5BXOA

Human tankyrase-2 in complex with macrocyclised extended peptide cp4n2m3
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
SGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human Tankyrase-2 in Complex with Extended Stapled Peptide sp4n2m3
rcsb
molecule keywords Tankyrase-2
molecule tags Transferase
source organism Homo sapiens
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5bxoA00
4LSZE 4GMRA 3F6QA 2QYJA 1A5EA 2DZOA 3JXIA 3UXGA 5EYPF 1MJ0A 1QYMA 4U95D 1D9SA 3V31A 1UOHA 2Y1LE 5EILA 2P2CP 3JUEA 5CBOA 4J8YA 2PNNA 3Q9NC 4K5CA 3TWSA 4DX1A 5ITZF 3Q9UC 4YDWA 2BKKB 4DX5D 2QC9A 1DC2A 5AQBA 2B0OE 4U96D 5HRYA 5FIOA 1MX6A 4B93B 3C5RA 4HBDA 2XEEA 1NFIE 5ENTD 3DEOA 4QQIA 3TWUA 1BU9A 2ETAA 3D9HA 2V4HC 4HNAD 4ZHBA 2MYOA 4DX6D 1K3ZD 5AN8A 4HB5A 2J8SD 1AWCB 4O60A 1TR4A 3NOCD 3J5PA 4C48B 4U8VD 5ENRD 4LG6A 5EYLA 1IXVA 1K1BA 3DEPA 5AQ9A 3B95A 3V79K 2DZNA 2HE0A 1OY3D 4ZFHA 4LNUD 1MX4A 3NOGD 4ATZD 3TWTA 4BERA 5KNGA 3V2XA 4Z68A 3UI2A 1BI8B 1G3NB 2V5QC 3KEAA 5HKPA 2DVWA 3W9FA 2BKGA 2F8XK 2ETBA 4UUCA 5ENQD 1YYHA 5HS0A 1AP7A 1WG0A 4OAVB 3JXJA 4F6RD 2Y0BG 3T8KA 2RFAA 4HRMB 4GPMA 4HI9A 3TWWA 5EIBE 2ZGGA 2F8YA 1BD8A 3J5QB 4J7WA 4JB8P 3AAAC 5ENPD 5CBNA 4N5QA 5KBAA 4TUMA 5JMND 1SVXA 5CECB 1MYOA 2XEHA 1MX2A 5FINA 1N11A 1K1AA 1DCQA 1BLXB 3ZU7B 5EIDA 3EHRA 2KXPC 4U8YD 3SO8A 4CYMD 3HRAA 2XENA 5AAOA 3ZUVB 4K5BA 5KWDA 4YDYA 4CZ2D 4DX7D 2NYJA 3EHQA 2VGEA 4QFVA 1SW6A 2XZDG 5JA4D 3HG0D 5BXUA 3V2OA 1N0QA 4DRXE 1YCSB 3W9GA 5AQAA 4OAUC 2DWZA 1BI7B 2FO1E 5KNHD 3LJNA 4HRLA 4HQDA 2F37A 3ZNGA 4BEPA 2ZGDA 4HI8A 3TWQA 4NIKA 4BSZB 1S70B 3V30A 5ENSD 3TWVA 3IXEA 1IKND 1IHBA 2JABA 4G8LA 5AARA 4BETA 1OT8A 4G8KA 3TWXA 3UTMA 2KBXA 5BXOA 2ETCA 4HRNA 3T9KA 4DUIA 4O1OA 3TWRA 3NBNB 5CEDB 4DX2A 3B7BA 5EN5D 5CEAA 2L6BA 4HLLA 4F1PA 1WDYA 4RLYA 1N0RA 3AJIA 4O1PA 4K5AB 5ENOD 4BESA 5CERB 4A63B 2RFMA 2A5EA 5D66A 3ZKJA 5AQ7A 2XZTG 3EU9A 2AJAA 1YMPA
chains in the Genus database with same CATH superfamily
2J09A 1N4QA 2E0IA 4AXHA 4DK5A 4HLEA 5CBOA 3HIZA 3SD5A 2LUHA 4K5CA 5ITZF 1OXJA 4DLQA 3ZHEB 4UWLA 5EDSA 3QARA 2R03A 1NFIE 3PE4A 5D0QD 2P58C 2J8SD 1TR4A 4U0ZA 4BT9A 4A55A 1HO8A 5BV0A 3RAUA 2XGMA 1UW4B 3ZHEA 4HS2A 3JYSA 1TJFA 4TRQA 3UIOC 5AYWD 2ETBA 3TL5A 3Q4AB 2VSYA 3T8KA 4Q94A 1GW6A 1MZCA 4ME2A 2F8YA 2VGYA 4XEIG 3VLEA 4GAAA 2YHCA 3L22A 5CHEE 3CHSA 4KXKB 3EHQA 4E6HA 4OAUC 1YCSB 4ACKA 4HQDA 4I9CA 4GYOA 3V30A 4LNBA 3S2AA 3TWVA 1HU3A 3U4TA 1TN6A 2A4ZA 1XGWA 5BXOA 3D9OA 5CEAA 5J90A 4N3AA 3ULQA 3K9IA 4K5AB 2QFCA 4RG9A 4WNFA 4TV3A 2Q7FA 2KM4A 2P9SG 3V31A 3I5PA 3CKCA 2PNNA 4DI3A 3ZFWA 5JJ7A 4F1SA 3E37A 3Q7FA 3RSEG 3C72A 2WXGA 3Q5MA 1OWOA 5CCMA 1INZA 2XEEA 4HNAD 4ZHBA 1KZOA 4DX6D 5AN8A 1E8ZA 1KZPA 5LCWJ 1EPUA 2WMNA 1LD7A 2QZAA 1H6OA 2XRYA 4G11A 5AJLA 4OVVA 5G05J 3BQOA 1AP7A 2FULA 2XHEA 5DIZA 1N52A 2OV8A 1ZB1A 4GTRA 4APFA 3FTVA 1O1TA 2GRNB 3L13A 3WXXA 3TXMA 2WPVA 1MX2A 3GZ2A 3AG4E 3EHRA 4H7YA 4CYMD 4JHKA 4CDMA 3HXEA 3O48A 5A6CA 3C3OA 3D9LA 3D9NA 1N0QA 2I6HA 1SZ9A 2F37A 2FO7A 3CIAA 4U7EB 2ZGDA 4NIKA 2L0IA 3KS2A 4V3IA 4G8LA 1X5BA 2V4LA 2EIKE 2KCVA 3UM0A 1TEZA 1NP7A 1O1SA 3SY2A 3FTXA 4G26A 4I9EA 5ENOD 3ZPJA 3ABKE 2AVPA 3AU5A 3UINC 3KSQA 3ZYMA 4TXPA 5LCWC 4BWRA 3D9IA 4G1TA 3RRNB 4I2ZA 3U66A 3TWSA 1NI1A 4AOFA 4FHJA 5FZSA 3C5RA 5G05C 3ZYKA 1UJKA 2GRPB 3PZDA 3AS5A 2VSXE 1JCRA 4C48B 3APDA 1TN7A 2XS8A 3B7RL 4ATZD 2FI7A 3HHMA 2V5QC 3FH5A 2F8XK 3KEZA 2KZTB 2C2LA 3ZXSA 2OOEA 2AW6A 1TYQG 3CQCB 3RIBA 4UWHA 2WXJA 4JEUA 2YINA 3CK9A 3U3WA 3SO8A 2VTBB 2HR2A 5KJMA 2AXZA 2LXLA 1Z6TA 4BTBA 3CV0A 3MKQA 1SZAA 3FY4A 3FTYA 2M63A 3S7FA 4GTVA 1S0PA 4GZ5A 5E76A 1OT8A 1U3DA 1UG3A 1TNOA 2WQHA 3SBTB 3G2UA 4A1GA 3ABME 4A3TA 3S7JA 3WG7E 2H6HA 3PZ4A 3JQ1A 3PZ3A 4A63B 3L17A 3ZKJA 3PEVB 3UXGA 3L6AA 3UT7A 3BUAA 1N54A 