5BW5A

Crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase d21a mutant from catenulisporales acidiphilia
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
219
Chain Sequence
KVLAGKKLTDLDPAEWAKAQASAERILVDVGTGDARTAYRQAIAHPEWLVVGVDPAWQRMTETAVRAARKPAKGGAPNLVLVSSAIETVPAALHGVADEVMVLMPWGKLLRGVVLGEADVLSGLRAVAKPGAPLEISIGTSIWREPIPLEIRDLPELTPETVVSTGLTDRLAALGWQVADVRLVPHTDLDTISSSWARRLGSGATETVLHLRAVAVDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional dichotomy in the 16S rRNA (m1A1408) methyltransferase family and control of catalytic activity via a novel tryptophan mediated loop reorganization.
pubmed doi rcsb
source organism Catenulispora acidiphila
molecule tags Transferase
molecule keywords 16S rRNA (adenine(1408)-N(1))-methyltransferase
total genus 67
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5bw5A00
1R8YA 4RTLA 2FCAA 3C6MA 3HCFA 1X1AA 4XUEA 3QOXA 1XCLA 3I5UA 4PYOA 3V97A 2IDKA 4EK9A 3CJTA 4GC9A 5DT2A 5K09A 4PYLA 3GRRA 4POOA 2PGXA 3UWPA 3LDUA 3LGAA 3ER8A 1P1BA 2JJQA 2AOWA 5MHTA 2H1RA 1B42A 3MERA 2IP2A 3QV2A 1MHTA 2OO3A 5HIMA 5B1SA 1G60A 2Y1XA 1NW7A 3GJYA 5IKMA 1NT2A 4P7JA 3EVDA 4RV9A 3KU1A 3P71T 4PWYA 3R0QA 1WY7A 2IDJA 5LQNA 4M36A 1JTFA 1L1EA 3LSTA 2G71A 3NMUF 2GAFA 3A26A 1M0EA 3B7PA 1AF7A 3ELUA 1DUSA 3KR1A 5CVVA 1JG1A 5EMLA 3LCCA 1L3BA 3M4XA 3JWHA 4PCAA 4MIKA 3DUWA 1QZZA 3A7EA 1WS6A 3IYLW 3A4TA 2P3QA 3NVMB 3ORHA 4P7FA 3BXOA 2CL5A 1ORHA 3G8BA 4GBED 5E1MA 3THRA 3OPNA 4R8RA 4F86A 3R9XB 3B3FA 2IBSA 3OZSA 3CVOA 3L8DA 1VP3A 3JWJA 3O7WA 3MGGA 4QQNA 2P41A 2YR0A 3D2LA 3GRYA 3EVFA 4IWNA 4GOOD 3JWGA 1FPQA 2PX2A 5HEKA 4YV2A 2PX8A 1WZNA 4AZWA 3P9KA 1BKYA 1KPHA 5DM1A 1QAOA 4RTRA 3HM2A 3IEIA 5DRTA 5EMKA 4OBXA 3KQPA 5CCBA 5CIYA 4E2WA 1G8AA 3P2KA 2WK1A 4GF5A 2IBTA 4HTFA 2QY6A 1BHJA 1Y8CA 4EKGA 2OB2A 1FP2A 2FRXA 2PV0A 3KQMA 1YZ3A 3LECA 2QE6A 3FUWA 1G6Q1 2B2CA 2ZFUA 4YMGA 2ZZMA 1JG4A 2IIPA 3G2MA 3M6WA 4LG1A 3VC1A 4RSRA 5E1OA 3IV6A 3FUUA 2UZ4A 1P91A 4HRAA 2VDVE 4BP1A 5BP7A 4FSDA 5D1NA 8MHTA 2A14A 3EVEA 4H0NA 1T43A 4R05A 2JH9A 1PRYA 4ISCA 1R18A 5H02A 1X1BA 5LQUA 3C3YA 4R8SA 2PWYA 3MQ2A 1DL5A 2EJTA 4OQEA 5CUQA 3MAGA 5EQJB 4ER7A 4X61A 3R3HA 1NW8A 3HP7A 4YUXA 2VDWA 3M6UA 1XCJA 1IM8A 4IV0A 5G02A 5KS2A 3I64A 2AVNA 1M6EX 1ZGJA 3HA3A 5F2OA 2ZW9A 5FUBA 2LD4A 3K6RA 1KIAA 2XVMA 4PONA 3EGVA 4C04A 4RWZA 3I58A 2ZCJA 5FWDA 1G8SA 1XDSA 2OXTA 5E1BA 4C06A 1RI1A 4F84A 3KPJA 1JQ3A 3G88A 3QOWA 1MJFA 3UZUA 2FYTA 3THSA 3OFJA 3GNLA 5DWQA 5K0BA 4M37A 4YUZA 1KPGA 3UJ9A 1N2XA 2VS1A 3HVHA 3K0BA 2AOUB 3E8SA 3UJDA 3DMHA 3TKAA 9MHTA 1XVAA 4RTQA 5ICGA 1KR5A 5DSTA 2ORED 5T64A 1NW3A 5EHGA 3UJ6A 4RTSA 5E9WA 4E33A 4X63A 4DF3A 1YFLA 4RTOA 5DTMA 4BLWA 5DLYA 2ZZNA 3C0KA 5EC8A 1JG2A 1D2HA 4PGHA 1XDZA 1RJEA 4OQDA 1WXXA 3LBFA 1YB2A 3DMGA 3EPPA 1RI5A 3SSNA 2HWKA 2AN5A 3LDGA 3ELYA 3SX0A 3BUSA 3FUTA 4AZTA 2O57A 2P7IA 2R6ZA 5HOQA 3G2OA 4HG2A 1EJ6A 4E32A 1JG3A 2I6GA 4DMGA 2NXCA 3EVZA 4E30A 4DKJA 4QPPA 1KP9A 1SKMA 5GM1A 4FS8A 2O0LA 3GDHA 5E9JA 1R8XA 3EVBA 2PSSA 5K8VA 1N7IA 2WA1A 3HVJA 3NTVA 2EX4A 5GP1A 4KDCA 2NXNA 2Z6AA 1AQIA 4FR0A 2OPBA 3BWMA 1TPYA 3GRZA 4K6MA 2DULA 5FULA 5ICCA 1VQ1A 4DA4A 2K4MA 1JR4A 1D2CA 3DR5A 2AN4A 3M6XA 3BT7A 4P7GA 5HZMA 2I7CA 2NYUA 1NKVA 2Z6UA 1KPIA 2ONYA 3DTNA 4X60A 3PLAE 4QTUB 1VBFA 2BR5A 2IH4A 3T7TA 3P9CA 3B3JA 1R74A 1VL5A 4GC5A 5CM2Z 2YX1A 1HNNA 2CWWA 4RTKA 5K0CA 4EMSA 4PYQA 3E05A 3KHKA 1HMYA 5EMMA 2YXEA 1RJDA 2NXEA 3MTIA 2VZ9A 4XCXA 1SG9A 1ZGAA 3BGIA 3DXZA 1M6YA 4PYMA 3HVKA 5HILA 2CMHA 2BZGA 1RI3A 4F85A 2GA9A 1L9KA 1NBHA 2Q41A 2XYRA 3NDIA 2NXJA 3ANXA 1TW2A 2XVAA 2PVCA 3P97A 4IV8A 5C0OE 3SVZA 3OE4A 4C07A 3G2PA 3LPMA 1V39A 2FHPA 4R6WA 1EJ0A 4YUVA 2HTEA 4E70A 1ZG3A 4PIPA 5FQOA 3KQOA 4DZRA 3HTXA 3PT9A 4LWPA 5BW5A 5KYGA 3G7UA 4NECA 1JTEA 5T67A 3TFWA 3TRKA 3ER9A 3HA7A 3SSMA 1XTPA 1NW5A 5JR3A 2P1DA 3P9NA 5JUWA 2JHCA 2F8LA 3ELWA 3LL7A 3HEMA 3OU2A 5E8JA 3UJ7A 3AY0A 4DM3A 1YUBA 4CWAA 3E23A 1VPTA 3P9IA 5T6BA 2JG3A 2B25A 4OA5A 5ICFA 5EPEA 2YXDA 1VIDA 2P40A 5K0NA 3SMQA 4EQZA 5K0FA 2AOVA 2PXCA 3NW9A 3O4FA 2H00A 3C6KA 5ERGB 3OU6A 4ZTBA 2O07A 2ZBRA 1ZKDA 3FUXA 2YXLA 3FPFA 4BP3A 5KVAA 3M6VA 3HCEA 3I9FA 2BM8A 2GH1A 4RX1A 5DX8A 3TQSA 1O54A 5DTRA 4KW7A 4KRGA 3C3PA 3V8VA 2P3OA 1NV8A 3PX2A 2C7RA 3M70A 3EMBA 3MCZA 3CC8A 5LQCA 1L3IA 5BXYA 3DOUA 4E2XA 3HCDA 4CKCA 2PWPA 3AXSA 2YQZA 5CD1A 1L3CA 2H11A 3BGVA 4XUCA 3GXOA 4P58A 2GLUA 3GGDA 2UYCA 4C05A 2ZULA 5DXJA 4PYIA 4CXMA 1QAMA 1EG2A 2JH8A 2QRVB 3G89A 1U2ZA 3BWCA 5DX1A 3SM3A 1G38A 1WG8A 2IH5A 4RTMA 3G5TA 1FP1D 4PGGA 3GO4A 3GRUA 5D1HA 1OR8A 3JWIA 3EGEA 2AOTB 4E2YA 2BR4A 4BLVA 5K0GA 2OZVA 3CJRA 3DXXA 4YUWA 2XYQA 4AX8A 3P2IA 3AWIA 4KIGA 2ZTHA 1F38A 1ZQ9A 4RVDA 4X41A 4PYNA 4ER5A 5DM2A 2ONZA 3R24A 2AS0A 3UBTA 1P39A 4HGYA 5FHRA 1NE2A 4A6EA 2QYOA 4CTKA 2GS9A 4E2ZA 1VE3A 2I9KA 3LKDA 3Q87B 4R6XA 1RJGA 3FTCA 1KYZA 3BWYA 1QYRA 3NWBA 4AZVA 5KQSA 1O9HA 5FTWA 4FGZA 3UJ8A 5F2NA 5EOVA 4GOLD 3DLIA 5E1DA 3T7SA 3PTAA 3KPWA 4AZSA 2FPOA 1X1DA 3OCJA 4QVGA 2O05A 2EJUA 5FA8A 5P8WA 3ME5A 1XJ5A 4P7KA 1XXLA 2ZWAA 3T0IA 4KWCA 1RI2A 2IH2A 5LQAA 5HIJA 4HSGA 3GCZA 3HCBA 4X1OA 2PLWA 2PT6A 3FPEA 