5BXIA

1.7 angstrom resolution crystal structure of putative nucleoside diphosphate kinase from toxoplasma gondii with tyrosine of tag bound to active site
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
AKQQERTYIMVKPDGVQRGLVSEVIRRFEQRGYKLVALKMKSPDATLLEEHYADLKGKPFFPGLISYMTSGPVVCMVWEGTDVVKQGRRMLGETRPLESNPGTLRGDFCIDVGRNIVHGSDSVESANKEISLWFTPEEICEWTSAQHKWVYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.7 Angstrom Resolution Crystal Structure of Putative Nucleoside Diphosphate Kinase from Toxoplasma gondii with Tyrosine of Tag Bound to Active Site.
rcsb
source organism Toxoplasma gondii me49
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 51
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5bxiA00
1HLWA 4WBFA 1ZS6A 2B8PA 3VGSA 3Q8UA 4UOGA 3NGTA 1NLKL 3Q86A 3VGTA 3VVTA 4ENOA 3EVMA 3FCWA 4W98A 2CWKA 3Q89A 1NCLA 4CP5A 2VU5A 2DXFA 4DZ6A 2DXDA 3R9LA 4F36A 1KDNA 3BBCA 1BUXA 3FBFA 3NGUA 1LWXA 1XQIA 1XIQA 1JXVA 2BEFA 3EMTA 1S5ZA 2BX6A 4ANDA 3PJ9A 3L7UA 3Q83A 4FKYA 3NGRA 1NSKL 3EICA 3Q8VA 3FBCA 4FKXA 3ZTPA 1PKUA 3BBFA 3GP9A 1B99A 2B8QA 3DKDA 3B6BA 3DDIA 4DUTA 3EE3A 3FBBA 1NHKL 2DY9A 5CAAA 1W7WA 1MN7A 4DI6A 2ZUAA 1BHNA 1NDKA 1B4SA 3PRVA 1UCNA 1NB2A 1F3FA 1NSQA 1WKJA 4C6AA 2AZ1A 2HURA 3EVOA 3Q8YA 3VGUA 4UOHA 5C7PA 1NDCA 2NCKL 3ENAA 3VVUA 3EM1A 2HVEA 1HIYA 3ZTOA 5CABA 3FCVA 3ELHA 3ZTQA 3VGVA 3ETMA 2AZ3A 1LEOA 3FC9A 4UOFA 2DXEA 1HHQA 4ANCA 3JS9A 3BH6B 1S59A 1PAEX 1MN9A 1WKKA 3ZTRA 4O0NA 3GPAA 2HVDA 1F6TA 1NUEA 3BBBA 3FBEA 4KPCA 3NGSA 3EJMA 1VYAA 1K44A 5IOLA 1BE4A 3MPDA 1EHWA 3BH7B 1S57A 1NPKA 1NDLA 4F4AA 3FKBA 3EVWA 3ZTSA 4S0MA 1NSPA 5BXIA 1NDPA 1U8WA 3B54A 3G2XA 4HR2A 4ANEA 4EK2A 2DYAA 3WX8A 1WKLA
chains in the Genus database with same CATH superfamily
1T3OA 3ENQA 3SDEA 2MQMA 1FRLA 3IM9A 3Q8UA 3EDQB 1RWOB 1X9MA 3GFXA 3Q86A 4YB7A 4DV7F 1J5OB 2KXNB 5AT1B 2NR0A 2OUGA 3W3SA 5LOQA 3CJQA 4HACB 5IWAF 2C2NA 5LJ5Y 5KFNA 5IC4B 4GKJF 4XIUA 3H25A 4RWWA 1M5PC 3GFHA 4R25A 5J2NA 1T05A 1NK9A 2KFYA 3QJPA 1UTAA 5ETRA 2RJZA 4N56A 1V3ZA 4DZ6A 4X65F 1UVMA 1BC6A 2B4UA 2A1BA 5KFQA 2WRMA 2QA4S 1VK3A 1QAYA 1LW2B 1S48A 3FEYB 3PYGA 3M2VA 3MEKA 4CTAB 4NEYA 5DLFA 3O5TB 3BV8A 1IBLF 1K1SA 4ZDNA 2PN6A 3RAXA 3Q8RB 3EGZA 4U8YA 4U67Q 4RKUC 1EP4B 1ZM2A 5HVGA 4B9TA 3MCNA 3W5XA 3W61A 4F7VA 4JI2J 2H54B 2WONB 2OI2A 4LBPA 3Q8QB 3GU0A 3GE9A 4MIBA 4C8MA 3ZNUA 3D0IE 2D7SA 2JSXA 2PFDA 3DLJA 3O6QA 3BDPA 2DGVA 3DKDA 4ECWA 5AE2A 2W7OA 3H5SA 4H4OB 2KZZA 1CJVA 3H8YA 2F3JA 4PXBA 2BYCA 2DHGA 4KO0A 4UZBA 2ZH8A 1ROFA 2F65A 2W4CA 4CM0A 2HVZA 3TEHB 3F56A 2LQ5A 3W2VA 5BYRA 4C48A 1ITPA 4ZCLA 4E98A 2B3TB 4F0MA 4USVA 2RDJA 2AX0A 1NK4A 1OPZA 1FEHA 1MNEA 2RQKA 5DO2A 5C24A 2CJQA 5T7LA 5ETPA 5A6WA 5DETA 3OUYB 1M1KT 1XERA 4OHYA 3K59A 1WKJA 2N7CA 1U1PA 1AB8A 2FY8A 4ETZA 5K8OA 5KFIA 2R7XA 1M5VC 1N52B 1T0TV 1NK8A 2YPZA 5IQ6A 4DFPA 4X64F 1KLMB 1TKTB 2HHHF 2QLFB 5GAGU 4IH5A 2C2DA 1JXLA 3VVUA 3HSJA 2WVFA 1YHQS 2V34A 4I67A 3EM1A 4KPYA 1RDRA 1P8GA 3VZHA 5LMNF 2KRRA 1N48A 1HYSA 1RAAB 1JLBB 1WF2A 2AJ2A 3I31A 3MGJA 4LR7A 3D67A 4X4SA 2F8HA 2WSCC 3ZO7A 1KVKA 1VQ8S 2K7JA 3ELHA 4JBCA 4OX9F 3T9NA 3KLGA 1VQ6S 1LXNA 3ETMA 3LPYA 5FD1A 3TVKA 2DBBA 5B0DA 2MYFA 2RQCA 4C4WA 4IKAA 1FE0A 4I2PB 5CQGA 1GTHA 4ZP7A 3NXZA 3AFGA 3BR8A 3IBFB 3GZ7A 4HDGA 3RUBL 4WK3A 4NLDA 4DL5A 1MWQA 1MN9A 4C8YA 1NHVA 4LF8J 2V8DA 2JDJA 4OMFG 1NJIT 1KRPA 3AHPA 1N5YB 4L6V3 5KFWA 1AROP 1U1LA 2MKJA 2HVIA 3P96A 1UJ4A 2ZNYA 4YN3B 3DOMB 5D3GA 1APSA 2YXLA 3SCKE 3ZZRA 5IZHA 2R8GA 3MECA 1R0AB 3QWPA 2IJFA 1BE4A 4CI0B 1H7WA 1VQ5S 5FIIA 2G2ZA 3QT7A 3W7BA 3DOMA 3X1LB 1U7LA 3NS5A 1RT5A 2W9CA 1VRTA 3MM8B 3PFEA 3PNIA 2AF6A 1H0HB 3DYAB 3NBPA 2HSEB 2MQ8A 4UQGA 2Z0GA 3M8PB 4UZCA 4L75A 4KRWA 3VAIA 1G1XA 1DJ0A 1OYEA 2VV5A 3MAHA 4LIRA 3T6JA 2W9BA 3PX6A 4CT8A 4JI7F 2ATLA 4WE1B 3WIUA 1B0PA 3B54A 1RZMA 1VCTA 1VOMA 4B3TF 4TXSA 4B02A 3K8VA 5F8GA 4A8KA 1RT7B 4N47A 3RBEA 2UXDF 4X4NA 3DGPA 3SDEB 1WKLA 2DGXA 3CDEA 4B08A 3DRSA 2A0FB 2Y0SD 3FZBA 3I96A 4K5RA 4M5GA 2R7WA 4GO7X 1EZZB 1S1VA 2I8EA 4ECRA 1H7XA 2WBMA 1U4BA 1F2GA 2VQFF 2XY6A 1NZAA 3QWUA 1XMQJ 4HACA 2GZOA 3DGPB 3M6XA 1HQEB 1TKXB 2XQCA 3OBIA 4RW9A 2MB0B 4LRCA 3CJ2A 4DF8A 2OEJA 4OHWA 1T9TA 1UW9A 3MXHP 2KDOA 1RT3A 2ASLA 1LWCB 3CIMA 2MSSA 3M30B 3VAFA 1S0OA 3DN9A 1PBAA 2H3EB 2GVDA 1KBRA 4IG3B 4E0DA 5GAGI 4LR9A 1U45A 5B0BA 1Q95G 4USMA 2E5LF 1XIQA 3R5DA 1RSCA 3LP1B 1C0TB 2MMYA 5LSRA 4R5PA 4C8LA 1FF2A 3EMTA 1TK5A 3V81A 4ANDA 4BDPA 4C8KA 2H4YB 2N3LA 4FKYA 2FHKA 2CNLB 2MY7A 3O1LA 1JJ2R 4ZVEA 1QJHA 1SV5A 3QLHB 3D6TB 2VQEF 3PX4A 1QAIA 4LF4F 4LFCF 1SJQA 2MZSA 3HK2A 4Q0BA 3BS9A 2L48A 3OPKA 2VPXB 3PJWA 2LYVA 1TL7B 1VHFA 2PMWA 2XO7A 2A2DA 1HFEL 4ZLLA 4B3OB 3VF0B 4DQPA 1N5SA 4DFJA 4LFCJ 2PO4A 4LF4J 4OYIA 2DKOB 3D6HB 3IA0A 4DV6J 4AXJA 2FTRA 2LXIA 4NCGB 4CLLA 3OR1A 1CC7A 1WC6A 3MPUB 3NS7B 3BSNA 4Z2XA 3PW2A 2LMIA 3S6EA 2C2RA 3CJSA 3DRPA 4NZ6A 3KK2A 2GQCA 2MTLA 1RT2A 3MHYA 4ZMMA 3OLAA 3ZXWA 1TKDA 1KVIA 2P9CA 4Y0FA 4KGZB 4C6AA 4RBTA 4IG0A 4DCOB 3JAMU 5KFJA 3MR6A 2HMIB 4QZVB 1WDDA 1YJ9S 5LSLA 1H3DA 1LWCA 2MZTA 3H7HB 4UOHA 5EX0A 5KFGA 3W64A 3L4BC 5HLFB 1QTMA 4KGVB 4IUFA 2QLBB 1XNQF 1TKTA 2Y8WA 3ENAA 2EBGA 5KFKA 3DLEB 1Y4ZB 4YQWA 4WFXA 2XS2A 1NK0A 2B7BB 3I5AA 4OX8A 1PO6A 2MJNA 2J0QD 3CD5A 4LQ9A 1HQEA 1TKXA 2UU9F 2HWHA 3QZ7A 1VC0A 2BE7D 1SQEA 4EYHB 1NK6A 2YPYA 3ITHA 5L9XA 1RAFB 3R8YA 2UUCJ 3I82A 2IRYA 3RZAA 3DU5A 3GYGA 2EC0A 4UTGA 1RTJB 2H65B 1ZM3A 2O01C 4NLWA 4QR1A 2W4PA 2DNOA 3DHWC 3M1VA 1WC4A 1CJUA 4IR1A 3RYLA 3VV2B 2YKNA 3HHLA 2VHGA 3C15A 3KKFA 3G4SS 3FBEA 2EKNA 2UVRA 1ZH5A 2KO1A 3NWRA 1NAQA 4FXWA 1ZTTA 4ZP9A 1N88A 4CCHA 2RQMA 2HFSA 1IM4A 1FK9B 1GEHA 1NEEA 3R2CJ 1U6BA 1IKYB 3CJ4A 2UXBJ 4FS1A 4WKRA 4MAKA 3CPWR 5KFHA 3K5MA 4DUYF 4UY85 1FTCA 3D1HA 3EGWB 5D0HA 3NG8A 2R8JA 1ZA2B 3DC2A 4LF6J 2PEHA 3J80Y 3VZIA 1VIXA 5DM7Q 4IDKA 3KHLA 1JLCA 2GQ2A 5KG2A 1LW0A 5HO4A 1CBKA 1WJ9A 2HBRB 2OPSA 1QUPA 2QZ8A 3MMCA 4ZP8A 4UOGA 4URGA 2HBYB 1X4GA 2VPWB 4K4SA 1JLBA 1AXQA 5E5NA 3ENWA 3A3PB 1GTEA 2KHDA 3H2UB 3ILOA 4LUBA 3TZZA 3IN5A 3GJRB 1KWMA 3QO9B 5J2PB 5LJ3Y 4DPWA 4EBCA 1MWZA 1T9UA 2XY5A 1KONA 1S4EA 4CP5A 2DNZA 2VU5A 3H4DA 1IKXB 1HL6A 4ALZA 5IV4A 2FGOA 2G0JA 1GMVA 3D1QA 3FNNA 5CD4H 1S97A 4F36A 3PM9A 2RVJA 2AT1B 2HRYA 2MY8A 2WSEC 4IYQA 1DY3A 1XR5A 3NCQA 2XLIA 2ZH9A 3NNHA 3KHGA 1CPZA 5H9EK 3Q8SB 1NSKL 2WZ1A 4CH0S 2HQ3A 3LP0A 3RB0A 4ZPTR 2KZMA 4O3NA 4RU9A 1HBMA 3GP9A 2B0GA 3NOGA 3KG1A 4H4KA 4LSLB 5A2QY 3IGVA 4C8ZA 2XTJP 4DV4F 1HNIA 1PC5A 1MMLA 4ED1A 1DZ5A 5U47A 3AD9C 2E1CA 2DCLA 3PFOA 4G1IA 4I2QB 2MQQA 3HSZA 1EETB 4I6YA 1M1GA 1MMDA 1KVJA 1XN9A 2Y1JA 5DGAA 4C3LA 2BJ1A 2LDIA 2E9ZA 3CO0P 3CC4S 4U7UD 4XK8C 3KLHA 3TP2A 4HTJA 2QLXA 3Q8YA 5A8RA 5HP1A 3HXMA 2ADBA 1AW0A 3AT1B 3KJQB 4QWDA 2AIRB 2E1AA 2CPJA 3DRRB 4Y2MA 3G6XA 1Q79A 1D09B 3P49B 2YWWA 3GCWP 3R7SB 2HYIB 2UUAF 1FE4A 3MEDA 1KN6A 1CG2A 2EKYA 3KFWX 5K8MA 5KOXA 4QW9A 1XBWA 4RW7B 5JVGQ 4MK8A 2IFXA 3MTKA 2JLGA 4F25A 1KLMA 1FT8A 1VQMS 1Q81T 1CULB 1GT8A 1EQMA 2HLTA 2ILYA 3ZZOA 1KLNA 2IVYA 2UUBF 3TUPA 3DDNA 2UV8G 4WK1A 2DXEA 3FMWA 1C1CB 1OSDA 5D4PA 2BQ3A 1KS2A 3I55S 2HQDA 3OTOJ 1S9GA 1X4EA 3C6UA 3TAPA 2UUTA 5KFCA 1JLAB 2JEFA 4UUXA 2F5GA 4PWDB 4DFMA 2KU7A 2GNKA 4O0NA 2XHWA 3TAMA 1PC4A 4Y2AA 3GTYX 4DR5J 1S6QA 5EWFA 3HT3A 4LQ3A 1C0UB 3F73A 2RHQB 3NNAA 4ZA1A 4N76A 3GV5B 3PYFA 3NBPB 1SC6A 3L7PA 1NK5A 1PJ5A 1O6XA 1SB6A 3CE8A 2UV8A 4OX7A 3Q0AA 4RUAA 4DX7A 3K57A 4NOHA 2CJ9A 3VQTA 1NO8A 2CPXA 1LKZA 1HW9A 2CADA 4N7TA 1ZETA 2D3OR 1R0AA 3D66A 4FBTA 4BC9A 4DR1F 3QLHA 1VQLS 4PRFA 2XB2D 1RHRB 2RILA 2ALZA 1MU2A 4ES1A 4R8UB 1T7PA 2FHMA 4TYAA 3P6YC 3G2XA 4KHPJ 3FSIA 4RPFA 2LECA 3G8QA 2CA9A 4TN2A 2W2NP 2IM3A 1RWVB 2X51A 3M8QB 2UP1A 1UEUA 3SQGB 4WYWA 1YLXA 3MEEA 3VAHA 2A6OA 3HM9A 1RT3B 2HHQA 1Y3JA 4NLYA 5F8MA 1RQ0A 2V0NA 4DR3J 2GC8A 1LWEA 3FFIB 4B9SA 1IUJA 4W98A 5KAKA 4FF4A 4ZVQB 4K2JA 5E41A 3QPIA 5EUHA 4QWCA 4P2XA 4CO2A 2DNRA 5CXTA 2B9XA 4HKQA 4ZVRB 3T1AA 3CJ0A 3M4XA 1FFSB 3I9V9 4O44A 2DXFA 1FCAA 3X3UA 1R43A 1XK8A 1VS3A 5HMXA 3KLEA 3G96A 2VJUA 2OIHA 4DOZA 4RNMA 3BBCA 3F0NA 2CFXA 3MM9A 3QGGA 2DEIA 5D15A 4ZKAA 2R2SA 2YY3A 1RWMB 3B8HA 3BKTA 4HH1A 2MQPA 3IWNC 3FSXA 2N3OA 4DR7F 2E5GA 4J9RA 3EYZA 1T9WA 4Q7AA 3CJKB 2CVEA 3QT5A 3M9OB 1NZ8A 3M8PA 2ZM6J 1SL0A 2HHXA 1XR7A 1AFIA 1YBTA 4X4VA 2ZOFA 4FNHA 3MAAB 4CO4A 4LBHA 4IQMA 3C46A 3CULA 3QRPA 1NSAA 1OY8A 1RA7A 3HT0A 4LMZA 3OR2A 1HD1A 1HHTP 4TQRA 1QSSA 4ELVA 2QSWA 3EX7B 4GC6A 4DL6A 1SH0A 3QFWA 3PR5B 2XS5A 1QLNA 2AX1A 1RBOB 3A8JA 3U1NA 5KFEA 3MDFA 2GW8A 3W9JA 3N5FA 1K9MT 2IA6A 2VFRA 3WDOA 1BHNA 3UW1A 1NDKA 2W9AA 3JSRA 4K4TA 3RR7A 3VAMA 1WSRA 2EXUA 3THTA 1E6VB 3G82B 2XMMA 2AZ1A 4OI2A 4D3HA 1XNRJ 3I32A 1LWFA 2UU9J 1EKRA 3FMBA 1S7IA 1EARA 4GRSA 4Y65A 2EG2A 2VG6A 3UI3A 3UDVA 4NL5A 3BM7A 2Y1LB 3UFCX 1RWNB 4BWMA 4PG7A 5J2NB 4AUKA 1IWGA 5DQIA 3CCLS 1T05B 2W4DA 2J6UA 3CD0A 1X0FA 4G1PA 4N77A 1U49A 4LF7J 1IQTA 2XYHB 4X4PA 1T9VA 2DNKA 2CG4A 2QV6A 2RD5C 4I2PA 2Q43A 2IYGA 5IV3A 3M9NB 4IOBA 5CCMA 1FNOA 2MLXA 5EHHA 5D4LA 3HSDA 1OQ3A 1TAUA 2XLKA 3NMAA 1BQNA 2KFNA 3BH6B 3HVRA 3UO0A 3H40A 3IC1A 1Q8BA 1TL3B 4J91A 3I5CA 3EZUA 1FKAF 1RADB 2KHCA 3QO9A 2CQBA 4WIQA 4ZVSB 1WKKA 2LFVA 3OXGA 3RRGA 2N4DA 2ZVSA 3PHEA 2XZDB 1ICEB 1UWAA 1LFPA 5HAOA 4OHZA 5C25A 2ADCA 2HIQA 4MJKA 1L3SA 3US5A 5BR8J 1RAJA 2XMUA 1WI6A 2FUG9 2OH2A 1PJ7A 1K44A 3KLFA 3GG1A 3O8WA 5HN0A 2FD2A 3MD1A 2A2CA 2BM1A 4NA2A 4TY8A 5K5MA 4RUCA 2E9TA 1JLFA 4EUVA 1C4AA 4TQSA 1X5PA 3SZ2A 4OI0A 2ZJQQ 3ZZPA 4K4ZA 3DXSX 2IYIA 4G65A 4ER8A 1TZ0A 2VL1A 2BKNA 2V50A 2CQCA 2IMOA 4ED2A 4K0KF 2XGPA 3GFZA 1CS4A 3D54A 4IFVB 1JLFB 4WP8A 1VBYA 4UY8T 1G3OA 1Q16B 5CYQB 5BXIA 2ASJA 1HWJA 3CVKA 3IAS9 1T8EA 2ZH7A 4F02A 3HO1A 4QCLA 5IM0B 4RO0A 3BGLA 3K5NA 4IRDA 1UMJA 2E5HA 3GIIA 4I56A 4QIGA 1N33F 5HQ8A 3N6MA 2DNMA 1SVDA 1GMWD 2B4OA 2QX0A 3M8ZA 4TU8A 1HPZB 1VRQC 4DQRA 1G7CB 1RTDA 1JLEB 5H9FK 2HNZA 3OTBA 5LL6d 2AJFE 2FHOB 2WOMA 3I0RA 4FZVA 1IBKF 4C11B 5DZ6A 3THPA 3H5UA 3LAKA 3UDEA 1YJWS 1UA1A 1SC1B 3PEHA 5F0WA 1PYTA 1LW2A 1K8AT 3QGIA 1FD2A 2MLYA 4B9UA 4WWSA 5M2RA 3G8SA 2VB6A 3N6LA 3I0RB 3DMJA 1JLQA 2JVRA 3GYXB 5KFOA 4LF9J 5L8RC 3G71S 1MWYA 2BJ3A 2L9WA 2DO4A 3KLEB 3UCZP 1HNVB 3MM6A 4PXEA 4P10A 4RBUA 2AYEA 1OIAA 3H5XA 5E3QA 5AJ3F 5HVHA 1CJTA 5CZVA 2ASDA 3K89A 4JI5J 1F5CA 1S49A 4AE5A 3B4DA 5D4NA 4H4OA 4LF2A 1VISA 2PC6A 1WC0A 1GXTA 2B4PA 3DFEA 2P2CB 4RNHA 5KFZA 3OW2R 4OHXA 4U95A 1NJWA 2ZH2A 3CCRS 1EETA 2B9YA 2OD4A 3NKYA 3R6LB 2YVSA 4CIOA 3IM8A 4DUTA 2FJAB 3SCLE 1NHKL 1U24A 2HG4A 3UN3A 4DV5F 2F4FA 1ZM4A 1FKPB 1Y9OA 4DCJB 1MU2B 1X4CA 5I4MA 3TX8A 5KTQA 