2XPYA 2ZU6B 4YDEA 4Q96A 2AXVA 1IYGA 4U96D 4GTTA 3FTWA 3UX4A 3ZN3A 2VJ8A 1Z3XA 3DEOA 4OVUA 3TWUA 4UWGA 2Y3AA 5C1DA 3BG1B 3NQPA 4HB5A 3VTXA 3NOCD 3FH8A 2WXFA 4YVOA 5FQ8A 4GZ6A 4TUUA 3TWTA 4KZ0A 2X6JA 1BI8B 4I17A 5ARFA 4OAVB 3PREA 4WAFA 2WXOA 5B1BE 5H7PA 2MRIA 4B8CB 4L7TA 2V8SE 4FJYA 1HZ4A 4LCTA 1KPSB 5ENPD 5EX3A 3SZ7A 1N11A 3ZU7B 5LP0A 3LS8A 1JWFA 3AG2E 4WNDA 4QFVA 3CHQA 3Q73A 4IULA 1SW6A 1H0AA 2C0LA 4B89A 3UT4A 4JZYA 3SI5A 4GZDA 3ZVVA 3CVYA 1KLXA 2X6FA 2J9QA 2YNQA 4MLPA 4NURA 4DUIA 4D10C 1IQUA 2IOLA 1WAO1 4TXQA 4ILHB 3JQ0A 1E8WA 3CHPA 3FDHA 2HO1A 2QYJA 2R5SA 5DBKA 3DWLG 3OXLA 4EBAG 4G24A 3NAWA 4FP7A 3Q9NC 3AG3E 1MX6A 3MKRA 1RW2A 4AM9A 1OCZE 5ENTD 4CDNA 4PH4B 3LY8A 2MYOA 4UI9J 3EHNA 3DSSA 3FUFA 3E30A 5ENRD 2J4BA 2NXPA 3RJVA 3OXGA 3FUDA 4C0MA 1DCEA 4ILGA 1FCHA 3KD7A 1N95A 2WXPA 3FULA 1UJJA 4BX9A 3DBSA 4GPMA 3SFXA 2L0TB 1YA0A 4BX8A 4UWKA 1U3CA 3SBSA 5CMYA 2DYSE 2P9LG 1DCQA 1IHGA 4AY5A 4G25A 4DI4A 4U8YD 4BT8A 3PNLB 3QKYA 4EECA 3Q49B 1JWGA 3ZW3A 5AIJA 2EIME 3D9KA 1D8DA 4L2YA 2AWIA 3IKOB 1JCQA 4EQFA 3ZRHA 3LVRE 5CEDB 1HX8A 1HG5A 2GRLA 3GZSA 1S63A 4RG6A 4UI9C 1EYHA 2RG8A 5CRUA 3N71A 2IONA 4C0EA 3Q7AA 2J49A 1HH8A 5EYPF 1MJ0A 2BF0X 2Y4TA 4OYSA 2EINE 4M7CA 5ARGA 2BKKB 4J8EA 1OUVA 3T5VA 2Y69E 2ETAA 2ILRA 2VYIA 2R2LA 2WXLA 4U8VD 3GZ1A 2YQ8A 3DRAA 3HYMB 3UM2A 3NOGD 3ASOE 1ELRA 5HKPA 1OCRE 2P9UG 2VGXB 1TNZA 4FHKA 1QNFA 1PC2A 2UWJG 3JUIA 3TWWA 4BSXA 3DPYA 3RRUA 2CHWA 3QK0A 2IF4A 4WNEA 5CECB 4ANUA 2KXPC 4GPKA 3BEEA 3LEWA 4FLHA 2F0YA 2VGXA 3G2TA 4J8FA 4XI9A 1E90A 3C3QA 4CGWA 3TJPA 4GMJA 3ASDA 3CHOA 4BEPA 4HI8A 1E96B 4HXIA 3ZGQA 5BT1A 5FQ7A 3LXUX 3QAQA 5KCMA 3EDTB 5G2NA 4HRNA 3CVNA 4YDOA 2WXHA 2L6BA 4HLLA 1KT0A 3RKVA 3ASNE 4N2SA 3AS4A 2IJGX 2R05A 3OTNA 4MKTA 3QOUA 5FWQA 3T5XA 3SF4A 3ABLE 2X6HA 3CVQA 1TNUA 2KC7A 2R17C 4AV7A 3MV2B 4U07A 5G55A 3TGOA 5KJLA 4O60A 3G2SA 3APCA 4FC8A 5EYLA 1IXVA 2OEVA 2WB2A 2FBNA 1ELKA 4U0SA 3LPZA 4F53A 1YYHA 2A5UA 3TG5A 3RO3A 4CCAA 5A23A 4I2WA 2GW1A 2Y0BG 2P9IG 5FJYA 2KCLA 3NB2A 1L5JA 3LJ3A 5EIDA 5EKQD 5C2YA 3MGBA 1Z3YA 3IEGA 4DX7D 2PQNA 5D2MC 2QY7A 1QZ2A 5T3RA 4DRXE 3R7RA 3NZUA 2OVFA 4L1BA 4A3VA 4JW1A 1JCSA 3HXFA 4G8KA 3DSTA 3FTUA 3C3RA 4Y6WA 2GGFA 4CT0A 1FT1A 3ML8A 3QC1A 2H6GA 2LNIA 5AQ7A 2XZTG 2GRRB 5G04J 3QWWA 5T8IA 3FUMA 4GA2A 4EZKA 1DC2A 2YHEA 5AQBA 1X81A 2B0OE 3EHMA 2WMOA 5FIOA 1WY6A 4B93B 3E34A 2X3MA 3GW4A 3B7TA 4KYOB 5KJNA 1EF1C 2OVBA 3FP3A 4GB9A 4KZCA 5B3SE 2XGSA 4U0UA 3CHRA 4XKCA 2GRMA 5B1AE 1RZ4A 4J8DA 2XEVA 2HE0A 4ZFHA 3RRMB 5BPPA 3FU3A 2DVWA 5EX0A 3DSUA 3QWVA 4KVOA 1SA4A 3BG0B 3D9PA 2XCBA 5FZQA 3UT8A 3TG4A 4CT4A 2ZGGA 4GTOA 3QWPA 1BPOA 1HE8A 4B94A 2XEHA 5FINA 1K1AA 4LERA 1N94A 5BUZA 3QNKA 4J0UA 2WXQA 1OCOE 4K5BA 4L9PA 4YDYA 4EZJA 5HQ8A 2XZDG 5G04C 1JPLA 4IN3B 3TWQA 2EIJE 3FTZA 2J4DA 2ETCA 1PY1A 4O1OA 2KZTA 5EN5D 4EZLA 4N3CA 4AJWA 2P9KG 4DLOA 2C0MA 4L2LA 1A5EA 3DXMG 2UY1B 2BUGA 2P2CP 4J8YA 4FU3A 2RD0A 2VTBA 4P29A 3R9AB 4U8HA 4QQIA 5FTPA 3UMVA 3L54A 2DCPA 3S7BA 4G23A 1OWMA 3AU4A 4WWPA 3QDNA 4UQXA 5CRVA 1A17A 2BKGA 2PM6A 3PEUB 2WQ7A 2HM8A 2EQXA 4W9RA 3ML9A 4HRMB 3B13A 3J5QB 4J7WA 4A1SA 4UQZA 1HG2A 1LD8A 4I6EA 2XENA 3EUVA 4ANWA 1H19A 4CZ2D 2CHZA 3UUXA 3L08A 3HDXA 3HG0D 3UKUG 3PNTB 4ATGA 3LJNA 2XPIA 3IV0A 3FWVA 4PS3A 3IHYA 4N39A 3FEXA 5ENSD 4F7AA 3IXEA 3I4GA 4XKBA 1FPPA 1HS6A 2WM9A 3SGHA 4XE0A 2I1JA 3C98A 5ANRA 3IHVA 2E2EA 4AP2A 3AJIA 4O1PA 4AY6A 4GMRA 1U2VG 4NQ0A 3U64A 3LY7A 1UOHA 2MHKA 1TJCA 4AIFA 3PE3A 4GA0A 3DSWA 1E7UA 3DXKG 4UWFA 4I1OB 2AXUA 3T8MA 3E32A 3FUEA 1BU9A 3MEKA 4R7LA 4I1MA 5AENA 3CGHA 3ASHA 4NACA 5A7DB 2P9PG 3ESKA 2VSNA 2XPZA 4XZ4A 3ULEG 3KSLA 3FU5A 3KAEA 2V5FA 4JA7A 1E7VA 3BU8A 3CVWA 4MBGA 3DSXA 2LO6A 3OAWA 2IO3C 5IY5E 3ENEA 3G2WA 3PVLA 3LCAA 3B7UX 4GCNA 3LKUA 5AAOA 2IFUA 5KWDA 4GTMA 2NYJA 