5BXOA

Human tankyrase-2 in complex with macrocyclised extended peptide cp4n2m3
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
SGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human Tankyrase-2 in Complex with Extended Stapled Peptide sp4n2m3
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tankyrase-2
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5bxoA00
4HB5A 4GPMA 2HE0A 5ITZF 3AAAC 1K1AA 1MJ0A 3KEAA 2F8XK 1BI8B 2ZGDA 3EHQA 5AQAA 4B93B 4HQDA 3JXIA 4K5BA 5FIOA 3W9GA 2XZTG 1SW6A 5BXOA 2FO1E 4LG6A 5EIBE 3DEPA 4QFVA 3HG0D 3V30A 3V2OA 5CBNA 2B0OE 4HI8A 5JA4D 4Z68A 4ZHBA 1OY3D 3TWQA 3SO8A 5HRYA 2L6BA 3ZNGA 2XEEA 4HLLA 4DX6D 4LSZE 4ATZD 4U8YD 1BU9A 3TWSA 5CBOA 3NOGD 3Q9NC 2PNNA 2F37A 4HRMB 3V2XA 4O1PA 5FINA 1IXVA 2P2CP 4J7WA 2DWZA 2Y0BG 3UTMA 5ENTD 2DVWA 2F8YA 5EIDA 5BXUA 1K3ZD 2QYJA 1BD8A 5KBAA 4OAUC 2XENA 4HRLA 2MYOA 3NBNB 1YYHA 1IHBA 4GMRA 3NOCD 5EILA 1DC2A 5ENOD 2XEHA 4N5QA 3IXEA 4K5AB 4BEPA 1NFIE 5JMND 3T8KA 1G3NB 5AQ7A 3B95A 3V79K 4DX1A 4UUCA 1IKND 4YDWA 4DUIA 2A5EA 1TR4A 5EN5D 1BI7B 4TUMA 3C5RA 3LJNA 2XZDG 5AARA 2BKGA 5AN8A 5AQBA 2KXPC 1AWCB 3ZU7B 2VGEA 5ENPD 4U8VD 4BERA 2ETBA 2BKKB 4O1OA 5KWDA 3B7BA 2ZGGA 1K1BA 1MX6A 2RFMA 4A63B 3EHRA 4DX2A 2NYJA 4G8KA 4O60A 4RLYA 3T9KA 3J5QB 5CECB 4C48B 1AP7A 3TWXA 3TWTA 3HRAA 1MYOA 5CEAA 1N11A 1SVXA 4K5CA 3DEOA 2AJAA 3UI2A 1MX2A 5ENSD 3V31A 1A5EA 2V4HC 1UOHA 3JXJA 5ENQD 2JABA 4JB8P 1DCQA 1D9SA 2RFAA 3AJIA 4HBDA 1N0QA 4F1PA 5KNHD 5CERB 3UXGA 5HS0A 1WDYA 2V5QC 5HKPA 3TWVA 4ZFHA 2ETAA 2DZNA 4OAVB 3TWUA 4HNAD 4LNUD 2J8SD 4F6RD 4HRNA 5ENRD 5KNGA 1QYMA 3Q9UC 3F6QA 4J8YA 1YMPA 2DZOA 2KBXA 4CZ2D 4U95D 2QC9A 2ETCA 4DRXE 3D9HA 4G8LA 1OT8A 3W9FA 1S70B 3ZKJA 4QQIA 5AQ9A 4BSZB 2Y1LE 4HI9A 1YCSB 4YDYA 5EYPF 4BESA 5D66A 3EU9A 4BETA 1WG0A 4U96D 1MX4A 3JUEA 1N0RA 5AAOA 4DX7D 3ZUVB 4NIKA 3TWWA 3TWRA 4CYMD 5EYLA 5CEDB 3J5PA 4DX5D 1BLXB
chains in the Genus database with same CATH superfamily
3VLDA 2XHEA 4K5BA 4F3VA 2QYUA 2MHKA 4DPRA 4DI4A 2FI7A 3TWQA 3SO8A 1JCSA 5FZQA 4ILGA 3IV0A 4BFRA 1IXVA 2RKKA 1UG3A 3ZXSA 4OAUC 2XEHA 5JMND 3T8KA 3Q7AA 3FEYA 5LOZA 4XEIG 2AVPA 1NI1A 3PH0C 4L23A 5EDSA 2KXPC 3HXCA 1HE8A 4G24A 3ZHEB 1TEZA 3ZHEA 3D9JA 3C72A 3K9IA 5FQ4A 5FJYA 3DSTA 2LXLA 2VSXE 3RRMB 1SVXA 4GTOA 3V31A 1ELKA 3OXLA 2RFAA 3RO3A 3FUJA 2Y69E 2X6FA 3TG5A 2XRYA 2RD0A 4HNAD 4XKBA 5ARFA 3SY2A 2DZOA 3PVLA 2EIKE 1H2TC 2DYRE 4F1SA 1HG5A 1S70B 3IBEA 