2CPDA 2ZUAA 1JNZB 1UFLA 1YX2A 1IBCB 4GMKA 1Y10A 2FY1A 5K20B 4TU9A 3E01B 1NB2A 3N28A 3IRWP 1TUGB 2DGTA 5L39A 1S6OA 1RI7A 2FZGB 4YB5A 2VC0A 7FD1A 4PG8A 2HURA 1TR0A 1HQUB 2E44A 1RAHB 5LMUJ 2VFSA 2J0WA 2CQ0A 2HQCA 5E7OB 3NAHA 2LU2A 5AXMA 4DG1A 2V6AA 1I94J 1RA6A 2KT5A 2R7QA 3MFIA 3BF4A 1F9EB 3RB4A 3HJFA 1RXOB 2HGNA 3GONA 2D3UA 5B0EA 4LFAF 4KYZA 3QQCD 3QRRA 1RGVA 2DNPA 2K8GA 1YJRA 2CKWA 2QFJA 2QIFA 3RJMB 4OLPA 1JLAA 1X4AA 1Q8IA 2CG8A 2GVDB 3MWBA 2MKSA 5EWEA 2MEWA 2M9KA 2CQ3A 5FJ4A 2KT2A 1JLQB 5A8WB 1IR0A 2NXJA 3HVTA 5CA5A 2X1FA 3JSBA 2CQDA 2E5JA 3RW7A 2Z4PA 1WF1A 2FB0A 4X84A 1D9AA 4LREA 1F6TA 1YWXA 1NUEA 3LUYA 4HHJA 3DM2A 2DR5A 2JWNA 1TVRB 1JXEA 3NGSA 5T7LB 2UXBF 4V19X 1L3UA 1LFWA 4Y2IA 2Y8YA 4NLRA 3GFYA 4R8UA 4EI2A 3Q8PB 2I38A 5T14A 2DISA 3MECB 3IG1A 5HJYA 1CJVB 4RLEA 3ZNJ1 2ZBRA 5AJ3J 1NK7A 3TR5A 3EPIA 4S0MA 3TJAA 3QYYA 4DPUA 3CC7S 1H73A 3J7A1 1TUWA 2AWZA 4I2QA 4LBIA 2WTFA 3FSYA 3ZZTA 1YJNS 2COLA 2RU9A 3V2UC 4DS5A 1Q78A 4HR2A 2ZHOA 1HARA 1C1BB 1FRKA 1M5SA 2IDEA 3CJTA 4LJMA 2YKQA 5B0CA 5DDRC 2JLEA 4A8MP 3R5BA 4K2XA 4HDHA 4LFBJ 4WZQA 3UNGC 1N6QB 3LO3A 2UUAJ 2PEBA 3VGTA 1U0HA 2R42A 3F41A 3W2WB 2ZH5A 3KHHA 3V6DB 4M63A 1FXDA 4Q5VA 3R6GB 3H2LA 3TQ1A 4PYDA 2XG8A 6AT1B 1J5EF 1HWUA 2M2BA 2Y1RI 3D68A 5KT5A 2QA1A 4OLOA 2KN4A 2H51B 1R8CA 3GV7B 3QGPA 1DQ8A 2XMTA 3O3LA 4M5NA 4LFAJ 1FWLA 2X7IA 2VBZA 1JLGA 1FVSA 3H98A 4X4QA 2BJ9A 2IC3A 2CZ4A 4TY9A 2QGFB 1KDNA 3BGOP 3W60A 2BQUA 3DLHA 1Q5YA 3FBFA 1KKHA 2DT9A 3AD7C 1Y3KA 2K3IA 1FRMA 1L3KA 3AOAA 1EJ7L 3DLGA 2K1RA 2WB4A 1JJCB 3IFEA 4Q2LA 5KG3A 2GIRA 3SCJE 4L3NA 4UOCA 2MKYA 1U02A 2PI5A 1FERA 3PVXA 2OMLA 2WB1D 5CZXA 2BR0A 3TVZA 1BWVA 5E3RA 3MEGA 2AGQA 4C7QA 4ECYA 4MKAA 3PV8A 2E66A 1SL1A 4LF5J 1DFDA 4I4BA 1PCAA 3KJVA 2C22A 2AKWB 1Q8KA 4QOTA 3H90A 3VAKA 3B6BA 1JX4A 2B6AB 2FGCA 3DLLQ 2RU3A 3VCDA 4DV2J 4E8UA 1QVGR 1RYSA 1KHWA 4HI2A 4NWBA 2FC9A 5AE3A 4IDKB 1T3NA 5B0FA 4KV8B 4ZVOB 1E6YA 4A47A 3K5LA 2BJEA 4F4XA 3HHNB 3E01A 3TWZA 3FEXB 2C2KB 3AAWB 2CQ4A 3PW5A 3Q22A 1P9YA 3W9IA 3AQPA 1DTQA 4MKVA 1R8BA 3KDOA 2ZJRQ 1O51A 1I94F 4QBUA 3FGVA 2XS7A 5ITHA 3R1HA 1U48A 4WKYA 3K7RA 2CJKA 1WDTA 3DDKA 2DNQA 3HPOA 3CCJS 2GHPA 1GXLA 1Q8LA 3CCSS 4MK7A 3BSAA 1V3SA 1TU0B 3J7ZT 1VC5A 2VIHA 2HRTA 3AXKA 2YQ3A 3JQKA 3GJQB 3L09A 1FWPA 2HFNA 4PABA 5HJXA 4CH1A 2GAGC 4F4YA 3TJ9A 2VQFJ 1WHXA 2J9DA 1IKXA 3CGIA 4Q44A 2FZCB 2ZD1B 2HK3A 1FD8A 4UOFA 4ERDA 3UR3C 3LOUA 1HKAA 3WIVA 2JVOA 5JXSA 2PA3A 1S9GB 2W01A 3K2YA 3RGIA 4X4TA 2B7CB 2AYBA 1PAEX 3ILIA 3K5PA 1SXLA 1EQ0A 4Y00A 1RT6B 2IAJA 1N33J 2O3DA 4LIWA 4ES3A 2DVIA 1KNZA 4JOUA 4A46A 3SSRA 4DR2F 3QIPA 4ZPBA 2V2KA 2HWTA 1WOOA 1SBRA 3JTNA 4CWBA 1N34J 2D69A 1CSJA 3PYDA 1FNXH 3NAIA 3BGRB 1LXJA 3FRYA 4P72A 3TA2A 2MKIA 5ADZA 4NA3A 4ZLPA 3G82A 4CRJA 3EZ5A 4B3SF 1RTIA 5SUHA 2ZHAA 2QTWA 1VRTB 2BE9B 3MM8A 2MGZB 4ZIVA 5DDQC 5A76A 3GSDA 3O44A 2OPRA 3ZTSA 4DR7J 1FNMA 3TNVA 2K06A 2FJVA 4A8OA 1RKIA 2EFGA 4DX6A 2BOPA 3LAMA 3EDRB 3PY8A 2F40A 1P1TA 3HJVA 2BRLA 2Z30B 2HNDA 3A3NB 5HATA 4EK2A 2ZBCA 2KKHA 2ZKUA 2AYGA 5K9FA 5KG1A 1CC8A 4P2SA 2QLWA 2FJDB 4JI8F 4CYUA 2LP4A 4ICLB 2OHDA 3UN2A 1HD0A 5I42B 2ZITA 3VVTA 3NY0A 2HNDB 2CZVC 2QA4G 1HNWF 4TLRA 2BVZA 3KJNB 1KD1T 2M7SA 3L9ZA 2G4BA 4JI8J 2R7TA 1VLOA 2BE2A 4KQZA 1HWLA 3EPGA 1WG1A 3U1LA 4CZCA 1UKUA 3OL7A 1SJ3P 1CEZA 1NB7A 5E2QA 1M1HA 2A6MA 5DG7A 2UXCF 1VQSA 1YRTA 1TTHB 1HNWJ 3IO1A 1U25A 4PAAA 4ES2A 4X64J 3BZQA 3D0GE 1YKWA 4C0HA 1N56A 4PPZA 1Y00A 4DU7A 2HFUA 4ZVGA 4WFAQ 2BW7A 2FQQB 4ZVFA 4DV2F 3DLGB 3GSIA 3OTDA 1JMTA 2GO9A 3G8TA 2MQLA 2FJXA 1R27B 4EU0A 4OZJA 4F0KA 3NGDA 1B3TA 2U2FA 1YK9A 3B78A 1BXNA 4CNYA 3KLGB 4RNOA 1U1MA 4XO0A 1UW4A 3CW2C 1RT1A 3C66A 5KFSA 2DTJA 3P4UB 2V9WA 3FQLA 2HK2A 1L3VA 2UXDJ 1Y5NB 2KT3A 2YQ1A 2YWFA 1ZAVA 1RAGB 2OFHX 5THWA 4A8XA 2OPQB 1P1LA 3H42A 4IOAQ 4AL7A 3EE3A 4ZVTB 4OYZA 2E7WA 5JJBA 3UWTA 3CCVS 1AUDA 4NCGA 5F8JA 1FKOB 4ZCIA 2MQNA 2XWXA 3N0VA 4HH0A 3PW7A 1EIYB 2KVIA 3LP2A 2E1PA 2KRBA 2L9DA 4ILRA 3ZZ0A 5C2GA 4LF7F 4DN9A 2N82B 2C3MA 2DGUA 3CJ3A 2HNZB 1CS4B 1KR4A 1H98A 8ATCB 1KQGB 3JYTA 3I0SA 1B64A 4QPXA 4RZRA 1CVJA 4PCQA 2V4JA 2EFOA 1M0SA 1RBAA 1IR1A 3ISND 4YEAA 5ETKA 1T95A 2J0XA 3TA1A 2HZVA 1RUSA 3KMSA 1S1XB 4HTIA 2J9DE 4LF8F 2KM8B 3DXBA 3UVJA 3CJ5A 4AYBD 2AEMA 2YNFB 3GR0A 3QATA 2VF3A 1REVA 4USUA 1QY7A 4Y6IA 3IXQA 4PR6A 3TX0A 4CH7A 4P7VA 1HI0P 1KQFB 3IMQJ 3FC9A 1IR2A 1BQNB 3OQ2A 4AQYJ 1B0TA 1RAOA 1S6QB 3THVA 3TUIC 2H4WB 1UPPA 1URRA 2XC9A 1PYOB 4NYZA 4FXVA 1S4FA 2C1EB 1SKWA 2PFFB 4YDDB 8AT1B 2FHJD 2IMWP 3MAQA 3E8OA 1F60B 4ZS6A 1CQNA 5DLGA 1ZZNA 2NZ4A 2ERRA 4GC7A 2UUWA 4DV4J 3PW4A 2F8EX 3B82A 2CJXB 1Q7YT 4GVLA 2ZHBA 1UVLA 1X7VA 1Q4RA 4HEA9 1KTQA 2BKOA 2EK6A 4ECTA 3NNCA 1FFGB 2K7KA 1RCOB 3BB5A 4ZPWR 3N4WA 2JC1A 2LA4A 4RW4B 4JUZA 1Y0HA 3OD2A 3SXLA 1YBUA 4RU2A 2HGLA 1UETA 4J5OA 2WW4A 5KFVA 1GX6A 1NSPA 2JNJA 5KFRA 4X66J 1S0MA 1X4HA 1RU1A 4OQJA 4F4KA 5C2CA 5L9NA 3MMJA 2ACMA 4RW6B 3V6DA 4UW2A 2B9EA 4DBQA 1UA0A 2FLLA 4ZCMA 1MROA 3QFHA 3DNCA 2BKPA 4HI1A 3QSIA 4O3OA 4J9LA 2XSJA 2GO8A 5I3PA 5BYSA 2V4JB 1C1BA 1IWAA 4FS2A 4A8WA 2N7YA 1XEZA 4IO1A 2HHHJ 3CMES 4C8OA 4KHPF 1YJVA 2HFOA 3OL8A 4JI4F 4DR4F 4OYXA 4ED0A 2W24A 5B7WA 1OS5A 2EFQA 2C3YA 4CQ1A 1NCLA 2NSBA 4P73A 3JQMA 4P9SA 1WTFA 2HKEA 3OFFA 3MFHA 4K4VA 2HS0A 1C0UA 4R5PB 2YWHA 4RW9B 4YP3A 2DR9A 1F1BB 3CDUA 3S7RA 4U9RA 4BCAA 3GR1A 2N4CA 2JOQA 1PIEA 2XEXA 2IAJB 1JWWA 7FDRA 2XMWA 2RRNA 3GQCA 1XQIA 5EX3A 3U02A 2CPZA 2DHHA 1HMVB 2QLJB 4B17A 5A8KA 2XMKA 2HGMA 3PJ9A 5HBMB 3T6BA 5IT0A 1YJ7A 2IC3B 1K1QA 3EICA 4NXMF 4A8FA 1SPBP 3K5OA 1G4CA 5KFXA 2APOA 2DH9A 2PMZD 4ED7A 5CCLA 1IKVA 1UVKA 2Z2LA 1TV6B 1NPRA 2V94A 3AQOA 4NPOA 1CQMA 3OTOF 3UN5A 1R0CB 4OYAA 2IA0A 1RT6A 1PJ6A 3SYZA 2W2PP 2B43A 1RTHA 2HHSA 4KO0B 1W7WA 2RKIB 2XSJB 2E7XA 4NA1A 3W2VB 1D0EA 1QVFR 4DS4A 3QT8A 2AU0A 1VQ4S 2G9OA 4GVBA 3J81Y 1LW0B 4KT0C 5GAEI 1D8YA 3OR1B 2XSFA 2CQPA 1YTYA 3CCWA 1QAJA 2GX8A 2MZRA 2JEGA 3D6MB 2XNRA 2GGPA 2HQGA 3TJ8A 5BR8F 4ZN1A 4D3GA 1IBKJ 1S9FA 3ONQA 5KT6A 1AYEA 4ILMA 5M2UA 2HIYA 3CTRA 1Z2ZA 4WU3A 4K50A 3BQ2A 3C2PA 3HZGA 4QIFA 5H9FJ 1SJFA 4NLGA 5B0GA 1TL1B 5DG8A 2NLWA 4FBUA 5GMDA 4NYPA 4JI6J 3V81B 3CJ8A 4KFBB 4BBYA 2KYXA 3ZTQA 2GS8A 3BGUA 4EFAC 4YOEA 4JI5F 2YQ0A 4BC7A 1RT4B 1HNVA 2P6TA 3T5HA 3QSYB 1HA1A 2EFPA 1C1CA 1IKVB 1H2VZ 3PRBA 2KL8A 1IJFB 1NHUA 3TUJC 2XCPA 3I56S 2DIVA 4ELTA 2WW8A 3MPWA 2F4VF 4DLGA 4ED8A 3D3CJ 3BKUA 5DJBA 3BGRA 1YITS 1LK5A 1W25A 4XAKA 2C2MB 4O4GB 3CXCR 2ZVIA 4NX9A 2R7SA 2D41A 3TAMB 2HWIA 3PKYA 2ZOGA 1D1UA 5A8KB 1TFYA 4QWAA 3HSGA 4N41A 2PIIA 3DI6A 4NLVA 1N0UA 2FZKB 4DXLA 3MUMP 5IOLA 3EJMA 1H2UX 5F41A 2XLJA 4FYYB 2J7KA 1FXRA 2YTCA 3MPDA 2YNIA 2CAJA 4H4KC 3D6FB 1IBMF 2HMIA 4GKKJ 3NOCA 3VR1A 2NYHA 4DL4A 4B9NA 2OJ3A 2Z2YB 4U96A 1H72C 3E51A 2A18A 3KUHA 3UDLA 2Y1IA 3S8SA 1RKJA 2ASYA 1FX4A 3EVWA 2D3ZA 4FPRA 5ETSA 4DX8H 5DZ7A 4ATNA 4OYOA 4CO0A 2ZUGA 4WE1A 1RWWB 2BABA 2FDNA 5RUBA 4WF9Q 3PCOB 3PTWA 5DRKA 4PEOA 5ETOA 4UF4A 3TRGA 4EZ9A 3QNWB 1N0VC 4DL3A 2XMVA 2RF2B 4MTPA 1S10A 1RLDA 4WBFA 2HBZB 3OVBA 1SC4B 3GJSB 4PUOA 4DZDA 2XCAA 2IVFB 5KT3A 5T41A 1DTQB 3BYRA 4DV0F 4LF9F 2VZ9A 5CHCB 3PRDA 4XPEA 4Q2MA 1ELOA 2J9CA 3MTJA 4PQAA 2KTQA 4AD6A 2V2QA 4LSNA 1DHMA 3I4PA 3M2UA 4FF2A 1C2PA 1S1UB 2CWKA 2DRDA 2V8HA 3R2DJ 1BQMA 2QYCA 4WXOA 3BO4A 5IXUA 5L1LA 2CJYB 4EYIB 3C15B 4DUYJ 3D7SB 3DRYA 1T9YA 1WF0A 1QSYA 2BJ8A 1BY9A 2DXDA 4L72B 2D9OA 2VH7A 4AT1B 2YWKA 3MM9B 3OFEA 4A4JA 4EMDA 2QMXA 2BJ7A 4A48A 3P3DA 1G2EA 3J7Z5 1Q0NA 1D3WA 2DHAA 1TK8A 2HHVA 4X2BA 4L76A 4DR2J 3AOCA 2J8AA 4IO9Q 4TNOA 3FBCA 1NH8A 4FKXA 4FYWB 4I64A 2Y9HA 2ATCB 3MM6B 1T9XA 4DWIA 2GIFA 2AGPA 3R1LA 2VOPA 1TV6A 4RNFA 5GAHI 3OTCA 4DHVA 3DI6B 2E1RA 3C14A 2V67A 3NL0A 4M8LA 3DDIA 2OEKA 3MR7A 5GMEA 4PKDB 5K8NA 4I6WA 1AFJA 1FO1A 2ZWPA 1RHMB 4Y2KA 2W9BB 3SIPB 1S1TB 1WACA 4DF4A 2DGWA 5K14A 1HWKA 1UCNA 3OLBA 2GJ2A 3UE2A 1K0TA 4LRAA 1QUVA 5BYQA 3HHDA 4B9LA 2VODA 1HW8A 4IG0B 2R4FA 1T03B 3M2UB 1S1XA 4OIXA 1I5OB 3G6VA 2G1HA 3DOLA 3OVAA 5ETNA 3A8IA 4W90B 1GK8A 3VGUA 2I6WA 1FHTA 2M0GB 1SQFA 2FPHX 2VG7A 9RUBA 3HX9A 1IQZA 2HAFA 4PUOB 4CLSA 4M5DB 3PO4A 3TAQA 1FDDA 3MCSA 2G2YA 2IVMA 3M6VA 2JJ4D 3V6HA 4GO5X 4I7FA 5SZTA 3HCXA 2VG7B 1J2VA 4OV6A 3VQSA 2Z56B 3V4IB 3RAMA 1X31C 2LQBA 1MROB 4MYTA 2VA2A 1HBOB 1ZYQA 2AZ3A 3KK1B 1NH7A 3T5LA 3TARA 2RSQA 1SIZA 2LDYA 3T19A 2EEYA 2MKCA 4ANCA 8RUCA 4YHHF 4RNNA 2P9GA 5ETVA 4DR6J 1KSPA 1XNRF 4LF5F 1SJ4P 2CPHA 5C25B 3J81U 2OMOA 2RS8A 4CO3A 5BJRA 5GADI 3PJXA 1RK8A 2RB7A 4QIWD 3M30A 3H20A 5CH7B 2CZ9A 3I9ZA 2MQOA 1JLGB 2FJWA 4C9DA 1SKSA 3ZC4A 2E9RX 5IT4A 5J1PA 4DL0C 2BA9A 2PGCA 2IIHA 1Q82T 2M3DA 4BS2A 2BXJA 1AZSB 1FEEA 1RB0A 2ROPA 5KFMA 2KH9A 1TKZB 5D0EA 4ZPDA 3BO3A 2V4RA 5D77A 4L3KA 2Q6BA 4NLUA 1X5SA 3SSQA 1T02A 1TL5A 1R8AA 1L5UA 2UUBJ 2XWYA 1YI2S 2ZDOA 3D0HE 2EFNA 2X1GA 1A6LA 1N6QA 1GXUA 4PXDA 4ZHRB 5KT7A 1N32F 5F8NA 5IM0A 4TKTA 3BR9A 2GMJA 1XMQF 2MZJA 5I3QA 4WU2A 3OJSA 4YB1P 2HHTA 3VGSA 3JYTB 4FNIA 1XMBA 1F0XA 1Q1KA 3NLCA 2ZWOA 2YX7A 5IWAJ 2DR6A 1YQHA 3IBCB 4B9MA 3N01A 4O0IA 5F9LA 1IXKA 1VFJA 4XDCA 4BHQA 1ZAWA 4F4WA 2ILZA 2HQFA 1OMSA 4PYAA 1RYRA 2CNOB 3UDCA 3IRXA 1NJXA 4DR4J 4WFNQ 4OX6A 2QE5A 4NI2B 4Z7YA 2Q6CA 2HNYA 2RH3A 3SFGA 1JJ4A 3DM2B 2IRUA 2VKRA 3GYNA 3MMBB 1FWKA 2R8IA 2DPIA 3CJKA 1KFSA 1ZPVA 5C5JA 2J76E 2ZC4A 3FZ2A 1RAIB 3FQKA 4HLBA 4UUWA 1YIJS 1T94A 3IBWA 3EWGA 3MZIA 4WTYA 3D3BJ 1QDUB 5FLXU 1JXVA 4LT6A 5IC6B 4B3RF 2XULA 3HVTB 2YWGA 4LR8A 3KJVB 3Q83A 3A8EA 3ET6B 1ZZFA 3IG1B 4KBIA 5H1SV 2WVBA 4X66F 2XYPB 1PKUA 1R6YA 3N9UC 3VAJA 4Y2CA 4DCPB 2RKIA 5EGYA 5DM6Q 1HMVA 2K2PA 3C16A 4KHMA 1S0NA 1WUUA 4PG5A 2FVPA 4DSLA 4ZN3A 1TVRA 2GHWA 1VQ7S 1SUQA 1I1GA 2CYYA 4A8SA 1A0OB 1KTVA 2NPIA 5GAEU 1RT2B 2DEJA 2KYZA 3AXMA 4R0JA 2CVIA 4ZIWA 1VGYA 2C2EA 4J90A 4MMOA 1NMEB 1MN7A 1FA0A 4ECZA 3PZPA 1JJHA 2QL9B 2ROEA 3LALA 5ETMA 4CLFA 5JMNA 3MM5B 3TUZC 1B4SA 4DFKA 4ZVPB 4YMEA 5HLFA 4B3RJ 2M70A 4JI2F 5L46A 5C24B 3OUYA 3KNAA 1GX5A 4I1TA 3CWJA 1YG0A 5JVHQ 1HQUA 4CYUB 1I3OB 2DD8S 3AJ2A 3I87A 3EVOA 4OYBA 1YSJA 3R7BB 2RHSB 2DNLA 1PYSB 3LW5C 4AQYF 5C7PA 2LLZA 4O23A 3HD1A 2HNYB 3NGKA 4ZITA 4B9VA 4FF1A 4GVBB 1XWLA 2A10A 2NCKL 3MCMA 2KVQE 1HI8A 2BE2B 3SQOP 5FLXY 1XTZA 1YJUA 3W9HA 2JFKA 1Q7LB 5J1NA 3BO2A 1J5EJ 2VPYB 1LQ9A 2Z58B 3CSKA 2RF2A 2V2VA 5KT2A 2B9WA 3R5JB 4OI6A 2YKMB 5AXKA 2DHSA 3KK3B 1U47A 2P6SA 1VRUA 3VGVA 1XC9A 4LFBF 3CIZA 5KG4A 4OZ0A 2LEPA 3MM7A 1VIOA 5KFBA 2LU1A 4YDXA 2WVDA 4EO8A 1N4LA 3CD7A 2UXCJ 3DRXA 3RR8A 2HW3A 1GNKA 2HQIA 5A8WA 4PWDA 3HVAA 4MFBB 3C3LA 3LQVA 1N32J 5LXRA 1OQ6A 4KIAA 4C2MA 2CQ1A 3R5CA 3KLFB 1KQKA 2LQJA 1U26A 2X3GA 2V63A 