5U4XA 5EEHA 5GINE 2G8NA 2OKCA 5FWAA 2QRVA 4YMHA 5K0EA 3TLJA 2ZWVA 3FYDA 5ICEA 5LSAA 1X1CA 4MHTA 3EMDA 3CKKA 5HIKA 5C9ZA 1FJXA 1SVUA 3UA4A 3PB3A 1F3LA 2OYRA 4Z2YA 1NW6A 3NWEA 2EFJA 2YTZA 3FPJA 3FTDA 3FRHA 4RTPA 4FZVA 4PINA 3BZBA 2UYHA 2HV9A 4DCMA 3RW9A 5HIIA 3LHDA 3KQSA 3AXTA 3GRVA 3P2EA 3KPUA 4QTTB 1X19A 2G1PA 2OY0A 3CCFA 1ORIA 3DP7A 3EEOA 1PJZA 3OE5A 4BLUA 3ERCA 2AOUA 3GWZA 3OZRA 1INLA 2ERCA 2ZIEA 2AZTA 3GU3A 1SQFA 5E2BA 2JHPA 3LX6A 3FYCA 1D2GA 1I4WA 2OB1A 2ZIGA 2JHAA 3DLCA 4WVLA 5GIOE 4C4AA 2NP6A 4RVFA 1JQDA 4YUYA 1YZHA 3PVCA 5CVUA 4OX9Y 4HGZA 5GIPE 1EAMA 4CTJA 5GM2A 4IKPA 1Q0TA 2OBFA 1ZHFA 4MWZA 5K01A 3OFKA 3KQYA 4B17A 3HCCA 1QAQA 3CJQA 4KVZA 2AVDA 1KHHA 3TPZA 4PYJA 2BM9A 5DRYA 4QVKA 4GUAA 3FTFA 3HCAA 4RYLA 3HA5A 2G70A 3KKZA 3G8AA 3CGGA 3ELDA 4ATNA 3EGIA 3KPYA 5E9QA 3A27A 3FTEA 1I9GA 4FT2A 3MCTA 5DPMA 5KQRA 2O06A 1KYWA 2PXXA 3DH0A 3S68A 1YFJA 5LQKA 2YUIA 3EVCA 1P1CA 3EVAA 3OU7A 4O29A 3TM5A 5LQRA 4RVGA 3AJDA 1WXWA 5EZSA 4RTJA 2C7OA 4CKEA 3UFBA 3A25A 2HNKA 1NBIA 5EZQA 1YF3A 3I53A 1TW3A 1O9GA 3TKYA 1FBNA 3UJCA 3KQWA 5M5BA 5IH3A 2DPMA 1R00A 2HMYB 2PT9A 3MB5A 2NP7A 2P7HA 2VP3A 3UA3A 1XDUA 1VP9A 4FSXA 4E31A 1NV9A 3BKXA 3KQTA 4HC4A 3O31A 4Y2HA 2AOXA 2AOTA 1BOOA 1R6AA 2IFTA 3UJBA 5CVDA 4EKIA 2C7QA 2AN3A 2CKDA 4YV1A 3B5IA 3M33A 3VC2A 3ID6C 5DTQA 2Y1WA 4V0QA 10MHA 5EIWA 2UYOA 2B3TA 5FA5A 3UJAA 2CMGA 1JQEA 4PYKA 3MTEA 4AUKA 2N47A 5LR6A 3LDFA 4QDJA 5DXAA 1SQGA 5DM0A 5CVEA 5EIFA 4MTLA 3KQQA 7MHTA 2ZSUA 3KQVA 3KR2A 2XYVA 3EEYA 3RIEA 2KW5A 4PNEA 4U7TB 4GEKA 5CCXA 2ADMA 4Y30A 2WA2A 3TM4A 4EVIA 3RODA 5CVJA 5GWXA 3BWBA 2R3SA 1I1NA 1Q0SA 5BW4A 3LKZA 4OBWA 5LQJA 3HNRA 4LECA 2G72A 3KPVA 1BC5A 3SSOA 4MQ4A 3FRIA 2IPXA 2VDUE 3VSEA 3TR6A 5FHQA 3TOSA 2ZLBA 2P35A 3PS9A 2Z6QA 1SUSA 2FK8A 2ZBPA 1IY9A 1KXZA 3HVIA 1IXKA 2ZVJA 2P8JA 2ESRA 4BY9E 4A6DA 4ER0A 2PY6A 3BGDA 4OA8A 3MHTA 2IGTA 2ZIFA 3LBYA 4KDRA 3DMFA 2E5WA 3FPHA 3PFHA 5DSXA 1AQJA 4WXHA 4DQ0A 2NNWB 2HR1A 2I62A 3LCVB 5EMJA 2PX4A 2ZZKA 4ER3A 5F2KA 5HFJA 3BKWA 3VYWA 3KR0A 3WSTA 3EVGA 2YVLA 4GQBA 1Z3CA 5DX0A 4GOMD 5EG5A 3FUVA 3G5LA 2AR0A 2BR3A 3DXYA 3R6TA 2GPYA 4M38A 3P8ZA 5K0LA 2XBMA 3FPGA 5EGSA 4LWOA 5K05A 3NDJA 3B3GA 2BH2A 3PFGA 1UWVA 4QDKA 5EHIA 4RTNA 4GOND 2V7EA 2B9EA 2PXAA 5FADA 4U7PB 5FCDA 4FP9A 4L7VA 5EKUA 3LCUA 2V74B 2PX5A 4FT4A 4JXJA 3TMAA 3Q7EA 5E2AA 5K0JA 3DULA 4C08A 5DM4A 1G55A 3G2QA 4KIFA 4UOEA 2B78A 2PKWA 1DCTA 2EG5A 4XUDA 4V0RA 2QM3A 3SR4A 4QPNA 5E8RA 3KR9A 4DCGA 5EVJA 1JSZA 3B89A 1UFKA 1VLMA 2PJDA 1JSXA 1RJFA 2C7PA 2UYQA 4PCLA 4YV0A 5GOZA 4RVHA 5C1IA 3SXJA 1SUIA 3OZTA 2FK7A 2ZBQA 4PIMA 3A7DA 3GIWA 1N7JA 4ER6A 3NVKI 5EKXA 3F4KA 4M7RA 5FQNA 3U81A 2PBFA 3CBGA 4HH4A 1EQAA 1AV6A 4HTFB 4QQKA 1H1DA 3SGLA 4G56A 3X0DA 1QANA 1EIZA 1UIRA 3E7PA 3IHTA 4CKBA 2P3LA 3H2BA 1RI4A 3NJRA 3PX3A 3T7RA 3REOA 4C03A 2GB4A 5K03A 3FZGA 5EEGA
chains in the Genus database with same CATH superfamily
1RM3A 4YDRA 1W85B 2ZPTX 3TVYA 1XGKA 3NPMA 5KVCA 3HXPA 4RD0A 4C30A 1IEQA 3I5UA 2IDKA 4PHHA 1ORWA 4GC9A 2F9FA 3W2FA 2BDTA 3CUUA 4RKEA 2D5LA 5JD3A 5DJ5A 3W2GA 3BS4A 4H17A 3MC1A 1P9LA 1A88A 1PT8A 4CUZA 1UC4B 4WA8A 4D45A 1D5CA 4RJTA 5IFKA 4B3MB 3H5IA 1F4VA 1VBMA 1KI6B 2GXUA 2POQX 4O8CA 3N2IA 3TIGA 3KELA 1X6VA 3AF5A 2WJJA 4KJZA 2NAPA 2AK3A 1HT2E 3TIFA 3COVA 3FYHA 1DI0A 2KSQA 4NSNA 4UEJA 2B8JA 1IY8A 2GAFA 3N2NA 4WBXC 3K6JA 3JVEA 2ZVPX 4RL6A 3KR1A 1L2TA 2GPJA 1DUSA 3GB9A 2XB2A 3LCCA 4BO0A 1YJAA 4CQMA 2VT6A 1W93A 5AW3A 3G0HA 3JQ7B 4Q4AA 4Q1CA 2O5CA 1P60A 1CE8A 3OPXA 4GZMA 1T3HA 3HMQA 1E3EA 3UWSA 3V7FA 1EINA 4H6WA 3AJ9A 5EKDA 5MDHA 3CPSA 3GARA 3I28A 2V7BA 4LOLA 4DJJA 3MXTA 2P6RA 1MFPA 4OL9A 2ZSBA 2H1OA 4KPEC 4A1FA 2FCRA 3OJEA 3VU1A 1FW8A 4N3NA 5BWNA 3U49A 4Z3DA 2NO4A 1RRVA 3GYBA 4XYGA 3U7EB 1T5OA 3NASA 4HO1X 2YNMA 4ZDWA 3R7WB 2P77A 5IJ9A 1BEEA 4UCQA 1IXYA 1BDHA 3OJLA 2Q6KA 1P18A 2HIGA 1Z38A 2XUFA 4DRXB 1IHUA 1BMFA 1JJVA 1M2OA 1XLWA 4LG1A 1OXKB 1ZVJA 2O1SA 3OLVA 4N12A 4KH0A 1V4VA 3KKKA 3WQBA 4AVYA 4BP1A 5REQB 4GXQA 2EWVA 2C8JA 3HRIA 2G08A 1PVDA 4O2BF 1X1BA 1WVGA 4ZYZA 3IUEA 2M1XA 3HUTA 4OQEA 5CUQA 3QF7A 4WXEA 1WW3A 4D3ZA 4Z49A 3WKDA 4W63A 3ZV3A 4IV0A 5JDIC 2PGNA 4HAZA 4BB0A 3I64A 1NXTA 2FVXA 2IYUA 2HYDA 1BU5A 1E5TA 2A0UA 2OO7A 3AB7A 4OP3A 1RS0A 2VHVA 4F4JA 3CWQA 4RWZA 2OAQ1 4FMCF 1HFKA 1ZVMA 1ECGA 4HX2A 1A9SA 3O8LA 4JT9A 1W0JA 4UPDA 4Q1DA 1GRRA 5EKSA 2CVPA 3THSA 2AFIB 4QFDA 3MT7A 4R2LA 3W5JA 5F23A 3ZIAA 4EABA 2CD7A 3ZJUA 2I6XA 4Q9DA 5JXJA 4EYEA 4NP6A 3GLIE 2FUKA 1OYVA 1O2DA 1GTRA 2YOHA 3HK2A 3HWSA 1TDJA 3CVWA 4JBWA 4OFBA 5EHGA 2XLBA 2QQ0A 5EHZA 5KC9A 1U4NA 2CB9A 3FIUA 4OAOA 4YTEA 1PDOA 3GROA 3RRJA 5CITA 2EKDA 3UK7A 2CNNA 2IU0A 3EODA 2UYYA 5CPBA 1OI2A 4BLWA 1PN3A 4J29A 2JFUA 3AFMA 3NDPA 1DO2A 1Z2AA 1MP0A 1QQAA 1EVIA 4RQTA 1ZL0A 3GOHA 4F2PA 2GT1A 2OCBA 1NDQA 3K8YA 2EL9A 5M34A 1EGHA 3RF7A 2VTEA 1AC5A 3AR4A 2R7KA 1PJAA 4U9UA 4FM9A 5L3RA 4G84A 5U4QA 3FZQA 2UXBB 3H8WA 4M0CA 4CLRA 1A8QA 3DMPA 4HOYA 4QYTA 2BGGA 2FR8A 2D2EA 1MGOA 2HRQA 2PRZA 3AHIA 4LRUA 3LC0A 3QELA 3IR7A 3EISA 5KO2A 2CK3A 3U0VA 1PJ8A 1TM3E 1OLSA 3CW8X 3V4LA 1LTQA 4WLNA 2DCMA 3KUKA 1RWVA 3D31A 3GMSA 2NO5A 3FRJA 