5AQ9A 4CGVA 4XI0A 4R7LA 3UPVA 4I6GA 4AY6A 2AW6A 4CYMD 4JPSA 4BY6A 4GPMA 4PDXA 2IEJA 1V55E 4B93B 1FCHA 3BUAA 2WMOA 2KCKA 3OTNA 2A4ZA 4KVOA 3CK7A 3QKYA 4U07A 3CVWA 4K03A 1BPOA 3D9PA 2Y4TA 5DIZA 1E8ZA 4DX6D 3Q47B 1BU9A 2NXPA 3SF4A 2XCCA 3VLEA 1O1TA 4F53A 3HIZA 2R59A 4LEUA 3RSEG 4UQYA 5KBAA 4CDRA 2Q7FA 4I1MA 3OXFA 3UIOC 4UI9J 1LTXA 3U9WA 3SFYA 1OXJA 4UWHA 1TR4A 4EZLA 3FEXA 4FHJA 5AQBA 4RG6A 4BSXA 2X3MA 4IRUA 2RG8A 4GA0A 5AENA 3EHRA 1UJJA 3FFLA 5CHEE 3FTSA 2ZXWE 5CEAA 1JUQA 3B7RL 2XPZA 4J8SA 5IY5E 4Y6CA 1A5EA 2JABA 1DCQA 3CVYA 5HKPA 3MV3B 2Y4UA 4LNUD 3ML8A 5KNGA 2XS1A 1QZ2A 1OT8A 3CVUA 3ZKJA 3RAUA 2WB2A 3FUIA 5FZRA 3ZIMA 4HVBA 5C2YA 1HS6A 2CHXA 3ULQA 4JEHA 3CSFA 3ZVVA 2GRMA 3LVRE 4RG9A 4BTAA 3PRZA 3SFZA 3HG0D 4ACKA 3CSTA 1MHQA 1Q2ZA 1O1SA 4ILHB 3G2SA 3PDNA 4CDNA 1E7VA 2XEEA 4WNGA 4MBGA 4C0EA 1WY6A 2EINE 4IYPA 4UQXA 2CG3A 2P2CP 5JJ7A 5EX3A 3UTMA 2I1KA 3G2TA 4J6IA 2LXMA 2P9IG 4U04A 4FULA 5EN5D 3TXNA 4X8QA 2BTDA 2IO2C 2I9CA 2GRPB 3UM2A 1MYOA 2X38A 3PZ2A 4K5CA 4IULA 2QFCA 5FTPA 3Q49B 2GRLA 4GAAA 4W9RA 2PM6A 2LNIA 4GZ6A 3TWUA 5ENRD 4AV7A 3AS8A 4GZDA 1OWNA 4L7TA 3DSXA 3D9HA 2P9KG 4H7YA 4XZ4A 4BETA 2OEWA 1HF8A 4LUNU 4FADA 2FEZA 3BEEA 4HOTA 3QOUA 4ANUA 4BX8A 3NAWA 3EUVA 4GCOA 2FULA 1SW6A 1U2VG 3ONLA 4TXRA 1ELWA 1OY3D 3ASFA 3S7FA 2L6BA 4IN3B 4F7AA 4G23A 4ABNA 4GZ5A 2XGOA 3GW4A 4J7WA 1TNYA 2DWZA 4G11A 1SA4A 3MCXA 2F8YA 5BXUA 1K3ZD 3UINC 2VSYA 3NBNB 3T5VA 2OV8A 1L5JA 3ONKA 3G2VA 1Z6TA 3D9OA 1BI7B 3QDNA 1AWCB 3RRUA 3DRAA 4ME2A 2P58C 5G04J 3L13A 2IY0C 3U66A 3LCAA 4JHJA 4TXPA 2WXHA 3DXKG 3Q78A 3FWVA 3TL5A 2R02A 5T3RA 4HBDA 3ZRHA 3AU5A 2DZNA 1JCQA 3SFXA 2WQ6A 1N54A 4J0UA 1PAQA 3AG3E 3W9FA 4BSZB 4HS2A 5EYPF 3AG2E 4L2YA 1OWLA 1K1AA 1BI8B 2V8SE 3EHQA 3L08A 2R5SA 3TGOA 3D9LA 2FO1E 1D8DA 4LG6A 1UJKA 5EIBE 3CHRA 1KZOA 3L54A 2ILRA 3DSVA 1S63A 1ZU2A 4G25A 4LSZE 3ISMC 3UM1A 5BV0A 2IOLA 3AG4E 3P2BA 2MYOA 4Y6WA 5AYWD 5EILA 3JUIA 4FC8A 1IKND 3PREA 3E33A 4JZYA 3SD5A 3T5XA 1NA3A 2XGMA 5EKQD 1IHGA 3ASHA 3TWTA 4YNDA 2ONDA 2WXKA 2V4LA 4H7XA 4PH4B 3UXGA 3ZW3A 3TXMA 4ZFHA 5KJLA 2ETAA 4JXTA 1QYMA 3F6QA 4GTTA 2ETCA 3ENEA 1JCRA 2Y1LE 4Q69A 2PL2A 3G2WA 3FH8A 3TWWA 4GZ3A 3R9AB 1TYQG 3U64A 3S7JA 4U7EB 1OCCE 4HQDA 3QJZA 2VTBB 1JWFA 2IO3C 1HZ4A 3ABKE 4YDOA 2HR2A 1EDUA 2XS8A 2H6IA 3ZYMA 3FY4A 3LYAA 1HO8A 2PNNA 3UIPC 2OVBA 4JC8A 4XE0A 5ENNA 4HRLA 4WWOA 3ULEG 4A55A 2IONA 3CV0A 1TNUA 5BNWA 4N5QA 3VLFA 4FLBA 1G3NB 3ULYA 3CVXA 