4G2VA 2WXMA 2R02A 4N5CA 3RU0A 3UM1A 2FO1E 3MA5A 1V54E 4EHMA 4JHJA 1IKND 3PS6A 2GRQB 1E8XA 2KBXA 3SHFA 4M3OA 3TWRA 3B7BA 3UM3A 2RKKA 2RFMA 3Q79A 5JHBA 1N4SA 2VSOE 3L9TA 4U95D 1QYMA 3EIJA 5EILA 3MYVA 2L9BA 3ZEFA 1NA3A 5E75A 4KBQA 2QC9A 4X8QA 5HRYA 2FF4A 3VLDA 3PRZA 4XIFA 5BV1A 4HBDA 4JL0A 3HXBA 2BTDA 3MJWA 4U04A 2XGOA 2IU1A 3HVEB 2J07A 3J5PA 1LTXA 4JD2G 3FUIA 2ONDA 2WXNA 2CHXA 5AQ9A 4BERA 4XI0A 4Y6CA 4E85A 5ENQD 1ELWA 3HXCA 3UIPC 2DYRE 4MS6A 3UKRG 3FU6A 1BD8A 1ZU2A 5KBAA 4J8SA 1FT2A 1SVXA 1B89A 3SNXA 2PQRA 1VDYA 2VGEA 3ASGA 5M72A 2X38A 3FUKA 2DWZA 3AS8A 2VQ2A 2ZXWE 2Y4UA 3RO2A 3CEQA 4JPSA 2HYZA 3ISMC 1IHBA 3B7SA 3T9KA 4ANXA 1N0RA 4FLBA 3NF1A 1PAQA 5D66A 2KCKA 1EDUA 3EU9A 4GZCA 3P1UA 3F6QA 4JHRA 1D8EA 3JXIA 1S64A 1D9SA 4B8AA 4H7XA 3O4ZA 3QJZA 3URZA 4GYYA 2XRZA 3L16A 1P5QA 1AWCB 4DPRA 1K1BA 4J6IA 3ONKA 4C9BB 3V79K 5HI7A 1K8KG 1NL4A 4Z68A 2J08A 1G3NB 1IQRA 3GYZA 4UUCA 1HXIA 2LAHA 2B6CA 2DBAA 3AAAC 5JHAA 2IY0C 4N5QA 2PL2A 3UPVA 4TUMA 3SFYA 2WXRA 3TXNA 2BEDA 3NZSA 4PDXA 2JLBA 5JJ6A 2IEJA 5AQAA 4BY6A 4B0ZA 5BW8C 2H6FA 2I1KA 5FT9A 4Q69A 4URKA 2IO2C 1H6PA 4F1PA 4GYWA 4RLYA 3DSVA 2H6IA 3FU0A 1DVPA 3CVLA 5LX8A 3Q78A 3JUEA 4ACLA 2KATA 4DX1A 3Q9UC 4RQIA 1FVHA 1H6KA 3L82A 3TAXA 4NRHB 3CHMA 1DNPA 4MRUA 2IQCA 4LG6A 3AG1E 4I6JA 3LDZA 3CK7A 4FJZA 4PS8A 4U63A 1OWLA 2JEKA 5LFAA 4WWOA 2RFAA 4WNGA 4JVSA 2OCCE 4JB8P 4K0RA 1TNYA 3ZXPA 1MYOA 2CG2A 4PS7A 4HFGA 5JA4D 2WVIA 3V2OA 3W9GA 4HRLA 3ZNGA 3ZYQA 1KT1A 1OCCE 3CVXA 4I6GA 2JABA 3MCXA 2QYUA 2X6IA 3TWXA 3EJNA 3G2VA 3HXDA 3I4RB 1FVFA 2LXMA 4PUCA 1LF8A 2NC9A 1JUQA 4KMOA 3Q47B 2MOWA 3R9MA 4AEZC 2CFZA 3EIQC 2Y1LE 1HFAA 4YNDA 5D0OD 2NSZA 1QBQA 3MX3A 4RVBA 4DX5D 3FH7A 4HORA 3JCKC 4I43A 3ULYA 4CEMA 1V55E 4AVXA 2XS1A 4ILIA 1H2UA 3FEYA 3ESLA 1QQEA 3MKQB 4HOUA 3D9MA 1SA5A 3B95A 4IYPA 4UQYA 2DZNA 1OY3D 4I1AA 5KJKA 1N9AA 3UI2A 5J08A 3JXJA 4GTPA 1UN9A 4F6RD 3CVPA 2PM7A 4CDRA 3PUJA 5CMWA 5LOZA 5CBNA 2UY1A 3FFLA 5JMND 4TXRA 4KT6B 4LUNU 1HF8A 5JJTA 4ABNA 3CQGB 2WXKA 3ZUVB 2PZIA 2XCCA 4GA1A 4WUYA 5BXUA 2EILE 2P9NG 4JXTA 5FQ4A 3LY9A 3SQVA 1S70B 3PDNA 5CCLA 3MZLB 1UN8A 2OEWA 3IBEA 3VTYA 3CLJA 2X6KA 1MQSA 4BESA 4LEUA 1MHQA 4LNUD 1YMPA 4HOTA 1TN8A 2DZOA 2L6JA 4XX5A 5BNWA 4DJAA 4LNGA 4GTSA 4YDWA 1XNFA 3ASFA 3FUJA 3CVUA 2LSVA 3CR3A 2XQ0A 3Q75A 2GROB 3CVVA 5FQ6A 3EU5A 3PZ1A 4KVMA 1Y8MA 1K3ZD 2R59A 4FA6A 3E4BA 4HOSA 3D9JA 2V0PA 1N4RA 3CK8A 3V2XA 1H2TC 2DIWA 4GU5A 3W9FA 1NA0A 5HS0A 1WG0A 4HOQA 4F3VA 4WWNA 3ZIMA 4JC8A 4BFRA 3U9WA 4ANVA 1H2VC 4EBAA 4APOA 1BLXB 1W3BA 3ONLA 4CRWA 3DPDA 1O5MA 3VLFA 4YVQC 4GMLA 2ZIRA 5ANLA 2ZISA 4GZ3A 4EPZA 2CG3A 1O1RA 3UTMA 1E8YA 3NBNB 4DX2A 4GTQA 4FADA 2AJAA 3ZYLA 4LSZE 3QB2A 3MV3B 3FHEA 3S7DA 4N2QA 2I9CA 3FTSA 3E33A 3SFZA 1Q2ZA 4N3BA 2LAIA 3CKBA 1OWPA 4LRZA 3RK6A 4GCOA 5AJDA 3D9HA 3Q15A 2V4HC 1NZNA 3OXFA 1TNBA 4JA9A 3DEPA 4JEHA 2WQ6A 4CGVA 3R7QA 1MX4A 1WM5A 4L23A 5KNGA 3KEAA 1SQMA 5T4YA 4BTAA 1Y6IA 2IOSA 5FZRA 3LYAA 2I2OA 1ZBPA 2LSUA 3PZ2A 4HI9A 3X2QE 5EIBE 3I3NA 4RSYA 2FEZA 3CSFA 3LVQE 4K03A 1OWNA 1N4PA 4IRUA 5ENNA 3HRAA 2CFUA 3D3MA 3P2BA 1Z5SC 3UQ3A 3HVEA 1BI7B 5KNHD 3CSTA 3APFA 3FUHA 3PUKA 4BSZB 4FULA 4HVBA 5AARA 4BETA 4O6FA 4UI9K 1WDYA 5CERB 3PH0C 3FUNA 2A5EA 2WXIA
chains in the Genus database with same CATH topology