2WU0A 1MG0A 2C03A 4BKMA 4ZHQA 3P20A 2XGJA 2DULA 3JQAB 1JR4A 1KDOA 1EB8A 3RF6A 2PZMA 4LMPA 4LPKA 3VZQA 1ND5A 4KOEC 4Z4GA 1XZHA 4Q16A 1GPJA 2IYOA 3DVLA 1VIAA 1EMDA 1U7TA 3AUTA 4M99A 3CZQA 3GPBA 4XSGA 2M6KA 4BFWA 2BR5A 3PLAE 3P9CA 4GWKA 1QMPA 2I7DA 2W4IA 3B3JA 3CVJA 4EKYA 2HQOA 1WDKA 3OI7A 2JD0A 5LKRA 1M6NA 2IY7A 2V6MA 1QHHB 1NQOA 2PBLA 2X2FA 1HMYA 1DBVO 1LNZA 3QVMA 4QOGA 4R83A 4TXJA 1UBKS 3UNXA 4D9BA 5TPWA 1V8DA 2W6OA 2Q45A 1LGYA 1XVTA 3JASB 3QPUA 5EPUA 5EESA 4F85A 5JRZA 3MF4A 1LDMA 2WOJA 3Q9UA 5DXFA 2GZ2A 2I4LA 1TW2A 3LOPA 3AEQB 4HDMB 1VA5A 4MRRA 5B4UA 3H13A 2H2HA 1E6KA 4KR7A 1HDGO 3AF0A 2G1AA 1KTVA 3ZU3A 3AERB 2QN6A 4JC4A 3WLIA 2O8DA 2R7MA 3TFWA 4LGVA 5BQ3A 1W48A 4KQ1A 3RYCA 2RBEA 5HCIA 1FFYA 2WP8J 1A5SB 3ELWA 1ZSYA 2W22A 4HAXA 2ZJBA 4XE5A 4EHFA 1Y6GA 1H2BA 3EIOA 2AX3A 4X8MA 3EASA 2BMAA 5FWNA 1VXOA 1P4JA 3K15A 3KT0A 2V7TA 2HX1A 5G40A 1R0WA 2ZUBA 3D9QX 3IRVA 3BXGA 3HKBB 4K1XA 3EAQA 4ZTBA 4OHYA 3F2IA 1NX6A 2CXSA 3Q15C 3PWTA 1PW5A 2PYZA 4DB2A 1WABA 2QZJA 3C5EA 5IDQA 1CX9B 5A2QA 1SHUX 2GXSA 1V26A 4KNVA 4S2EA 121PA 1S8AA 1IMOA 1PZEA 1QR6A 2FFBA 4PO9A 1WCIA 1QH9A 1S01A 3PEWA 2B94A 2Y1FA 4HGNA 2TSYB 3TE6A 4BNVA 4C7KA 1I3LA 5B4VA 1U1CA 4GPZA 4MVYA 1W5TA 2WWWA 2ZE7A 1T1JA 2RGYA 3OKPA 4MV4A 3IUQA 3AR5A 1BEZA 3F3MA 4P22A 4KLCA 1WG8A 1XWWA 4RTMA 3NOQA 3GRUA 3QU9A 1C30B 4W6ZA 1AU9A 2AF3C 3SBDA 1QZ3A 4E2YA 2Z04A 2ORIA 3CJRA 1XF9A 1Z0IA 4LOKA 3P2IA 2V9CA 3RJZA 4QT4A 4DG9A 1VECA 3R7LA 4CDMA 4O5OA 5TQ2B 2BFEA 1TEZA 3TCNA 3MZ0A 3FXAA 3PEVA 3ZS9A 2Y3IA 2MSEB 3FKSD 2W8BA 3Q8XB 2ZR7A 2CXHA 4P36A 5B58C 3UMMA 2FN7A 2YCBA 2VK8A 2G9RA 1U2DC 3D3WB 1OI7A 1ZLXA 4RF2A 1O94C 2RGNC 3C8DA 3WP0A 1X3SA 4MWEA 1PFGA 4LGMA 1QKKA 3CNNA 1FNMA 1V43A 4G4GA 3BOSA 3QNWA 1KL7A 4I4TF 4CODB 3FMIA 3U7GA 2DECA 4E5KA 3TW8B 2JGFA 2VYVD 2WPDD 3GCZA 1Y6QA 5U4XA 3MWEB 3FGPA 4I3HA 3S2IA 3AB3A 3PFNA 1I13A 3H8VA 4HUTA 2N46A 1W29A 1SD2A 2D2FA 1PK9A 2HSZA 3VSDA 1BDIA 5BV2P 4BAGA 4D3XA 1NXSA 2B30A 4X1IA 1NBMD 2H2FA 1UPAA 4NXNB 3DGEC 5BV1A 4TKLA 1SBHA 1DOAA 4X62B 2QE7D 1EGVB 1PX2A 1Z8FA 2W83A 4QHSA 5JQGF 2FOXA 4DCMA 1T9CA 5IK2A 1PU2A 3RSQA 4MUFA 5AOVA 5AKHA 4ZKDA 2X19A 3I9NA 1FFGA 3JQGB 4JI2B 4WJZA 1U2DA 3CNBA 5FLYA 1XZ8A 4DAEA 1CR1A 1K75A 2XCQA 3DTVB 1HBJA 1PFVA 4CM8A 3S8YA 2AOUA 3BE8A 3OZRA 2NV0A 4WFKA 1GNVA 1VCOA 1ZK1A 5E2BA 1R6TA 5EJ9A 1UKEA 3L8CA 3AESB 3CB2A 1S1MA 3H0EA 2QMZA 3PHBE 1AKTA 3BMQA 4AWBA 5JFGA 3HY6A 2JLUA 2KLHA 5EHXA 3DG9A 1IJKA 4EHNA 1JBKA 2GBLA 1U3VA 1RQ2A 2GTIA 4AY2A 3KOMA 3FH0A 2E1RA 3HCAA 4RYLA 2VYNA 1XZCA 3T3EA 4CKCB 3RTGA 2X0IA 3A9SA 3RAGA 5KYTA 4WESB 2CXRA 2R62A 2BFFB 2C4UA 5DEOA 2FPUA 3BRCA 4LYJA 3UGKA 1VKJA 4CV3A 2RGCA 3C7TA 4K3UA 1KAOA 1WXHA 3MLBA 2PG3A 1XG5A 1KQOA 1LQ2A 2O2CA 1X7XA 3RRZA 3ASUA 1Z06A 5I9NA 4QTZA 5EIXA 1EXDA 1EZ1A 4UTRA 3H75A 2RGEA 3ESRA 1FNCA 3Q0TA 2YV1A 4GS5A 3BXPA 4CU5A 5K5EA 2J4FA 4ZRNA 4YQFA 1XNJA 3IX7A 2BKLA 4IINA 1E6CA 1MN6A 4ZGBA 4D98A 2X42A 5E4FA 2HBQA 5J2TB 3B78A 1TW3A 4PN7A 1BHQ1 1JDBB 2XKKA 3P0EA 1JF8A 4N40A 1Z0KA 3HC7A 1SH7A 1US8A 3HLYA 1TZCA 1BXZA 1A4UA 1UBRS 3OFVA 5DBGA 1M33A 5CX4A 3OF5A 4D6YA 2JASA 3H5WA 3JR7A 3NKFA 3EQ9A 3AM3A 5JJCA 4YP5A 4L08A 5TQJA 4BQEA 2AHRA 5E6RB 5A3VA 2PA0A 2HA3A 4O4IF 4E1BA 3SD7A 10MHA 2P6OA 3ZGOA 1QRTA 2HTFA 1UXKA 1DAEA 3BRQA 1Q95A 2FPSA 1S02A 2WAYA 2YV4A 2GSWA 4UEWA 3C87A 1X7YB 2VYND 5K3EA 1JPJA 3UJHA 4FNGA 2WJ6A 1QWOA 4LK2A 4B73A 4Q4LA 2IEZA 1FDUA 1XT6A 1BMTA 1NR1A 3SVLA 1M7BA 1M8PA 1HDEA 4D8UA 3FI0A 2BHSA 4HSEA 4JHXA 5HK8A 5BN4B 5T4EA 3AETA 3CEMA 1N2GA 4KGDA 1L4YA 3AHDA 4EVIA 1IPFA 1N32B 3ZGLA 3ANYB 1QK3A 4LXXA 1JB9A 1GXSA 1ZD4A 3E4DA 1N6OA 4LECA 5KWJA 4QNMA 4A27A 4A8HA 1Y3DE 2WIBA 3D2CA 3PXBA 5JADA 2WABA 3GNTA 1IVNA 2BMEA 1SXGA 4GI7A 5IUJC 1FXWF 1IUKA 3QMPA 2FWNA 2ZJ1A 3KFLA 2OGZA 4QJ4A 3CH6A 1WUJS 2PQMA 2I2BA 3DUFB 1P9NA 1WU7A 1YWGO 3BVPA 4V24A 1P7YA 4D44A 3A9VA 3PE3A 3SS8A 3LWNA 3AVYA 2GNAA 4NFLA 2DPYA 3C6QA 4BQQA 4BX3A 4IILA 4BGDA 1USGA 4O4HB 2Y76A 2QSZA 3ZE1B 3TXXA 3LCVB 4CBVA 4D4GA 3GGSA 3N6XA 3EXEB 1GTJ1 3O8QB 4W8OA 3SNHA 4AY3A 3GD7A 2FPMA 4JJ8A 4U7JA 1BX3A 3A06A 1P33A 3B9RA 1QUFA 3EZXA 3FGZA 4EG0A 1CE8B 1P2FA 1JW9B 3FUVA 2VN8A 2ACKA 3GI1A 4O2RA 4ZQHA 2HRCA 2OEPA 1EI9A 2QP3A 4IX9A 4H3KB 4M38A 4Z7QB 4QJBA 4EJ0A 2RHJA 3TQRA 4TTQA 4H1UA 4PLVA 5ALHA 5K6AA 4GOND 1AZSC 1UP6A 2EJVA 2WZDA 4OJNA 1EBBA 2I8LA 2ZTUA 2R7NA 1RYEA 4FMBB 4RFSA 5EKUA 1RJ9B 2MYUA 2PAFA 2VRCD 1B8OA 1K2VN 2OG1A 3WQSB 5JMPA 3V4ZA 3WV4A 3D7KA 1WD5A 2VZEA 5H1YA 1OC4A 1AK2A 3HXKA 3L5KA 1OQAA 3Q7EA 5LUAA 4ZCLA 2BSQA 5FFNA 3UAXA 7GPBA 1V3UA 3W1WA 2BMDA 4AJIA 3G2QA 4GPBA 4IXDA 1FBTA 1JX6A 1P61B 2LW7A 2IZZA 3D1LA 3EH2A 3FSEA 2SNIE 3KL2A 4AJ1A 3K70D 3QVJA 4DLBA 4DPMA 4QPNA 5E8RA 6GPBA 4KQXA 2DJIA 1RRPA 4UBIA 3WISA 4AXBA 1X86B 3LX8A 2LCIA 4BBAA 3ORYA 3HSYA 3TWOA 3UMJA 2Q3FA 3WLHA 4I9NA 2J48A 5J9FA 3QXSA 4WE3A 4M7RA 5F76A 2P9HA 4O2AF 2ZANA 2H0QA 4YMWA 1ZDMA 4KCGA 3FDJA 1GPAA 3SGLA 2RKWA 1DQRA 3PJGA 3N0XA 5KSZA 4TMTA 2JCVA 2YV5A 4IJKA 3CLKA 2ARKA 3PF9A 1F6WA 1T9AA 1X87A 4DXAA 1EFHA 1MOPA 2J7KA 4B46A 4OB7A 3TOVA 4RZ3A 2Y1LA 3Q6IA 4Z0PA 2YY6A 5KKAA 1U1IA 5FYQA 1X1AA 2IYWA 5CLHA 1N33B 