4DX1A 3X2QE 4I9CA 4MS6A 1TN7A 2X6IA 3AU4A 5AN8A 2VGXB 2ETBA 4O1OA 5KWDA 1K1BA 4B0ZA 2RFMA 1UN8A 2NYJA 4N2QA 4O60A 3IEGA 3SQVA 4GTVA 2BUGA 4YVOA 1TJFA 3HXDA 4UQZA 5CERB 2V5QC 3UM3A 4C9BB 3BQOA 4F6RD 3SI5A 3CEQA 1FPPA 4CDMA 4A1SA 3HVEB 4KMOA 1IYGA 2IOSA 4BT8A 5BUZA 4AVXA 1NL4A 2L9BA 5EYLA 4CCAA 1H2UA 2IJGX 1NA0A 3D9KA 5D0QD 2QZAA 3JXIA 4L2LA 2LO6A 1DVPA 1E90A 5CBNA 1X5BA 1U3CA 5KJKA 2MRIA 4DK5A 5CMYA 5B1BE 2YNQA 3QK0A 4LRZA 4JHRA 3HXFA 2L6JA 3ABME 4I2ZA 5FINA 2WMNA 3DSSA 5M72A 3DBSA 5BPPA 1KZPA 1TNBA 4GMJA 3ZEFA 3QWPA 2KCVA 2NC9A 2X6KA 1OCRE 3CHOA 4GTQA 3EU5A 2GW1A 4UWFA 4KZ0A 4FA6A 3Q5MA 5ENPD 2ZU6B 2JEKA 3CK8A 4CGWA 2P9SG 2MOWA 3ESLA 5CECB 3TWXA 4N3BA 4JEUA 4FJZA 2PZIA 5CRVA 2LAIA 1HU3A 4JB8P 1TNZA 4K0RA 4G2VA 4F1PA 4I43A 2P9NG 4OYSA 4G26A 4UI9C 2E2EA 5FT9A 4EBAA 4WNDA 4J8YA 1HG2A 2KBXA 4GB9A 3RK6A 3CK9A 5G55A 2EIJE 4DRXE 4G8LA 5H7PA 3TJPA 4HI9A 4YDYA 4B89A 5J08A 3KAEA 4U96D 3JUEA 1HXIA 3ZUVB 1TN8A 3L17A 3MKQA 3V30A 4TXQA 2C0LA 4LERA 1U3DA 3ZNGA 1D8EA 4U8YD 4DLQA 5CBOA 2WXQA 3Q9NC 1E7UA 3MV2B 5A7DB 4GCNA 4PS8A 1HFAA 3SHFA 4B8CB 3UKUG 2NSZA 4BX9A 3PEUB 3RKVA 1NFIE 4GPKA 2J49A 4GTMA 4HOSA 1P5QA 3LJNA 2KM4A 1XNFA 2VGEA 3QNKA 5FQ7A 3RJVA 3PZ1A 3B7BA 3KSQA 1MX6A 1DCEA 4AEZC 4GA2A 3J5QB 4C48B 3FUNA 1PY1A 2WXPA 1N95A 2WQHA 3FHEA 3AS4A 4APFA 3O48A 3FTWA 3B7UX 3DPDA 4D10C 5G04C 3PZ4A 3MA5A 2V0PA 1YMPA 4AIFA 5G05C 1KT0A 3URZA 1H6KA 2P9LG 4BESA 3EU9A 2AWIA 3NF1A 5E75A 2CHZA 2LSUA 4DX5D 2HE0A 4BT9A 5KCMA 3R9MA 1K8KG 2XZTG 4QFVA 2QY7A 3GZ1A 2IU1A 3UX4A 4I6JA 4B94A 4LNBA 4ATZD 3I3NA 1N94A 3NOGD 2CHWA 3CQGB 5AJLA 4J8FA 3FUFA 4TV3A 3QWWA 2J9QA 3S7BA 1N4RA 3DPYA 4E85A 2M63A 1YYHA 1IHBA 4GMRA 3CIAA 3PUKA 5B1AE 2BEDA 4EBAG 4YDWA 1WM5A 1TJCA 2XZDG 2WXOA 4AM9A 3JYSA 2DIWA 1Y6IA 5CCLA 4U8VD 1LD8A 4AOFA 2L0TB 3ZFWA 4ATGA 3LJ3A 2GGFA 4LCTA 1NP7A 4GA1A 5FQ8A 5CRUA 3FU3A 1O5MA 5CMWA 4CT4A 1UOHA 2I2OA 3PE3A 2VYIA 5A6CA 4I2WA 5CCMA 2WXMA 3R7QA 1WDYA 4KXKB 1PC2A 1N4QA 2IQCA 3MKRA 5LFAA 1E96B 4U0SA 3MGBA 2BF0X 2X6HA 3LY8A 4RQIA 4GYWA 2IF4A 4NIKA 4E6HA 3AAAC 3CLJA 1INZA 2HM8A 1OWPA 3W9GA 3PUJA 3APCA 3OAWA 2XRZA 4FP7A 4JVSA 3ASDA 3QWVA 1EYHA 4MLPA 4FHKA 4UWKA 3HYMB 5EIDA 2WXIA 1QQEA 3FTYA 2I6HA 2GRRB 3EDTB 3ZYKA 3V79K 2R17C 4UWLA 3FULA 4JL0A 3SBSA 3N71A 4EHMA 5ARGA 3P1UA 4GU5A 3KD7A 3LDZA 2H6HA 3JCKC 2BKKB 3E4BA 2YHEA 1TNOA 4A63B 3L16A 3E32A 3RIBA 2V4HC 3FTZA 3JXJA 1D9SA 1N0QA 3SNXA 3ZPJA 1MZCA 3T8MA 5FWQA 