4MIAA 4USIA 1PSDA 1UWBB 3DMJB 3QZ8A 4KY3A 3R27A 4OJGA 5KFTA 2WAQD 3BJYA 1RJJA 4OV1A 2V8GA 2Q66A 1MSWD 2C28A 1FDBA 4O4GA 2GCFA 3W5ZA 3BH7B 3BDEA 4EGLA 1NXIA 3DGVA 3KNGA 3QIPB 3M9MB 3R97A 3CF5Q 5B09A 4DEZA 3V6JA 1NPKA 2L3MA 1VJWA 3PO5A 3GJTB 3PKMA 2F1FA 1WHYA 3AA9A 2B51A 3QJJA 1FJCA 3ZFVA 1WEZA 1NPPA 5LXYA 2WCXA 3PIOQ 2VICA 1L3TA 5JUMA 3T1HJ 4Q43A 3UD3P 4P52A 4M5JA 4ANEA 5AXNA 2AMCB 2BW2A 2F9DA 2FVSA 3WX8A 4NCAA 4DLEA 3KHRA 1FRIA 2VKZG 1ZS6A 3MOZA 4U7UK 1UJ6A 5HMYA 2VONA 3GB0A 3UQSA 1D9DA 3RRKA 2LXUA 2MDAA 3QBCA 1DBDA 4K7QA 4PQUA 3FUYA 4ENOA 2EBEA 2R3VA 2E5LJ 2K3KA 5HROA 4FF3A 1WG4A 4IRCA 1Z2LA 2PI4A 4ICLA 3MMAB 2ZH3A 1PG5B 2CXEA 4DV3F 4PQUB 2ZEJA 2DNNA 3CEDA 5LMUF 2BV3A 2DJWA 3ILJA 2UVVA 3NRBA 1SC3B 2DK2A 3GIJA 2NREA 2D9PA 5J1EB 3WZ0A 1WELA 3ITHB 4WYLA 2KG1A 2NS1B 2B56A 1N5YA 2YNIB 5L1IA 2FLPA 1RTIB 1WSVA 1TFWA 2JFDA 4W4MA 3TQEA 4Y28C 4UT4A 2J8SA 3J81j 3KLIB 2F63A 1A7GE 2ZNZA 3PDNA 3KTQA 1BD6A 4NMLA 1NM2A 2ZBPA 4U6PA 4FPIA 4PPDA 2IBKA 2VQEJ 1SIWB 1X60A 2R7RA 3W8PA 2BMBA 3M8SA 1W26A 1WI8A 4QYZJ 4ED5A 3CCES 3GLJA 2BANA 1AA1B 1JB0C 1SUQB 3FVYA 3HKWA 5GVQA 4M1KA 2LEBA 4JI7J 1WWHA 2ZC3A 4XDDA 3HF5A 3QIDA 4AXIA 4DI6A 1U1KA 1N34F 4EZ6A 1Z1ZA 4ZCKA 2EWHA 2OFGX 4KKOB 1FJ7A 3HHEA 1RWUA 2W8LA 2AW0A 4O3PA 3DRPB 3KK2B 3FDSA 4NYOA 2DIUA 3CCMS 3TO8A 4EBDA 1TAQA 3OTEA 3TEGA 5FDLA 1U1OA 2SXLA 4WPAA 3TZXA 1U2FA 4RW7A 2Y0BB 4KGKA 2LCWA 4LVNP 2X1AA 3LWMA 3K17A 3Q2TC 3ISZA 1VQOS 4O3RA 1UPMB 3HFZB 2HHUA 2EVZA 2EFVA 3IP0A 4IRKA 3I4HX 4FXDA 3IR5B 2XNQA 2CJBA 1HIYA 3AOBA 1Y5IB 3M2VB 2CNKB 4M5LA 3ZTOA 4CTAA 1HR0F 2BM0A 2R7OA 1HBNB 2E29A 4FVMA 4L74A 4USTA 5DGBA 1JNRB 1RHQB 4DSEA 3BSOA 3E2EA 1H38A 3M2RB 2DCUB 4OX9J 3JXOA 3OL9A 2IJNA 4DV0J 3MF5A 1UJ5A 3HVWA 3ICLA 4QW8A 1O8BA 3MUTP 2JLFA 3HFKA 3G6ES 3JS9A 3SV3A 5G0RA 3MUVP 1GFWB 3UCUP 3W66A 3RB6A 1TL3A 2CPEA 3CDAA 3EZOA 3GIRA 3M1VB 2XI3A 3V6KA 2G1DA 4HT7A 3BQ1A 3H5YA 3IS9A 1CJTB 1X5TA 2DNHA 1PBUA 4O44B 3SEOA 2YH1A 1KEKA 1LV5A 3OR2B 1IBMJ 3ULHA 1Y7PA 2LKZA 2J0SD 1WOPA 3S1TA 2HZCA 3OXLA 3ETOA 3P5BP 5L1JA 1Q53A 4DDFA 3W8GA 4J9SA 3DLBA 2CJAA 1U1NA 2HFZA 2R8HA 4ELUA 5IS2A 3FKBA 5F8LA 3KOAA 3VHQA 2MPUA 4K4XA 2C3UA 3UPFA 4P71A 4QU6A 4MT1A 2F4VJ 2O66A 1JLCB 2D3O1 4WCEQ 2DYAA 4J9OA 2CRLA 2NPFA 5HP1B 2GAHC 2HBQB 3OFGA 1ZBTA 1QAXA 1N36F 4OFZA 3KLVA 3CDWA 4Y3CA 2DRBA 3SFUA 4F3QA 5A8RB 1TL4A 2KJWA 2YKOA 4Y34A 4JI6F 3P8BB 5DDPC 4ETXA 1U2CA 4WFYA 4NLTA 2V5HG 4QR2A 5D6GA 2WVEA 2QFIA 3HULA 3RRHA 3DOKB 1REGX 2H5JB 4CO1A 2CQIA 4DR1J 4I7FB 3AB2B 2OSQA 3LH2S 2AJ1A 4OZ1A 4IOCQ 2OD6A 3H2VE 1N54B 2YNHB 3TA0A 2EG1A 3Q24A 3DOKA 1IN0A 2H5IB 5A2QU 1SL2A 1BGXT 2XO6A 2YNGB 2BEFA 3ILLA 1D8ZA 3A12A 7AT1B 1V3RA 3AB4B 2BX6A 2DGSA 3RBXA 3L7UA 5DS7A 2MZ1A 4ECQA 4Q8FA 3NGRA 4F2RA 4IG3A 4ZPCA 4QWBA 1H2TZ 1D9FA 1S99A 4KGMA 3D1OA 1T11A 1FJGF 1RABB 3OSPA 4USJC 1YJTA 5F8IA 2BANB 4RUHA 3SI8A 2YX4A 2YKAA 1YGYA 2IJRA 3HHLD 1KP6A 3MM5A 1YDLA 4K8RA 4QPTA 1HBUA 3CO9A 4N5SA 4URSA 4IQXA 3T5JA 3KUGA 3BGFA 4KH1B 2J6SA 2WHOA 1V9OA 2DR7A 1KC8T 4NZ0A 4F8RA 1UWBA 4NXMJ 3LGNA 3MR3A 2PA8D 3R5GA 5M2PA 5DQHA 4WTOB 1NJYA 1K73T 4ECVA 1KQSR 2Z2MA 2VG5A 3OSNA 2ZZNA 2VG6B 3D5MA 3CT9A 3HDSA 1LOUA 3JB9k 3IRXB 4ECSA 3GWCA 4TLQA 2EW9A 6FD1A 3KMQA 2JH3A 1FRJA 1NDCA 3NMRA 2R8KA 5E3PA 3CCZA 5CYQA 2W1BA 1RU2A 1WHWA 4RWXA 3SQGA 5L38A 1ZAXA 2VJVA 2FVRA 1KFDA 3MM7B 3UNYA 4ZLNA 2AQ4A 3QRQA 1TK0A 2IRXA 2XM3A 2I2YA 4OZ3A 2KJVA 2IPOB 3BYPA 3M6UA 4NRTA 2MSTA 3DCAA 2VFUA 4J9NA 1SV5B 1JQGA 3M2RA 1Q5VA 1TP7A 2BUNA 2VFVA 3KK1A 2QMUB 2CQGA 5EN1A 2NYIA 1RWXB 4M5MA 4USHA 5CYMA 2IHR1 4JI0F 2KM8C 1HNXF 5B0AA 4B3OA 3MMAA 4KE5A 1DAXA 4EBEA 4IH7A 4QYZK 1RTHB 2QG9B 3DU6A 3ZTRA 2VA3A 1WORA 1VQYA 2K1RB 5KOWA 5H9EJ 3IWXA 3CJRA 3TYTA 3BBBA 1WTBA 3IGNA 1UZHA 3K8WA 1HNIB 4UQTA 3LF0A 4LF6F 4ZLJA 1SH3A 4C0BA 2NXNA 4NLQA 3WC0A 1FVQA 1LNQA 5DQGA 1S57A 4ZVHA 5E33A 3QGHA 1URNA 3LANA 1U09A 1UEVA 5C42A 2W25A 4USWA 2FHJA 1WC5A 2J7WA 1H74A 3GCXP 4PXCA 4A8QA 3KG4A 4G6VB 2XMAA 1J27A 3D28A 2PE8A 1NDPA 3MCOA 3MMCB 1U8WA 4JI1F 1MLAA 3TOQA 1RT7A 2OSRA 4RL1A 3UD5A 5HQMA 3T1YF 3H59A 4YB6A 3JAMY 3VTIA 1XJWB 3C19A 1RHKB 2HRUA 3S01A 4F26A 2WOMB 4K4UA 4MH8A 2B8PA 1R8HA 2QO3A 4YFUA 3HP6A 3KJFB 3MEEB 3NGTA 4X65J 2PDAA 3G6YA 1RT4A 2VBYA 4KHRA 4OZLA 3UVJB 2C3OA 4ECXA 3T3FA 4IR9A 1GH8A 4XTTA 1REVB 1S76D 3ADAC 4GKJJ 4MFBA 3Q89A 3RW6A 5J1EA 1IM6A 1WD6A 4L73A 2O1PA 1P6TA 1FJEB 4KTQA 2UZAA 4WZMA 2I0XA 4K59A 4DV7J 1CJKB 4IFYB 2H48B 2KXHA 3M8YA 3QJLA 2NXUA 4P6QA 1BUXA 2ZZMA 3L95X 3ZZYA 3NWGA 4KGXB 1XMOF 1VBKA 2ABYA 2AEFA 5ETLA 3VAGA 4DQSA 1RHJB 1RHUB 1NBEB 1RTJA 3R5AA 1SKRA 2JX2A 4M95A 3Q8VA 4CLUA 4TU7A 3WC2A 1V6HA 2QC3A 2M88A 4RW8B 2GVZB 1FKOA 2VBWA 2VDHA 2FJBB 1OO0B 2XMJA 1FKPA 4QQBA 2EPIA 4NXNF 4X4UA 3MAAA 1TKZA 4OJ3A 2R2TA 2BDPA 2UUCF 3FBBA 1RT1B 1ULRA 4CDIA 5KG7A 5E0OA 2E5IA 3HMJG 1YZ7A 2QJ3A 3CC2S 1NKCA 2V69A 1FDAA 2GMLA 2XZWA 2Z8QA 1G6BA 1UZDA 3L3CA 1SJ1A 3DHXA 3UD4P 4DR6F 4J9QA 1S1WA 2MHNA 3PRVA 1RWKB 1F3FA 1MMNA 1NSQA 5I3UB 5HI7A 4C11A 4F2SA 5LSOA 3M8QA 2GA7A 3QAEA 4P75A 4X62J 1NKBA 3SSSA 5KFPA 2GQQA 3A4TA 4ZJLA 4G1QA 1FDNA 3C6TA 2GIQA 2YNFA 2CQHA 1DQAA 3M32B 4H4MB 4ID5B 1EAYC 3JSYA 4DSIA 3PG9A 2HS3A 2IBOA 3PIPQ 4DQQA 3M8RA 4QWEA 3U27A 3KLHB 1UFWA 4CLYA 3TANA 2C3PA 1TL1A 2WVCA 3WQPA 5K8PA 1IBLJ 4JP8A 2UVWA 4M5IA 2RUGA 3M7VA 3V5RA 1SI9A 1VRUB 1SQGA 2F8MA 3BN7A 3KLIA 4Q45A 3KK3A 2QSFA 3AJ1A 2QT7A 4OZ5A 4QIVA 4NE9C 2CQ2A 3A8KA 4QJVA 3RG6A 1LEOA 1GAOA 4NASA 2O5DA 3CMQA 1HHQA 1OY9A 1X4FA 1HR0J 1R3NA 4KH0B 5F3TA 4CLKA 3W65A 3W1YC 4F3MA 2OP5A 3T1HF 2HZAA 3RB3A 4YR0A 1RP5A 4P2MA 5MAOA 3KDNA 2HVDA 1X8DA 3AODA 3WX4A 4DSFA 2R7VA 4C98A 3C6UB 2HAIA 3D9BA 3LA0A 3OVSA 3OV7A 1EP4A 1Y11A 1YRUA 4PWWA 1VYAA 4RW4A 2V9KA 4Z37A 1TQLA 2CWXA 4DV1F 4B3SJ 1AT1B 3N79A 2M8DB 2DRAA 4NLSA 5EDWA 2KXFA 4HHHA 1Z4UA 3C14B 2ZH6A 3H4BA 4KJIA 2EI5A 1NDLA 2NXEA 2I5JB 5G4DA 2WBRA 1VQNS 2QEXS 4DV1J 2H9ZA 1OWXA 4RR5A 1DTTB 2P5VA 1CLFA 2DHXA 3K0JA 3C16B 1M5KC 4KKOA 2JEIA 1U6ZA 1JKHA 2B5JB 2NUUG 3HI9A 3PYEA 4QIEA 4F0HA 4ZK7M 1M90T 1DRZA 1YRXA 4URQU 2AD9A 1HLWA 2HVHA 1DURA 2IY5B 1DTTA 5L1KA 4ECUA 5B08A 2W2QP 1Q86T 5EWGA 2FIUA 2YBVA 1WNEA 2RDIA 2CNNB 2Q3PA 2BZ2A 4DUZF 1U1RA 5G0RB 3EVMA 1I6JA 3OL6A 1O5JA 4KC5A 1SKUB 2I9SA 2G13A 1YZ6A 1E6VA 4KB7A 1BQMB 1KHVA 4AFFA 4J9PA 3TVYA 2QMWA 1TELA 3BKFA 4M5HA 5AXLA 2ZH1A 1PGZA 4DR3F 1XNQJ 2GGPB 5KFFA 3PXGa 5D0GA 1OYDA 1HBNA 3RAQA 1UVJA 1ZA1B 1UEKA 3QT6A 4LSZB 5HANA 2YWEA 1FTRA 4QU7A 5IT9Y 4J9UE 2OTJS 3CCTA 3D4JA 3SV4A 2NXCA 2BACA 4R0EA 3HLUA 2HFVA 2ZKTA 4P7TA 1S5ZA 5KT4A 2IM1A 3DYAA 3G87A 3M8WA 2D1CA 2ROGA 2XI2A 2MKKA 1BMQB 1S6PA 2ALYB 3I6PA 4DV6F 2XYGB 3TZWA 4B3MJ 3HKZD 3IAM9 1YBAA 2YH0A 4NMXA 1UP1A 4RUBA 4ZHRA 2W7AA 1X4DA 4LSLA 1VI7A 1NKEA 1B99A 4FYDA 4F3OA 4DPXA 2RRBA 2E7VA 4CLTA 3PHTA 3MOJB 2DY9A 2E1MC 2OPRB 2RS2A 4FP9A 4QYRA 2VDIA 1FXLA 4RX6A 3PX0A 4OI3A 4KSEB 1N8RT 3CB4A 5CD4A 5KFLA 9ATCB 2OPPB 3SBMA 4DR5F 3G9CA 4JI3F 3DLKB 3NCPA 4MK9A 4Q8EA 1S9EA 2Z2ZA 1RACB 3HFVA 3K58A 5LMNJ 1ZPWX 2QN6B 3V4IA 2OPSB 1PILA 3HHLC 2J9EA 4DL7A 1VBXA 2FYXA 2AJ4A 4J9VA 1R7IA 4EEYA 1J5OA 3TW0A 2RUSA 5KG0A 3WBZA 2DO0A 4DG1B 1AUSL 1SH2A 2A3JA 1HYSB 2XHCA 3MEDB 1VMBA 5AE1A 2ZE2A 1XR6A 2M52A 3HHKA 4W92B 4JV5J 2LQ9A 5CABA 2YNGA 4LRBA 1LWEB 3FFIA 1JK9B 3ET6A 2POKA 1VJQA 4ZJQA 2CPIA 4OHVA 1HBOA 1HI1A 2CPYA 3BQ0A 1DLOA 1S7HA 2RAQA 4F4ZA 5J2MB 5I42A 2KB2A 4B3TJ 1S59A 2YNHA 2GJIA 4CLWA 4WIIA 1TL7A 4WJBA 1RCXB 2L9NA 3CNQP 2I1RA 4U7CA 1IJEB 1VQPS 4NXNJ 2GMHA 2G0CA 4O3SA 2GJFA 2AHOB 3GPAA 5KFAA 5J2MA 4ED3A 5IQQA 4CNZA 2NSCA 1RISA 4ILLA 2BQRA 1CJKA 4IFYA 2MHEA 1UL3A 4FN5A 2ZBQA 4KPCA 1I51B 2DR8A 2V8VA 1F2HA 2GHVC 3G86A 3KG0A 3CDBA 3W63A 1XMOJ 3MEGB 2JEJA 4PZVA 4M94A 1W2IA 4TYBA 4F67A 3V4MA 2QL5B 2EK1A 4FDFA 1S0VA 3IR7B 1MW7A 3GV8B 3W62A 1F5AA 2VD3A 4N8NA 4I6AA 5D78A 2IM0A 1R89A 1KOHA 1NNDA 4USKA 5K14B 4CLPA 3JTPA 4DU8A 4F4AA 6FDRA 3OJUA 3R3TA 4DL2A 3H0PA 5GMKa 5I3UA 2DNYA 2H1YA 2X1BA 4KAIA 3UCGA 5D0RA 2DH8A 4OZNA 1V5VA 2M8HA 2OPPA 3BPSP 5HSPA 1IKWB 1S9EB 2B5JA 3MI7X 1VBZA 1QD1A 4ID5A 2LA6A 1X4BA 4N8OA 1P27B 4CLZA 5J2PA 4MKBA 1S1VB 1F9HA 1OJ4A 1TUVA 4NZ7A 2W2MP 2QA2A 2IDLA 1IKWA 2DITA 5A0YB 3MURP 1ACMB 2LQ8A 2AP6A 1HNZF 1VQKS 4CT9A 2KI2A 2WSFC 3LWLA 4NCBA 4YR3A 3BN4A 2DB1A 1BQXA 3GILA 5GADU 1V5IB 3I0SB 1N36J 1BLUA 2DPJA 2XGQA 4DSKA 2P9EA 1SCJB 1RTDB 4JI3J 2YKMA 4CM2A 4OYPA 3MMBA 5HROB 3CUNA 4NEZA 2F7VA 4WFZA 3R9LA 2L08A 4NLOA 3T9ZA 5KFUA 1HQ2A 2DGOA 3EXYA 1VK8A 1DLOB 2EC2A 3AD8C 3FEZA 4NLPA 5KFDA 3AY0A 1S79A 1LWXA 2GVZA 4OJHA 3SCIE 1IKYA 3W5YA 3OFHA 5CYMB 1NJZA 1RAEB 1MG7A 2Y3YA 2VFTA 1EX8A 4E2FB 4DV5J 2F9JA 3P5TL 2XBPA 4F50A 1SJRA 3ZTPA 5ETTA 4NRUA 4IFVA 5IFMA 1RBLA 1UVIA 4B3MF 3B4MA 3NS6A 2YKNB 3HHLB 2UVUA 2NUHA 4OYWA 4JI0J 4ZJOA 4OZ2A 1RTZA 3PACA 2B8QA 4OL8A 2BOAA 1QE1B 2VPZB 2ZDPA 2J6TA 1C4CA 4AL5A 3TZYA 2RNEA 4LRFA 1B7FA 3OXFA 5CAAA 2OELA 1FJGJ 4OI4A 1HBMB 3IR6B 4H54A 4ED4A 3GIKA 3DOLB 3AH6A 2ZJPQ 2ACYA 2FVQA 4DJBA 3JSMA 3DLKA 2CIMA 4YR2A 3OHAA 3C6TB 3M32A 2JZ5A 4H4MA 2KG0A 4IH6A 3U1MA 1FRHA 2D74B 4J9MA 4MIWA 1VHIA 2OLWA 3JSMB 4MYUA 2M5YA 4DUZJ 2MJUA 4LRDA 1CULA 2R2RA 1WEYA 3JTOA 4PG6A 2FVCA 2ZFHA 1RWPB 3DLEA 4F04B 2KFZA 2PMHA 5F9NA 2CDRB 3SMZA 3FCVA 4YHHJ 2Z57B 2OO4A 3NP5A 4DSJA 4JV5F 2RT3A 3MPVA 4FYVB 1N5QA 1N5TA 3IWLA 3C8YA 1N5VA 4M5DA 4X4OA 1R6VA 2MKHA 4KFBA 2RMLA 2LEAA 2DY1A 5ETQA 2YX1A 1UAWA 1U0HB 1B0VA 1TMMA 2ZD1A 3A3OB 3N5BA 4RW8A 4Z7CA 2C42A 2W7PA 3IS9B 2B4VA 5KG5A 4O4RA 2U1AA 5LM7E 4HT5A 2DH7A 3Q23A 3JQJA 1QE1A 5HL7Q 3FK4A 2QRRA 3POTA 1S6PB 4K0KJ 3UR0A 2WK4A 2G2OA 1GQEA 5HK4A 5E3AA 1F3VA 4C97A 3T41A 4JV0A 1X5OA 4I69A 4CO5A 1RT5B 3VALA 2OAUA 1GMUA 4WFBQ 2P8IA 5J2QA 1ZTWA 3WHIA 3GMGA 4WP3A 3POTB 3ZZUA 4YS2A 4Q0BB 5KFYA 4GKKF 3BSCA 2RRAA 2YKPA 4K5SA 3BPDA 4TY8B 2NZCA 4DPTA 3LP1A 5MLCV 3TI0A 4RBVA 1PAUB 2OPQA 2QYGA 1HHSA 2JC0A 4NLXA 4YY3F 2M4MA 2RDDA 3MD3A 2JL9A 3QAUA 4KV8A 2HHWA 2AGOA 5C42B 1B7YB 2AEJA 2VG5B 5HMZA 4XPCA 2NQPA 2BBEA 3R7NB 2MXYA 2J7UA 2RE1A 3VWSA 3LTOA 2ZZTA 1QM9A 4ZOSA 3FJ2A 2DGQA 2R9LA 4MKYA 4OJ1A 4JYAJ 1U0SA 1K47A 2I5JA 2B6AA 2AV5A 3GG0A 3LPEA 2VOOA 5HMWA 1LK7A 2OGUA 4V19J 4DPYA 1Y5LB 3ENVA 4DMZA 2H5EA 3J7YI 3RBDA 1NLKL 1VLYA 2RQ4A 3LGHA 4X4RA 1JKHB 4O3QA 1JLEA 2VBXA 3DRRA 3RTVA 2PT0A 4J7CA 1HPZA 2Q1LA 2OKQA 3T5KA 5KG6A 1X0PA 3DRSB 3FCWA 1S1UA 5F3ZA 4X62F 2VC1A 4LSNB 3ZZZA 5HVFA 2V4QA 2ZOMA 1R8PA 2FJEB 2G0IA 2GFFA 4U8VA 2AJ0A 2FLOA 4I68A 3GIMA 4A8YA 1LWFB 1VC6A 2R7UA 4FYXB 4YY3J 5D4OA 5F0UA 1DARA 2FC8A 2LXFA 2O67A 3U7JA 5DG9A 3NEKA 2FLNA 4ZP6A 1TMJA 4P74A 4K4YA 2RIJA 3NGUA 2L41A 2HS4A 3J80U 1CJUB 1U8SA 4V1Ak 4WXWA 1RE1B 1S6UA 1OY6A 2CDQA 4ZPVR 1IVZA 3KUEA 5DDOC 3PR4A 4JV1A 4J37A 3RBZA 2AJQA 2IM2A 1RLCL 4M5KA 1X9SA 1QSLA 2HEKA 3BBFA 3BEGB 3LP0B 1FK9A 3N6NA 2HPUA 2VASA 4ID8A 4C0OC 4HYKA 1YVFA 5D3GB 1M5OC 1F9FA 5J2QB 4RW6A 4JI1J 4J9KA 3EXCX 5IT9U 2XY7A 2BRKA 4C3KA 1FX2A 1VR6A 1ZOTA 2C2ZB 3P45B 4KR0B 3MR5A 4G3IA 1S1TA 1UVNA 1AZSA 1EKSA 4LVOP 4FVCA 4JV2A 4HHUA 5A6PA 1UFKA 2ZM6F 5D8HB 3QMQA 3F44A 3LP2B 3O2IA 3RU0A 1S1WB 1HBUB 4EO6A 4ZVUB 1A9NB 4OI1A 5FDLB 3OHBA 3PW0A 1BWEA 3KWMA 1DQ9A 1FFWB 1U1QA 2PSZA 1FI4A 2CUYA 4RJVA 2OTLS 2BJDA 2ZE2B 4K4WA 2R2UA 5A0YA 3HD2A 3KXDA 4EWTA 1U2RA 3LGMA 3M05A 3NCRA 1ZM9A 4P2FA 3FCHA 4C3MA 5HQLA 2AYMA 5LT5A 1JIHA 1S12A 1WC3A 2OEMA 2XZTB 1OSCA 3BREA 3EGNA 2V8PA 3W2WA 4HVZA 4AL6A 2MLZA 2HVEA 2J5AA 4JI4J 2GV1A 1NRKA 4DV3J 1WC1A 2HHPA 3T1YJ 1QTNB 1P9QC 2VUGA 5HBMA 1WHVA 1WEXA 5GAHU 1FESA 3PEJA 4ZPAA 1M5HA 1NU4A 3KYLA 1EB0A 2JHEA 2ZBIA 1HNZJ 1FRXA 3A1YG 1R31A 4NI2A 4JB8B 4QR0A 2ZH4A 1S72S 4JYAF 3J7YU 3EGVA 2DNGA 2CPFA 3CD6S 2V2ZA 2QL7B 1HWIA 3OT9A 1F5BA 2C2OB 4HL9A 4PWUA 1X9WA 5CYJA 1VQ9S 2HLUA 1C0TA 1WOSA 4PG4A 3MPYA 2WONA 3ISNC 4ITSA 1VDHA 1O0PA 1B70B 4DN0A 1GMWA 2MGZA 1KOOA 5E3CA 1E6YB 4C8NA 1R0BG 4WP9A 2X3DA 4DX5A 4YUDA 1U6FA 3CCUS 3D2WA 4DPOA 2MZQA 1S77D 2W9CB 4TVAB 1EHWA 4LF1A 2W2OP 1HNXJ 5F8HA 2JRSA 3L7OA 4I0WA 4ED6A 1WG5A 4OYMA 1K0VA 2V68A 3CMAS 2PD1A 1W2BR 3CCQS 3HZEA 3Q2SC 3A13A 1T03A 1H6KX 2LVWA 3FRZA 4BLGA 3E3XA 2Q79A 3AJDA 2W8KA 3EUNA 1OPIA 3AA8A 3M6WA 4DQIA 3I5BA 4G1QB 3MR2A 3J7AN 4BWJA