4LSZE 4GMRA 3F6QA 2QYJA 1A5EA 2DZOA 3JXIA 3UXGA 5EYPF 1MJ0A 1QYMA 4U95D 1D9SA 3V31A 1UOHA 2Y1LE 5EILA 2P2CP 3JUEA 5CBOA 4J8YA 2PNNA 3Q9NC 4K5CA 3TWSA 4DX1A 5ITZF 3Q9UC 4YDWA 2BKKB 4DX5D 2QC9A 1DC2A 5AQBA 2B0OE 4U96D 5HRYA 5FIOA 1MX6A 4B93B 3C5RA 4HBDA 2XEEA 1NFIE 5ENTD 3DEOA 4QQIA 3TWUA 1BU9A 2ETAA 3D9HA 2V4HC 4HNAD 4ZHBA 2MYOA 4DX6D 1K3ZD 5AN8A 4HB5A 2J8SD 1AWCB 4O60A 1TR4A 3NOCD 3J5PA 4C48B 4U8VD 5ENRD 4LG6A 5EYLA 1IXVA 1K1BA 3DEPA 5AQ9A 3B95A 3V79K 2DZNA 2HE0A 1OY3D 4ZFHA 4LNUD 1MX4A 3NOGD 4ATZD 3TWTA 4BERA 5KNGA 3V2XA 4Z68A 3UI2A 1BI8B 1G3NB 2V5QC 3KEAA 5HKPA 2DVWA 3W9FA 2BKGA 2F8XK 2ETBA 4UUCA 5ENQD 1YYHA 5HS0A 1AP7A 1WG0A 4OAVB 3JXJA 4F6RD 2Y0BG 3T8KA 2RFAA 4HRMB 4GPMA 4HI9A 3TWWA 5EIBE 2ZGGA 2F8YA 1BD8A 3J5QB 4J7WA 4JB8P 3AAAC 5ENPD 5CBNA 4N5QA 5KBAA 4TUMA 5JMND 1SVXA 5CECB 1MYOA 2XEHA 1MX2A 5FINA 1N11A 1K1AA 1DCQA 1BLXB 3ZU7B 5EIDA 3EHRA 2KXPC 4U8YD 3SO8A 4CYMD 3HRAA 2XENA 5AAOA 3ZUVB 4K5BA 5KWDA 4YDYA 4CZ2D 4DX7D 2NYJA 3EHQA 2VGEA 4QFVA 1SW6A 2XZDG 5JA4D 3HG0D 5BXUA 3V2OA 1N0QA 4DRXE 1YCSB 3W9GA 5AQAA 4OAUC 2DWZA 1BI7B 2FO1E 5KNHD 3LJNA 4HRLA 4HQDA 2F37A 3ZNGA 4BEPA 2ZGDA 4HI8A 3TWQA 4NIKA 4BSZB 1S70B 3V30A 5ENSD 3TWVA 3IXEA 1IKND 1IHBA 2JABA 4G8LA 5AARA 4BETA 1OT8A 4G8KA 3TWXA 3UTMA 2KBXA 5BXOA 2ETCA 4HRNA 3T9KA 4DUIA 4O1OA 3TWRA 3NBNB 5CEDB 4DX2A 3B7BA 5EN5D 5CEAA 2L6BA 4HLLA 4F1PA 1WDYA 4RLYA 1N0RA 3AJIA 4O1PA 4K5AB 5ENOD 4BESA 5CERB 4A63B 2RFMA 2A5EA 5D66A 3ZKJA 5AQ7A 2XZTG 3EU9A 2AJAA 1YMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSZ E;  4GMR A;  3F6Q A;  2QYJ A;  1A5E A;  2DZO A;  3JXI A;  3UXG A;  5EYP F;  1MJ0 A;  1QYM A;  4U95 D;  1D9S A;  3V31 A;  1UOH A;  2Y1L E;  5EIL A;  2P2C P;  3JUE A;  5CBO A;  4J8Y A;  2PNN A;  3Q9N C;  4K5C A;  3TWS A;  4DX1 A;  5ITZ F;  3Q9U C;  4YDW A;  2BKK B;  4DX5 D;  2QC9 A;  1DC2 A;  5AQB A;  2B0O E;  4U96 D;  5HRY A;  5FIO A;  1MX6 A;  4B93 B;  3C5R A;  4HBD A;  2XEE A;  1NFI E;  5ENT D;  3DEO A;  4QQI A;  3TWU A;  1BU9 A;  2ETA A;  3D9H A;  2V4H C;  4HNA D;  4ZHB A;  2MYO A;  4DX6 D;  1K3Z D;  5AN8 A;  4HB5 A;  2J8S D;  1AWC B;  4O60 A;  1TR4 A;  3NOC D;  3J5P A;  4C48 B;  4U8V D;  5ENR D;  4LG6 A;  5EYL A;  1IXV A;  1K1B A;  3DEP A;  5AQ9 A;  3B95 A;  3V79 K;  2DZN A;  2HE0 A;  1OY3 D;  4ZFH A;  4LNU D;  1MX4 A;  3NOG D;  4ATZ D;  3TWT A;  4BER A;  5KNG A;  3V2X A;  4Z68 A;  3UI2 A;  1BI8 B;  1G3N B;  2V5Q C;  3KEA A;  5HKP A;  2DVW A;  3W9F A;  2BKG A;  2F8X K;  2ETB A;  4UUC A;  5ENQ D;  1YYH A;  5HS0 A;  1AP7 A;  1WG0 A;  4OAV B;  3JXJ A;  4F6R D;  2Y0B G;  3T8K A;  2RFA A;  4HRM B;  4GPM A;  4HI9 A;  3TWW A;  5EIB E;  2ZGG A;  2F8Y A;  1BD8 A;  3J5Q B;  4J7W A;  4JB8 P;  3AAA C;  5ENP D;  5CBN A;  4N5Q A;  5KBA A;  4TUM A;  5JMN D;  1SVX A;  5CEC B;  1MYO A;  2XEH A;  1MX2 A;  5FIN A;  1N11 A;  1K1A A;  1DCQ A;  1BLX B;  3ZU7 B;  5EID A;  3EHR A;  2KXP C;  4U8Y D;  3SO8 A;  4CYM D;  3HRA A;  2XEN A;  5AAO A;  3ZUV B;  4K5B A;  5KWD A;  4YDY A;  4CZ2 D;  4DX7 D;  2NYJ A;  3EHQ A;  2VGE A;  4QFV A;  1SW6 A;  2XZD G;  5JA4 D;  3HG0 D;  5BXU A;  3V2O A;  1N0Q A;  4DRX E;  1YCS B;  3W9G A;  5AQA A;  4OAU C;  2DWZ A;  1BI7 B;  2FO1 E;  5KNH D;  3LJN A;  4HRL A;  4HQD A;  2F37 A;  3ZNG A;  4BEP A;  2ZGD A;  4HI8 A;  3TWQ A;  4NIK A;  4BSZ B;  1S70 B;  3V30 A;  5ENS D;  3TWV A;  3IXE A;  1IKN D;  1IHB A;  2JAB A;  4G8L A;  5AAR A;  4BET A;  1OT8 A;  4G8K A;  3TWX A;  3UTM A;  2KBX A;  5BXO A;  2ETC A;  4HRN A;  3T9K A;  4DUI A;  4O1O A;  3TWR A;  3NBN B;  5CED B;  4DX2 A;  3B7B A;  5EN5 D;  5CEA A;  2L6B A;  4HLL A;  4F1P A;  1WDY A;  4RLY A;  1N0R A;  3AJI A;  4O1P A;  4K5A B;  5ENO D;  4BES A;  5CER B;  4A63 B;  2RFM A;  2A5E A;  5D66 A;  3ZKJ A;  5AQ7 A;  2XZT G;  3EU9 A;  2AJA A;  1YMP A; 
#chains in the Genus database with same CATH topology