1A17A 4GMLA 4KZCA 3FH7A 4C0MA 2WQ7A 5BT1A 1N0RA 3NB2A 5AAOA 4FU3A 3CHQA 3O4ZA 3J5PA 1S0PA 2CG2A 2F8XK 2R05A 1Y8MA 3LS8A 4N3AA 3UT8A 2VSNA 5ANRA 3GZSA 3RRNB 2B0OE 2P9PG 3B7SA 3MJWA 1HH8A 2AXZA 1Z3YA 4JW1A 3SBTB 3E37A 4KBQA 1X81A 2F37A 1SZAA 2LSVA 3ZYLA 4AP2A 4U0UA 4MKTA 3CHMA 3RU0A 3EHNA 3Q7FA 4LNGA 3ESKA 5AQ7A 2OVFA 4DUIA 4BTBA 2WM9A 3TAXA 4WNFA 1VDYA 2WXLA 3MZLB 5D0OD 3C3RA 1AP7A 3FU6A 1IQRA 3BU8A 3UI2A 4N2SA 1LF8A 3TG4A 3ASOE 2EILE 4KT6B 3CVQA 3CR3A 3IHYA 3PEVB 4AXHA 4URKA 2L0IA 2DYSE 1YCSB 4WUYA 5DBKA 1WG0A 4I1AA 3FTXA 1JPLA 2JLBA 3NZUA 2EQXA 2VSOE 2ZGDA 2Y3AA 1MQSA 5FIOA 4G1TA 4GTRA 4JA9A 4ZHBA 1B89A 1RZ4A 4M3OA 4DI3A 4J8EA 4CT0A 3ZN3A 3PZ3A 4HLLA 1N9AA 2FBNA 2V5FA 1ELRA 3FTUA 5AIJA 5A23A 2DVWA 2XPIA 2UY1B 2XENA 1OWMA 2KATA 4CEMA 1N4SA 2C2LA 1DC2A 3CVLA 3IXEA 3SGHA 2A5UA 4UUCA 3LEWA 1NZNA 3C5RA 5KJNA 3ZU7B 2KC7A 3G2UA 3EJNA 4V3IA 4NURA 4RLYA 2I1JA 2P9UG 1KPSB 1QBQA 4OVVA 3DEOA 1RW2A 3PNLB 2F0YA 1KT1A 5ENSD 3PNTB 5LCWC 5AJDA 3TWVA 2WPVA 2J8SD 4A1GA 3KSLA 3ZXPA 3L6AA 4A3TA 5LCWJ 3FUHA 2H6FA 1N4PA 1DNPA 2PQNA 5T8IA 4I9EA 3MYVA 2PQRA 5LP0A 3HVEA 3HHMA 4N39A 1H19A 3R7RA 3HXBA 3D3MA 3OXGA 2DCPA 4DLOA 3DEPA 3QB2A 1WAO1 1XGWA 4HI8A 3Q79A 4I1OB 4N3CA 1E8XA 3LPZA 3NZSA 3MKQB 3UQ3A 5HI7A 3TWSA 3PE4A 2OCCE 3MEKA 4JHKA 1BD8A 4XX5A 4CRWA 3NOCD 4HXIA 4ANWA 1IQUA 4XI9A 4BEPA 3CVVA 4HORA 2B6CA 5G2NA 3KS2A 1V54E 2UY1A 4L1BA 3ASNE 2VGYA 2YQ8A 3S7DA 5ANLA 3I4GA 3D9MA 4J8DA 1H2VC 4NACA 4GYOA 1N11A 2DBAA 2R2LA 2YINA 5ENQD 3U4TA 3AJIA 1FVHA 1FVFA 4EZKA 3Q15A 4GTPA 4EZJA 3BG0B 3QC1A 2CFUA 4U0ZA 2LUHA 1ZB1A 3I4RB 1S64A 2QC9A 2WXJA 4KVMA 3L22A 1UN9A 5JJ6A 3APFA 5D66A 3QARA 3CKBA 5CEDB 5EX0A 5ITZF 3KEAA 5E76A 1YA0A 4NRHB 3CHSA 3FH5A 5BXOA 4Z68A 2WXNA 1O1RA 2OOEA 2LAHA 4EQFA 2UWJG 4A3VA 3FU5A 3JQ0A 5J90A 1W3BA 1OWOA 4PS3A 5ENTD 3GZ2A 4HOQA 4L9PA 5JHBA 2XEVA 3KEZA 1Z3XA 1SQMA 3S2AA 5BV1A 4P29A 4K5AB 1FT1A 4OVUA 4KYOB 4RVBA 4TUMA 2GROB 2BKGA 3EIJA 1OCZE 2VJ8A 3CHPA 3L82A 1TN6A 2H6GA 1ZBPA 3B13A 4BERA 3LY7A 4RSYA 3HXEA 3UM0A 4DX2A 3PZDA 3D9IA 5JJTA 1LD7A 3CKCA 3UUXA 4UWGA 2EIME 2AJAA 2VGXA 3LKUA 3Q73A 3MX3A 5T4YA 4OAVB 4HRNA 3Q9UC 5FZSA 1H6OA 4XIFA 5JHAA 1JWGA 4GTSA 1E8YA 4TRQA 3QAQA 4PS7A 2ZIRA 3FTVA 4DX7D 4AJWA 4O6FA 4JA7A 1BLXB 4HB5A 5LX8A 3EHMA 1H0AA 4I17A 1EF1C 5AQAA 3Q75A 4WNEA 3FDHA 3DWLG 5JA4D 3V2OA 4EPZA 3ABLE 2VTBA 1FT2A 5HRYA 4EECA 3U3WA 2C0MA 4I6EA 4HRMB 3CQCB 2WXRA 3APDA 1OCOE 3FUEA 4WAFA 