chains in the Genus database with same CATH topology
1HLWA 4WBFA 1ZS6A 2B8PA 3VGSA 3Q8UA 4UOGA 3NGTA 1NLKL 3Q86A 3VGTA 3VVTA 4ENOA 3EVMA 3FCWA 4W98A 2CWKA 3Q89A 1NCLA 4CP5A 2VU5A 2DXFA 4DZ6A 2DXDA 3R9LA 4F36A 1KDNA 3BBCA 1BUXA 3FBFA 3NGUA 1LWXA 1XQIA 1XIQA 1JXVA 2BEFA 3EMTA 1S5ZA 2BX6A 4ANDA 3PJ9A 3L7UA 3Q83A 4FKYA 3NGRA 1NSKL 3EICA 3Q8VA 3FBCA 4FKXA 3ZTPA 1PKUA 3BBFA 3GP9A 1B99A 2B8QA 3DKDA 3B6BA 3DDIA 4DUTA 3EE3A 3FBBA 1NHKL 2DY9A 5CAAA 1W7WA 1MN7A 4DI6A 2ZUAA 1BHNA 1NDKA 1B4SA 3PRVA 1UCNA 1NB2A 1F3FA 1NSQA 1WKJA 4C6AA 2AZ1A 2HURA 3EVOA 3Q8YA 3VGUA 4UOHA 5C7PA 1NDCA 2NCKL 3ENAA 3VVUA 3EM1A 2HVEA 1HIYA 3ZTOA 5CABA 3FCVA 3ELHA 3ZTQA 3VGVA 3ETMA 2AZ3A 1LEOA 3FC9A 4UOFA 2DXEA 1HHQA 4ANCA 3JS9A 3BH6B 1S59A 1PAEX 1MN9A 1WKKA 3ZTRA 4O0NA 3GPAA 2HVDA 1F6TA 1NUEA 3BBBA 3FBEA 4KPCA 3NGSA 3EJMA 1VYAA 1K44A 5IOLA 1BE4A 3MPDA 1EHWA 3BH7B 1S57A 1NPKA 1NDLA 4F4AA 3FKBA 3EVWA 3ZTSA 4S0MA 1NSPA 5BXIA 1NDPA 1U8WA 3B54A 3G2XA 4HR2A 4ANEA 4EK2A 2DYAA 3WX8A 1WKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLW A;  4WBF A;  1ZS6 A;  2B8P A;  3VGS A;  3Q8U A;  4UOG A;  3NGT A;  1NLK L;  3Q86 A;  3VGT A;  3VVT A;  4ENO A;  3EVM A;  3FCW A;  4W98 A;  2CWK A;  3Q89 A;  1NCL A;  4CP5 A;  2VU5 A;  2DXF A;  4DZ6 A;  2DXD A;  3R9L A;  4F36 A;  1KDN A;  3BBC A;  1BUX A;  3FBF A;  3NGU A;  1LWX A;  1XQI A;  1XIQ A;  1JXV A;  2BEF A;  3EMT A;  1S5Z A;  2BX6 A;  4AND A;  3PJ9 A;  3L7U A;  3Q83 A;  4FKY A;  3NGR A;  1NSK L;  3EIC A;  3Q8V A;  3FBC A;  4FKX A;  3ZTP A;  1PKU A;  3BBF A;  3GP9 A;  1B99 A;  2B8Q A;  3DKD A;  3B6B A;  3DDI A;  4DUT A;  3EE3 A;  3FBB A;  1NHK L;  2DY9 A;  5CAA A;  1W7W A;  1MN7 A;  4DI6 A;  2ZUA A;  1BHN A;  1NDK A;  1B4S A;  3PRV A;  1UCN A;  1NB2 A;  1F3F A;  1NSQ A;  1WKJ A;  4C6A A;  2AZ1 A;  2HUR A;  3EVO A;  3Q8Y A;  3VGU A;  4UOH A;  5C7P A;  1NDC A;  2NCK L;  3ENA A;  3VVU A;  3EM1 A;  2HVE A;  1HIY A;  3ZTO A;  5CAB A;  3FCV A;  3ELH A;  3ZTQ A;  3VGV A;  3ETM A;  2AZ3 A;  1LEO A;  3FC9 A;  4UOF A;  2DXE A;  1HHQ A;  4ANC A;  3JS9 A;  3BH6 B;  1S59 A;  1PAE X;  1MN9 A;  1WKK A;  3ZTR A;  4O0N A;  3GPA A;  2HVD A;  1F6T A;  1NUE A;  3BBB A;  3FBE A;  4KPC A;  3NGS A;  3EJM A;  1VYA A;  1K44 A;  5IOL A;  1BE4 A;  3MPD A;  1EHW A;  3BH7 B;  1S57 A;  1NPK A;  1NDL A;  4F4A A;  3FKB A;  3EVW A;  3ZTS A;  4S0M A;  1NSP A;  5BXI A;  1NDP A;  1U8W A;  3B54 A;  3G2X A;  4HR2 A;  4ANE A;  4EK2 A;  2DYA A;  3WX8 A;  1WKL A; 
#chains in the Genus database with same CATH topology
 1T3O A;  3ENQ A;  3SDE A;  2MQM A;  1FRL A;  3IM9 A;  3Q8U A;  3EDQ B;  1RWO B;  1X9M A;  3GFX A;  3Q86 A;  4YB7 A;  4DV7 F;  1J5O B;  2KXN B;  5AT1 B;  2NR0 A;  2OUG A;  3W3S A;  5LOQ A;  3CJQ A;  4HAC B;  5IWA F;  2C2N A;  5LJ5 Y;  5KFN A;  5IC4 B;  4GKJ F;  4XIU A;  3H25 A;  4RWW A;  1M5P C;  3GFH A;  4R25 A;  5J2N A;  1T05 A;  1NK9 A;  2KFY A;  3QJP A;  1UTA A;  5ETR A;  2RJZ A;  4N56 A;  1V3Z A;  4DZ6 A;  4X65 F;  1UVM A;  1BC6 A;  2B4U A;  2A1B A;  5KFQ A;  2WRM A;  2QA4 S;  1VK3 A;  1QAY A;  1LW2 B;  1S48 A;  3FEY B;  3PYG A;  3M2V A;  3MEK A;  4CTA B;  4NEY A;  5DLF A;  3O5T B;  3BV8 A;  1IBL F;  1K1S A;  4ZDN A;  2PN6 A;  3RAX A;  3Q8R B;  3EGZ A;  4U8Y A;  4U67 Q;  4RKU C;  1EP4 B;  1ZM2 A;  5HVG A;  4B9T A;  3MCN A;  3W5X A;  3W61 A;  4F7V A;  4JI2 J;  2H54 B;  2WON B;  2OI2 A;  4LBP A;  3Q8Q B;  3GU0 A;  3GE9 A;  4MIB A;  4C8M A;  3ZNU A;  3D0I E;  2D7S A;  2JSX A;  2PFD A;  3DLJ A;  3O6Q A;  3BDP A;  2DGV A;  3DKD A;  4ECW A;  5AE2 A;  2W7O A;  3H5S A;  4H4O B;  2KZZ A;  1CJV A;  3H8Y A;  2F3J A;  4PXB A;  2BYC A;  2DHG A;  4KO0 A;  4UZB A;  2ZH8 A;  1ROF A;  2F65 A;  2W4C A;  4CM0 A;  2HVZ A;  3TEH B;  3F56 A;  2LQ5 A;  3W2V A;  5BYR A;  4C48 A;  1ITP A;  4ZCL A;  4E98 A;  2B3T B;  4F0M A;  4USV A;  2RDJ A;  2AX0 A;  1NK4 A;  1OPZ A;  1FEH A;  1MNE A;  2RQK A;  5DO2 A;  5C24 A;  2CJQ A;  5T7L A;  5ETP A;  5A6W A;  5DET A;  3OUY B;  1M1K T;  1XER A;  4OHY A;  3K59 A;  1WKJ A;  2N7C A;  1U1P A;  1AB8 A;  2FY8 A;  4ETZ A;  5K8O A;  5KFI A;  2R7X A;  1M5V C;  1N52 B;  1T0T V;  1NK8 A;  2YPZ A;  5IQ6 A;  4DFP A;  4X64 F;  1KLM B;  1TKT B;  2HHH F;  2QLF B;  5GAG U;  4IH5 A;  2C2D A;  1JXL A;  3VVU A;  3HSJ A;  2WVF A;  1YHQ S;  2V34 A;  4I67 A;  3EM1 A;  4KPY A;  1RDR A;  1P8G A;  3VZH A;  5LMN F;  2KRR A;  1N48 A;  1HYS A;  1RAA B;  1JLB B;  1WF2 A;  2AJ2 A;  3I31 A;  3MGJ A;  4LR7 A;  3D67 A;  4X4S A;  2F8H A;  2WSC C;  3ZO7 A;  1KVK A;  1VQ8 S;  2K7J A;  3ELH A;  4JBC A;  4OX9 F;  3T9N A;  3KLG A;  1VQ6 S;  1LXN A;  3ETM A;  3LPY A;  5FD1 A;  3TVK A;  2DBB A;  5B0D A;  2MYF A;  2RQC A;  4C4W A;  4IKA A;  1FE0 A;  4I2P B;  5CQG A;  1GTH A;  4ZP7 A;  3NXZ A;  3AFG A;  3BR8 A;  3IBF B;  3GZ7 A;  4HDG A;  3RUB L;  4WK3 A;  4NLD A;  4DL5 A;  1MWQ A;  1MN9 A;  4C8Y A;  1NHV A;  4LF8 J;  2V8D A;  2JDJ A;  4OMF G;  1NJI T;  1KRP A;  3AHP A;  1N5Y B;  4L6V 3;  5KFW A;  1ARO P;  1U1L A;  2MKJ A;  2HVI A;  3P96 A;  1UJ4 A;  2ZNY A;  4YN3 B;  3DOM B;  5D3G A;  1APS A;  2YXL A;  3SCK E;  3ZZR A;  5IZH A;  2R8G A;  3MEC A;  1R0A B;  3QWP A;  2IJF A;  1BE4 A;  4CI0 B;  1H7W A;  1VQ5 S;  5FII A;  2G2Z A;  3QT7 A;  3W7B A;  3DOM A;  3X1L B;  1U7L A;  3NS5 A;  1RT5 A;  2W9C A;  1VRT A;  3MM8 B;  3PFE A;  3PNI A;  2AF6 A;  1H0H B;  3DYA B;  3NBP A;  2HSE B;  2MQ8 A;  4UQG A;  2Z0G A;  3M8P B;  4UZC A;  4L75 A;  4KRW A;  3VAI A;  1G1X A;  1DJ0 A;  1OYE A;  2VV5 A;  3MAH A;  4LIR A;  3T6J A;  2W9B A;  3PX6 A;  4CT8 A;  4JI7 F;  2ATL A;  4WE1 B;  3WIU A;  1B0P A;  3B54 A;  1RZM A;  1VCT A;  1VOM A;  4B3T F;  4TXS A;  4B02 A;  3K8V A;  5F8G A;  4A8K A;  1RT7 B;  4N47 A;  3RBE A;  2UXD F;  4X4N A;  3DGP A;  3SDE B;  1WKL A;  2DGX A;  3CDE A;  4B08 A;  3DRS A;  2A0F B;  2Y0S D;  3FZB A;  3I96 A;  4K5R A;  4M5G A;  2R7W A;  4GO7 X;  1EZZ B;  1S1V A;  2I8E A;  4ECR A;  1H7X A;  2WBM A;  1U4B A;  1F2G A;  2VQF F;  2XY6 A;  1NZA A;  3QWU A;  1XMQ J;  4HAC A;  2GZO A;  3DGP B;  3M6X A;  1HQE B;  1TKX B;  2XQC A;  3OBI A;  4RW9 A;  2MB0 B;  4LRC A;  3CJ2 A;  4DF8 A;  2OEJ A;  4OHW A;  1T9T A;  1UW9 A;  3MXH P;  2KDO A;  1RT3 A;  2ASL A;  1LWC B;  3CIM A;  2MSS A;  3M30 B;  3VAF A;  1S0O A;  3DN9 A;  1PBA A;  2H3E B;  2GVD A;  1KBR A;  4IG3 B;  4E0D A;  5GAG I;  4LR9 A;  1U45 A;  5B0B A;  1Q95 G;  4USM A;  2E5L F;  1XIQ A;  3R5D A;  1RSC A;  3LP1 B;  1C0T B;  2MMY A;  5LSR A;  4R5P A;  4C8L A;  1FF2 A;  3EMT A;  1TK5 A;  3V81 A;  4AND A;  4BDP A;  4C8K A;  2H4Y B;  2N3L A;  4FKY A;  2FHK A;  2CNL B;  2MY7 A;  3O1L A;  1JJ2 R;  4ZVE A;  1QJH A;  1SV5 A;  3QLH B;  3D6T B;  2VQE F;  3PX4 A;  1QAI A;  4LF4 F;  4LFC F;  1SJQ A;  2MZS A;  3HK2 A;  4Q0B A;  3BS9 A;  2L48 A;  3OPK A;  2VPX B;  3PJW A;  2LYV A;  1TL7 B;  1VHF A;  2PMW A;  2XO7 A;  2A2D A;  1HFE L;  4ZLL A;  4B3O B;  3VF0 B;  4DQP A;  1N5S A;  4DFJ A;  4LFC J;  2PO4 A;  4LF4 J;  4OYI A;  2DKO B;  3D6H B;  3IA0 A;  4DV6 J;  4AXJ A;  2FTR A;  2LXI A;  4NCG B;  4CLL A;  3OR1 A;  1CC7 A;  1WC6 A;  3MPU B;  3NS7 B;  3BSN A;  4Z2X A;  3PW2 A;  2LMI A;  3S6E A;  2C2R A;  3CJS A;  3DRP A;  4NZ6 A;  3KK2 A;  2GQC A;  2MTL A;  1RT2 A;  3MHY A;  4ZMM A;  3OLA A;  3ZXW A;  1TKD A;  1KVI A;  2P9C A;  4Y0F A;  4KGZ B;  4C6A A;  4RBT A;  4IG0 A;  4DCO B;  3JAM U;  5KFJ A;  3MR6 A;  2HMI B;  4QZV B;  1WDD A;  1YJ9 S;  5LSL A;  1H3D A;  1LWC A;  2MZT A;  3H7H B;  4UOH A;  5EX0 A;  5KFG A;  3W64 A;  3L4B C;  5HLF B;  1QTM A;  4KGV B;  4IUF A;  2QLB B;  1XNQ F;  1TKT A;  2Y8W A;  3ENA A;  2EBG A;  5KFK A;  3DLE B;  1Y4Z B;  4YQW A;  4WFX A;  2XS2 A;  1NK0 A;  2B7B B;  3I5A A;  4OX8 A;  1PO6 A;  2MJN A;  2J0Q D;  3CD5 A;  4LQ9 A;  1HQE A;  1TKX A;  2UU9 F;  2HWH A;  3QZ7 A;  1VC0 A;  2BE7 D;  1SQE A;  4EYH B;  1NK6 A;  2YPY A;  3ITH A;  5L9X A;  1RAF B;  3R8Y A;  2UUC J;  3I82 A;  2IRY A;  3RZA A;  3DU5 A;  3GYG A;  2EC0 A;  4UTG A;  1RTJ B;  2H65 B;  1ZM3 A;  2O01 C;  4NLW A;  4QR1 A;  2W4P A;  2DNO A;  3DHW C;  3M1V A;  1WC4 A;  1CJU A;  4IR1 A;  3RYL A;  3VV2 B;  2YKN A;  3HHL A;  2VHG A;  3C15 A;  3KKF A;  3G4S S;  3FBE A;  2EKN A;  2UVR A;  1ZH5 A;  2KO1 A;  3NWR A;  1NAQ A;  4FXW A;  1ZTT A;  4ZP9 A;  1N88 A;  4CCH A;  2RQM A;  2HFS A;  1IM4 A;  1FK9 B;  1GEH A;  1NEE A;  3R2C J;  1U6B A;  1IKY B;  3CJ4 A;  2UXB J;  4FS1 A;  4WKR A;  4MAK A;  3CPW R;  5KFH A;  3K5M A;  4DUY F;  4UY8 5;  1FTC A;  3D1H A;  3EGW B;  5D0H A;  3NG8 A;  2R8J A;  1ZA2 B;  3DC2 A;  4LF6 J;  2PEH A;  3J80 Y;  3VZI A;  1VIX A;  5DM7 Q;  4IDK A;  3KHL A;  1JLC A;  2GQ2 A;  5KG2 A;  1LW0 A;  5HO4 A;  1CBK A;  1WJ9 A;  2HBR B;  2OPS A;  1QUP A;  2QZ8 A;  3MMC A;  4ZP8 A;  4UOG A;  4URG A;  2HBY B;  1X4G A;  2VPW B;  4K4S A;  1JLB A;  1AXQ A;  5E5N A;  3ENW A;  3A3P B;  1GTE A;  2KHD A;  3H2U B;  3ILO A;  4LUB A;  3TZZ A;  3IN5 A;  3GJR B;  1KWM A;  3QO9 B;  5J2P B;  5LJ3 Y;  4DPW A;  4EBC A;  