP8A 4LUCA 2FX3A 2G76A 1OF1A 2IHNA 2IZ6A 1IFXA 3IMKA 3FLMA 2N1MA 3RVMA 4FX2A 2O2CA 1SU4A 1NLYA 1P6QA 2I65A 2PJUA 2NP7A 4DUPA 2H2WA 4RHCA 4IIVA 3P2EA 2NZ2A 3U9LA 3AKCA 3MFQA 3MLEA 4Q4HA 1KE2A 3WWDA 3O47A 4QGSA 1S5PA 3BJEA 3C1UA 3DDWA 3K73O 3ISTA 5HRUA 1LH0A 3A6EA 2AXEA 4Z4QA 3DL4A 4LV8B 2ZJ6A 4UD6A 1M2NA 1BKSB 1MAWA 1Q57A 2BHSA 2OV1A 2XMCA 3L0DA 3VUEA 1CX9B 2VA8A 3LSTA 5DP1A 4EKYA 1U63A 2VJNA 5FDFA 1NJ5A 2EP8A 4U4AA 3I8SA 2AC7A 3LWNA 1ZC3A 3OWHA 4MUIA 5ENZA 2JI4A 1LDNA 2B8EA 2Q21A 4F60A 2HX1A 1LVUA 1RBQA 2CVFA 3I37X 4Z4FA 3KXLA 5HMMA 3RJ9A 3WLSA 5IHPA 2WT9A 1K5DA 2WW8A 4URUR 2Z2XA 3KQSA 4Z2YA 3EFOA 3N2EA 4B3HA 4QHSA 2WIGA 4IXNA 3KDSE 3MCVA 1SG0A 2DT8A 2OGSA 3ZY5A 5C32A 2IKSA 3IT1A 3UMYA 4MLZA 4DUZB 1USWA 1Z12A 3AX6A 3ISJA 1EZZA 3KEMA 4KIGA 4OU4A 4PLWA 2OK8A 4QA9A 4U0KA 4C5CA 3I09A 4F86A 3S8YA 1VJ0A 2CZGA 1K75A 4UULA 2FGJA 4Y6QA 1CERA 2ECQA 2ZSIA 3ZVRA 3F1LA 3ON5A 2GASA 4YRDA 3PVSA 3U3MA 3UCXA 1MQ9A 2J3HA 2JJ2A 4EW6A 1I4EB 4XYBA 3TRJA 1LK7A 1Y98A 3H2JA 5LOVA 3J80A 1Z38A 2PWPA 2ZUDA 1KZ1A 5BR1A 2P2DA 3UGJA 5AW3A 4TMFA 4EA7A 2Q8NA 4N54A 5CVEA 1Y4DE 4R7ZA 4EW1A 1RYMA 2CFTA 5AM5A 2VZEA 3R0XA 3FNRA 4KPUA 1XZGA 3M4JA 6AT1A 3WGNA 4GC5A 2VF4X 3MWDA 1PFKA 3CH7A 1P2FA 4IIJF 4EB0A 4EYQA 4ALIA 1Y1KE 2I91A 1TD9A 4E07A 3GGOA 3KKPA 1H2EA 2EDAA 2QG6A 3ETEA 4LMAA 4Q37A 5GINE 1G4UR 3AZOA 4U2FA 1B8VA 3BIWA 4IHJA 4RACA 1E2LA 2NO0A 4AMBA 3DD5A 1GNTA 4EWLA 3PXAA 5F5NA 2WICA 3DCYA 3B53X 1ZH6A 5JBIA 3OSZA 2ZDHA 2VDKB 3F7MA 4YRNA 3F6EX 1ZSNA 2HT6A 4QYIB 4HEHA 5B2EA 3G0GA 1CV2A 2FPOA 1DZ3A 3ROXA 1B0ZA 3FDFA 3E9RA 1L5YA 1FXWF 1NJ2A 4MR8A 2HDHA 2CD9A 1KMHA 3OI7A 3ZHZA 1UBLS 2ZEJA 4OI0A 2VYFA 3A9UA 1IWOA 3G1UA 1IOLA 3QMPA 4V0OA 2FAXA 5MDHA 3VTAA 1ZIDA 5KJ1A 3HZZA 4UBMA 1C4XA 1QCYA 5DTRA 3O8RA 1HEYA 3IBFA 4OXXA 1OHHD 4ZOAA 5FBHA 1R5OA 2A35A 5FR1A 2FZCA 1RRMA 1VOTA 3H8WA 1T1GA 3NI2A 4JX9A 4PVCA 2UVDA 4HEA1 2X3YA 3JSAA 3VYWA 3B6JA 3TKAA 1A8HA 3HVRA 1NR5A 4MW7A 5IKPA 5AJZA 4BNGA 3IEIA 1M5TA 5JV5A 3PZRA 1ZGJA 5IVDA 3CZMA 1TEHA 2VP5A 2C8KA 3RKRA 1LVHA 4MKZA 1Q91A 3U81A 3H2IA 4DCJA 2FJ0A 3QUBA 1SVIA 3MT8A 1NQUA 4LECA 5MF6A 1V6AA 2WYWA 3DZGA 1OFIA 5CA0A 2DECA 1KI8A 1BTOA 1ZM4A 2QPTA 4DLSA 3IEUA 4Z49A 3EODA 4I50F 5DN9A 1NU6A 2A5LA 4DM3A 2C7GA 2APJA 2I2CA 3PNVA 4JBWA 3RRJA 3DLTA 1FYFA 2FDXA 2VDMB 1Y63A 3A4MA 4KFSA 4WKNA 5C7LO 5IM4A 1QP0A 1VG1A 1DKPA