2E0IA 2J4DA 2XPYA 3EIQC 4XKCA 4ANVA 3IHVA 5AARA 4JD2G 3FU0A 3FUDA 3HDXA 2IFUA 4U8HA 2ZGGA 5D2MC 2FO7A 4G8KA 2J07A 4HOUA 3AG1E 2FF4A 4ANXA 1SA5A 1SZ9A 4GYYA 4FLHA 4HLEA 2GRNB 5KNHD 2KZTA 3WXXA 3GYZA 3ZYQA 3ZGQA 1EPUA 3WG7E 3VTYA 4U95D 4M7CA 5G05J 2R03A 2GRQB 4GZCA 4B8AA 3FP3A 3UMVA 5KJMA 3SZ7A 3DSUA 2CFZA 3UKRG 1MX4A 3AS5A 2HYZA 1OUVA 4Q94A 4N5CA 1MJ0A 2J08A 2J09A 2KZTB 5C1DA 1Z5SC 5B3SE 2AXVA 3LXUX 3IKOB 4NQ0A 1QNFA 1E8WA 4HFGA 3RO2A 2AXUA 3C98A 4APOA 3B7TA 4U63A 3V2XA 1N52A 3E34A 4O1PA 3VTXA 3UT4A 2Y0BG 2X6JA 3D9NA 3UT7A 2QYJA 2WXFA 4Q96A 4ILIA 4WWPA 5ENOD 1UW4B 4AY5A 3B95A 3JQ1A 3I5PA 2A5EA 3CGHA 3L9TA 2OEVA 2J4BA 1HX8A 4YDEA 4PUCA 4BWRA 3DSWA 4ACLA 3T9KA 3ASGA 4TUUA 3E30A 3HRAA 2XQ0A 1MX2A 2WXGA 3LVQE 4YVQC 3Q4AB 3C3OA 4WWNA 1H6PA 5BW8C 3PS6A 2WVIA 2HO1A 2PM7A 2YHCA 3C3QA 3BG1B 4MRUA 5HS0A 1KLXA 5HQ8A 2ZISA 3DXMG 3CVPA 4CZ2D 3FUMA 3NQPA 4FJYA 3FUKA 4QQIA 4UI9K 2VQ2A 3CVNA 2KCLA 3LY9A 5FQ6A 4DJAA 2XGSA 2XCBA 3TWRA 3ML9A 1GW6A
chains in the Genus database with same CATH topology
4HB5A 4GPMA 2HE0A 5ITZF 3AAAC 1K1AA 1MJ0A 3KEAA 2F8XK 1BI8B 2ZGDA 3EHQA 5AQAA 4B93B 4HQDA 3JXIA 4K5BA 5FIOA 3W9GA 2XZTG 1SW6A 5BXOA 2FO1E 4LG6A 5EIBE 3DEPA 4QFVA 3HG0D 3V30A 3V2OA 5CBNA 2B0OE 4HI8A 5JA4D 4Z68A 4ZHBA 1OY3D 3TWQA 3SO8A 5HRYA 2L6BA 3ZNGA 2XEEA 4HLLA 4DX6D 4LSZE 4ATZD 4U8YD 1BU9A 3TWSA 5CBOA 3NOGD 3Q9NC 2PNNA 2F37A 4HRMB 3V2XA 4O1PA 5FINA 1IXVA 2P2CP 4J7WA 2DWZA 2Y0BG 3UTMA 5ENTD 2DVWA 2F8YA 5EIDA 5BXUA 1K3ZD 2QYJA 1BD8A 5KBAA 4OAUC 2XENA 4HRLA 2MYOA 3NBNB 1YYHA 1IHBA 4GMRA 3NOCD 5EILA 1DC2A 5ENOD 2XEHA 4N5QA 3IXEA 4K5AB 4BEPA 1NFIE 5JMND 3T8KA 1G3NB 5AQ7A 3B95A 3V79K 4DX1A 4UUCA 1IKND 4YDWA 4DUIA 2A5EA 1TR4A 5EN5D 1BI7B 4TUMA 3C5RA 3LJNA 2XZDG 5AARA 2BKGA 5AN8A 5AQBA 2KXPC 1AWCB 3ZU7B 2VGEA 5ENPD 4U8VD 4BERA 2ETBA 2BKKB 4O1OA 5KWDA 3B7BA 2ZGGA 1K1BA 1MX6A 2RFMA 4A63B 3EHRA 4DX2A 2NYJA 4G8KA 4O60A 4RLYA 3T9KA 3J5QB 5CECB 4C48B 1AP7A 3TWXA 3TWTA 3HRAA 1MYOA 5CEAA 1N11A 1SVXA 4K5CA 3DEOA 2AJAA 3UI2A 1MX2A 5ENSD 3V31A 1A5EA 2V4HC 1UOHA 3JXJA 5ENQD 2JABA 4JB8P 1DCQA 1D9SA 2RFAA 3AJIA 4HBDA 1N0QA 4F1PA 5KNHD 5CERB 3UXGA 5HS0A 1WDYA 2V5QC 5HKPA 3TWVA 4ZFHA 2ETAA 2DZNA 4OAVB 3TWUA 4HNAD 4LNUD 2J8SD 4F6RD 4HRNA 5ENRD 5KNGA 1QYMA 3Q9UC 3F6QA 4J8YA 1YMPA 2DZOA 2KBXA 4CZ2D 4U95D 2QC9A 2ETCA 4DRXE 3D9HA 4G8LA 1OT8A 3W9FA 1S70B 3ZKJA 4QQIA 5AQ9A 4BSZB 2Y1LE 4HI9A 1YCSB 4YDYA 5EYPF 4BESA 5D66A 3EU9A 