2ZYRA 4F9TA 2GI4A 3EBLA 2C00A 2QTLA 3KB6A 2C96A 1E0JA 1WEHA 1EUQA 1P1BA 1ODLA 3KALA 4OXQA 5BMVA 1NU8A 3K0CC 2WJWA 3IAS1 3RHSA 4PIVA 3H7AA 1U65A 4FS3A 4FYXA 1YVDA 2GDZA 1FW6A 3QA3E 1E66A 3D8HA 3ENZA 2HDNB 2CLEB 3LGXA 3B82A 4YP7A 2GF2A 3D0QA 3P9PA 4GECA 2E5FA 3R0QA 4H6VA 4OI2A 3DR3A 3FYUC 4YPVA 4NESA 3NMUF 2C7GA 1L8QA 1IQRA 4DDHA 2ZRIA 1D6MA 4YCSA 5ALRA 5EWMA 1FFDA 2BF4A 4E3WA 1YGPA 5HIAA 2ODAA 2VTBB 2VJCA 4DEVA 1Y4DE 1WY5A 4XPZA 2V8OA 3IBYA 4PO1A 4PQEA 4YH1A 2M6SA 1ORHA 1WQ1R 3D6HA 2E6UX 2H1WA 2Z5GA 3IB6A 3B3FA 1H3NA 2PUDA 3NAQA 4URFA 4CLEA 5JH7F 1GAEO 4QXAA 1CZKA 1THGA 4MLPA 1GPMA 2HZBA 5JAPA 1KZ7B 1K8ZB 3HCRA 3OPMA 4D46A 3P9KA 2XXBA 3EW7A 4UUAA 4YAWA 1E7RA 1KBQA 3L4BC 2EFEB 3ITDA 3O82A 3PXXA 2EF0A 1JJIA 1Y1RA 4MCJA 4MS4A 4TV9B 4WCDA 3WA6A 3ZHTA 5BUSA 2ECKA 4EFLA 1KS9A 3IH5A 4F91B 5CYGA 2QY6A 3N75A 1DFIA 5IS2A 5LA6A 1UDAA 2F8MA 2OB2A 4QGFA 1JXAA 1QH8B 5EJ8A 1J7JA 5KIAA 5FL3A 1KMQA 1L7VC 5CFLA 1W19A 1ZR2A 1Z5OA 3FYUA 2WYOA 3A6DA 4NE9A 4ND8A 2MDTA 5GMOA 1HSZA 3N8GA 1K9SA 2UZ4A 1L7AA 1FIUA 2OD7A 2WSIA 1KH3A 3DV2A 2NZJA 2ZROA 1J8YF 3AF2A 2GD6A 5DT9A 2QD1A 4OJQA 1HG1A 1NM5C 4R7GA 4ZI5A 2R6FA 1PZHA 4C43A 5BYAA 2CMFA 2X40A 3R7NA 5HF6A 1LBSA 4Z9XA 3ASYA 4RKFA 1KAMA 2ZI6A 3A9TA 3HP7A 2CDCA 3HU3A 3LHSA 4JJKA 1TXGA 4J0KA 1WRBA 4ZI3A 1T5HX 2VK1A 1D1QA 4LJ8A 6ABPA 2DH6A 4P4SA 3WHKA 2JG3A 1Y9DA 4J0EA 3EUEA 3NEJA 4N49A 4BEWA 2GD1O 4IOLA 1E1RA 5FWDA 4MKIA 1XDSA 4EA7A 5JVDA 4UHCA 1OB5A 1NVAA 3DUFA 1ODSA 1T15A 5TARA 2ZJOA 3H65A 3M5WA 4OB6A 2TMDA 1NBWB 3EG9B 3QVLA 4H7JA 1GUAA 1Q20A 1TYDE 4CIWA 2MYPA 5KYVA 3RQSA 1N2XA 3DDUA 3FHLA 2ZE8A 1W87A 3B6IA 1T3TA 1VZ2A 3EF0A 5KB3A 3K0HA 4OP2A 3UT6A 3WHLA 3MUOA 5EZYA 1UANA 4HWGA 1CY6A 2C0QA 3LWDA 2YJ6A 4MGEA 2W6PA 5CVCA 2C2KA 2J8ZA 3OMWA 4HEQA 5A5EA 1M54A 4Y6RA 4KO8A 4URWR 3C0KA 1XTQA 3ZDXB 5AK0A 3JYOA 3OO0A 4M87A 3RS3A 5AUPB 4OQDA 2A0KA 5EY5B 4N5MA 3EPPA 3QLVA 1TVKA 4RFSB 1EU1A 2BISA 3BXZA 4LVOA 3E9DA 2AN5A 2JB9A 3WYNA 1YRWA 4TTVA 5THKA 4KWTA 3LUBA 3UQZA 2ZYUX 2A4MA 4A0RA 2QTWB 4F97A 1B6SA 3P19A 1MF7A 3G9QA 1BIFA 2IHYA 1QWSA 2J87A 3KKEA 4WXYB 3U16A 2GASA 1ZM7A 2V5UA 3OO1A 5DK4A 3X1WA 5HNKA 2H57A 2IUFA 5ELXA 3LYUA 4C0QC 1SKMA 4FS8A 1X92A 3IESA 1YASA 2WJAA 3EF1A 1DS6A 3L7AA 5ER6A 2FUG1 1VSUA 1MG5A 1X0XA 2VUTA 1N1GA 4IDPA 4IXWA 4D41A 2CV0A 3BFPA 4F4IA 1QX3A 2EX4A 1FYEA 2H9YA 1LEHA 2W0SA 1RU3A 3A4VA 4JLPA 1DIOB 3AR2A 3Q3CA 3QOYA 5L3SB 2YFYA 5HTKA 5A3SA 3TMKA 3TUZC 1V37A 4L15A 4CV0A 2QTZA 4N48A 2RGRA 2Q1WA 3THWB 1KY5A 1VE5A 4F4CA 3FF4A 1U9IC 2NYUA 3OJ0A 2P9QA 1KDPA 3Q88A 2NQ2C 3NIWA 3N7AA 4QTUB 1W88A 3QFHA 3X44A 5CXQA 4N41A 2F4NA 2G3YA 1Z2EA 2P2YA 4MAFA 4N3CA 2OZKA 1G9SA 2J45A 3T3PB 3HBLA 1NF8A 1N9GA 4NZZA 4D4JA 4EMSA 5I51A 3KHKA 4P1ZA 1ISMA 1RYNA 4QARA 4DG8A 1RAHA 4RV5A 1V48A 2CLLB 2HA7A 2YXEA 4BFTA 1N2ZA 2VZ9A 1RLTA 1RT9A 1ZGAA 2IXEA 2VJMB 2REQB 2W58A 1I7NA 3RJ9A 1XTJA 4EFDA 2CKMA 5ITVA 5GONB 1PNRA 2C98A 3EY4A 3BCRA 1CUEA 2A0YA 2NUAB 1WF3A 4DW8A 2WVHA 3DM5A 3ON5A 3PENA 3WWOA 1KQGA 3OJWA 4E70A 2Q29A 3IKVA 3MJCA 2IOFK 3KQOA 3LFTA 6CHYA 1I2CA 3PT9A 5U9CA 2OCIA 4PSAA 4Z7OB 3G7UA 5GTDA 2Z6UA 2X5OA 2BSAA 4PC3A 5DEIA 2C3UA 5E9AA 1KXJA 1KK3A 3GEHA 3IKLA 4PG5A 5IM4A 3P0IA 4NVRA 8AT1A 2XEDA 2YHUA 3FN4A 3M4YA 2GF0A 4A3SA 4RMNA 4D43A 1VPTA 1RQLA 4RZSA 3W9UA 1LBQA 2G1UA 2W2PA 3DBLB 3BXEA 3JQ8A 4NCJA 1PW7A 3EIFA 4DUYB 1BQEA 1MPTA 5AJWA 1N0HA 3AKCA 1M6VA 5F9HA 3OMXA 3WE7A 4AIIA 1QGAA 4HDKB 2PL9A 3OU6A 3B6EA 2FFQA 4KPGA 3KVOA 4OV6B 1P29A 4MKGA 4RX1A 2IU3A 3WXMA 2UUBB 4A0FA 3K0AA 3P4YA 1RSZA 3COYA 1FMLA 3ENNA 4KW7A 4YHHB 4FCWA 2IW3A 2B7LA 3WHPA 2X14A 1KYXA 1UPUA 3EMBA 1E2QA 4Q0MA 3RBZA 3WBBA 4MP8A 3FVVA 1CPYA 4F5EA 1YKFA 2HMVA 4Q7JB 4P58A 1MC8A 1NVEA 1B26A 2GRAA 2ZULA 2JVIA 1MX9A 3ZIUA 1P4RA 1KWKA 3T3OA 1OFVA 1QAMA 2JGEA 1XCPA 3ICCA 5I5GA 1T6XA 4ZCTA 1C9DB 2KWIA 4B5LA 1IUPA 4GM0A 4P38A 4JP2A 5ARDA 1QV7A 1S2LA 2XADA 4UE3S 4ZODA 1VHDA 2J32A 5FX2A 2O7RA 2II6A 2PKXA 4XVQA 4MRAA 4XQGA 3L01A 1ZK3A 1R4MA 5AOBA 2C42A 5LOVF 3INRA 1Y0BA 3EB9A 3ENKA 1N4AA 4ZZ1A 4TRMA 2RBKA 1PVOA 5BSGA 2VQ3A 4NBSA 3F1LA 3TRDA 4CTKA 5KYKA 1SVLA 2PWBA 2VL7A 3B9QA 1G6OA 1N6HA 4FDTA 4REQB 2B4RO 2OGWA 4DAOA 1TAGA 1XNGA 3BWYA 3QYJA 1L4BA 1YL6A 2VRWA 1QJ4A 1E8MA 4R40A 3HKCB 3ESDA 2BEJA 2J3HA 2WF8A 3I9JA 4R8VA 5FRDA 5TY0A 5IT5A 1NTRA 1YZGA 2A9FA 4HNRA 3K0FB 3W7AA 3PTAA 5BNWA 1XL1A 3DBIA 2JIDA 1X1DA 5P8WA 2I2DA 3K8ZA 3ONEA 5TS3A 3IXMA 1QC5A 1DBRA 3W3AD 3NS7A 2QF7A 2NZYA 3QBEA 5E6RA 2FWBA 4QT0A 4RH0A 4XPIA 5DHAA 1GZ6A 5BQXA 1ODIA 1DAKA 1SU6A 1X1CA 1JR2A 4C3UA 5CCEA 3GRCA 4R2MA 1XU9A 4K9RA 1YJBA 3SLKA 1HE5A 4OHRA 4WKPA 5AW5A 3IEVA 2OYRA 1ZMXA 3QKWA 3HGTA 4LRSB 4MKRA 1Y4SA 3FPJA 1DXOA 3LBAA 4PINA 4TS3A 5HFAA 3WNZA 3IRUA 3LUJA 4OMFG 4ZRDA 3Q8KA 1ESZA 3SXUA 4RHYA 2QLTA 2WYHA 1NLUA 1E9FA 4CL8A 1CUYA 2I3DA 2P6PA 3ND9A 3AXTA 1MOSA 2XUIA 2F90A 2NYAA 5AI4A 5U1PA 5BV8A 5IT0A 4MA0A 1KZ4A 4PSVA 5ALFA 3C1TA 1AS0A 4O2LA 4AJOA 2WMNB 1SQFA 5ICCA 5ALKA 1I4WA 1AMNA 2J0VA 1K5PA 1UT6A 2X8LA 3B12A 1L6RA 4L6IA 1JQDA 3HB7A 2JFVA 5AI6A 5CVUA 1KZ9A 4HGZA 4WY8A 3D4NA 5F78A 2SBTA 4BJ5A 1PHRA 3DCNA 4UVIA 4E3ZA 3J7TA 2GHIA 3U4AA 4A8JC 