 2J09 A;  1N4Q A;  2E0I A;  4AXH A;  4DK5 A;  4HLE A;  5CBO A;  3HIZ A;  3SD5 A;  2LUH A;  4K5C A;  5ITZ F;  1OXJ A;  4DLQ A;  3ZHE B;  4UWL A;  5EDS A;  3QAR A;  2R03 A;  1NFI E;  3PE4 A;  5D0Q D;  2P58 C;  2J8S D;  1TR4 A;  4U0Z A;  4BT9 A;  4A55 A;  1HO8 A;  5BV0 A;  3RAU A;  2XGM A;  1UW4 B;  3ZHE A;  4HS2 A;  3JYS A;  1TJF A;  4TRQ A;  3UIO C;  5AYW D;  2ETB A;  3TL5 A;  3Q4A B;  2VSY A;  3T8K A;  4Q94 A;  1GW6 A;  1MZC A;  4ME2 A;  2F8Y A;  2VGY A;  4XEI G;  3VLE A;  4GAA A;  2YHC A;  3L22 A;  5CHE E;  3CHS A;  4KXK B;  3EHQ A;  4E6H A;  4OAU C;  1YCS B;  4ACK A;  4HQD A;  4I9C A;  4GYO A;  3V30 A;  4LNB A;  3S2A A;  3TWV A;  1HU3 A;  3U4T A;  1TN6 A;  2A4Z A;  1XGW A;  5BXO A;  3D9O A;  5CEA A;  5J90 A;  4N3A A;  3ULQ A;  3K9I A;  4K5A B;  2QFC A;  4RG9 A;  4WNF A;  4TV3 A;  2Q7F A;  2KM4 A;  2P9S G;  3V31 A;  3I5P A;  3CKC A;  2PNN A;  4DI3 A;  3ZFW A;  5JJ7 A;  4F1S A;  3E37 A;  3Q7F A;  3RSE G;  3C72 A;  2WXG A;  3Q5M A;  1OWO A;  5CCM A;  1INZ A;  2XEE A;  4HNA D;  4ZHB A;  1KZO A;  4DX6 D;  5AN8 A;  1E8Z A;  1KZP A;  5LCW J;  1EPU A;  2WMN A;  1LD7 A;  2QZA A;  1H6O A;  2XRY A;  4G11 A;  5AJL A;  4OVV A;  5G05 J;  3BQO A;  1AP7 A;  2FUL A;  2XHE A;  5DIZ A;  1N52 A;  2OV8 A;  1ZB1 A;  4GTR A;  4APF A;  3FTV A;  1O1T A;  2GRN B;  3L13 A;  3WXX A;  3TXM A;  2WPV A;  1MX2 A;  3GZ2 A;  3AG4 E;  3EHR A;  4H7Y A;  4CYM D;  4JHK A;  4CDM A;  3HXE A;  3O48 A;  5A6C A;  3C3O A;  3D9L A;  3D9N A;  1N0Q A;  2I6H A;  1SZ9 A;  2F37 A;  2FO7 A;  3CIA A;  4U7E B;  2ZGD A;  4NIK A;  2L0I A;  3KS2 A;  4V3I A;  4G8L A;  1X5B A;  2V4L A;  2EIK E;  2KCV A;  3UM0 A;  1TEZ A;  1NP7 A;  1O1S A;  3SY2 A;  3FTX A;  4G26 A;  4I9E A;  5ENO D;  3ZPJ A;  3ABK E;  2AVP A;  3AU5 A;  3UIN C;  3KSQ A;  3ZYM A;  4TXP A;  5LCW C;  4BWR A;  3D9I A;  4G1T A;  3RRN B;  4I2Z A;  3U66 A;  3TWS A;  1NI1 A;  4AOF A;  4FHJ A;  5FZS A;  3C5R A;  5G05 C;  3ZYK A;  1UJK A;  2GRP B;  3PZD A;  3AS5 A;  2VSX E;  1JCR A;  4C48 B;  3APD A;  1TN7 A;  2XS8 A;  3B7R L;  4ATZ D;  2FI7 A;  3HHM A;  2V5Q C;  3FH5 A;  2F8X K;  3KEZ A;  2KZT B;  2C2L A;  3ZXS A;  2OOE A;  2AW6 A;  1TYQ G;  3CQC B;  3RIB A;  4UWH A;  2WXJ A;  4JEU A;  2YIN A;  3CK9 A;  3U3W A;  3SO8 A;  2VTB B;  2HR2 A;  5KJM A;  2AXZ A;  2LXL A;  1Z6T A;  4BTB A;  3CV0 A;  3MKQ A;  1SZA A;  3FY4 A;  3FTY A;  2M63 A;  3S7F A;  4GTV A;  1S0P A;  4GZ5 A;  5E76 A;  1OT8 A;  1U3D A;  1UG3 A;  1TNO A;  2WQH A;  3SBT B;  3G2U A;  4A1G A;  3ABM E;  4A3T A;  3S7J A;  3WG7 E;  2H6H A;  3PZ4 A;  3JQ1 A;  3PZ3 A;  4A63 B;  3L17 A;  3ZKJ A;  3PEV B;  3UXG A;  3L6A A;  3UT7 A;  3BUA A;  1N54 A;  2XPY A;  2ZU6 B;  4YDE A;  4Q96 A;  2AXV A;  1IYG A;  4U96 D;  4GTT A;  3FTW A;  3UX4 A;  3ZN3 A;  2VJ8 A;  1Z3X A;  3DEO A;  4OVU A;  3TWU A;  4UWG A;  2Y3A A;  5C1D A;  3BG1 B;  3NQP A;  4HB5 A;  3VTX A;  3NOC D;  3FH8 A;  2WXF A;  4YVO A;  5FQ8 A;  4GZ6 A;  4TUU A;  3TWT A;  4KZ0 A;  2X6J A;  1BI8 B;  4I17 A;  5ARF A;  4OAV B;  3PRE A;  4WAF A;  2WXO A;  5B1B E;  5H7P A;  2MRI A;  4B8C B;  4L7T A;  2V8S E;  4FJY A;  1HZ4 A;  4LCT A;  1KPS B;  5ENP D;  5EX3 A;  3SZ7 A;  1N11 A;  3ZU7 B;  5LP0 A;  3LS8 A;  1JWF A;  3AG2 E;  4WND A;  4QFV A;  3CHQ A;  3Q73 A;  4IUL A;  1SW6 A;  1H0A A;  2C0L A;  4B89 A;  3UT4 A;  4JZY A;  3SI5 A;  4GZD A;  3ZVV A;  3CVY A;  1KLX A;  2X6F A;  2J9Q A;  2YNQ A;  4MLP A;  4NUR A;  4DUI A;  4D10 C;  1IQU A;  2IOL A;  1WAO 1;  4TXQ A;  4ILH B;  3JQ0 A;  1E8W A;  3CHP A;  3FDH A;  2HO1 A;  2QYJ A;  2R5S A;  5DBK A;  3DWL G;  3OXL A;  4EBA G;  4G24 A;  3NAW A;  4FP7 A;  3Q9N C;  3AG3 E;  1MX6 A;  3MKR A;  1RW2 A;  4AM9 A;  1OCZ E;  5ENT D;  4CDN A;  4PH4 B;  3LY8 A;  2MYO A;  4UI9 J;  3EHN A;  3DSS A;  3FUF A;  3E30 A;  5ENR D;  2J4B A;  2NXP A;  3RJV A;  3OXG A;  3FUD A;  4C0M A;  1DCE A;  4ILG A;  1FCH A;  3KD7 A;  1N95 A;  2WXP A;  3FUL A;  1UJJ A;  4BX9 A;  3DBS A;  4GPM A;  3SFX A;  2L0T B;  1YA0 A;  4BX8 A;  4UWK A;  1U3C A;  3SBS A;  5CMY A;  2DYS E;  2P9L G;  1DCQ A;  1IHG A;  4AY5 A;  4G25 A;  4DI4 A;  4U8Y D;  4BT8 A;  3PNL B;  3QKY A;  4EEC A;  3Q49 B;  1JWG A;  3ZW3 A;  5AIJ A;  2EIM E;  3D9K A;  1D8D A;  4L2Y A;  2AWI A;  3IKO B;  1JCQ A;  4EQF A;  3ZRH A;  3LVR E;  5CED B;  1HX8 A;  1HG5 A;  2GRL A;  3GZS A;  1S63 A;  4RG6 A;  4UI9 C;  1EYH A;  2RG8 A;  5CRU A;  3N71 A;  2ION A;  4C0E A;  3Q7A A;  2J49 A;  1HH8 A;  5EYP F;  1MJ0 A;  2BF0 X;  2Y4T A;  4OYS A;  2EIN E;  4M7C A;  5ARG A;  2BKK B;  4J8E A;  1OUV A;  3T5V A;  2Y69 E;  2ETA A;  2ILR A;  2VYI A;  2R2L A;  2WXL A;  4U8V D;  3GZ1 A;  2YQ8 A;  3DRA A;  3HYM B;  3UM2 A;  3NOG D;  3ASO E;  1ELR A;  5HKP A;  1OCR E;  2P9U G;  2VGX B;  1TNZ A;  4FHK A;  1QNF A;  1PC2 A;  2UWJ G;  3JUI A;  3TWW A;  4BSX A;  3DPY A;  3RRU A;  2CHW A;  3QK0 A;  2IF4 A;  4WNE A;  5CEC B;  4ANU A;  2KXP C;  4GPK A;  3BEE A;  3LEW A;  4FLH A;  2F0Y A;  2VGX A;  3G2T A;  4J8F A;  4XI9 A;  1E90 A;  3C3Q A;  4CGW A;  3TJP A;  4GMJ A;  3ASD A;  3CHO A;  4BEP A;  4HI8 A;  1E96 B;  4HXI A;  3ZGQ A;  5BT1 A;  5FQ7 A;  3LXU X;  3QAQ A;  5KCM A;  3EDT B;  5G2N A;  4HRN A;  3CVN A;  4YDO A;  2WXH A;  2L6B A;  4HLL A;  1KT0 A;  3RKV A;  3ASN E;  4N2S A;  3AS4 A;  2IJG X;  2R05 A;  3OTN A;  4MKT A;  3QOU A;  5FWQ A;  3T5X A;  3SF4 A;  3ABL E;  2X6H A;  3CVQ A;  1TNU A;  2KC7 A;  2R17 C;  4AV7 A;  3MV2 B;  4U07 A;  5G55 A;  3TGO A;  5KJL A;  4O60 A;  3G2S A;  3APC A;  4FC8 A;  5EYL A;  1IXV A;  2OEV A;  2WB2 A;  2FBN A;  1ELK A;  4U0S A;  3LPZ A;  4F53 A;  1YYH A;  2A5U A;  3TG5 A;  3RO3 A;  4CCA A;  5A23 A;  4I2W A;  2GW1 A;  2Y0B G;  2P9I G;  5FJY A;  2KCL A;  3NB2 A;  1L5J A;  3LJ3 A;  5EID A;  5EKQ D;  5C2Y A;  3MGB A;  1Z3Y A;  3IEG A;  4DX7 D;  2PQN A;  5D2M C;  2QY7 A;  1QZ2 A;  5T3R A;  4DRX E;  3R7R A;  3NZU A;  2OVF A;  4L1B A;  4A3V A;  4JW1 A;  1JCS A;  3HXF A;  4G8K A;  3DST A;  3FTU A;  3C3R A;  4Y6W A;  2GGF A;  4CT0 A;  1FT1 A;  3ML8 A;  3QC1 A;  2H6G A;  2LNI A;  5AQ7 A;  2XZT G;  2GRR B;  5G04 J;  3QWW A;  5T8I A;  3FUM A;  4GA2 A;  4EZK A;  1DC2 A;  2YHE A;  5AQB A;  1X81 A;  2B0O E;  3EHM A;  2WMO A;  5FIO A;  1WY6 A;  4B93 B;  3E34 A;  2X3M A;  3GW4 A;  3B7T A;  4KYO B;  5KJN A;  1EF1 C;  2OVB A;  3FP3 A;  4GB9 A;  4KZC A;  5B3S E;  2XGS A;  4U0U A;  3CHR A;  4XKC A;  2GRM A;  5B1A E;  1RZ4 A;  4J8D A;  2XEV A;  2HE0 A;  4ZFH A;  3RRM B;  5BPP A;  3FU3 A;  2DVW A;  5EX0 A;  3DSU A;  3QWV A;  4KVO A;  1SA4 A;  3BG0 B;  3D9P A;  2XCB A;  5FZQ A;  3UT8 A;  3TG4 A;  4CT4 A;  2ZGG A;  4GTO A;  3QWP A;  1BPO A;  1HE8 A;  4B94 A;  2XEH A;  5FIN A;  1K1A A;  4LER A;  1N94 A;  5BUZ A;  3QNK A;  4J0U A;  2WXQ A;  1OCO E;  4K5B A;  4L9P A;  4YDY A;  4EZJ A;  5HQ8 A;  2XZD G;  5G04 C;  1JPL A;  4IN3 B;  3TWQ A;  2EIJ E;  3FTZ A;  2J4D A;  2ETC A;  1PY1 A;  4O1O A;  2KZT A;  5EN5 D;  4EZL A;  4N3C A;  4AJW A;  2P9K G;  4DLO A;  2C0M A;  4L2L A;  1A5E A;  3DXM G;  2UY1 B;  2BUG A;  2P2C P;  4J8Y A;  4FU3 A;  2RD0 A;  2VTB A;  4P29 A;  3R9A B;  4U8H A;  4QQI A;  5FTP A;  3UMV A;  3L54 A;  2DCP A;  3S7B A;  4G23 A;  1OWM A;  3AU4 A;  4WWP A;  3QDN A;  4UQX A;  5CRV A;  1A17 A;  2BKG A;  2PM6 A;  3PEU B;  2WQ7 A;  2HM8 A;  2EQX A;  4W9R A;  3ML9 A;  4HRM B;  3B13 A;  3J5Q B;  4J7W A;  4A1S A;  4UQZ A;  1HG2 A;  1LD8 A;  4I6E A;  2XEN A;  3EUV A;  4ANW A;  1H19 A;  4CZ2 D;  2CHZ A;  3UUX A;  3L08 A;  3HDX A;  3HG0 D;  3UKU G;  3PNT B;  4ATG A;  3LJN A;  2XPI A;  3IV0 A;  3FWV A;  4PS3 A;  3IHY A;  4N39 A;  3FEX A;  5ENS D;  4F7A A;  3IXE A;  3I4G A;  4XKB A;  1FPP A;  1HS6 A;  2WM9 A;  3SGH A;  4XE0 A;  2I1J A;  3C98 A;  5ANR A;  3IHV A;  2E2E A;  4AP2 A;  3AJI A;  4O1P A;  4AY6 A;  4GMR A;  1U2V G;  4NQ0 A;  3U64 A;  3LY7 A;  1UOH A;  2MHK A;  1TJC A;  4AIF A;  3PE3 A;  4GA0 A;  3DSW A;  1E7U A;  3DXK G;  4UWF A;  4I1O B;  2AXU A;  3T8M A;  3E32 A;  3FUE A;  1BU9 A;  3MEK A;  