1MWZ A;  1T9U A;  2XY5 A;  1KON A;  1S4E A;  4CP5 A;  2DNZ A;  2VU5 A;  3H4D A;  1IKX B;  1HL6 A;  4ALZ A;  5IV4 A;  2FGO A;  2G0J A;  1GMV A;  3D1Q A;  3FNN A;  5CD4 H;  1S97 A;  4F36 A;  3PM9 A;  2RVJ A;  2AT1 B;  2HRY A;  2MY8 A;  2WSE C;  4IYQ A;  1DY3 A;  1XR5 A;  3NCQ A;  2XLI A;  2ZH9 A;  3NNH A;  3KHG A;  1CPZ A;  5H9E K;  3Q8S B;  1NSK L;  2WZ1 A;  4CH0 S;  2HQ3 A;  3LP0 A;  3RB0 A;  4ZPT R;  2KZM A;  4O3N A;  4RU9 A;  1HBM A;  3GP9 A;  2B0G A;  3NOG A;  3KG1 A;  4H4K A;  4LSL B;  5A2Q Y;  3IGV A;  4C8Z A;  2XTJ P;  4DV4 F;  1HNI A;  1PC5 A;  1MML A;  4ED1 A;  1DZ5 A;  5U47 A;  3AD9 C;  2E1C A;  2DCL A;  3PFO A;  4G1I A;  4I2Q B;  2MQQ A;  3HSZ A;  1EET B;  4I6Y A;  1M1G A;  1MMD A;  1KVJ A;  1XN9 A;  2Y1J A;  5DGA A;  4C3L A;  2BJ1 A;  2LDI A;  2E9Z A;  3CO0 P;  3CC4 S;  4U7U D;  4XK8 C;  3KLH A;  3TP2 A;  4HTJ A;  2QLX A;  3Q8Y A;  5A8R A;  5HP1 A;  3HXM A;  2ADB A;  1AW0 A;  3AT1 B;  3KJQ B;  4QWD A;  2AIR B;  2E1A A;  2CPJ A;  3DRR B;  4Y2M A;  3G6X A;  1Q79 A;  1D09 B;  3P49 B;  2YWW A;  3GCW P;  3R7S B;  2HYI B;  2UUA F;  1FE4 A;  3MED A;  1KN6 A;  1CG2 A;  2EKY A;  3KFW X;  5K8M A;  5KOX A;  4QW9 A;  1XBW A;  4RW7 B;  5JVG Q;  4MK8 A;  2IFX A;  3MTK A;  2JLG A;  4F25 A;  1KLM A;  1FT8 A;  1VQM S;  1Q81 T;  1CUL B;  1GT8 A;  1EQM A;  2HLT A;  2ILY A;  3ZZO A;  1KLN A;  2IVY A;  2UUB F;  3TUP A;  3DDN A;  2UV8 G;  4WK1 A;  2DXE A;  3FMW A;  1C1C B;  1OSD A;  5D4P A;  2BQ3 A;  1KS2 A;  3I55 S;  2HQD A;  3OTO J;  1S9G A;  1X4E A;  3C6U A;  3TAP A;  2UUT A;  5KFC A;  1JLA B;  2JEF A;  4UUX A;  2F5G A;  4PWD B;  4DFM A;  2KU7 A;  2GNK A;  4O0N A;  2XHW A;  3TAM A;  1PC4 A;  4Y2A A;  3GTY X;  4DR5 J;  1S6Q A;  5EWF A;  3HT3 A;  4LQ3 A;  1C0U B;  3F73 A;  2RHQ B;  3NNA A;  4ZA1 A;  4N76 A;  3GV5 B;  3PYF A;  3NBP B;  1SC6 A;  3L7P A;  1NK5 A;  1PJ5 A;  1O6X A;  1SB6 A;  3CE8 A;  2UV8 A;  4OX7 A;  3Q0A A;  4RUA A;  4DX7 A;  3K57 A;  4NOH A;  2CJ9 A;  3VQT A;  1NO8 A;  2CPX A;  1LKZ A;  1HW9 A;  2CAD A;  4N7T A;  1ZET A;  2D3O R;  1R0A A;  3D66 A;  4FBT A;  4BC9 A;  4DR1 F;  3QLH A;  1VQL S;  4PRF A;  2XB2 D;  1RHR B;  2RIL A;  2ALZ A;  1MU2 A;  4ES1 A;  4R8U B;  1T7P A;  2FHM A;  4TYA A;  3P6Y C;  3G2X A;  4KHP J;  3FSI A;  4RPF A;  2LEC A;  3G8Q A;  2CA9 A;  4TN2 A;  2W2N P;  2IM3 A;  1RWV B;  2X51 A;  3M8Q B;  2UP1 A;  1UEU A;  3SQG B;  4WYW A;  1YLX A;  3MEE A;  3VAH A;  2A6O A;  3HM9 A;  1RT3 B;  2HHQ A;  1Y3J A;  4NLY A;  5F8M A;  1RQ0 A;  2V0N A;  4DR3 J;  2GC8 A;  1LWE A;  3FFI B;  4B9S A;  1IUJ A;  4W98 A;  5KAK A;  4FF4 A;  4ZVQ B;  4K2J A;  5E41 A;  3QPI A;  5EUH A;  4QWC A;  4P2X A;  4CO2 A;  2DNR A;  5CXT A;  2B9X A;  4HKQ A;  4ZVR B;  3T1A A;  3CJ0 A;  3M4X A;  1FFS B;  3I9V 9;  4O44 A;  2DXF A;  1FCA A;  3X3U A;  1R43 A;  1XK8 A;  1VS3 A;  5HMX A;  3KLE A;  3G96 A;  2VJU A;  2OIH A;  4DOZ A;  4RNM A;  3BBC A;  3F0N A;  2CFX A;  3MM9 A;  3QGG A;  2DEI A;  5D15 A;  4ZKA A;  2R2S A;  2YY3 A;  1RWM B;  3B8H A;  3BKT A;  4HH1 A;  2MQP A;  3IWN C;  3FSX A;  2N3O A;  4DR7 F;  2E5G A;  4J9R A;  3EYZ A;  1T9W A;  4Q7A A;  3CJK B;  2CVE A;  3QT5 A;  3M9O B;  1NZ8 A;  3M8P A;  2ZM6 J;  1SL0 A;  2HHX A;  1XR7 A;  1AFI A;  1YBT A;  4X4V A;  2ZOF A;  4FNH A;  3MAA B;  4CO4 A;  4LBH A;  4IQM A;  3C46 A;  3CUL A;  3QRP A;  1NSA A;  1OY8 A;  1RA7 A;  3HT0 A;  4LMZ A;  3OR2 A;  1HD1 A;  1HHT P;  4TQR A;  1QSS A;  4ELV A;  2QSW A;  3EX7 B;  4GC6 A;  4DL6 A;  1SH0 A;  3QFW A;  3PR5 B;  2XS5 A;  1QLN A;  2AX1 A;  1RBO B;  3A8J A;  3U1N A;  5KFE A;  3MDF A;  2GW8 A;  3W9J A;  3N5F A;  1K9M T;  2IA6 A;  2VFR A;  3WDO A;  1BHN A;  3UW1 A;  1NDK A;  2W9A A;  3JSR A;  4K4T A;  3RR7 A;  3VAM A;  1WSR A;  2EXU A;  3THT A;  1E6V B;  3G82 B;  2XMM A;  2AZ1 A;  4OI2 A;  4D3H A;  1XNR J;  3I32 A;  1LWF A;  2UU9 J;  1EKR A;  3FMB A;  1S7I A;  1EAR A;  4GRS A;  4Y65 A;  2EG2 A;  2VG6 A;  3UI3 A;  3UDV A;  4NL5 A;  3BM7 A;  2Y1L B;  3UFC X;  1RWN B;  4BWM A;  4PG7 A;  5J2N B;  4AUK A;  1IWG A;  5DQI A;  3CCL S;  1T05 B;  2W4D A;  2J6U A;  3CD0 A;  1X0F A;  4G1P A;  4N77 A;  1U49 A;  4LF7 J;  1IQT A;  2XYH B;  4X4P A;  1T9V A;  2DNK A;  2CG4 A;  2QV6 A;  2RD5 C;  4I2P A;  2Q43 A;  2IYG A;  5IV3 A;  3M9N B;  4IOB A;  5CCM A;  1FNO A;  2MLX A;  5EHH A;  5D4L A;  3HSD A;  1OQ3 A;  1TAU A;  2XLK A;  3NMA A;  1BQN A;  2KFN A;  3BH6 B;  3HVR A;  3UO0 A;  3H40 A;  3IC1 A;  1Q8B A;  1TL3 B;  4J91 A;  3I5C A;  3EZU A;  1FKA F;  1RAD B;  2KHC A;  3QO9 A;  2CQB A;  4WIQ A;  4ZVS B;  1WKK A;  2LFV A;  3OXG A;  3RRG A;  2N4D A;  2ZVS A;  3PHE A;  2XZD B;  1ICE B;  1UWA A;  1LFP A;  5HAO A;  4OHZ A;  5C25 A;  2ADC A;  2HIQ A;  4MJK A;  1L3S A;  3US5 A;  5BR8 J;  1RAJ A;  2XMU A;  1WI6 A;  2FUG 9;  2OH2 A;  1PJ7 A;  1K44 A;  3KLF A;  3GG1 A;  3O8W A;  5HN0 A;  2FD2 A;  3MD1 A;  2A2C A;  2BM1 A;  4NA2 A;  4TY8 A;  5K5M A;  4RUC A;  2E9T A;  1JLF A;  4EUV A;  1C4A A;  4TQS A;  1X5P A;  3SZ2 A;  4OI0 A;  2ZJQ Q;  3ZZP A;  4K4Z A;  3DXS X;  2IYI A;  4G65 A;  4ER8 A;  1TZ0 A;  2VL1 A;  2BKN A;  2V50 A;  2CQC A;  2IMO A;  4ED2 A;  4K0K F;  2XGP A;  3GFZ A;  1CS4 A;  3D54 A;  4IFV B;  1JLF B;  4WP8 A;  1VBY A;  4UY8 T;  1G3O A;  1Q16 B;  5CYQ B;  5BXI A;  2ASJ A;  1HWJ A;  3CVK A;  3IAS 9;  1T8E A;  2ZH7 A;  4F02 A;  3HO1 A;  4QCL A;  5IM0 B;  4RO0 A;  3BGL A;  3K5N A;  4IRD A;  1UMJ A;  2E5H A;  3GII A;  4I56 A;  4QIG A;  1N33 F;  5HQ8 A;  3N6M A;  2DNM A;  1SVD A;  1GMW D;  2B4O A;  2QX0 A;  3M8Z A;  4TU8 A;  1HPZ B;  1VRQ C;  4DQR A;  1G7C B;  1RTD A;  1JLE B;  5H9F K;  2HNZ A;  3OTB A;  5LL6 d;  2AJF E;  2FHO B;  2WOM A;  3I0R A;  4FZV A;  1IBK F;  4C11 B;  5DZ6 A;  3THP A;  3H5U A;  3LAK A;  3UDE A;  1YJW S;  1UA1 A;  1SC1 B;  3PEH A;  5F0W A;  1PYT A;  1LW2 A;  1K8A T;  3QGI A;  1FD2 A;  2MLY A;  4B9U A;  4WWS A;  5M2R A;  3G8S A;  2VB6 A;  3N6L A;  3I0R B;  3DMJ A;  1JLQ A;  2JVR A;  3GYX B;  5KFO A;  4LF9 J;  5L8R C;  3G71 S;  1MWY A;  2BJ3 A;  2L9W A;  2DO4 A;  3KLE B;  3UCZ P;  1HNV B;  3MM6 A;  4PXE A;  4P10 A;  4RBU A;  2AYE A;  1OIA A;  3H5X A;  5E3Q A;  5AJ3 F;  5HVH A;  1CJT A;  5CZV A;  2ASD A;  3K89 A;  4JI5 J;  1F5C A;  1S49 A;  4AE5 A;  3B4D A;  5D4N A;  4H4O A;  4LF2 A;  1VIS A;  2PC6 A;  1WC0 A;  1GXT A;  2B4P A;  3DFE A;  2P2C B;  4RNH A;  5KFZ A;  3OW2 R;  4OHX A;  4U95 A;  1NJW A;  2ZH2 A;  3CCR S;  1EET A;  2B9Y A;  2OD4 A;  3NKY A;  3R6L B;  2YVS A;  4CIO A;  3IM8 A;  4DUT A;  2FJA B;  3SCL E;  1NHK L;  1U24 A;  2HG4 A;  3UN3 A;  4DV5 F;  2F4F A;  1ZM4 A;  1FKP B;  1Y9O A;  4DCJ B;  1MU2 B;  1X4C A;  5I4M A;  3TX8 A;  5KTQ A;  2CPD A;  2ZUA A;  1JNZ B;  1UFL A;  1YX2 A;  1IBC B;  4GMK A;  1Y10 A;  2FY1 A;  5K20 B;  4TU9 A;  3E01 B;  1NB2 A;  3N28 A;  3IRW P;  1TUG B;  2DGT A;  5L39 A;  1S6O A;  1RI7 A;  2FZG B;  4YB5 A;  2VC0 A;  7FD1 A;  4PG8 A;  2HUR A;  1TR0 A;  1HQU B;  2E44 A;  1RAH B;  5LMU J;  2VFS A;  2J0W A;  2CQ0 A;  2HQC A;  5E7O B;  3NAH A;  2LU2 A;  5AXM A;  4DG1 A;  2V6A A;  1I94 J;  1RA6 A;  2KT5 A;  2R7Q A;  3MFI A;  3BF4 A;  1F9E B;  3RB4 A;  3HJF A;  1RXO B;  2HGN A;  3GON A;  2D3U A;  5B0E A;  4LFA F;  4KYZ A;  3QQC D;  3QRR A;  1RGV A;  2DNP A;  2K8G A;  1YJR A;  2CKW A;  2QFJ A;  2QIF A;  3RJM B;  4OLP A;  1JLA A;  1X4A A;  1Q8I A;  2CG8 A;  2GVD B;  3MWB A;  2MKS A;  5EWE A;  2MEW A;  2M9K A;  2CQ3 A;  5FJ4 A;  2KT2 A;  1JLQ B;  5A8W B;  1IR0 A;  2NXJ A;  3HVT A;  5CA5 A;  2X1F A;  3JSB A;  2CQD A;  2E5J A;  3RW7 A;  2Z4P A;  1WF1 A;  2FB0 A;  4X84 A;  1D9A A;  4LRE A;  1F6T A;  1YWX A;  1NUE A;  3LUY A;  4HHJ A;  3DM2 A;  2DR5 A;  2JWN A;  1TVR B;  1JXE A;  3NGS A;  5T7L B;  2UXB F;  4V19 X;  1L3U A;  1LFW A;  4Y2I A;  2Y8Y A;  4NLR A;  3GFY A;  4R8U A;  4EI2 A;  3Q8P B;  2I38 A;  5T14 A;  2DIS A;  3MEC B;  3IG1 A;  5HJY A;  1CJV B;  4RLE A;  3ZNJ 1;  2ZBR A;  5AJ3 J;  1NK7 A;  3TR5 A;  3EPI A;  4S0M A;  3TJA A;  3QYY A;  4DPU A;  3CC7 S;  1H73 A;  3J7A 1;  1TUW A;  2AWZ A;  4I2Q A;  4LBI A;  2WTF A;  3FSY A;  3ZZT A;  1YJN S;  2COL A;  2RU9 A;  3V2U C;  4DS5 A;  1Q78 A;  4HR2 A;  2ZHO A;  1HAR A;  1C1B B;  1FRK A;  1M5S A;  2IDE A;  3CJT A;  4LJM A;  2YKQ A;  5B0C A;  5DDR C;  2JLE A;  4A8M P;  3R5B A;  4K2X A;  4HDH A;  4LFB J;  4WZQ A;  3UNG C;  1N6Q B;  3LO3 A;  2UUA J;  2PEB A;  3VGT A;  1U0H A;  2R42 A;  3F41 A;  3W2W B;  2ZH5 A;  3KHH A;  3V6D B;  4M63 A;  1FXD A;  4Q5V A;  3R6G B;  3H2L A;  3TQ1 A;  4PYD A;  2XG8 A;  6AT1 B;  1J5E F;  1HWU A;  2M2B A;  2Y1R I;  3D68 A;  5KT5 A;  2QA1 A;  4OLO A;  2KN4 A;  2H51 B;  1R8C A;  3GV7 B;  3QGP A;  1DQ8 A;  2XMT A;  3O3L A;  4M5N A;  4LFA J;  1FWL A;  2X7I A;  2VBZ A;  1JLG A;  1FVS A;  3H98 A;  4X4Q A;  2BJ9 A;  2IC3 A;  2CZ4 A;  4TY9 A;  2QGF B;  1KDN A;  3BGO P;  3W60 A;  2BQU A;  3DLH A;  1Q5Y A;  3FBF A;  1KKH A;  2DT9 A;  3AD7 C;  1Y3K A;  2K3I A;  1FRM A;  1L3K A;  3AOA A;  1EJ7 L;  3DLG A;  2K1R A;  2WB4 A;  1JJC B;  3IFE A;  4Q2L A;  5KG3 A;  2GIR A;  3SCJ E;  4L3N A;  4UOC A;  2MKY A;  1U02 A;  2PI5 A;  1FER A;  3PVX A;  2OML A;  2WB1 D;  5CZX A;  2BR0 A;  3TVZ A;  1BWV A;  5E3R A;  3MEG A;  2AGQ A;  4C7Q A;  4ECY A;  4MKA A;  3PV8 A;  2E66 A;  1SL1 A;  4LF5 J;  1DFD A;  4I4B A;  1PCA A;  3KJV A;  2C22 A;  2AKW B;  1Q8K A;  4QOT A;  3H90 A;  3VAK A;  3B6B A;  1JX4 A;  2B6A B;  2FGC A;  3DLL Q;  2RU3 A;  3VCD A;  4DV2 J;  4E8U A;  1QVG R;  1RYS A;  1KHW A;  4HI2 A;  4NWB A;  2FC9 A;  5AE3 A;  4IDK B;  1T3N A;  5B0F A;  4KV8 B;  4ZVO B;  1E6Y A;  4A47 A;  3K5L A;  2BJE A;  4F4X A;  3HHN B;  3E01 A;  3TWZ A;  3FEX B;  2C2K B;  3AAW B;  2CQ4 A;  3PW5 A;  3Q22 A;  1P9Y A;  3W9I A;  3AQP A;  1DTQ A;  4MKV A;  1R8B A;  3KDO A;  2ZJR Q;  1O51 A;  1I94 F;  4QBU A;  3FGV A;  2XS7 A;  5ITH A;  3R1H A;  1U48 A;  4WKY A;  3K7R A;  2CJK A;  1WDT A;  3DDK A;  2DNQ A;  3HPO A;  3CCJ S;  2GHP A;  1GXL A;  1Q8L A;  3CCS S;  4MK7 A;  3BSA A;  1V3S A;  1TU0 B;  3J7Z T;  1VC5 A;  2VIH A;  2HRT A;  3AXK A;  2YQ3 A;  3JQK A;  3GJQ B;  3L09 A;  1FWP A;  2HFN A;  4PAB A;  5HJX A;  4CH1 A;  2GAG C;  4F4Y A;  3TJ9 A;  2VQF J;  1WHX A;  2J9D A;  1IKX A;  3CGI A;  4Q44 A;  2FZC B;  2ZD1 B;  2HK3 A;  1FD8 A;  4UOF A;  4ERD A;  3UR3 C;  3LOU A;  1HKA A;  3WIV A;  2JVO A;  5JXS A;  2PA3 A;  1S9G B;  2W01 A;  3K2Y A;  3RGI A;  4X4T A;  2B7C B;  2AYB A;  1PAE X;  3ILI A;  3K5P A;  1SXL A;  1EQ0 A;  4Y00 A;  1RT6 B;  2IAJ A;  1N33 J;  2O3D A;  4LIW