1XD9A 1YMVA 1WPRA 1O6FA 2GEBA 2J5RA 3CJQA 5HBRA 1HSOA 1NWHA 4OD0A 1YDGA 3VVBA 2O4CA 1G2QA 3IMEA 1TZ2A 3G8AA 1EBUA 4JL6A 4DWVA 5AUOB 2C59A 2I3AA 1R5BA 2QUZA 4MPRA 3E5MA 4C4RA 4HQ0A 5TT1A 1GDDA 2E89A 1F6DA 2PMWB 3CNQS 1JFSA 1QE5A 1XYVA 6LDHA 1A2QA 1PYDA 2GGSA 2RH4A 3D6FA 2O2JA 2WF5A 3O1LA 5CDHA 3WOVA 2DAPA 1N6IA 5LQKA 3FOEC 3GPLA 3WL7A 5T7BA 5KJEA 2BGWA 5LQRA 5I7OA 4UHHA 4RVGA 1G64A 2BH9A 3LLCA 4KGXA 5EZSA 2A5LA 1UZUA 1HFJA 2R5WA 5EZQA 3B9PA 1SCJA 3A6ZA 4MTCA 3OZDA 3SDZA 3W05A 3LT1A 3O1HB 1LLDA 2NGRA 3I6QA 2QDKA 3OAAD 4ZAFA 1RKQA 5FR1A 1E2DA 1Y1KE 3NANA 4F3KA 3BFVA 1GGNA 3DE6X 4FXOA 2EV9A 3KAKA 2BUAA 1Z6GA 2QLNA 3GVCA 3PQ2A 3QBTA 4FK8A 1KJ8A 2AC2A 5AQ1A 1B23P 2O8CA 3W5AA 4L5AA 4YJ3A 2TECE 3V6MA 3AI3A 5CVDA 1GZVA 4CIBA 4CL0A 3L07A 3M33A 5G0WA 2E82A 3ZQUA 4BB9A 2Y1WA 1YU9A 4TTSA 5DWVA 3TZCA 1M2HA 3RSOA 4Z53A 5CU7A 4KE8A 3ZKWB 3UJAA 3WLTA 2F8TA 1A0OA 3UC5A 4XYLA 3LDFA 2C5LA 2DR0A 4ZO9A 3W1VA 3V4RA 1C1DA 1J9EA 1MVNA 5G1OA 1C9EA 3KQQA 2QTCA 2FPKA 1Z73A 2AQKA 1COWD 1V9SA 2XYVA 3CN7A 3EEYA 2I3GA 4UC0A 3JQ9A 2KW5A 1ZLYA 3PKIA 4XX1A 1K6XA 2W2MA 4ODIA 3WB1A 1CTQA 2F3TA 1XMJA 1KA9H 4QDUA 4MP6A 2KS6A 4N7MA 1QRRA 4S12A 3ECAA 5A62A 4ZK6A 2N1MA 3OM9A 3UHOA 3KVVA 5BMVB 1J8VA 1SD1A 2Y9PB 3DE2X 1KC3A 1LRLA 4JH0A 4NX2A 1OZAA 3GEDA 4OEHA 2IYEA 4AZ3A 4DDUA 2Z6QA 4JVSB 1QOPB 2G77B 1QDEA 2G40A 2G0AA 2X8JA 3DLAA 1O6BA 3PZRA 4X92A 3IQZA 3UGJA 5KWEA 4KDRA 5CLIA 4X84A 4NMWA 2BM1A 1NQUA 3FJYA 1ODKA 1NXVA 3RC7A 1LK5A 1NTOA 3I83A 2GXAA 4LHVA 3SDSA 4ZI7A 3BKWA 5JNTA 5KNCH 4DY4A 1NAHA 4BIMA 3PA8A 4P5PA 3ZLUA 3X2FA 1MEOA 2GFIA 2IELA 4BQRA 2XDAA 5EE3A 1UXJA 2XVXA 2C4TA 5AM5A 4YRSA 5I47A 1AKUA 1GAQA 2N42A 4A1OA 3ZBQA 3JD2A 3JVIA 3VYVA 3IP7A 1D2EA 1NUHA 2FR0A 2V7EA 3DE1X 4GQAA 4A7PA 4EWLA 2IHZA 3IBGA 3K4PA 1U80A 3BILA 4QL3A 3LCRA 1RKXA 2DPXA 3AK4A 3VDQA 3U1TA 4C5BA 2JAHA 3L8MA 3UK2A 4QUIA 1QVAA 2Q9CA 4JR1A 1AUPA 1ZYUA 4XVRA 4IHJB 3TMAA 1SOWA 2HL6A 1V9LA 1K7SN 2IY8A 2OFFA 2IX3A 1LBEA 4CQLA 4NF2A 3ZVNA 1SBYA 1VJ1A 8ATCA 3Q40A 4Q1FA 5DN6A 1CLUA 1IN8A 3JQEA 3ZN2A 4YRFA 3ZJ4A 1I01A 2GK4A 1L4FA 1TO6A 5HRUA 4UD6A 4BWGA 1YC5A 3RC3A 1E2MA 1AMUA 4FFMA 3K9FC 1HKUA 1NX9A 2WUGA 4E22A 3PNPA 3GT0A 3K2BA 3X43A 3ZC3A 1E2HA 3AKYA 4F5DA 5D01A 3KTOA 3EZGA 4UVGA 5FLXA 3CBGA 2HGSA 2OFXA 1D2AA 4MAAA 5C32A 2G6BA 1YVRA 3KXKA 4C5AA 2BVNA 1ODTC 3ZHQA 1J4AA 1Y98A 2CDRA 2P3LA 4P4SB 3TKLA 1YQTA 3REOA 5K03A 1R8YA 2VI5A 4GEGA 4AJNA 3PGKA 1U3WA 5KKCA 1L7DA 3J81k 1R1DA 4XRGA 1YRQA 2VAXA 5KOJA 2WYVA 1UBUS 4BFCA 1I4LD 3TL3A 4B6QA 3RGGA 4H0FA 3NHSA 5IKMA 1Q7BA 2RC6A 1Y34E 3JPYA 2H1RA 1I3NA 2XTZA 4LE2A 4XIYA 2ZSEA 4GKJB 1PSDA 1MHTA 1YHYA 1S7CA 3P7MA 4Q3LA 3GJYA 1DT3A 2ZJ5A 1XQ9A 4LF9B 2NM0A 4ZZ2A 5FPSA 3DV0A 5FBVB 3KU1A 1XYYA 2BTOA 2H8KA 1ULSA 1UIMA 2QORA 4HWSA 1SVIA 1CDDA 1ATZA 3U5ZB 5AHXA 1X8KA 3KHUA 3SF8B 4ZARA 1TYCA 2AJTA 1AA6A 1J07A 4BB5A 3M4XA 1A2BA 3DAOA 4B71A 2XE7A 3A4TA 4C29A 2X4DA 2HY7A 2O6LA 5I8ZA 2WR8A 3ZK7A 4HATA 4CCSA 1ZJJA 1ZIDA 4JVNA 1E1CA 1P5FA 2ANCA 4S1NA 4EHLA 3WIUA 3X1JA 1HPLA 1ZN2A 4ISBA 1J8FA 2DE0X 1TB4A 3GG9A 4M9SA 4MW7A 1WUHS 4WZBE 4YT5A 3U40A 3R9KA 2O8CB 4AZWA 1L7XA 2GEDA 4J0JA 5CURA 2PZ8A 4YDSA 2OHXA 1XUOA 2VHYA 2IITA 3KQPA 3NI2A 4RZIA 4Y9TA 5IUNC 2J4CA 3CX6A 1E6LA 2UKDA 2IV7A 5HRAA 1K68A 1R16A 4ZCSA 3ZZUA 1EVLA 1U1FA 2QW8A 4X1KA 2EZTA 1PGPA 5ILGA 3M1AA 2D0DA 3RK1A 4JLWA 1RXVA 1W0JD 1I2BA 1VI2A 2H6EA 4M83A 5AKGA 3FI9A 3IQGX 3OICA 3IV6A 3P9RA 4RSRA 5GJWC 5TQVA 3LUAA 1NDUA 3EWIA 3OLYA 2MIIA 5D1NA 1Z4LA 2AFHA 5I7AA 3ZY3A 5IJZA 4RL4A 4OYHA 5BR7A 1XZPA 4R5HA 4MDHA 2EWMA 1IRIA 3I01A 1K8YB 3OIWA 4I19A 3UHPA 1QHXA 3KLMX 2C7BA 3VV2A 5KS2A 1MU0A 3EZLA 2AVNA 4ZT4A 5K6RA 3P1JA 3Q2OA 4KXFB 3X1MA 4EB8A 1OB2A 3E3AA 3TD6A 3K6RA 2WY2D 5KTYA 2ZG6A 4B6PA 3MFYA 2JANA 4IJ5A 4IDHA 2IPOA 3EY9A 2RH8A 5FBQB 3G82C 4N47A 3CE9A 4EX7A 2A1TS 2JZNA 4TV8A 1FX0A 2ZIZA 3BAZA 1U2EA 3PUZA 4J8PA 4OGKA 4WDQA 3RJTA 2C4HA 3FNRA 3HGMA 1EFPB 3QVSA 4GGPA 3TLGA 1H69A 5G1PA 2AHOA 5K0BA 4DB4A 3HL4A 1B6TA 2D1SA 4G25A 4NATA 3UJ9A 3R23A 4W1SA 2XNDD 3EQ8A 4BZZA 4HJXA 3ZVRA 5A0VA 1TE2A 2HSJA 3SJCA 4CCYB 3C7CB 2BBSA 3KOYA 3OCVA 2F43A 3DTTA 4JQZA 1WW8A 1TQ2A 5G0SA 3IAXA 2BKVA 4IFEA 3W8FA 1S2GA 5AW6A 2HFJA 3TSWA 4CUKA 8OHMA 2JAWA 4CR8A 2ZZNA 1V1RA 4ND5A 1KK2A 2PUBA 1ESEA 2O5VA 1ADFA 1ZAYA 3G2KA 1BQ4A 1TYAE 3W5VA 4BGIA 4L6CA 4ESHA 1RWNA 2MCFA 2MOKA 4CF3A 5KX5F 3G68A 1I7SB 4ES6A 4O0LA 4DMGA 1AHIA 3BE6A 4JSYA 2CXPA 3BDIA 4GU5A 4Q12A 3VHQA 2OO5A 2EFCB 2LGJA 3H86A 5BV0A 4X6UA 2VFAA 1UMCA 2R11A 3LQQA 1JEOA 4G01B 3WSVA 3V8QA 4DLKA 6REQB 4CMKA 1R8XA 3OPVA 2JLWA 5EFOA 1CY1A 1LWNA 1S0UA 4R8MA 4YT2A 4IJVA 4L07A 3L7CA 2C54A 4EJSB 3HDJA 2O7NA 3OT4A 2PKEA 4X85A 2HU5A 1GZ5A 2DSNA 4WV3A 5AHKA 3KYIB 4BQPA 2OPBA 5LU8A 1EFVB 1TPYA 1HLPA 4DA4A 3AM1A 1D2CA 1M10A 3FNBA 2H29A 1NMZA 1XFAA 2QD4A 3HV0A 4GBJA 1YBMA 2F3PA 4D6PA 1L7RA 1VBFA 1XHLA 2X3YA 1YTUA 2WF9A 1LVUA 3R44A 2PR2A 1ZPDA 1CJTC 2OHOA 4TL8A 1YI8A 3F8TA 3T5BA 3V4FA 1GDHA 5JNVA 1I4TD 4Q4HB 1BWRA 5TF4A 2CFOA 4V0LA 5FBHA 3JAWB 4F2DA 5ALJA 2IWHA 3PEYA 3ONDA 2CVFA 2X3FA 3DXZA 4IXMA 4F9GA 1WM1A 3PIRA 3AU8A 3RUIA 4BKOA 4YRAA 2HF8A 1SJ9A 3CSUA 