4R7L A;  4I1M A;  5AEN A;  3CGH A;  3ASH A;  4NAC A;  5A7D B;  2P9P G;  3ESK A;  2VSN A;  2XPZ A;  4XZ4 A;  3ULE G;  3KSL A;  3FU5 A;  3KAE A;  2V5F A;  4JA7 A;  1E7V A;  3BU8 A;  3CVW A;  4MBG A;  3DSX A;  2LO6 A;  3OAW A;  2IO3 C;  5IY5 E;  3ENE A;  3G2W A;  3PVL A;  3LCA A;  3B7U X;  4GCN A;  3LKU A;  5AAO A;  2IFU A;  5KWD A;  4GTM A;  2NYJ A;  4G2V A;  2WXM A;  2R02 A;  4N5C A;  3RU0 A;  3UM1 A;  2FO1 E;  3MA5 A;  1V54 E;  4EHM A;  4JHJ A;  1IKN D;  3PS6 A;  2GRQ B;  1E8X A;  2KBX A;  3SHF A;  4M3O A;  3TWR A;  3B7B A;  3UM3 A;  2RKK A;  2RFM A;  3Q79 A;  5JHB A;  1N4S A;  2VSO E;  3L9T A;  4U95 D;  1QYM A;  3EIJ A;  5EIL A;  3MYV A;  2L9B A;  3ZEF A;  1NA3 A;  5E75 A;  4KBQ A;  2QC9 A;  4X8Q A;  5HRY A;  2FF4 A;  3VLD A;  3PRZ A;  4XIF A;  5BV1 A;  4HBD A;  4JL0 A;  3HXB A;  2BTD A;  3MJW A;  4U04 A;  2XGO A;  2IU1 A;  3HVE B;  2J07 A;  3J5P A;  1LTX A;  4JD2 G;  3FUI A;  2OND A;  2WXN A;  2CHX A;  5AQ9 A;  4BER A;  4XI0 A;  4Y6C A;  4E85 A;  5ENQ D;  1ELW A;  3HXC A;  3UIP C;  2DYR E;  4MS6 A;  3UKR G;  3FU6 A;  1BD8 A;  1ZU2 A;  5KBA A;  4J8S A;  1FT2 A;  1SVX A;  1B89 A;  3SNX A;  2PQR A;  1VDY A;  2VGE A;  3ASG A;  5M72 A;  2X38 A;  3FUK A;  2DWZ A;  3AS8 A;  2VQ2 A;  2ZXW E;  2Y4U A;  3RO2 A;  3CEQ A;  4JPS A;  2HYZ A;  3ISM C;  1IHB A;  3B7S A;  3T9K A;  4ANX A;  1N0R A;  4FLB A;  3NF1 A;  1PAQ A;  5D66 A;  2KCK A;  1EDU A;  3EU9 A;  4GZC A;  3P1U A;  3F6Q A;  4JHR A;  1D8E A;  3JXI A;  1S64 A;  1D9S A;  4B8A A;  4H7X A;  3O4Z A;  3QJZ A;  3URZ A;  4GYY A;  2XRZ A;  3L16 A;  1P5Q A;  1AWC B;  4DPR A;  1K1B A;  4J6I A;  3ONK A;  4C9B B;  3V79 K;  5HI7 A;  1K8K G;  1NL4 A;  4Z68 A;  2J08 A;  1G3N B;  1IQR A;  3GYZ A;  4UUC A;  1HXI A;  2LAH A;  2B6C A;  2DBA A;  3AAA C;  5JHA A;  2IY0 C;  4N5Q A;  2PL2 A;  3UPV A;  4TUM A;  3SFY A;  2WXR A;  3TXN A;  2BED A;  3NZS A;  4PDX A;  2JLB A;  5JJ6 A;  2IEJ A;  5AQA A;  4BY6 A;  4B0Z A;  5BW8 C;  2H6F A;  2I1K A;  5FT9 A;  4Q69 A;  4URK A;  2IO2 C;  1H6P A;  4F1P A;  4GYW A;  4RLY A;  3DSV A;  2H6I A;  3FU0 A;  1DVP A;  3CVL A;  5LX8 A;  3Q78 A;  3JUE A;  4ACL A;  2KAT A;  4DX1 A;  3Q9U C;  4RQI A;  1FVH A;  1H6K A;  3L82 A;  3TAX A;  4NRH B;  3CHM A;  1DNP A;  4MRU A;  2IQC A;  4LG6 A;  3AG1 E;  4I6J A;  3LDZ A;  3CK7 A;  4FJZ A;  4PS8 A;  4U63 A;  1OWL A;  2JEK A;  5LFA A;  4WWO A;  2RFA A;  4WNG A;  4JVS A;  2OCC E;  4JB8 P;  4K0R A;  1TNY A;  3ZXP A;  1MYO A;  2CG2 A;  4PS7 A;  4HFG A;  5JA4 D;  2WVI A;  3V2O A;  3W9G A;  4HRL A;  3ZNG A;  3ZYQ A;  1KT1 A;  1OCC E;  3CVX A;  4I6G A;  2JAB A;  3MCX A;  2QYU A;  2X6I A;  3TWX A;  3EJN A;  3G2V A;  3HXD A;  3I4R B;  1FVF A;  2LXM A;  4PUC A;  1LF8 A;  2NC9 A;  1JUQ A;  4KMO A;  3Q47 B;  2MOW A;  3R9M A;  4AEZ C;  2CFZ A;  3EIQ C;  2Y1L E;  1HFA A;  4YND A;  5D0O D;  2NSZ A;  1QBQ A;  3MX3 A;  4RVB A;  4DX5 D;  3FH7 A;  4HOR A;  3JCK C;  4I43 A;  3ULY A;  4CEM A;  1V55 E;  4AVX A;  2XS1 A;  4ILI A;  1H2U A;  3FEY A;  3ESL A;  1QQE A;  3MKQ B;  4HOU A;  3D9M A;  1SA5 A;  3B95 A;  4IYP A;  4UQY A;  2DZN A;  1OY3 D;  4I1A A;  5KJK A;  1N9A A;  3UI2 A;  5J08 A;  3JXJ A;  4GTP A;  1UN9 A;  4F6R D;  3CVP A;  2PM7 A;  4CDR A;  3PUJ A;  5CMW A;  5LOZ A;  5CBN A;  2UY1 A;  3FFL A;  5JMN D;  4TXR A;  4KT6 B;  4LUN U;  1HF8 A;  5JJT A;  4ABN A;  3CQG B;  2WXK A;  3ZUV B;  2PZI A;  2XCC A;  4GA1 A;  4WUY A;  5BXU A;  2EIL E;  2P9N G;  4JXT A;  5FQ4 A;  3LY9 A;  3SQV A;  1S70 B;  3PDN A;  5CCL A;  3MZL B;  1UN8 A;  2OEW A;  3IBE A;  3VTY A;  3CLJ A;  2X6K A;  1MQS A;  4BES A;  4LEU A;  1MHQ A;  4LNU D;  1YMP A;  4HOT A;  1TN8 A;  2DZO A;  2L6J A;  4XX5 A;  5BNW A;  4DJA A;  4LNG A;  4GTS A;  4YDW A;  1XNF A;  3ASF A;  3FUJ A;  3CVU A;  