4BETA 1WG0A 4U96D 1MX4A 3JUEA 1N0RA 5AAOA 4DX7D 3ZUVB 4NIKA 3TWWA 3TWRA 4CYMD 5EYLA 5CEDB 3J5PA 4DX5D 1BLXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB5 A;  4GPM A;  2HE0 A;  5ITZ F;  3AAA C;  1K1A A;  1MJ0 A;  3KEA A;  2F8X K;  1BI8 B;  2ZGD A;  3EHQ A;  5AQA A;  4B93 B;  4HQD A;  3JXI A;  4K5B A;  5FIO A;  3W9G A;  2XZT G;  1SW6 A;  5BXO A;  2FO1 E;  4LG6 A;  5EIB E;  3DEP A;  4QFV A;  3HG0 D;  3V30 A;  3V2O A;  5CBN A;  2B0O E;  4HI8 A;  5JA4 D;  4Z68 A;  4ZHB A;  1OY3 D;  3TWQ A;  3SO8 A;  5HRY A;  2L6B A;  3ZNG A;  2XEE A;  4HLL A;  4DX6 D;  4LSZ E;  4ATZ D;  4U8Y D;  1BU9 A;  3TWS A;  5CBO A;  3NOG D;  3Q9N C;  2PNN A;  2F37 A;  4HRM B;  3V2X A;  4O1P A;  5FIN A;  1IXV A;  2P2C P;  4J7W A;  2DWZ A;  2Y0B G;  3UTM A;  5ENT D;  2DVW A;  2F8Y A;  5EID A;  5BXU A;  1K3Z D;  2QYJ A;  1BD8 A;  5KBA A;  4OAU C;  2XEN A;  4HRL A;  2MYO A;  3NBN B;  1YYH A;  1IHB A;  4GMR A;  3NOC D;  5EIL A;  1DC2 A;  5ENO D;  2XEH A;  4N5Q A;  3IXE A;  4K5A B;  4BEP A;  1NFI E;  5JMN D;  3T8K A;  1G3N B;  5AQ7 A;  3B95 A;  3V79 K;  4DX1 A;  4UUC A;  1IKN D;  4YDW A;  4DUI A;  2A5E A;  1TR4 A;  5EN5 D;  1BI7 B;  4TUM A;  3C5R A;  3LJN A;  2XZD G;  5AAR A;  2BKG A;  5AN8 A;  5AQB A;  2KXP C;  1AWC B;  3ZU7 B;  2VGE A;  5ENP D;  4U8V D;  4BER A;  2ETB A;  2BKK B;  4O1O A;  5KWD A;  3B7B A;  2ZGG A;  1K1B A;  1MX6 A;  2RFM A;  4A63 B;  3EHR A;  4DX2 A;  2NYJ A;  4G8K A;  4O60 A;  4RLY A;  3T9K A;  3J5Q B;  5CEC B;  4C48 B;  1AP7 A;  3TWX A;  3TWT A;  3HRA A;  1MYO A;  5CEA A;  1N11 A;  1SVX A;  4K5C A;  3DEO A;  2AJA A;  3UI2 A;  1MX2 A;  5ENS D;  3V31 A;  1A5E A;  2V4H C;  1UOH A;  3JXJ A;  5ENQ D;  2JAB A;  4JB8 P;  1DCQ A;  1D9S A;  2RFA A;  3AJI A;  4HBD A;  1N0Q A;  4F1P A;  5KNH D;  5CER B;  3UXG A;  5HS0 A;  1WDY A;  2V5Q C;  5HKP A;  3TWV A;  4ZFH A;  2ETA A;  2DZN A;  4OAV B;  3TWU A;  4HNA D;  4LNU D;  2J8S D;  4F6R D;  4HRN A;  5ENR D;  5KNG A;  1QYM A;  3Q9U C;  3F6Q A;  4J8Y A;  1YMP A;  2DZO A;  2KBX A;  4CZ2 D;  4U95 D;  2QC9 A;  2ETC A;  4DRX E;  3D9H A;  4G8L A;  1OT8 A;  3W9F A;  1S70 B;  3ZKJ A;  4QQI A;  5AQ9 A;  4BSZ B;  2Y1L E;  4HI9 A;  1YCS B;  4YDY A;  5EYP F;  4BES A;  5D66 A;  3EU9 A;  4BET A;  1WG0 A;  4U96 D;  1MX4 A;  3JUE A;  1N0R A;  5AAO A;  4DX7 D;  3ZUV B;  4NIK A;  3TWW A;  3TWR A;  4CYM D;  5EYL A;  5CED B;  3J5P A;  4DX5 D;  1BLX B; 