1ZEMA 1GADO 3FNFA 2JKYA 4K6OA 4NK5A 4FI3C 4NYJQ 2TMKA 3A1DA 1USUA 3BMNB 1YV9A 2WUFA 1H05A 2BEUA 3UO8B 3C14C 4OGFA 4EW3A 1GKKA 4UTZA 2OBBA 2OGUA 1N0VC 4UHBA 4NBWA 1QKJA 3GVIA 1QC5B 3IO3A 4BB6A 4Z4QA 1LV8A 3V8EA 2BHNA 3GLFE 1O95A 1J0XO 2AZDA 1OCEA 2Y05A 4OQLA 2WG1A 1Q1AA 3C6YA 4AJHA 1FQWA 1VSVA 4B0OA 1FMCA 1OZ0A 2P1DA 2QA5A 3P9NA 4FW9A 5JUWA 1RXWA 1PR3A 4C0HA 4KVFA 2X0JA 3OU2A 3HVUA 4GR5A 2I7VA 4J1NA 3HQ4O 4DM3A 4C01A 3OG9A 4Q4CA 1HO3A 2FSSA 1ZJ5A 5CYFA 5ALOA 4LQDA 1QOQB 2B25A 1RYDA 4KSBA 4OA5A 3HZRA 3PDIA 1EE9A 2XUPA 3U3DA 1IONA 2J85A 4HXYA 1JPVA 3ZKAA 1MIOB 3F5QA 1EWVA 3Q1KA 3NRCA 1KFEB 5KI6A 4L72A 2JVKA 1KDZA 4XVCA 1M2VA 2JEOA 2IV3A 4CQMD 4CEHB 4X7RA 1QZUA 1APBA 4KH1A 4GVLA 1JQAA 2ZIXB 1O54A 2C1EA 3I8XA 3QQ5A 5BPHA 4N5HX 3I6BA 2B0CA 1C41A 2FEKA 3KXLA 4X97A 4LVCA 3T1QA 1NVDA 1Y8QB 4EY6A 1M1NB 1A8PA 4V1CI 2C7RA 3DBRA 5FOUA 4JP1A 3UV6A 3GL9A 4P3PA 2FZEA 5CAEA 4HWPA 1JNYA 1Y3IA 4GXNA 3HCDA 5DI9A 5HS6A 1JXQA 2H11A 4XUCA 3JASA 4XGKA 1M7GA 3ZE7A 3CT6A 2QOEA 3UF0A 5C4GB 2KB0A 4OUKX 4W5QA 4PYIA 4YXWD 4CXMA 3R3YA 3JQFA 4JNCA 5HQJA 2YIMA 4GZ3A 3FLEA 4GH5A 5DOVA 3M89A 2PUEA 1ZM4A 1L5SA 3IHKA 1UKCA 1GGMA 3EOZA 3IVRA 4DYHA 4ABTA 1X7WB 3EEBA 1F8YA 2OV1A 3W90A 2GXQA 1ISFA 5LC1A 1E79D 2BR4A 1RYMA 4ZI7F 1Q7GA 5KTRA 4Z4IA 1OUMA 1R10A 2WPDA 1RXUA 2RHRA 3LRPA 2XGMA 4NS1A 5GADl 3WMFA 3E1KA 2BUCA 3B1YA 3Q4GA 3S44A 1H1TA 4BNDB 3FTPA 2XOKA 3NTOA 5GONF 1HV8A 4ENPA 5JYDA 1ZSVA 1HQDA 2AYYA 3C3EA 4C20A 3VR2D 5TQ0B 1ZH4A 4KFTA 3DE4X 2HWXA 4BHTA 3I9V6 2I9KA 2J33A 1UBSB 1QJCA 4R6XA 2GK3A 2H16A 1G0NA 4OKNA 4YBZA 5AJZA 2WIAA 5AUNB 4B6EA 4N7JA 3VYUB 2RI0A 3DLIA 3LX4A 4K8RB 4EEZA 2GPTA 4KKVA 1EBFA 3TD2A 1OJLA 2HPZA 3BB4A 5LZ4A 3ILVA 3NDBB 4LQ4A 1KJZA 2CBGA 3L6UA 5A7HA 2LRHA 2FPRA 3FF1A 4IHJF 3N6VA 5EEHA 1Z25A 4HDRA 1KAEA 1JG7A 3BJIC 1BRTA 1FFCA 2YBEA 3C4QA 1N2HA 3JALA 1S2DA 1DX6A 1ZK4A 4EI9A 1RHJA 4RLQA 2C07A 1C7RA 4G37A 4LYEA 4GLFA 3UA4A 4C22A 1JVBA 4ND1A 3PPYA 4V2IA 4G1FA 3DEYX 1NW6A 3NWEA 2ZJ0A 4LS3A 1E9VA 2QJFA 3ACBA 4PTLA 5FNVB 3RWOA 4FZVA 4MQMA 3U7RA 4ASUA 4YMUA 1AUVA 3SIXA 1MT3A 3GUZA 4RVNA 1KQFA 4ZVUA 1ABBA 3M9WA 4PTZA 4YVFA 4EAQA 4EJSC 3AUJB 3Q7PA 4CEJA 3VU9B 2B3DA 2DWPA 1AOXA 1RQGA 2R6GA 1ENYA 1ULAA 4BWFB 3HYCA 4XYMA 4J2TA 3AOEC 1P62B 3D8TA 1IZZA 3AL2A 4R3WA 4JUIA 1XOIA 3FYCA 1D2GA 4KXLA 3WGVA 4BFYA 2V7WA 1DBPA 5JXHA 4C2AA 4NYIQ 4OX9Y 3KEOA 2JA1A 1YR2A 3OZEA 4PNPA 4ZVTA 1U02A 2E37A 3K1AA 4Q93A 1JDPA 4V1CB 4LBZA 3U3JA 3D3QA 4HX5A 4QFBA 2ZM6B 5JC1A 1JAZA 3HCCA 1J2EA 1OAOA 2HA5A 5CT9A 3H6KA 1H0SA 1E94E 4QVKA 5C81A 3A1EA 4TLCA 2M2IA 4UTXA 4DJDC 4PC6A 4ZT5A 1QVWA 4F4FA 3TECE 2O8BB 3L8ZA 2QLMA 2ZK7A 3JAWA 2DXIA 4DHWA 2A94A 5TX7A 3MWEA 4PQGA 4ZJYA 3FTEA 3ILSA 3ZDAA 1SKAA 4D9KA 1DAOA 4YCBA 2QL7A 2ZE6A 3TW0A 6Q21A 5I6DA 3EWNA 3MTQA 4WFQA 3SKYA 2VTBA 3B48A 1OMOA 3EVCA 3RS8A 1J7KA 1ICIA 1P1CA 2O6HA 3JXEA 5FA6A 3O90A 5KYXB 3GEBA 1Z33A 2GEVA 3NTQA 3NC0C 1XTBA 3EHDA 4KBFA 4L02A 4E6PA 4F60A 3QW4B 5KQMA 2FXIA 2HMSA 3EC2A 4P98A 2DPMA 5B2EA 5J4VA 2G5CA 3BJMA 1N5MA 2EF1A 2IDMA 1S2MA 1SU7A 2RGWA 2CNWD 2VF7A 3N2GB 4E31A 4DDVA 1B1AA 1RPAA 4KUGA 3E6AA 4LDPA 2QUBA 4NBTA 1BOOA 3LT0A 2FPLA 4CG0A 4D5EA 2EW2A 1V5IA 1XZAA 2G9UA 2YFQA 5K20A 1X42A 2Z56A 1B41A 2AN3A 5J63A 4YV1A 1FP4A 2IYPA 2JIPA 3OQPA 4I1RA 1LSOA 5HUJA 1KKUA 4ZU1X 1E3LA 4E21A 5K0ZA 1OKKA 1GCGA 1SUPA 1L4EA 3FWPA 3GP5A 3KTAA 1T5IA 2OMKA 3N8IA 5LOVA 2X41A 4WLFA 1BH6A 5DM0A 5M04A 5HCUA 2IHBA 1D4OA 2DFPA 3QXJA 4IVQA 5EIFA 3RC9A 3W6NA 4C4YA 4QWMA 2ZSIA 2FMTA 4LKRA 3WJ2A 3NHYA 2NSYA 5FOSA 1U0SY 5F5LA 1EUCB 2VQFB 1TJNA 1G7TA 1TK2A 1PKEA 2F1JA 3S2ZA 5L7WA 3QE0A 4DJAA 5GZ1A 4ENVA 1KI6A 1KGDA 4WEQA 1RZRD 3O4GA 2CGEA 2D8AA 4ZO7A 3IOEA 4KR0A 3WGTA 1GQQA 1SBZA 1G5IA 1Q74A 3OSUA 3MD0A 3RVSA 4WGGA 1E58A 3K9GA 1X7WA 2O2DA 4R2JA 4WW0A 4RF4A 4KQFA 1UOOA 4UBLA 1EK0A 3C3JA 3ZBPA 2WYWA 4M0MA 5CJJA 5B2FA 1MV5A 2Z5FA 1FFSA 3I2IA 1BJKA 1Q6ZA 3QSGA 4OP1A 1EE2A 1W49A 2PY6A 3QFRA 4XM0A 5TE9A 4NFSA 2ZIFA 1GPNA 1I5EA 2DKOA 4RCYA 2O9JA 1N8TA 1DT5A 2OGSA 1U8UA 3MCVA 2G1JA 1HT1E 3RI3A 4ZT2A 3U3XA 1J25A 4X6LA 1B0UA 4AMZA 2X7HA 1V9CA 1XRSB 2WP0A 4JL8A 3VHLB 1CD5A 1LF5A 1UPTA 2VUUA 3R2JA 4Y1GA 3GJ6A 3R6TA 1AKYA 5EG5A 3KT6A 3PLRA 2W42A 2DX7A 2G17A 3PE6A 2C94A 4LJ7A 2IW1A 4I4LA 4UM8B 4ALKA 2WTXA 4IQGA 2FFRA 2NQ8A 1OWLA 2ZU6A 3KCQA 2QXTA 3MIIA 5IMSA 4FP9A 1KZ6A 4L8FA 4DRXA 2ZDGA 1DX4A 3UVEA 5CYOA 4B3RB 1E18A 2HGZA 4N0MA 2ATIA 4KVGA 3TW6A 3BRWD 1KIMA 4ZOLA 4IKEA 3DULA 1PS0A 3GAAA 3IPAA 4QUBA 1GJRA 1G98A 1QHSA 2K2WA 3N2KA 3NR2A 4KGZA 4RHEA 5EP4A 2XRZA 1RLOA 2XEXA 4M55A 1XTRA 1QK5A 4JXZA 5IABA 5BSVA 3FB1A 2PU7A 1UM9A 2JK0A 4YREA 2F00A 4FQ5A 5CG1A 2NLOA 1OI4A 3HPRA 4HDSA 4YJ2F 3V1NA 2QY9A 4MA5A 3OTWA 1Z8HA 2HQRA 1RPJA 4MW0A 1ZW6A 4LGCA 4TN1A 2BFPA 1L6IA 1JZTA 1NOKA 2EFYA 4NNPA 3WAGA 3BCHA 4NCHA 4CV2A 1XEXB 3OVMA 1ULHA 1V4NA 4G56A 2XGOA 3N28A 2QLBA 1XRRA 4KRXA 4YLEA 1Q2XA 3RAJA 4BGUA 1Y33E 3N0TA 3HG7A 3WYBA 5C4MA 1YQ9A 2WHQA 3V4OA 4BE4A 5CB8A 4ZTZB 2CUTA 2QRHA 1TJ5A 3PEEA 4PWZA 4WZBB 3PGVA 1KE1A 3T4XA 3WWYA 1YJCA 3U26A 2E6KA 4A5OA 2MSCB 2EARA 1CNMA 4M9UA 3S29A 5CBPA 4TWJA 1DKNA 1TM2A 5GJBA 5CDFE 3GLHA 