2LSV A;  3CR3 A;  2XQ0 A;  3Q75 A;  2GRO B;  3CVV A;  5FQ6 A;  3EU5 A;  3PZ1 A;  4KVM A;  1Y8M A;  1K3Z D;  2R59 A;  4FA6 A;  3E4B A;  4HOS A;  3D9J A;  2V0P A;  1N4R A;  3CK8 A;  3V2X A;  1H2T C;  2DIW A;  4GU5 A;  3W9F A;  1NA0 A;  5HS0 A;  1WG0 A;  4HOQ A;  4F3V A;  4WWN A;  3ZIM A;  4JC8 A;  4BFR A;  3U9W A;  4ANV A;  1H2V C;  4EBA A;  4APO A;  1BLX B;  1W3B A;  3ONL A;  4CRW A;  3DPD A;  1O5M A;  3VLF A;  4YVQ C;  4GML A;  2ZIR A;  5ANL A;  2ZIS A;  4GZ3 A;  4EPZ A;  2CG3 A;  1O1R A;  3UTM A;  1E8Y A;  3NBN B;  4DX2 A;  4GTQ A;  4FAD A;  2AJA A;  3ZYL A;  4LSZ E;  3QB2 A;  3MV3 B;  3FHE A;  3S7D A;  4N2Q A;  2I9C A;  3FTS A;  3E33 A;  3SFZ A;  1Q2Z A;  4N3B A;  2LAI A;  3CKB A;  1OWP A;  4LRZ A;  3RK6 A;  4GCO A;  5AJD A;  3D9H A;  3Q15 A;  2V4H C;  1NZN A;  3OXF A;  1TNB A;  4JA9 A;  3DEP A;  4JEH A;  2WQ6 A;  4CGV A;  3R7Q A;  1MX4 A;  1WM5 A;  4L23 A;  5KNG A;  3KEA A;  1SQM A;  5T4Y A;  4BTA A;  1Y6I A;  2IOS A;  5FZR A;  3LYA A;  2I2O A;  1ZBP A;  2LSU A;  3PZ2 A;  4HI9 A;  3X2Q E;  5EIB E;  3I3N A;  4RSY A;  2FEZ A;  3CSF A;  3LVQ E;  4K03 A;  1OWN A;  1N4P A;  4IRU A;  5ENN A;  3HRA A;  2CFU A;  3D3M A;  3P2B A;  1Z5S C;  3UQ3 A;  3HVE A;  1BI7 B;  5KNH D;  3CST A;  3APF A;  3FUH A;  3PUK A;  4BSZ B;  4FUL A;  4HVB A;  5AAR A;  4BET A;  4O6F A;  4UI9 K;  1WDY A;  5CER B;  3PH0 C;  3FUN A;  2A5E A;  2WXI A; 
#chains in the Genus database with same CATH homology
 4LSZ E;  4GMR A;  3F6Q A;  2QYJ A;  1A5E A;  2DZO A;  3JXI A;  3UXG A;  5EYP F;  1MJ0 A;  1QYM A;  4U95 D;  1D9S A;  3V31 A;  1UOH A;  2Y1L E;  5EIL A;  2P2C P;  3JUE A;  5CBO A;  4J8Y A;  2PNN A;  3Q9N C;  4K5C A;  3TWS A;  4DX1 A;  5ITZ F;  3Q9U C;  4YDW A;  2BKK B;  4DX5 D;  2QC9 A;  1DC2 A;  5AQB A;  2B0O E;  4U96 D;  5HRY A;  5FIO A;  1MX6 A;  4B93 B;  3C5R A;  4HBD A;  2XEE A;  1NFI E;  5ENT D;  3DEO A;  4QQI A;  3TWU A;  1BU9 A;  2ETA A;  3D9H A;  2V4H C;  4HNA D;  4ZHB A;  2MYO A;  4DX6 D;  1K3Z D;  5AN8 A;  4HB5 A;  2J8S D;  1AWC B;  4O60 A;  1TR4 A;  3NOC D;  3J5P A;  4C48 B;  4U8V D;  5ENR D;  4LG6 A;  5EYL A;  1IXV A;  1K1B A;  3DEP A;  5AQ9 A;  3B95 A;  3V79 K;  2DZN A;  2HE0 A;  1OY3 D;  4ZFH A;  4LNU D;  1MX4 A;  3NOG D;  4ATZ D;  3TWT A;  4BER A;  5KNG A;  3V2X A;  4Z68 A;  3UI2 A;  1BI8 B;  1G3N B;  2V5Q C;  3KEA A;  5HKP A;  2DVW A;  3W9F A;  2BKG A;  2F8X K;  2ETB A;  4UUC A;  5ENQ D;  1YYH A;  5HS0 A;  1AP7 A;  1WG0 A;  4OAV B;  3JXJ A;  4F6R D;  2Y0B G;  3T8K A;  2RFA A;  4HRM B;  4GPM A;  4HI9 A;  3TWW A;  5EIB E;  2ZGG A;  2F8Y A;  1BD8 A;  3J5Q B;  4J7W A;  4JB8 P;  3AAA C;  5ENP D;  5CBN A;  4N5Q A;  5KBA A;  4TUM A;  5JMN D;  1SVX A;  5CEC B;  1MYO A;  2XEH A;  1MX2 A;  5FIN A;  1N11 A;  1K1A A;  1DCQ A;  1BLX B;  3ZU7 B;  5EID A;  3EHR A;  2KXP C;  4U8Y D;  3SO8 A;  4CYM D;  3HRA A;  2XEN A;  5AAO A;  3ZUV B;  4K5B A;  5KWD A;  4YDY A;  4CZ2 D;  4DX7 D;  2NYJ A;  3EHQ A;  2VGE A;  4QFV A;  1SW6 A;  2XZD G;  5JA4 D;  3HG0 D;  5BXU A;  3V2O A;  1N0Q A;  4DRX E;  1YCS B;  3W9G A;  5AQA A;  4OAU C;  2DWZ A;  1BI7 B;  2FO1 E;  5KNH D;  3LJN A;  4HRL A;  4HQD A;  2F37 A;  3ZNG A;  4BEP A;  2ZGD A;  4HI8 A;  3TWQ A;  4NIK A;  4BSZ B;  1S70 B;  3V30 A;  5ENS D;  3TWV A;  3IXE A;  1IKN D;  1IHB A;  2JAB A;  4G8L A;  5AAR A;  4BET A;  1OT8 A;  4G8K A;  3TWX A;  3UTM A;  2KBX A;  5BXO A;  2ETC A;  4HRN A;  3T9K A;  4DUI A;  4O1O A;  3TWR A;  3NBN B;  5CED B;  4DX2 A;  3B7B A;  5EN5 D;  5CEA A;  2L6B A;  4HLL A;  4F1P A;  1WDY A;  4RLY A;  1N0R A;  3AJI A;  4O1P A;  4K5A B;  5ENO D;  4BES A;  5CER B;  4A63 B;  2RFM A;  2A5E A;  5D66 A;  3ZKJ A;  5AQ7 A;  2XZT G;  3EU9 A;  2AJA A;  1YMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...