#chains in the Genus database with same CATH topology
 3VLD A;  2XHE A;  4K5B A;  4F3V A;  2QYU A;  2MHK A;  4DPR A;  4DI4 A;  2FI7 A;  3TWQ A;  3SO8 A;  1JCS A;  5FZQ A;  4ILG A;  3IV0 A;  4BFR A;  1IXV A;  2RKK A;  1UG3 A;  3ZXS A;  4OAU C;  2XEH A;  5JMN D;  3T8K A;  3Q7A A;  3FEY A;  5LOZ A;  4XEI G;  2AVP A;  1NI1 A;  3PH0 C;  4L23 A;  5EDS A;  2KXP C;  3HXC A;  1HE8 A;  4G24 A;  3ZHE B;  1TEZ A;  3ZHE A;  3D9J A;  3C72 A;  3K9I A;  5FQ4 A;  5FJY A;  3DST A;  2LXL A;  2VSX E;  3RRM B;  1SVX A;  4GTO A;  3V31 A;  1ELK A;  3OXL A;  2RFA A;  3RO3 A;  3FUJ A;  2Y69 E;  2X6F A;  3TG5 A;  2XRY A;  2RD0 A;  4HNA D;  4XKB A;  5ARF A;  3SY2 A;  2DZO A;  3PVL A;  2EIK E;  1H2T C;  2DYR E;  4F1S A;  1HG5 A;  1S70 B;  3IBE A;  5AQ9 A;  4CGV A;  4XI0 A;  4R7L A;  3UPV A;  4I6G A;  4AY6 A;  2AW6 A;  4CYM D;  4JPS A;  4BY6 A;  4GPM A;  4PDX A;  2IEJ A;  1V55 E;  4B93 B;  1FCH A;  3BUA A;  2WMO A;  2KCK A;  3OTN A;  2A4Z A;  4KVO A;  3CK7 A;  3QKY A;  4U07 A;  3CVW A;  4K03 A;  1BPO A;  3D9P A;  2Y4T A;  5DIZ A;  1E8Z A;  4DX6 D;  3Q47 B;  1BU9 A;  2NXP A;  3SF4 A;  2XCC A;  3VLE A;  1O1T A;  4F53 A;  3HIZ A;  2R59 A;  4LEU A;  3RSE G;  4UQY A;  5KBA A;  4CDR A;  2Q7F A;  4I1M A;  3OXF A;  3UIO C;  4UI9 J;  1LTX A;  3U9W A;  3SFY A;  1OXJ A;  4UWH A;  1TR4 A;  4EZL A;  3FEX A;  4FHJ A;  5AQB A;  4RG6 A;  4BSX A;  2X3M A;  4IRU A;  2RG8 A;  4GA0 A;  5AEN A;  3EHR A;  1UJJ A;  3FFL A;  5CHE E;  3FTS A;  2ZXW E;  5CEA A;  1JUQ A;  3B7R L;  2XPZ A;  4J8S A;  5IY5 E;  4Y6C A;  1A5E A;  2JAB A;  1DCQ A;  3CVY A;  5HKP A;  3MV3 B;  2Y4U A;  4LNU D;  3ML8 A;  5KNG A;  2XS1 A;  1QZ2 A;  1OT8 A;  3CVU A;  3ZKJ A;  3RAU A;  2WB2 A;  3FUI A;  5FZR A;  3ZIM A;  4HVB A;  5C2Y A;  1HS6 A;  2CHX A;  3ULQ A;  4JEH A;  3CSF A;  3ZVV A;  2GRM A;  3LVR E;  4RG9 A;  4BTA A;  3PRZ A;  3SFZ A;  3HG0 D;  4ACK A;  3CST A;  1MHQ A;  1Q2Z A;  1O1S A;  4ILH B;  3G2S A;  3PDN A;  4CDN A;  1E7V A;  2XEE A;  4WNG A;  4MBG A;  4C0E A;  1WY6 A;  2EIN E;  4IYP A;  4UQX A;  2CG3 A;  2P2C P;  5JJ7 A;  5EX3 A;  3UTM A;  2I1K A;  3G2T A;  4J6I A;  2LXM A;  2P9I G;  4U04 A;  4FUL A;  5EN5 D;  3TXN A;  4X8Q A;  2BTD A;  2IO2 C;  2I9C A;  2GRP B;  3UM2 A;  1MYO A;  2X38 A;  3PZ2 A;  4K5C A;  4IUL A;  2QFC A;  5FTP A;  3Q49 B;  2GRL A;  4GAA A;  4W9R A;  2PM6 A;  2LNI A;  4GZ6 A;  3TWU A;  5ENR D;  4AV7 A;  3AS8 A;  4GZD A;  1OWN A;  4L7T A;  