A;  4ES3 A;  2DVI A;  1KNZ A;  4JOU A;  4A46 A;  3SSR A;  4DR2 F;  3QIP A;  4ZPB A;  2V2K A;  2HWT A;  1WOO A;  1SBR A;  3JTN A;  4CWB A;  1N34 J;  2D69 A;  1CSJ A;  3PYD A;  1FNX H;  3NAI A;  3BGR B;  1LXJ A;  3FRY A;  4P72 A;  3TA2 A;  2MKI A;  5ADZ A;  4NA3 A;  4ZLP A;  3G82 A;  4CRJ A;  3EZ5 A;  4B3S F;  1RTI A;  5SUH A;  2ZHA A;  2QTW A;  1VRT B;  2BE9 B;  3MM8 A;  2MGZ B;  4ZIV A;  5DDQ C;  5A76 A;  3GSD A;  3O44 A;  2OPR A;  3ZTS A;  4DR7 J;  1FNM A;  3TNV A;  2K06 A;  2FJV A;  4A8O A;  1RKI A;  2EFG A;  4DX6 A;  2BOP A;  3LAM A;  3EDR B;  3PY8 A;  2F40 A;  1P1T A;  3HJV A;  2BRL A;  2Z30 B;  2HND A;  3A3N B;  5HAT A;  4EK2 A;  2ZBC A;  2KKH A;  2ZKU A;  2AYG A;  5K9F A;  5KG1 A;  1CC8 A;  4P2S A;  2QLW A;  2FJD B;  4JI8 F;  4CYU A;  2LP4 A;  4ICL B;  2OHD A;  3UN2 A;  1HD0 A;  5I42 B;  2ZIT A;  3VVT A;  3NY0 A;  2HND B;  2CZV C;  2QA4 G;  1HNW F;  4TLR A;  2BVZ A;  3KJN B;  1KD1 T;  2M7S A;  3L9Z A;  2G4B A;  4JI8 J;  2R7T A;  1VLO A;  2BE2 A;  4KQZ A;  1HWL A;  3EPG A;  1WG1 A;  3U1L A;  4CZC A;  1UKU A;  3OL7 A;  1SJ3 P;  1CEZ A;  1NB7 A;  5E2Q A;  1M1H A;  2A6M A;  5DG7 A;  2UXC F;  1VQS A;  1YRT A;  1TTH B;  1HNW J;  3IO1 A;  1U25 A;  4PAA A;  4ES2 A;  4X64 J;  3BZQ A;  3D0G E;  1YKW A;  4C0H A;  1N56 A;  4PPZ A;  1Y00 A;  4DU7 A;  2HFU A;  4ZVG A;  4WFA Q;  2BW7 A;  2FQQ B;  4ZVF A;  4DV2 F;  3DLG B;  3GSI A;  3OTD A;  1JMT A;  2GO9 A;  3G8T A;  2MQL A;  2FJX A;  1R27 B;  4EU0 A;  4OZJ A;  4F0K A;  3NGD A;  1B3T A;  2U2F A;  1YK9 A;  3B78 A;  1BXN A;  4CNY A;  3KLG B;  4RNO A;  1U1M A;  4XO0 A;  1UW4 A;  3CW2 C;  1RT1 A;  3C66 A;  5KFS A;  2DTJ A;  3P4U B;  2V9W A;  3FQL A;  2HK2 A;  1L3V A;  2UXD J;  1Y5N B;  2KT3 A;  2YQ1 A;  2YWF A;  1ZAV A;  1RAG B;  2OFH X;  5THW A;  4A8X A;  2OPQ B;  1P1L A;  3H42 A;  4IOA Q;  4AL7 A;  3EE3 A;  4ZVT B;  4OYZ A;  2E7W A;  5JJB A;  3UWT A;  3CCV S;  1AUD A;  4NCG A;  5F8J A;  1FKO B;  4ZCI A;  2MQN A;  2XWX A;  3N0V A;  4HH0 A;  3PW7 A;  1EIY B;  2KVI A;  3LP2 A;  2E1P A;  2KRB A;  2L9D A;  4ILR A;  3ZZ0 A;  5C2G A;  4LF7 F;  4DN9 A;  2N82 B;  2C3M A;  2DGU A;  3CJ3 A;  2HNZ B;  1CS4 B;  1KR4 A;  1H98 A;  8ATC B;  1KQG B;  3JYT A;  3I0S A;  1B64 A;  4QPX A;  4RZR A;  1CVJ A;  4PCQ A;  2V4J A;  2EFO A;  1M0S A;  1RBA A;  1IR1 A;  3ISN D;  4YEA A;  5ETK A;  1T95 A;  2J0X A;  3TA1 A;  2HZV A;  1RUS A;  3KMS A;  1S1X B;  4HTI A;  2J9D E;  4LF8 F;  2KM8 B;  3DXB A;  3UVJ A;  3CJ5 A;  4AYB D;  2AEM A;  2YNF B;  3GR0 A;  3QAT A;  2VF3 A;  1REV A;  4USU A;  1QY7 A;  4Y6I A;  3IXQ A;  4PR6 A;  3TX0 A;  4CH7 A;  4P7V A;  1HI0 P;  1KQF B;  3IMQ J;  3FC9 A;  1IR2 A;  1BQN B;  3OQ2 A;  4AQY J;  1B0T A;  1RAO A;  1S6Q B;  3THV A;  3TUI C;  2H4W B;  1UPP A;  1URR A;  2XC9 A;  1PYO B;  4NYZ A;  4FXV A;  1S4F A;  2C1E B;  1SKW A;  2PFF B;  4YDD B;  8AT1 B;  2FHJ D;  2IMW P;  3MAQ A;  3E8O A;  1F60 B;  4ZS6 A;  1CQN A;  5DLG A;  1ZZN A;  2NZ4 A;  2ERR A;  4GC7 A;  2UUW A;  4DV4 J;  3PW4 A;  2F8E X;  3B82 A;  2CJX B;  1Q7Y T;  4GVL A;  2ZHB A;  1UVL A;  1X7V A;  1Q4R A;  4HEA 9;  1KTQ A;  2BKO A;  2EK6 A;  4ECT A;  3NNC A;  1FFG B;  2K7K A;  1RCO B;  3BB5 A;  4ZPW R;  3N4W A;  2JC1 A;  2LA4 A;  4RW4 B;  4JUZ A;  1Y0H A;  3OD2 A;  3SXL A;  1YBU A;  4RU2 A;  2HGL A;  1UET A;  4J5O A;  2WW4 A;  5KFV A;  1GX6 A;  1NSP A;  2JNJ A;  5KFR A;  4X66 J;  1S0M A;  1X4H A;  1RU1 A;  4OQJ A;  4F4K A;  5C2C A;  5L9N A;  3MMJ A;  2ACM A;  4RW6 B;  3V6D A;  4UW2 A;  2B9E A;  4DBQ A;  1UA0 A;  2FLL A;  4ZCM A;  1MRO A;  3QFH A;  3DNC A;  2BKP A;  4HI1 A;  3QSI A;  4O3O A;  4J9L A;  2XSJ A;  2GO8 A;  5I3P A;  5BYS A;  2V4J B;  1C1B A;  1IWA A;  4FS2 A;  4A8W A;  2N7Y A;  1XEZ A;  4IO1 A;  2HHH J;  3CME S;  4C8O A;  4KHP F;  1YJV A;  2HFO A;  3OL8 A;  4JI4 F;  4DR4 F;  4OYX A;  4ED0 A;  2W24 A;  5B7W A;  1OS5 A;  2EFQ A;  2C3Y A;  4CQ1 A;  1NCL A;  2NSB A;  4P73 A;  3JQM A;  4P9S A;  1WTF A;  2HKE A;  3OFF A;  3MFH A;  4K4V A;  2HS0 A;  1C0U A;  4R5P B;  2YWH A;  4RW9 B;  4YP3 A;  2DR9 A;  1F1B B;  3CDU A;  3S7R A;  4U9R A;  4BCA A;  3GR1 A;  2N4C A;  2JOQ A;  1PIE A;  2XEX A;  2IAJ B;  1JWW A;  7FDR A;  2XMW A;  2RRN A;  3GQC A;  1XQI A;  5EX3 A;  3U02 A;  2CPZ A;  2DHH A;  1HMV B;  2QLJ B;  4B17 A;  5A8K A;  2XMK A;  2HGM A;  3PJ9 A;  5HBM B;  3T6B A;  5IT0 A;  1YJ7 A;  2IC3 B;  1K1Q A;  3EIC A;  4NXM F;  4A8F A;  1SPB P;  3K5O A;  1G4C A;  5KFX A;  2APO A;  2DH9 A;  2PMZ D;  4ED7 A;  5CCL A;  1IKV A;  1UVK A;  2Z2L A;  1TV6 B;  1NPR A;  2V94 A;  3AQO A;  4NPO A;  1CQM A;  3OTO F;  3UN5 A;  1R0C B;  4OYA A;  2IA0 A;  1RT6 A;  1PJ6 A;  3SYZ A;  2W2P P;  2B43 A;  1RTH A;  2HHS A;  4KO0 B;  1W7W A;  2RKI B;  2XSJ B;  2E7X A;  4NA1 A;  3W2V B;  1D0E A;  1QVF R;  4DS4 A;  3QT8 A;  2AU0 A;  1VQ4 S;  2G9O A;  4GVB A;  3J81 Y;  1LW0 B;  4KT0 C;  5GAE I;  1D8Y A;  3OR1 B;  2XSF A;  2CQP A;  1YTY A;  3CCW A;  1QAJ A;  2GX8 A;  2MZR A;  2JEG A;  3D6M B;  2XNR A;  2GGP A;  2HQG A;  3TJ8 A;  5BR8 F;  4ZN1 A;  4D3G A;  1IBK J;  1S9F A;  3ONQ A;  5KT6 A;  1AYE A;  4ILM A;  5M2U A;  2HIY A;  3CTR A;  1Z2Z A;  4WU3 A;  4K50 A;  3BQ2 A;  3C2P A;  3HZG A;  4QIF A;  5H9F J;  1SJF A;  4NLG A;  5B0G A;  1TL1 B;  5DG8 A;  2NLW A;  4FBU A;  5GMD A;  4NYP A;  4JI6 J;  3V81 B;  3CJ8 A;  4KFB B;  4BBY A;  2KYX A;  3ZTQ A;  2GS8 A;  3BGU A;  4EFA C;  4YOE A;  4JI5 F;  2YQ0 A;  4BC7 A;  1RT4 B;  1HNV A;  2P6T A;  3T5H A;  3QSY B;  1HA1 A;  2EFP A;  1C1C A;  1IKV B;  1H2V Z;  3PRB A;  2KL8 A;  1IJF B;  1NHU A;  3TUJ C;  2XCP A;  3I56 S;  2DIV A;  4ELT A;  2WW8 A;  3MPW A;  2F4V F;  4DLG A;  4ED8 A;  3D3C J;  3BKU A;  5DJB A;  3BGR A;  1YIT S;  1LK5 A;  1W25 A;  4XAK A;  2C2M B;  4O4G B;  3CXC R;  2ZVI A;  4NX9 A;  2R7S A;  2D41 A;  3TAM B;  2HWI A;  3PKY A;  2ZOG A;  1D1U A;  5A8K B;  1TFY A;  4QWA A;  3HSG A;  4N41 A;  2PII A;  3DI6 A;  4NLV A;  1N0U A;  2FZK B;  4DXL A;  3MUM P;  5IOL A;  3EJM A;  1H2U X;  5F41 A;  2XLJ A;  4FYY B;  2J7K A;  1FXR A;  2YTC A;  3MPD A;  2YNI A;  2CAJ A;  4H4K C;  3D6F B;  1IBM F;  2HMI A;  4GKK J;  3NOC A;  3VR1 A;  2NYH A;  4DL4 A;  4B9N A;  2OJ3 A;  2Z2Y B;  4U96 A;  1H72 C;  3E51 A;  2A18 A;  3KUH A;  3UDL A;  2Y1I A;  3S8S A;  1RKJ A;  2ASY A;  1FX4 A;  3EVW A;  2D3Z A;  4FPR A;  5ETS A;  4DX8 H;  5DZ7 A;  4ATN A;  4OYO A;  4CO0 A;  2ZUG A;  4WE1 A;  1RWW B;  2BAB A;  2FDN A;  5RUB A;  4WF9 Q;  3PCO B;  3PTW A;  5DRK A;  4PEO A;  5ETO A;  4UF4 A;  3TRG A;  4EZ9 A;  3QNW B;  1N0V C;  4DL3 A;  2XMV A;  2RF2 B;  4MTP A;  1S10 A;  1RLD A;  4WBF A;  2HBZ B;  3OVB A;  1SC4 B;  3GJS B;  4PUO A;  4DZD A;  2XCA A;  2IVF B;  5KT3 A;  5T41 A;  1DTQ B;  3BYR A;  4DV0 F;  4LF9 F;  2VZ9 A;  5CHC B;  3PRD A;  4XPE A;  4Q2M A;  1ELO A;  2J9C A;  3MTJ A;  4PQA A;  2KTQ A;  4AD6 A;  2V2Q A;  4LSN A;  1DHM A;  3I4P A;  3M2U A;  4FF2 A;  1C2P A;  1S1U B;  2CWK A;  2DRD A;  2V8H A;  3R2D J;  1BQM A;  2QYC A;  4WXO A;  3BO4 A;  5IXU A;  5L1L A;  2CJY B;  4EYI B;  3C15 B;  4DUY J;  3D7S B;  3DRY A;  1T9Y A;  1WF0 A;  1QSY A;  2BJ8 A;  1BY9 A;  2DXD A;  4L72 B;  2D9O A;  2VH7 A;  4AT1 B;  2YWK A;  3MM9 B;  3OFE A;  4A4J A;  4EMD A;  2QMX A;  2BJ7 A;  4A48 A;  3P3D A;  1G2E A;  3J7Z 5;  1Q0N A;  1D3W A;  2DHA A;  1TK8 A;  2HHV A;  4X2B A;  4L76 A;  4DR2 J;  3AOC A;  2J8A A;  4IO9 Q;  4TNO A;  3FBC A;  1NH8 A;  4FKX A;  4FYW B;  4I64 A;  2Y9H A;  2ATC B;  3MM6 B;  1T9X A;  4DWI A;  2GIF A;  2AGP A;  3R1L A;  2VOP A;  1TV6 A;  4RNF A;  5GAH I;  3OTC A;  4DHV A;  3DI6 B;  2E1R A;  3C14 A;  2V67 A;  3NL0 A;  4M8L A;  3DDI A;  2OEK A;  3MR7 A;  5GME A;  4PKD B;  5K8N A;  4I6W A;  1AFJ A;  1FO1 A;  2ZWP A;  1RHM B;  4Y2K A;  2W9B B;  3SIP B;  1S1T B;  1WAC A;  4DF4 A;  2DGW A;  5K14 A;  1HWK A;  1UCN A;  3OLB A;  2GJ2 A;  3UE2 A;  1K0T A;  4LRA A;  1QUV A;  5BYQ A;  3HHD A;  4B9L A;  2VOD A;  1HW8 A;  4IG0 B;  2R4F A;  1T03 B;  3M2U B;  1S1X A;  4OIX A;  1I5O B;  3G6V A;  2G1H A;  3DOL A;  3OVA A;  5ETN A;  3A8I A;  4W90 B;  1GK8 A;  3VGU A;  2I6W A;  1FHT A;  2M0G B;  1SQF A;  2FPH X;  2VG7 A;  9RUB A;  3HX9 A;  1IQZ A;  2HAF A;  4PUO B;  4CLS A;  4M5D B;  3PO4 A;  3TAQ A;  1FDD A;  3MCS A;  2G2Y A;  2IVM A;  3M6V A;  2JJ4 D;  3V6H A;  4GO5 X;  4I7F A;  5SZT A;  3HCX A;  2VG7 B;  1J2V A;  4OV6 A;  3VQS A;  2Z56 B;  3V4I B;  3RAM A;  1X31 C;  2LQB A;  1MRO B;  4MYT A;  2VA2 A;  1HBO B;  1ZYQ A;  2AZ3 A;  3KK1 B;  1NH7 A;  3T5L A;  3TAR A;  2RSQ A;  1SIZ A;  2LDY A;  3T19 A;  2EEY A;  2MKC A;  4ANC A;  8RUC A;  4YHH F;  4RNN A;  2P9G A;  5ETV A;  4DR6 J;  1KSP A;  1XNR F;  4LF5 F;  1SJ4 P;  2CPH A;  5C25 B;  3J81 U;  2OMO A;  2RS8 A;  4CO3 A;  5BJR A;  5GAD I;  3PJX A;  1RK8 A;  2RB7 A;  4QIW D;  3M30 A;  3H20 A;  5CH7 B;  2CZ9 A;  3I9Z A;  2MQO A;  1JLG B;  2FJW A;  4C9D A;  1SKS A;  3ZC4 A;  2E9R X;  5IT4 A;  5J1P A;  4DL0 C;  2BA9 A;  2PGC A;  2IIH A;  1Q82 T;  2M3D A;  4BS2 A;  2BXJ A;  1AZS B;  1FEE A;  1RB0 A;  2ROP A;  5KFM A;  2KH9 A;  1TKZ B;  5D0E A;  4ZPD A;  3BO3 A;  2V4R A;  5D77 A;  4L3K A;  2Q6B A;  4NLU A;  1X5S A;  3SSQ A;  1T02 A;  1TL5 A;  1R8A A;  1L5U A;  2UUB J;  2XWY A;  1YI2 S;  2ZDO A;  3D0H E;  2EFN A;  2X1G A;  1A6L A;  1N6Q A;  1GXU A;  4PXD A;  4ZHR B;  5KT7 A;  1N32 F;  5F8N A;  5IM0 A;  4TKT A;  3BR9 A;  2GMJ A;  1XMQ F;  2MZJ A;  5I3Q A;  4WU2 A;  3OJS A;  4YB1 P;  2HHT A;  3VGS A;  3JYT B;  4FNI A;  1XMB A;  1F0X A;  1Q1K A;  3NLC A;  2ZWO A;  2YX7 A;  5IWA J;  2DR6 A;  1YQH A;  3IBC B;  4B9M A;  3N01 A;  4O0I A;  5F9L A;  1IXK A;  1VFJ A;  4XDC A;  4BHQ A;  1ZAW A;  4F4W A;  2ILZ A;  2HQF A;  1OMS A;  4PYA A;  1RYR A;  2CNO B;  3UDC A;  3IRX A;  1NJX A;  4DR4 J;  4WFN Q;  4OX6 A;  2QE5 A;  4NI2 B;  4Z7Y A;  2Q6C A;  2HNY A;  2RH3 A;  3SFG A;  1JJ4 A;  3DM2 B;  2IRU A;  2VKR A;  3GYN A;  3MMB B;  1FWK A;  2R8I A;  2DPI A;  3CJK A;  1KFS A;  1ZPV A;  5C5J A;  2J76 E;  2ZC4 A;  3FZ2 A;  1RAI B;  3FQK A;  4HLB A;  4UUW A;  1YIJ S;  1T94 A;  3IBW A;  3EWG A;  3MZI A;  4WTY A;  3D3B J;  1QDU B;  5FLX U;  1JXV A;  4LT6 A;  5IC6 B;  4B3R F;  2XUL A;  3HVT B;  2YWG A;  4LR8 A;  3KJV B;  3Q83 A;  3A8E A;  3ET6 B;  1ZZF A;  3IG1 B;  4KBI A;  5H1S V;  2WVB A;  4X66 F;  2XYP B;  1PKU A;  1R6Y A;  3N9U C;  3VAJ A;  4Y2C A;  4DCP B;  2RKI A;  5EGY A;  5DM6 Q;  1HMV A;  2K2P A;  3C16 A;  4KHM A;  1S0N A;  1WUU A;  4PG5 A;  2FVP A;  4DSL A;  4ZN3 A;  1TVR A;  2GHW A;  1VQ7 S;  1SUQ A;  1I1G A;  2CYY A;  4A8S A;  1A0O B;  1KTV A;  2NPI A;  5GAE U;  1RT2 B;  2DEJ A;  2KYZ A;  3AXM A;  4R0J A;  2CVI A;  4ZIW A;  1VGY A;  2C2E A;  4J90 A;  4MMO A;  1NME B;  1MN7 A;  1FA0 A;  4ECZ A;  3PZP A;  1JJH A;  2QL9 B;  2ROE A;  3LAL A;  5ETM A;  4CLF A;  5JMN A;  3MM5 B;  3TUZ C;  1B4S A;  4DFK A;  4ZVP B;  4YME A;  5HLF A;  4B3R J;  2M70 A;  4JI2 F;  5L46 A;  5C24 B;  3OUY A;  3KNA A;  1GX5 A;  4I1T A;  3CWJ A;  1YG0 A;  5JVH Q;  1HQU A;  4CYU B;  1I3O B;  2DD8 S;  3AJ2 A;  3I87 A;  3EVO A;  4OYB A;  1YSJ A;  3R7B B;  2RHS B;  2DNL A;  1PYS B;  3LW5 C;  4AQY F;  5C7P A;  2LLZ A;  4O23 A;  3HD1 A;  2HNY B;  3NGK A;  4ZIT A;  4B9V A;  4FF1 A;  4GVB B;  1XWL A;  2A10 A;  2NCK L;  3MCM A;  2KVQ E;  1HI8 A;  2BE2 B;  3SQO P;  5FLX Y;  1XTZ A;  1YJU A;  3W9H A;  2JFK A;  1Q7L B;  5J1N A;  3BO2 A;  1J5E J;  2VPY B;  1LQ9 A;  2Z58 B;  3CSK A;  2RF2 A;  2V2V A;  5KT2 A;  2B9W A;  3R5J B;  4OI6 A;  2YKM B;  5AXK A;  2DHS A;  3KK3 B;  1U47 A;  2P6S A;  1VRU A;  3VGV A;  1XC9 A;  4LFB F;  3CIZ A;  5KG4 A;  4OZ0 A;  2LEP A;  3MM7 A;  1VIO A;  5KFB A;  2LU1 A;  4YDX A;  2WVD A;  4EO8 A;  1N4L A;  3CD7 A;  2UXC J;  3DRX A;  3RR8 A;  2HW3 A;  1GNK A;  2HQI A;  5A8W A;  4PWD A;  3HVA A;  4MFB B;  3C3L A;  3LQV A;  1N32 J;  5LXR A;  1OQ6 A;  4KIA A;  4C2M A;  2CQ1 A;  3R5C A;  3KLF B;  1KQK A;  2LQJ A;  1U26 A;  2X3G A;  2V63 A;  4MIA A;  4USI A;  1PSD A;  1UWB B;  3DMJ B;  3QZ8 A;  4KY3 A;  3R27 A;  4OJG A;  5KFT A;  2WAQ D;  3BJY A;  1RJJ A;  4OV1 A;  2V8G A;  2Q66 A;  1MSW D;  2C28 A;  1FDB A;  4O4G A;  2GCF A;  3W5Z A;  3BH7 B;  3BDE A;  4EGL A;  1NXI A;  3DGV A;  3KNG A;  3QIP B;  3M9M B;  3R97 A;  3CF5 Q;  5B09 A;  4DEZ A;  3V6J A;  1NPK A;  2L3M A;  1VJW A;  3PO5 A;  3GJT B;  3PKM A;  2F1F A;  1WHY A;  3AA9 A;  2B51 A;  3QJJ A;  1FJC A;  3ZFV A;  1WEZ A;  1NPP A;  5LXY A;  2WCX A;  3PIO Q;  2VIC A;  1L3T A;  5JUM A;  3T1H J;  4Q43 A;  3UD3 P;  4P52 A;  4M5J A;  4ANE A;  5AXN A;  2AMC B;  2BW2 A;  2F9D A;  2FVS A;  3WX8 A;  4NCA A;  4DLE A;  3KHR A;  1FRI A;  2VKZ G;  1ZS6 A;  3MOZ A;  4U7U K;  1UJ6 A;  5HMY A;  2VON A;  3GB0 A;  3UQS A;  1D9D A;  3RRK A;  2LXU A;  2MDA A;  3QBC A;  1DBD A;  4K7Q A;  4PQU A;  3FUY A;  4ENO A;  2EBE A;  2R3V A;  2E5L J;  2K3K A;  5HRO A;  4FF3 A;  1WG4 A;  4IRC A;  1Z2L A;  2PI4 A;  4ICL A;  3MMA B;  2ZH3 A;  1PG5 B;  2CXE A;  4DV3 F;  4PQU B;  2ZEJ A;  2DNN A;  3CED A;  5LMU F;  2BV3 A;  2DJW A;  3ILJ A;  2UVV A;  3NRB A;  1SC3 B;  2DK2 A;  3GIJ A;  2NRE A;  2D9P A;  5J1E B;  3WZ0 A;  1WEL A;  3ITH B;  4WYL A;  2KG1 A;  2NS1 B;  2B56 A;  1N5Y A;  2YNI B;  5L1I A;  2FLP A;  1RTI B;  1WSV A;  1TFW A;  2JFD A;  4W4M A;  3TQE A;  4Y28 C;  4UT4 A;  2J8S A;  3J81 j;  3KLI B;  2F63 A;  1A7G E;  2ZNZ A;  3PDN A;  3KTQ A;  1BD6 A;  4NML A;  1NM2 A;  2ZBP A;  4U6P A;  4FPI A;  4PPD A;  2IBK A;  2VQE J;  1SIW B;  1X60 A;  2R7R A;  3W8P A;  2BMB A;  3M8S A;  1W26 A;  1WI8 A;  4QYZ J;  4ED5 A;  3CCE S;  3GLJ A;  2BAN A;  1AA1 B;  1JB0 C;  1SUQ B;  3FVY A;  3HKW A;  5GVQ A;  4M1K A;  2LEB A;  4JI7 J;  1WWH A;  2ZC3 A;  4XDD A;  3HF5 A;  3QID A;  4AXI A;  4DI6 A;  1U1K A;  1N34 F;  4EZ6 A;  1Z1Z A;  4ZCK A;  2EWH A;  2OFG X;  4KKO B;  1FJ7 A;  3HHE A;  1RWU A;  2W8L A;  2AW0 A;  4O3P A;  3DRP B;  3KK2 B;  3FDS A;  4NYO A;  2DIU A;  3CCM S;  3TO8 A;  4EBD A;  1TAQ A;  3OTE A;  3TEG A;  5FDL A;  1U1O A;  2SXL A;  4WPA A;  3TZX A;  1U2F A;  4RW7 A;  2Y0B B;  4KGK A;  2LCW A;  4LVN P;  2X1A A;  3LWM A;  3K17 A;  3Q2T C;  3ISZ A;  1VQO S;  4O3R A;  1UPM B;  3HFZ B;  2HHU A;  2EVZ A;  2EFV A;  3IP0 A;  4IRK A;  3I4H X;  4FXD A;  3IR5 B;  2XNQ A;  2CJB A;  1HIY A;  3AOB A;  1Y5I B;  3M2V B;  2CNK B;  4M5L A;  3ZTO A;  4CTA A;  1HR0 F;  2BM0 A;  2R7O A;  1HBN B;  2E29 A;  4FVM A;  4L74 A;  4UST A;  5DGB A;  1JNR B;  1RHQ B;  4DSE A;  3BSO A;  3E2E A;  1H38 A;  3M2R B;  2DCU B;  4OX9 J;  3JXO A;  3OL9 A;  2IJN A;  4DV0 J;  3MF5 A;  1UJ5 A;  3HVW A;  3ICL A;  4QW8 A;  1O8B A;  3MUT P;  2JLF A;  3HFK A;  3G6E S;  3JS9 A;  3SV3 A;  5G0R A;  3MUV P;  1GFW B;  3UCU P;  3W66 A;  3RB6 A;  1TL3 A;  2CPE A;  3CDA A;  3EZO A;  3GIR A;  3M1V B;  2XI3 A;  3V6K A;  2G1D A;  4HT7 A;  3BQ1 A;  3H5Y A;  3IS9 A;  1CJT B;  1X5T A;  2DNH A;  1PBU A;  4O44 B;  3SEO A;  2YH1 A;  1KEK A;  1LV5 A;  3OR2 B;  1IBM J;  3ULH A;  1Y7P A;  2LKZ A;  2J0S D;  1WOP A;  3S1T A;  2HZC A;  3OXL A;  3ETO A;  3P5B P;  5L1J A;  1Q53 A;  4DDF A;  3W8G A;  4J9S A;  3DLB A;  2CJA A;  1U1N A;  2HFZ A;  2R8H A;  4ELU A;  5IS2 A;  3FKB A;  5F8L A;  3KOA A;  3VHQ A;  2MPU A;  4K4X A;  2C3U A;  3UPF A;  4P71 A;  4QU6 A;  4MT1 A;  2F4V J;  2O66 A;  1JLC B;  2D3O 1;  4WCE Q;  2DYA A;  4J9O A;  2CRL A;  2NPF A;  5HP1 B;  2GAH C;  2HBQ B;  3OFG A;  1ZBT A;  1QAX A;  1N36 F;  4OFZ A;  3KLV A;  3CDW A;  4Y3C A;  2DRB A;  3SFU A;  4F3Q A;  5A8R B;  1TL4 A;  2KJW A;  2YKO A;  4Y34 A;  4JI6 F;  3P8B B;  5DDP C;  4ETX A;  1U2C A;  4WFY A;  4NLT A;  2V5H G;  4QR2 A;  5D6G A;  2WVE A;  2QFI A;  3HUL A;  3RRH A;  3DOK B;  1REG X;  2H5J B;  4CO1 A;  2CQI A;  4DR1 J;  4I7F B;  3AB2 B;  2OSQ A;  3LH2 S;  2AJ1 A;  4OZ1 A;  4IOC Q;  2OD6 A;  3H2V E;  1N54 B;  2YNH B;  3TA0 A;  2EG1 A;  3Q24 A;  3DOK A;  1IN0 A;  2H5I B;  5A2Q U;  1SL2 A;  1BGX T;  2XO6 A;  2YNG B;  2BEF A;  3ILL A;  1D8Z A;  3A12 A;  7AT1 B;  1V3R A;  3AB4 B;  2BX6 A;  2DGS A;  3RBX A;  3L7U A;  5DS7 A;  2MZ1 A;  4ECQ A;  4Q8F A;  3NGR A;  4F2R A;  4IG3 A;  4ZPC A;  4QWB A;  1H2T Z;  1D9F A;  1S99 A;  4KGM A;  3D1O A;  1T11 A;  1FJG F;  1RAB B;  3OSP A;  4USJ C;  1YJT A;  5F8I A;  2BAN B;  4RUH A;  3SI8 A;  2YX4 A;  2YKA A;  1YGY A;  2IJR A;  3HHL D;  1KP6 A;  3MM5 A;  1YDL A;  4K8R A;  4QPT A;  1HBU A;  3CO9 A;  4N5S A;  4URS A;  4IQX A;  3T5J A;  3KUG A;  3BGF A;  4KH1 B;  2J6S A;  2WHO A;  1V9O A;  2DR7 A;  1KC8 T;  4NZ0 A;  4F8R A;  1UWB A;  4NXM J;  3LGN A;  3MR3 A;  2PA8 D;  3R5G A;  5M2P A;  5DQH A;  4WTO B;  1NJY A;  1K73 T;  4ECV A;  1KQS R;  2Z2M A;  2VG5 A;  3OSN A;  2ZZN A;  2VG6 B;  3D5M A;  3CT9 A;  3HDS A;  1LOU A;  3JB9 k;  3IRX B;  4ECS A;  3GWC A;  4TLQ A;  2EW9 A;  6FD1 A;  3KMQ A;  2JH3 A;  1FRJ A;  1NDC A;  3NMR A;  2R8K A;  5E3P A;  3CCZ A;  5CYQ A;  2W1B A;  1RU2 A;  1WHW A;  4RWX A;  3SQG A;  5L38 A;  1ZAX A;  2VJV A;  2FVR A;  1KFD A;  3MM7 B;  3UNY A;  4ZLN A;  2AQ4 A;  3QRQ A;  1TK0 A;  2IRX A;  2XM3 A;  2I2Y A;  4OZ3 A;  2KJV A;  2IPO B;  3BYP A;  3M6U A;  4NRT A;  2MST A;  3DCA A;  2VFU A;  4J9N A;  1SV5 B;  1JQG A;  3M2R A;  1Q5V A;  1TP7 A;  2BUN A;  2VFV A;  3KK1 A;  2QMU B;  2CQG A;  5EN1 A;  2NYI A;  1RWX B;  4M5M A;  4USH A;  5CYM A;  2IHR 1;  4JI0 F;  2KM8 C;  1HNX F;  5B0A A;  4B3O A;  3MMA A;  4KE5 A;  1DAX A;  4EBE A;  4IH7 A;  4QYZ K;  1RTH B;  2QG9 B;  3DU6 A;  3ZTR A;  2VA3 A;  1WOR A;  1VQY A;  2K1R B;  5KOW A;  5H9E J;  3IWX A;  3CJR A;  3TYT A;  3BBB A;  1WTB A;  3IGN A;  1UZH A;  3K8W A;  1HNI B;  4UQT A;  3LF0 A;  4LF6 F;  4ZLJ A;  1SH3 A;  4C0B A;  2NXN A;  4NLQ A;  3WC0 A;  1FVQ A;  1LNQ A;  5DQG A;  1S57 A;  4ZVH A;  5E33 A;  3QGH A;  1URN A;  3LAN A;  1U09 A;  1UEV A;  5C42 A;  2W25 A;  4USW A;  2FHJ A;  1WC5 A;  2J7W A;  1H74 A;  3GCX P;  4PXC A;  4A8Q A;  3KG4 A;  4G6V B;  2XMA A;  1J27 A;  3D28 A;  2PE8 A;  1NDP A;  3MCO A;  3MMC B;  1U8W A;  4JI1 F;  1MLA A;  3TOQ A;  1RT7 A;  2OSR A;  4RL1 A;  3UD5 A;  5HQM A;  3T1Y F;  3H59 A;  4YB6 A;  3JAM Y;  3VTI A;  1XJW B;  3C19 A;  1RHK B;  2HRU A;  3S01 A;  4F26 A;  2WOM B;  4K4U A;  4MH8 A;  2B8P A;  1R8H A;  2QO3 A;  4YFU A;  3HP6 A;  3KJF B;  3MEE B;  3NGT A;  4X65 J;  2PDA A;  3G6Y A;  1RT4 A;  2VBY A;  4KHR A;  4OZL A;  3UVJ B;  2C3O A;  4ECX A;  3T3F A;  4IR9 A;  1GH8 A;  4XTT A;  1REV B;  1S76 D;  3ADA C;  4GKJ J;  4MFB A;  3Q89 A;  3RW6 A;  5J1E A;  1IM6 A;  1WD6 A;  4L73 A;  2O1P A;  1P6T A;  1FJE B;  4KTQ A;  2UZA A;  4WZM A;  2I0X A;  4K59 A;  4DV7 J;  1CJK B;  4IFY B;  2H48 B;  2KXH A;  3M8Y A;  3QJL A;  2NXU A;  4P6Q A;  1BUX A;  2ZZM A;  3L95 X;  3ZZY A;  3NWG A;  4KGX B;  1XMO F;  1VBK A;  2ABY A;  2AEF A;  5ETL A;  3VAG A;  4DQS A;  1RHJ B;  1RHU B;  1NBE B;  1RTJ A;  3R5A A;  1SKR A;  2JX2 A;  4M95 A;  3Q8V A;  4CLU A;  4TU7 A;  3WC2 A;  1V6H A;  2QC3 A;  2M88 A;  4RW8 B;  2GVZ B;  1FKO A;  2VBW A;  2VDH A;  2FJB B;  1OO0 B;  2XMJ A;  1FKP A;  4QQB A;  2EPI A;  4NXN F;  4X4U A;  3MAA A;  1TKZ A;  4OJ3 A;  2R2T A;  2BDP A;  2UUC F;  3FBB A;  1RT1 B;  1ULR A;  4CDI A;  5KG7 A;  5E0O A;  2E5I A;  3HMJ G;  1YZ7 A;  2QJ3 A;  3CC2 S;  1NKC A;  2V69 A;  1FDA A;  2GML A;  2XZW A;  2Z8Q A;  1G6B A;  1UZD A;  3L3C A;  1SJ1 A;  3DHX A;  3UD4 P;  4DR6 F;  4J9Q A;  1S1W A;  2MHN A;  3PRV A;  1RWK B;  1F3F A;  1MMN A;  1NSQ A;  5I3U B;  5HI7 A;  4C11 A;  4F2S A;  5LSO A;  3M8Q A;  2GA7 A;  3QAE A;  4P75 A;  4X62 J;  1NKB A;  3SSS A;  5KFP A;  2GQQ A;  3A4T A;  4ZJL A;  4G1Q A;  1FDN A;  3C6T A;  2GIQ A;  2YNF A;  2CQH A;  1DQA A;  3M32 B;  4H4M B;  4ID5 B;  1EAY C;  3JSY A;  4DSI A;  3PG9 A;  2HS3 A;  2IBO A;  3PIP Q;  4DQQ A;  3M8R A;  4QWE A;  3U27 A;  3KLH B;  1UFW A;  4CLY A;  3TAN A;  2C3P A;  1TL1 A;  2WVC A;  3WQP A;  5K8P A;  1IBL J;  4JP8 A;  2UVW A;  4M5I A;  2RUG A;  3M7V A;  3V5R A;  1SI9 A;  1VRU B;  1SQG A;  2F8M A;  3BN7 A;  3KLI A;  4Q45 A;  3KK3 A;  2QSF A;  3AJ1 A;  2QT7 A;  4OZ5 A;  4QIV A;  4NE9 C;  2CQ2 A;  3A8K A;  4QJV A;  3RG6 A;  1LEO A;  1GAO A;  4NAS A;  2O5D A;  3CMQ A;  1HHQ A;  1OY9 A;  1X4F A;  1HR0 J;  1R3N A;  4KH0 B;  5F3T A;  4CLK A;  3W65 A;  3W1Y C;  4F3M A;  2OP5 A;  3T1H F;  2HZA A;  3RB3 A;  4YR0 A;  1RP5 A;  4P2M A;  5MAO A;  3KDN A;  2HVD A;  1X8D A;  3AOD A;  3WX4 A;  4DSF A;  2R7V A;  4C98 A;  3C6U B;  2HAI A;  3D9B A;  3LA0 A;  3OVS A;  3OV7 A;  1EP4 A;  1Y11 A;  1YRU A;  4PWW A;  1VYA A;  4RW4 A;  2V9K A;  4Z37 A;  1TQL A;  2CWX A;  4DV1 F;  4B3S J;  1AT1 B;  3N79 A;  2M8D B;  2DRA A;  4NLS A;  5EDW A;  2KXF A;  4HHH A;  1Z4U A;  3C14 B;  2ZH6 A;  3H4B A;  4KJI A;  2EI5 A;  1NDL A;  2NXE A;  2I5J B;  5G4D A;  2WBR A;  1VQN S;  2QEX S;  4DV1 J;  2H9Z A;  1OWX A;  4RR5 A;  1DTT B;  2P5V A;  1CLF A;  2DHX A;  3K0J A;  3C16 B;  1M5K C;  4KKO A;  2JEI A;  1U6Z A;  1JKH A;  2B5J B;  2NUU G;  3HI9 A;  3PYE A;  4QIE A;  4F0H A;  4ZK7 M;  1M90 T;  1DRZ A;  1YRX A;  4URQ U;  2AD9 A;  1HLW A;  2HVH A;  1DUR A;  2IY5 B;  1DTT A;  5L1K A;  