3GQBA 3K9HA 5LBUA 4DIBA 5A9RA 2RHGB 2I87A 4Q37A 2VYQA 1ZZGA 3ZD7A 1MVLA 1KF0A 4K88A 4B40A 1I2ZA 4WKGA 5DHFA 2J9YB 4V0ME 2C9YA 3HN7A 3RT9A 3JYLA 3KKLA 4TX1A 4V03A 3LUKA 2Q4OA 1KYTA 4YONB 3UWDA 3WK4A 5IFLA 2J09A 2EERA 1GNRA 4S2UA 1WB5A 3VU3A 3GEGA 1CQWA 4DLXA 3F8SA 5EUBA 1WDWB 3CWZA 1NI4B 1VDMA 2C9OA 4UMVA 1L3BA 3H2HA 1ZJ4A 1V11A 3JWHA 3M6FA 4MIKA 5JOQA 2GEJA 3GZNA 3D3KA 3CZ9A 3NUZA 4H60A 2Z4TA 4QGHA 3B1FA 4MGHA 3GY0A 4WSOA 4PBSA 1HTWA 3SHWA 3D02A 3HJRA 4HFMA 3BQNB 1VP3A 3O93A 4MQEB 1FU8A 4G5SA 2YR0A 1M67A 3DS8A 3IAUA 3QWFA 2SECE 2AI2A 1AN0A 1E2PA 4C2TA 4A8JB 3TINA 4XWOA 5AW8A 4RV4A 3GGOA 4QE3A 4XYEA 2VBIA 5DRTA 5CMLA 2HB6A 5BNZA 2HPHA 3K53A 4GWLA 4PNZA 2JGMA 4YK7A 1K4YA 2GJAA 4I8XA 1M1YA 4RPGA 2GFHA 5A6VA 3AHGA 2QTFA 4QQFA 2ZZMA 1FFWA 4K28A 4G1MB 2O0MA 5DOZA 3LJKA 3TZQA 1UWCA 2CFTA 2GVZC 4K1LA 2HN9A 4LVNA 2KX7A 2QR2A 2X0NA 2DPGA 1OZHA 2FKAA 3AJAA 2FLVA 3C4JA 1NY5A 3ZY2A 5TNXA 1PR6A 3G2NA 3UT5B 3V3KA 4ARBA 5H02A 1E7MA 2XJ4A 4GLJA 5KX5B 3QEJA 2C4WA 1VYVA 5IEJA 3OLXA 1EFRD 2VP6A 1KFJB 3KAPA 1UBFA 4ITRC 4NZPA 5F2EA 4CM1A 1IXSB 1YB1A 2GN2A 2IXFA 2CFCA 3L06A 4IIXA 4DIDA 2O54A 4PO3X 5K3SA 1KAHA 1TTTA 2PLAA 2RKOA 3DWFA 3I23A 3TUIC 3PICA 3GK3A 4BTEA 3GJ5A 2ECQA 3AY6A 4JCOA 4KO3S 1B8PA 4L4YA 4PONA 3I58A 5DM60 4GPAA 3WLOA 1G8SA 3E7WA 3FNEA 1XMSA 4ZCPA 1K3FA 1EGMB 1N5JA 1V2HE 2GJ9A 3CONA 2HUPA 4EB0A 4MGZR 4WCFA 5AVKA 3IIKA 2EHDA 3OZCA 4ZOAA 1A76A 5FPPA 5J59A 5JZ9A 3QVGA 3VNAA 2O2SA 3MHPA 1H42A 2VS1A 2XWQA 2VZ0A 2W6CX 3D6MA 3QITA 4KHZA 2O3TA 4KXNA 3ZQ4A 4EFKA 1B2LA 1G8HA 2C2YA 1XVAA 3FMPB 3OIYA 2GMWA 4IUDS 1EFUA 3HO8A 4E4RA 1KDRA 1T36A 2Q4EA 2YMQA 2ZT7A 1WMEA 2PTHA 1QTNA 2Z09A 1BN6A 4KBGA 5AMXA 3BCUA 4X63A 1H1LB 4EHBA 1LQUA 3VHXA 3U5TA 1O0CA 5DTMA 1NZDA 3QTLA 4I1SA 3UXMA 1EM6A 2QTVA 4MV6A 2YH2A 4U6QA 5EJGA 4EGFA 2ZAIA 2CCGA 3W3AH 3V1TC 2RK3A 3C6XA 3JZDA 1VG8A 5HF5A 4X00A 3SSNA 2I4OA 3KD2A 2XXJA 3WZ2A 2YKGA 4E5VA 3DWGA 1ZA2A 1QU2A 2AKYA 2BW0A 3ELYA 2AXQA 4M1OA 3QU5A 4CTOA 3W5HA 2NUPA 3G1WA 3TB4A 2I6GA 2F55A 3IP3A 1YD7A 3AG5A 3MUFA 3TRHA 4E30A 5C18A 1W5AA 3IP1A 3EPKA 1QFMA 1R9MA 2B92A 2CEKA 4RENA 2YWXA 4JVMA 4L50A 3KYCB 2XXAA 2DUWA 5LD2B 3OX4A 2OZLA 3TBHA 5JWRA 4H27A 2J3EA 1ZICA 5IJAA 4F6RB 5L45A 4HEJA 1OE0A 2D0OB 1ZU4A 4K6FA 1SCIA 1LK7A 2XA9A 4B31A 2QZ9A 3UENA 2GFQA 5BW8A 1WOYA 5CH8A 2ZSHA 2PQ0A 2HLHA 1S5PA 3WTCA 4W5JA 4P3XA 3DZFA 2E4WA 4K6MA 1TU3A 1TUBB 4BKRA 1P4HA 3D8NA 1X7ZA 2GF9A 3EZYA 1TT5B 3D5TA 4BUJA 4K9SA 3MJDA 2I8CA 5HZMA 4ZVSA 1J0BA 4GYKA 1UR5A 1QLHA 1E4VA 1NKSA 1RZVA 1U7ZA 2H3HA 2ZAYA 4OOEA 3V8BA 3H5TA 1PZMA 4E09A 2MINA 4PLTA 4B45A 4YAGA 1Y7HA 2P91A 2V3VA 5FR2A 2AWOA 2NG1A 4KPUA 4KXMA 1J9ZA 4NMXB 4ZEOA 2TMYA 4MMXB 2Q46A 4RIFA 3RYFB 4XWWA 3OQOA 4L28A 3A2KA 3EN0A 1SIWA 3HSSA 2IIBA 2V1XA 3U1VA 5JO0A 1YRBA 3IERA 4NCIA 4S1OA 2HCRA 3F5FA 3TOXA 4UTPA 4QDTA 1Y3CE 3KUCA 4MYTA 2CMHA 2O48X 1CJVC 1OV6A 3KEFA 3ONFA 4KO1S 4WKOA 1JL3A 1U04A 4RULA 1II0A 4HNUA 1BAPA 1JEQB 2EP5A 3B53X 3VPBA 3JAKA 3T06B 4QBHA 1V7PC 3M0EA 3QUSA 4RANA 2QM7A 3G2PA 1TCVA 4IDOA 4U2KA 3ZWXA 4A6XA 5L4SA 1GFWA 5E7JA 3DP9A 2X7XA 5FV7A 5JBIA 4L0MA 1HFWA 1CS0B 3TTUA 1U8TA 4RGVA 3VZSA 3WFZA 1DMRA 4QZVA 2I71A 1SFRA 2GHQA 2FW9A 2TYSB 1IPHA 4M60A 4ENWA 5A4MS 5I7FA 2RDMA 2H7XA 1T6BY 3HEMA 5E8JA 5EIEA 1I14A 1TPZA 3A2MA 4V0SA 2HV8A 4YAEA 1TD9A 1ZISA 2GUWA 4NBKA 4Y2GA 5L3SA 3I2FA 3VTAA 5TR9A 1QIJA 3I6MA 3STXA 1NPDA 4WI1A 5K4GA 4FOPA 2BGJA 2XKAA 1EVEA 2GHRA 2ZRDA 3GH3A 1CXZA 2XIQA 4DJTA 1TA4A 4Q1AA 5NULA 1Y9JA 4OBBA 2MSWA 4BVJA 2HRZA 2XE6A 3SQNA 3WDKA 5DBEX 1AKRA 4EA8A 5DTRA 5IYZA 1MPXA 2XB4A 1UJNA 1B3BA 3E58A 3HDQA 1HLFA 5DWDA 5JNWA 1SVNA 4JWKA 3MTGA 3RAEC 4I1IA 3FLBA 1GA4A 3HKEA 5IBCA 1OA0A 4BUCA 3C8ZA 4GL2A 3ZWKA 4ZYVA 5BXYA 3I32A 1U7PA 4CKCA 3GJ8A 5J2UA 1LX6A 1PL8A 1VGRA 2YQZA 4WESA 3K2QA 3T95A 5CD1A 1O0SA 2YWCA 3MRTA 3RBAA 4F71A 1UPFA 1BGVA 4YPOA 2ZJAA 4V1CA 1J1UA 2ZEJA 3O7MA 3OWOA 4B3JA 3K9LA 4GX2A 3D64A 4M2LA 5DXJA 4CT5A 2UV8A 4X24A 4DLPA 4IIGA 5DX1A 3C74A 4XQCA 5H81A 4PAWA 2XQVA 3VH3A 4AC9A 3IXQA 1OFUA 2P0YA 5KU7A 4AY5A 1OR8A 5ECGC 5IK2D 3TUJC 4MW4A 2PZKA 3TLBA 2FSHA 5I9TA 1IPEA 1NN0A 1UODA 1ZD9A 4OIMA 1CEYA 3M1LA 5AJYA 4RVDA 2F67A 1NUUA 2AS0A 3K09C 1JGTA 2OLKA 3D3NA 1RMQA 1DKQA 4D9CA 3DZHA 3C2QA 1FYVA 1Z5UA 2DFVA 4OMUA 1V6AA 1Q91A 5J5VA 3AVXA 1Z83A 4N65A 2ZVDA 3AR8A 4PFSA 5FI0B 3ZQJA 2J5KA 4GGMX 4GVXA 3WK7A 5FPKA 3OWXA 5EN4A 1OLSB 2IPMA 3QIAA 3TL2A 4GWGA 2O20A 2CNLA 1T36B 2VBCA 3D7MA 3HZHA 3PP8A 3UJ3X 16PKA 2BJHA 1T5DX 1A7UA 4QVGA 4UPVA 4PFQA 3O3OB 3T0IA 3N9IA 1XXLA 1TFUA 2XYPA 2YYAA 4DNQA 1E8DA 2M9MA 4G8BA 1PSZA 4M6WA 4N39A 3S5JA 1PWYE 2P2NA 3TDMA 1FP4B 4Z1OA 3TSYA 1QH0A 5C80A 3WJAA 3NU1A 5F1OA 2Q4TA 4EF5A 3DYIA 4PPNA 1FSGA 1DU4A 2PSHA 3V2IA 1HF3A 3MJRA 4B8WA 5JARA 2O50A 3RBVA 1SVUA 1KJ9A 3QNUA 2G76A 2A9RA 1GCIA 3S7ZA 4Z4HA 1J2RA 4MGKR 1FRVA 1Z6YA 1QHHA 1C3EA 5LYYA 1BOFA 4OHVA 3R7WA 1TF5A 3SBOA 1SCBA 2J6HA 3NXSA 4NMHA 1AD2A 3A6KA 3KQSA 5E95A 4L4ZA 3ZDRA 1M0WA 3JYPA 5JH7A 3E9EA 3SP1A 3GRVA 2A1UB 4JV5B 1RQNA 2IU4A 3QUTA 2Z1DA 4NBVA 4O4JA 5IUKC 4JI8B 2P90A 1C0EA 3ESAA 3AR9A 3QP9A 4I08A 2ZIEA 4NAVA 4P34A 4DLNA 4IOJA 4ZEVA 