4ECU A;  5B08 A;  2W2Q P;  1Q86 T;  5EWG A;  2FIU A;  2YBV A;  1WNE A;  2RDI A;  2CNN B;  2Q3P A;  2BZ2 A;  4DUZ F;  1U1R A;  5G0R B;  3EVM A;  1I6J A;  3OL6 A;  1O5J A;  4KC5 A;  1SKU B;  2I9S A;  2G13 A;  1YZ6 A;  1E6V A;  4KB7 A;  1BQM B;  1KHV A;  4AFF A;  4J9P A;  3TVY A;  2QMW A;  1TEL A;  3BKF A;  4M5H A;  5AXL A;  2ZH1 A;  1PGZ A;  4DR3 F;  1XNQ J;  2GGP B;  5KFF A;  3PXG a;  5D0G A;  1OYD A;  1HBN A;  3RAQ A;  1UVJ A;  1ZA1 B;  1UEK A;  3QT6 A;  4LSZ B;  5HAN A;  2YWE A;  1FTR A;  4QU7 A;  5IT9 Y;  4J9U E;  2OTJ S;  3CCT A;  3D4J A;  3SV4 A;  2NXC A;  2BAC A;  4R0E A;  3HLU A;  2HFV A;  2ZKT A;  4P7T A;  1S5Z A;  5KT4 A;  2IM1 A;  3DYA A;  3G87 A;  3M8W A;  2D1C A;  2ROG A;  2XI2 A;  2MKK A;  1BMQ B;  1S6P A;  2ALY B;  3I6P A;  4DV6 F;  2XYG B;  3TZW A;  4B3M J;  3HKZ D;  3IAM 9;  1YBA A;  2YH0 A;  4NMX A;  1UP1 A;  4RUB A;  4ZHR A;  2W7A A;  1X4D A;  4LSL A;  1VI7 A;  1NKE A;  1B99 A;  4FYD A;  4F3O A;  4DPX A;  2RRB A;  2E7V A;  4CLT A;  3PHT A;  3MOJ B;  2DY9 A;  2E1M C;  2OPR B;  2RS2 A;  4FP9 A;  4QYR A;  2VDI A;  1FXL A;  4RX6 A;  3PX0 A;  4OI3 A;  4KSE B;  1N8R T;  3CB4 A;  5CD4 A;  5KFL A;  9ATC B;  2OPP B;  3SBM A;  4DR5 F;  3G9C A;  4JI3 F;  3DLK B;  3NCP A;  4MK9 A;  4Q8E A;  1S9E A;  2Z2Z A;  1RAC B;  3HFV A;  3K58 A;  5LMN J;  1ZPW X;  2QN6 B;  3V4I A;  2OPS B;  1PIL A;  3HHL C;  2J9E A;  4DL7 A;  1VBX A;  2FYX A;  2AJ4 A;  4J9V A;  1R7I A;  4EEY A;  1J5O A;  3TW0 A;  2RUS A;  5KG0 A;  3WBZ A;  2DO0 A;  4DG1 B;  1AUS L;  1SH2 A;  2A3J A;  1HYS B;  2XHC A;  3MED B;  1VMB A;  5AE1 A;  2ZE2 A;  1XR6 A;  2M52 A;  3HHK A;  4W92 B;  4JV5 J;  2LQ9 A;  5CAB A;  2YNG A;  4LRB A;  1LWE B;  3FFI A;  1JK9 B;  3ET6 A;  2POK A;  1VJQ A;  4ZJQ A;  2CPI A;  4OHV A;  1HBO A;  1HI1 A;  2CPY A;  3BQ0 A;  1DLO A;  1S7H A;  2RAQ A;  4F4Z A;  5J2M B;  5I42 A;  2KB2 A;  4B3T J;  1S59 A;  2YNH A;  2GJI A;  4CLW A;  4WII A;  1TL7 A;  4WJB A;  1RCX B;  2L9N A;  3CNQ P;  2I1R A;  4U7C A;  1IJE B;  1VQP S;  4NXN J;  2GMH A;  2G0C A;  4O3S A;  2GJF A;  2AHO B;  3GPA A;  5KFA A;  5J2M A;  4ED3 A;  5IQQ A;  4CNZ A;  2NSC A;  1RIS A;  4ILL A;  2BQR A;  1CJK A;  4IFY A;  2MHE A;  1UL3 A;  4FN5 A;  2ZBQ A;  4KPC A;  1I51 B;  2DR8 A;  2V8V A;  1F2H A;  2GHV C;  3G86 A;  3KG0 A;  3CDB A;  3W63 A;  1XMO J;  3MEG B;  2JEJ A;  4PZV A;  4M94 A;  1W2I A;  4TYB A;  4F67 A;  3V4M A;  2QL5 B;  2EK1 A;  4FDF A;  1S0V A;  3IR7 B;  1MW7 A;  3GV8 B;  3W62 A;  1F5A A;  2VD3 A;  4N8N A;  4I6A A;  5D78 A;  2IM0 A;  1R89 A;  1KOH A;  1NND A;  4USK A;  5K14 B;  4CLP A;  3JTP A;  4DU8 A;  4F4A A;  6FDR A;  3OJU A;  3R3T A;  4DL2 A;  3H0P A;  5GMK a;  5I3U A;  2DNY A;  2H1Y A;  2X1B A;  4KAI A;  3UCG A;  5D0R A;  2DH8 A;  4OZN A;  1V5V A;  2M8H A;  2OPP A;  3BPS P;  5HSP A;  1IKW B;  1S9E B;  2B5J A;  3MI7 X;  1VBZ A;  1QD1 A;  4ID5 A;  2LA6 A;  1X4B A;  4N8O A;  1P27 B;  4CLZ A;  5J2P A;  4MKB A;  1S1V B;  1F9H A;  1OJ4 A;  1TUV A;  4NZ7 A;  2W2M P;  2QA2 A;  2IDL A;  1IKW A;  2DIT A;  5A0Y B;  3MUR P;  1ACM B;  2LQ8 A;  2AP6 A;  1HNZ F;  1VQK S;  4CT9 A;  2KI2 A;  2WSF C;  3LWL A;  4NCB A;  4YR3 A;  3BN4 A;  2DB1 A;  1BQX A;  3GIL A;  5GAD U;  1V5I B;  3I0S B;  1N36 J;  1BLU A;  2DPJ A;  2XGQ A;  4DSK A;  2P9E A;  1SCJ B;  1RTD B;  4JI3 J;  2YKM A;  4CM2 A;  4OYP A;  3MMB A;  5HRO B;  3CUN A;  4NEZ A;  2F7V A;  4WFZ A;  3R9L A;  2L08 A;  4NLO A;  3T9Z A;  5KFU A;  1HQ2 A;  2DGO A;  3EXY A;  1VK8 A;  1DLO B;  2EC2 A;  3AD8 C;  3FEZ A;  4NLP A;  5KFD A;  3AY0 A;  1S79 A;  1LWX A;  2GVZ A;  4OJH A;  3SCI E;  1IKY A;  3W5Y A;  3OFH A;  5CYM B;  1NJZ A;  1RAE B;  1MG7 A;  2Y3Y A;  2VFT A;  1EX8 A;  4E2F B;  4DV5 J;  2F9J A;  3P5T L;  2XBP A;  4F50 A;  1SJR A;  3ZTP A;  5ETT A;  4NRU A;  4IFV A;  5IFM A;  1RBL A;  1UVI A;  4B3M F;  3B4M A;  3NS6 A;  2YKN B;  3HHL B;  2UVU A;  2NUH A;  4OYW A;  4JI0 J;  4ZJO A;  4OZ2 A;  1RTZ A;  3PAC A;  2B8Q A;  4OL8 A;  2BOA A;  1QE1 B;  2VPZ B;  2ZDP A;  2J6T A;  1C4C A;  4AL5 A;  3TZY A;  2RNE A;  4LRF A;  1B7F A;  3OXF A;  5CAA A;  2OEL A;  1FJG J;  4OI4 A;  1HBM B;  3IR6 B;  4H54 A;  4ED4 A;  3GIK A;  3DOL B;  3AH6 A;  2ZJP Q;  2ACY A;  2FVQ A;  4DJB A;  3JSM A;  3DLK A;  2CIM A;  4YR2 A;  3OHA A;  3C6T B;  3M32 A;  2JZ5 A;  4H4M A;  2KG0 A;  4IH6 A;  3U1M A;  1FRH A;  2D74 B;  4J9M A;  4MIW A;  1VHI A;  2OLW A;  3JSM B;  4MYU A;  2M5Y A;  4DUZ J;  2MJU A;  4LRD A;  1CUL A;  2R2R A;  1WEY A;  3JTO A;  4PG6 A;  2FVC A;  2ZFH A;  1RWP B;  3DLE A;  4F04 B;  2KFZ A;  2PMH A;  5F9N A;  2CDR B;  3SMZ A;  3FCV A;  4YHH J;  2Z57 B;  2OO4 A;  3NP5 A;  4DSJ A;  4JV5 F;  2RT3 A;  3MPV A;  4FYV B;  1N5Q A;  1N5T A;  3IWL A;  3C8Y A;  1N5V A;  4M5D A;  4X4O A;  1R6V A;  2MKH A;  4KFB A;  2RML A;  2LEA A;  2DY1 A;  5ETQ A;  2YX1 A;  1UAW A;  1U0H B;  1B0V A;  1TMM A;  2ZD1 A;  3A3O B;  3N5B A;  4RW8 A;  4Z7C A;  2C42 A;  2W7P A;  3IS9 B;  2B4V A;  5KG5 A;  4O4R A;  2U1A A;  5LM7 E;  4HT5 A;  2DH7 A;  3Q23 A;  3JQJ A;  1QE1 A;  5HL7 Q;  3FK4 A;  2QRR A;  3POT A;  1S6P B;  4K0K J;  3UR0 A;  2WK4 A;  2G2O A;  1GQE A;  5HK4 A;  5E3A A;  1F3V A;  4C97 A;  3T41 A;  4JV0 A;  1X5O A;  4I69 A;  4CO5 A;  1RT5 B;  3VAL A;  2OAU A;  1GMU A;  4WFB Q;  2P8I A;  5J2Q A;  1ZTW A;  3WHI A;  3GMG A;  4WP3 A;  3POT B;  3ZZU A;  4YS2 A;  4Q0B B;  5KFY A;  4GKK F;  3BSC A;  2RRA A;  2YKP A;  4K5S A;  3BPD A;  4TY8 B;  2NZC A;  4DPT A;  3LP1 A;  5MLC V;  3TI0 A;  4RBV A;  1PAU B;  2OPQ A;  2QYG A;  1HHS A;  2JC0 A;  4NLX A;  4YY3 F;  2M4M A;  2RDD A;  3MD3 A;  2JL9 A;  3QAU A;  4KV8 A;  2HHW A;  2AGO A;  5C42 B;  1B7Y B;  2AEJ A;  2VG5 B;  5HMZ A;  4XPC A;  2NQP A;  2BBE A;  3R7N B;  2MXY A;  2J7U A;  2RE1 A;  3VWS A;  3LTO A;  2ZZT A;  1QM9 A;  4ZOS A;  3FJ2 A;  2DGQ A;  2R9L A;  4MKY A;  4OJ1 A;  4JYA J;  1U0S A;  1K47 A;  2I5J A;  2B6A A;  2AV5 A;  3GG0 A;  3LPE A;  2VOO A;  5HMW A;  1LK7 A;  2OGU A;  4V19 J;  4DPY A;  1Y5L B;  3ENV A;  4DMZ A;  2H5E A;  3J7Y I;  3RBD A;  1NLK L;  1VLY A;  2RQ4 A;  3LGH A;  4X4R A;  1JKH B;  4O3Q A;  1JLE A;  2VBX A;  3DRR A;  3RTV A;  2PT0 A;  4J7C A;  1HPZ A;  2Q1L A;  2OKQ A;  3T5K A;  5KG6 A;  1X0P A;  3DRS B;  3FCW A;  1S1U A;  5F3Z A;  4X62 F;  2VC1 A;  4LSN B;  3ZZZ A;  5HVF A;  2V4Q A;  2ZOM A;  1R8P A;  2FJE B;  2G0I A;  2GFF A;  4U8V A;  2AJ0 A;  2FLO A;  4I68 A;  3GIM A;  4A8Y A;  1LWF B;  1VC6 A;  2R7U A;  4FYX B;  4YY3 J;  5D4O A;  5F0U A;  1DAR A;  2FC8 A;  2LXF A;  2O67 A;  3U7J A;  5DG9 A;  3NEK A;  2FLN A;  4ZP6 A;  1TMJ A;  4P74 A;  4K4Y A;  2RIJ A;  3NGU A;  2L41 A;  2HS4 A;  3J80 U;  1CJU B;  1U8S A;  4V1A k;  4WXW A;  1RE1 B;  1S6U A;  1OY6 A;  2CDQ A;  4ZPV R;  1IVZ A;  3KUE A;  5DDO C;  3PR4 A;  4JV1 A;  4J37 A;  3RBZ A;  2AJQ A;  2IM2 A;  1RLC L;  4M5K A;  1X9S A;  1QSL A;  2HEK A;  3BBF A;  3BEG B;  3LP0 B;  1FK9 A;  3N6N A;  2HPU A;  2VAS A;  4ID8 A;  4C0O C;  4HYK A;  1YVF A;  5D3G B;  1M5O C;  1F9F A;  5J2Q B;  4RW6 A;  4JI1 J;  4J9K A;  3EXC X;  5IT9 U;  2XY7 A;  2BRK A;  4C3K A;  1FX2 A;  1VR6 A;  1ZOT A;  2C2Z B;  3P45 B;  4KR0 B;  3MR5 A;  4G3I A;  1S1T A;  1UVN A;  1AZS A;  1EKS A;  4LVO P;  4FVC A;  4JV2 A;  4HHU A;  5A6P A;  1UFK A;  2ZM6 F;  5D8H B;  3QMQ A;  3F44 A;  3LP2 B;  3O2I A;  3RU0 A;  1S1W B;  1HBU B;  4EO6 A;  4ZVU B;  1A9N B;  4OI1 A;  5FDL B;  3OHB A;  3PW0 A;  1BWE A;  3KWM A;  1DQ9 A;  1FFW B;  1U1Q A;  2PSZ A;  1FI4 A;  2CUY A;  4RJV A;  2OTL S;  2BJD A;  2ZE2 B;  4K4W A;  2R2U A;  5A0Y A;  3HD2 A;  3KXD A;  4EWT A;  1U2R A;  3LGM A;  3M05 A;  3NCR A;  1ZM9 A;  4P2F A;  3FCH A;  4C3M A;  5HQL A;  2AYM A;  5LT5 A;  1JIH A;  1S12 A;  1WC3 A;  2OEM A;  2XZT B;  1OSC A;  3BRE A;  3EGN A;  2V8P A;  3W2W A;  4HVZ A;  4AL6 A;  2MLZ A;  2HVE A;  2J5A A;  4JI4 J;  2GV1 A;  1NRK A;  4DV3 J;  1WC1 A;  2HHP A;  3T1Y J;  1QTN B;  1P9Q C;  2VUG A;  5HBM A;  1WHV A;  1WEX A;  5GAH U;  1FES A;  3PEJ A;  4ZPA A;  1M5H A;  1NU4 A;  3KYL A;  1EB0 A;  2JHE A;  2ZBI A;  1HNZ J;  1FRX A;  3A1Y G;  1R31 A;  4NI2 A;  4JB8 B;  4QR0 A;  2ZH4 A;  1S72 S;  4JYA F;  3J7Y U;  3EGV A;  2DNG A;  2CPF A;  3CD6 S;  2V2Z A;  2QL7 B;  1HWI A;  3OT9 A;  1F5B A;  2C2O B;  4HL9 A;  4PWU A;  1X9W A;  5CYJ A;  1VQ9 S;  2HLU A;  1C0T A;  1WOS A;  4PG4 A;  3MPY A;  2WON A;  3ISN C;  4ITS A;  1VDH A;  1O0P A;  1B70 B;  4DN0 A;  1GMW A;  2MGZ A;  1KOO A;  5E3C A;  1E6Y B;  4C8N A;  1R0B G;  4WP9 A;  2X3D A;  4DX5 A;  4YUD A;  1U6F A;  3CCU S;  3D2W A;  4DPO A;  2MZQ A;  1S77 D;  2W9C B;  4TVA B;  1EHW A;  4LF1 A;  2W2O P;  1HNX J;  5F8H A;  2JRS A;  3L7O A;  4I0W A;  4ED6 A;  1WG5 A;  4OYM A;  1K0V A;  2V68 A;  3CMA S;  2PD1 A;  1W2B R;  3CCQ S;  3HZE A;  3Q2S C;  3A13 A;  1T03 A;  1H6K X;  2LVW A;  3FRZ A;  4BLG A;  3E3X A;  2Q79 A;  3AJD A;  2W8K A;  3EUN A;  1OPI A;  3AA8 A;  3M6W A;  4DQI A;  3I5B A;  4G1Q B;  3MR2 A;  3J7A N;  4BWJ A; 
#chains in the Genus database with same CATH homology
 1HLW A;  4WBF A;  1ZS6 A;  2B8P A;  3VGS A;  3Q8U A;  4UOG A;  3NGT A;  1NLK L;  3Q86 A;  3VGT A;  3VVT A;  4ENO A;  3EVM A;  3FCW A;  4W98 A;  2CWK A;  3Q89 A;  1NCL A;  4CP5 A;  2VU5 A;  2DXF A;  4DZ6 A;  2DXD A;  3R9L A;  4F36 A;  1KDN A;  3BBC A;  1BUX A;  3FBF A;  3NGU A;  1LWX A;  1XQI A;  1XIQ A;  1JXV A;  2BEF A;  3EMT A;  1S5Z A;  2BX6 A;  4AND A;  3PJ9 A;  3L7U A;  3Q83 A;  4FKY A;  3NGR A;  1NSK L;  3EIC A;  3Q8V A;  3FBC A;  4FKX A;  3ZTP A;  1PKU A;  3BBF A;  3GP9 A;  1B99 A;  2B8Q A;  3DKD A;  3B6B A;  3DDI A;  4DUT A;  3EE3 A;  3FBB A;  1NHK L;  2DY9 A;  5CAA A;  1W7W A;  1MN7 A;  4DI6 A;  2ZUA A;  1BHN A;  1NDK A;  1B4S A;  3PRV A;  1UCN A;  1NB2 A;  1F3F A;  1NSQ A;  1WKJ A;  4C6A A;  2AZ1 A;  2HUR A;  3EVO A;  3Q8Y A;  3VGU A;  4UOH A;  5C7P A;  1NDC A;  2NCK L;  3ENA A;  3VVU A;  3EM1 A;  2HVE A;  1HIY A;  3ZTO A;  5CAB A;  3FCV A;  3ELH A;  3ZTQ A;  3VGV A;  3ETM A;  2AZ3 A;  1LEO A;  3FC9 A;  4UOF A;  2DXE A;  1HHQ A;  4ANC A;  3JS9 A;  3BH6 B;  1S59 A;  1PAE X;  1MN9 A;  1WKK A;  3ZTR A;  4O0N A;  3GPA A;  2HVD A;  1F6T A;  1NUE A;  3BBB A;  3FBE A;  4KPC A;  3NGS A;  3EJM A;  1VYA A;  1K44 A;  5IOL A;  1BE4 A;  3MPD A;  1EHW A;  3BH7 B;  1S57 A;  1NPK A;  1NDL A;  4F4A A;  3FKB A;  3EVW A;  3ZTS A;  4S0M A;  1NSP A;  5BXI A;  1NDP A;  1U8W A;  3B54 A;  3G2X A;  4HR2 A;  4ANE A;  4EK2 A;  2DYA A;  3WX8 A;  1WKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...