2OBXA 3HR7A 5KYUB 4BDSA 2CE2X 2O7SA 2JHAA 4Q9JA 1J2JA 1VRCA 4F0JA 3O8OB 1R2QA 3AHEA 3QPDA 1COZA 1YZHA 3PVCA 5KTMA 2A33A 5DI3B 1D9XA 2DCUA 3EXEA 4B87A 4D96A 3C8HA 3R0VA 2CZCA 2F17A 3BXXA 4HR7A 4NU5A 4UD2A 1LPBB 5DCUA 4M1WA 1M8FA 2HJHA 3HU1A 4B17A 2IBMA 2B1JA 5L51A 3OAAA 1SG6A 4L0QA 1U11A 2C3YA 2QNBA 1QONA 4UBKA 2P2SA 3KKZA 2ON6A 4XLTA 3PYXA 4XWGA 3T5PA 1YNSA 3ZWVA 4E13A 1I3OA 3ITNA 3KPYA 1L8XA 4HVTA 1K7FB 5BYBA 5KZMB 1UBHS 2JI6A 4N5LA 4NONA 4CYMA 2EX1A 3EXHC 4M54A 1BX0A 5JCZA 5L8VA 1OH8A 3GEMA 4LF8B 3MCTA 2KMLA 1OU4A 3GRAA 2EJCA 1LK0A 2VQ6A 4FYYA 2HO4A 4JFRA 1F5NA 5I9MA 5KSWB 1T3GA 3GFRA 5C3MA 1YFJA 5ALXA 4NOMA 2IWRA 3HFJA 2KJQA 1ZA1A 4TWAA 1JA9A 1X39A 2RFLA 2RCYA 2XAUA 5ECYA 5HUQA 5LNK6 4NY1A 5FI5A 4CL3A 5LM3A 2V1UA 1FRQA 1RLJA 3T9AA 3DGFC 4YRZA 4WY2A 1RC1A 2WT8A 2X2PA 5CG2A 4R98A 1NP7A 1DDGA 3DFUA 1UINA 4DDKA 1WUIS 2RJNA 4Q1EA 4RVOA 1BKDR 2BGLA 2IZOA 2ZSKA 3O31A 3RRFA 2AOTA 5BSFA 3VPAA 3X2SA 2C8KA 4KTVE 2MTBA 3VPSA 3GMTA 1ZFNA 3V1LA 1P1JA 3I52A 3UYLA 4FNAA 2QTAA 4MV9A 1PJQA 2LTAA 3HBAA 3CYFA 4YRGA 3BIWA 3MLAA 2PS1A 2ZAOA 3WC4A 2QPTA 3BDVA 2PAAA 3QSYA 1KDTA 2NYVA 3FCXA 5LR6A 2DTDA 4MVWA 2YICA 4QIHA 4C7XA 2X4LA 1PJCA 1P7VA 2CMDA 2FOIA 4RADA 5EJFA 5SV2A 3UMRA 4DIEA 1E9EA 1SK9A 1IIRA 2CNBA 4QM7A 4MIEA 2H48A 3OHPA 4UUPA 2MT9A 3DB1A 2AUMA 3JD4A 4QQ8A 2VXBA 2FLWA 4DCSA 1DRKA 1X1RA 2V5AA 5CVJA 3UFXA 1TU4A 5BW4A 2HQBA 1SAYA 2G72A 3L8GA 4J4TA 1GZSA 5KYYA 3H8SA 1QZXA 3FSRA 1VM6A 4O3FA 1OLXB 2QUJA 3L0BA 3T5DA 3GT3A 1AHHA 1XVUA 4UZEA 3JAMA 2R85A 4HLQB 7REQA 2FK8A 3QEOA 1PEKE 1DJPA 1MRZA 3NBQA 3RVKA 4COOA 3LPLA 5CH3A 1I33A 3OZBA 2C0PA 2GRUA 4JYBA 1KOLA 2C4KA 1L5MA 1DEHA 5DDIP 3ZK9A 1SEVA 2BDUA 2W6ZA 3PFHA 4ARSA 4DLSA 4DQ0A 2I62A 4HBZA 4YT4A 3PNVA 4XOUA 4TYQA 5EMJA 4WOCA 4RKYA 3LP5A 3NB0A 3RVRA 4U3JA 3DHWC 5J4HA 5CBKA 5FV4A 1KQ3A 3SHFA 4TXHA 1JWLA 1E0KA 3ESCA 5TV2A 4B44A 2RSLA 2ATCA 1U94A 2A5FA 4GOMD 4W1RA 4D0LB 2ZJ8A 2QENA 2XECA 1A72A 2R4QA 3FPGA 5L3VA 4C4SA 3DMTA 1L7PA 4P81A 4Z4FA 1IBRA 5EHIA 2W2LD 5FFMA 4O08A 4DL9A 2JBAB 4EL0A 1VFPA 4U7PB 3L7NA 1TLLA 3DOIA 1UBLS 2IEIA 3FCYA 1K0FA 1E64A 5ITWA 5C1OA 3VH4A 3BMQB 2BWJA 4EZIA 1KIFA 5LJLA 3HNOA 4GGOA 4EJSA 221PA 3RS2A 1C3JA 1G1AA 1Y4ZA 4FQ7A 1CUFA 2BI4A 1N0UA 2H0RA 1GDTA 1P5ZB 2IT1A 4DCGA 3OCCA 2A7QA 5ARCA 3NAMA 2PJDA 4INPA 4W6QA 3SYLA 3LCJA 1SXJE 1B6GA 5FUVA 5GOZA 4F2HA 2CXQA 4AIRA 4Q24A 5EKXA 3QHQA 2DQSA 3U81A 3K72B 2VXOA 1KO7A 4BJ3A 1EXVA 1S1CA 4EMTA 2DRIA 3PKZA 3REQA 3GC6A 2Z8XA 3BTSA 3OZAA 4IPTA 3ZYCA 3LFUA 2B5WA 3PKJA 3KSUA 4ZWNA 1NMQA 3T7RA 1ULZA 3ZD9A 2DETA 2DLCX 2H4FA 1TAQA 1QYXA 1PGOA 3O8OA 5C8YA 2L0XA 3SS7X 4YMSA 3GLIA 2WUEA 3K5WA 2NT3A 4QJ3A 3ENQA 1LTKA 3I9KA 4RAQA 5DT2A 2H85A 1T9BA 1IM5A 1LPSA 3CZCA 1T5BA 3GRRA 3KV1A 4POOA 5LJIA 1P2VA 3LGAA 4RPJA 4QHTA 1NUAA 1QZTA 2D2XA 2OK8A 2RCNA 3FZYA 2E4VA 4BMVA 2V7XA 5A5FA 1ECJA 5BO5A 3RU3A 3OE7D 4RKRA 3DSRA 1V5WA 3CZRA 3G17A 4HLUA 1T8WA 3U9LA 2DFKB 4AJEA 2Z98A 4C89A 3TF5A 4FZJA 2XCRB 1N9ZA 3P71T 1IK4A 1GZDA 3KTFA 2W8BB 4MXDA 1MC4A 4C5CA 3TNDA 5C7OO 3A6FA 2D0PB 4WZAB 1ANKA 3BK7A 3N3AC 3I9LA 4FC6A 5HMMA 5EE0A 5AWFC 4BVHA 1VHJA 4B6FA 4LXHA 1FNNA 3PA6A 2HK6A 2JFOA 3OEYA 1LBHA 1T35A 4OHMA 5D6OA 1QG6A 4CLDA 4D0GA 1ORTA 3EARA 1W5EA 1PJSA 5AHRA 4YN3A 1Y9AA 1U7WA 4CUJA 1PQYA 3F4LA 3WGLA 5IF9A 2QNRA 4P7FA 3BXOA 3GOQA 4H59A 4WNAB 3CUKA 3N8HA 5GVSA 3Q3EA 2RGXA 3L8DA 3TGWA 1X15A 3OC0A 1QFJA 1XD2B 1NJGA 4GOJA 8LDHA 4ZTUB 1RACA 1TX4B 3AJ8A 4MJ3A 4RHCA 1A9OA 3NUGA 4HD8A 4ZO4A 4M1KA 1BWQA 1I4OA 4NJEB 1JZQA 2BE9A 2XTAA 1ECLA 5KVVA 1Y8CA 4QUGA 2OORC 1TIPA 1QUEA 1MC5A 2Z0MA 3Q3VA 2PV0A 2YJTD 4H7PA 5IAJA 1LA2A 4IOMA 4KMMA 3FUWA 2PJRA 4TWRA 1U4SA 3KSZO 4EFNA 2UUOA 2EX0A 2Y67A 3CLRC 2W9XA 1H66A 3BSYA 4P4TA 2VNKA 4PPQA 4DV7B 4OL0A 2XUQA 4UW9A 1PEAA 4HDOB 3SC6A 8MHTA 2J4DA 2JI7A 3TAUA 1GL6A 3AF6A 4R05A 3UCXA 4IEIA 4MV1A 1CR6A 2ECFA 3OJOA 1R18A 4NE7A 4OXXA 1HR0B 2ZJYA 1Z47A 1CDOA 1ODCA 4RNDB 3W2TA 1FNDA 2FDRA 1O89A 1NW8A 5G02A 3ZOZA 4KU4A 1KEUA 1ZBQA 2A92A 3OQ1A 3F78A 1JFTA 1Z6XA 3ILHA 5IN5A 2PGOA 2YIJA 4N0PA 5IP5A 2UZIR 4C04A 1TO2E 3STWA 1DAIA 2OXTA 3B13B 3G2HA 1AKWA 3DBVO 3RHZA 3PD0A 4K9LA 1ST2A 1RHRA 3C3MA 1PBTA 2NAFA 4XD2A 1E1CB 5DWQA 1C4XA 2FPIA 3HU2A 3O73A 5BUQA 3SZ3A 1VFNA 3WNVA 4V39A 2ZR0A 4DBLC 4DZZA 5BWBA 4UDNA 1YFKA 1VL8A 5AM0A 3WYCA 4BUZA 2OLEA 1JHPA 3PEUA 3VU0A 1GLGA 1C2TA 2CD9A 2D0IA 2BI7A 2PGJA 2DFDA 2E0IA 4HDKA 5FOXA 3VPFA 1VI5A 5EUMA 4DF3A 3AVTA 2Q28A 1GNLA 3CG0A 1VHQA 1KI7A 1Z4IA 2A2ZA 2QNIA 4PM4A 2VATA 3WNCA 3EUAA 3A4IA 1OGYA 4PQYA 1JFFB 1JIKA 1PR9A 2BGIA 3PQ5A 1DJMA 4GLBA 3BEDA 2UAGA 3BMCB 3GPDG 1M1UA 1PF7E 4JLAA 4N8DA 4RQUA 3S70A 2E2WA 3N86A 3K32A 2SCUA 2YHSA 3E9NA 3G2OA 3GDGA 1W2GA 4HG2A 3OHSX 3SJ7A 3GLGA 3PUKA 3QLEA 1UP7A 1DMSA 2C99A 2VTKA 3EGXA 4LZJA 1MW9X 1A8UA 3KQNA 2O8FB 1J00A 2QAGB 1G21A 4O4JF 1EA7A 1QVRA 4F8YA 1F4LA 5DGTA 2IZ0A 3GCWA 3H3FA 4XIIA 2OVBA 4DYVA 4L0DA 4GT1A 1XP5A 4IJMA 4RDXA 5I7EA 3FDFA 2QL9A 1RFLA 1S4MA 2R6R1 5KWSA 4P3NA 1TECE 1G42A 3ZS8A 2CVZA 5J4YA 1GUYA 5EIOA 4XB2A 5JXWA 4LZZA 2PS0A 4TV9F 1CJUC 1D4FA 2G82A 3AU9A 3NFYA 3NKLA 4NZNA 1SC4A 4UNNA 4YB8A 2DBQA 2VSYA 4R71A