3DSX A;  3D9H A;  2P9K G;  4H7Y A;  4XZ4 A;  4BET A;  2OEW A;  1HF8 A;  4LUN U;  4FAD A;  2FEZ A;  3BEE A;  4HOT A;  3QOU A;  4ANU A;  4BX8 A;  3NAW A;  3EUV A;  4GCO A;  2FUL A;  1SW6 A;  1U2V G;  3ONL A;  4TXR A;  1ELW A;  1OY3 D;  3ASF A;  3S7F A;  2L6B A;  4IN3 B;  4F7A A;  4G23 A;  4ABN A;  4GZ5 A;  2XGO A;  3GW4 A;  4J7W A;  1TNY A;  2DWZ A;  4G11 A;  1SA4 A;  3MCX A;  2F8Y A;  5BXU A;  1K3Z D;  3UIN C;  2VSY A;  3NBN B;  3T5V A;  2OV8 A;  1L5J A;  3ONK A;  3G2V A;  1Z6T A;  3D9O A;  1BI7 B;  3QDN A;  1AWC B;  3RRU A;  3DRA A;  4ME2 A;  2P58 C;  5G04 J;  3L13 A;  2IY0 C;  3U66 A;  3LCA A;  4JHJ A;  4TXP A;  2WXH A;  3DXK G;  3Q78 A;  3FWV A;  3TL5 A;  2R02 A;  5T3R A;  4HBD A;  3ZRH A;  3AU5 A;  2DZN A;  1JCQ A;  3SFX A;  2WQ6 A;  1N54 A;  4J0U A;  1PAQ A;  3AG3 E;  3W9F A;  4BSZ B;  4HS2 A;  5EYP F;  3AG2 E;  4L2Y A;  1OWL A;  1K1A A;  1BI8 B;  2V8S E;  3EHQ A;  3L08 A;  2R5S A;  3TGO A;  3D9L A;  2FO1 E;  1D8D A;  4LG6 A;  1UJK A;  5EIB E;  3CHR A;  1KZO A;  3L54 A;  2ILR A;  3DSV A;  1S63 A;  1ZU2 A;  4G25 A;  4LSZ E;  3ISM C;  3UM1 A;  5BV0 A;  2IOL A;  3AG4 E;  3P2B A;  2MYO A;  4Y6W A;  5AYW D;  5EIL A;  3JUI A;  4FC8 A;  1IKN D;  3PRE A;  3E33 A;  4JZY A;  3SD5 A;  3T5X A;  1NA3 A;  2XGM A;  5EKQ D;  1IHG A;  3ASH A;  3TWT A;  4YND A;  2OND A;  2WXK A;  2V4L A;  4H7X A;  4PH4 B;  3UXG A;  3ZW3 A;  3TXM A;  4ZFH A;  5KJL A;  2ETA A;  4JXT A;  1QYM A;  3F6Q A;  4GTT A;  2ETC A;  3ENE A;  1JCR A;  2Y1L E;  4Q69 A;  2PL2 A;  3G2W A;  3FH8 A;  3TWW A;  4GZ3 A;  3R9A B;  1TYQ G;  3U64 A;  3S7J A;  4U7E B;  1OCC E;  4HQD A;  3QJZ A;  2VTB B;  1JWF A;  2IO3 C;  1HZ4 A;  3ABK E;  4YDO A;  2HR2 A;  1EDU A;  2XS8 A;  2H6I A;  3ZYM A;  3FY4 A;  3LYA A;  1HO8 A;  2PNN A;  3UIP C;  2OVB A;  4JC8 A;  4XE0 A;  5ENN A;  4HRL A;  4WWO A;  3ULE G;  4A55 A;  2ION A;  3CV0 A;  1TNU A;  5BNW A;  4N5Q A;  3VLF A;  4FLB A;  1G3N B;  3ULY A;  3CVX A;  4DX1 A;  3X2Q E;  4I9C A;  4MS6 A;  1TN7 A;  2X6I A;  3AU4 A;  5AN8 A;  2VGX B;  2ETB A;  4O1O A;  5KWD A;  1K1B A;  4B0Z A;  2RFM A;  1UN8 A;  2NYJ A;  4N2Q A;  4O60 A;  3IEG A;  3SQV A;  4GTV A;  2BUG A;  4YVO A;  1TJF A;  3HXD A;  4UQZ A;  5CER B;  2V5Q C;  3UM3 A;  4C9B B;  3BQO A;  4F6R D;  3SI5 A;  3CEQ A;  1FPP A;  4CDM A;  4A1S A;  3HVE B;  4KMO A;  1IYG A;  2IOS A;  4BT8 A;  5BUZ A;  4AVX A;  1NL4 A;  2L9B A;  5EYL A;  4CCA A;  1H2U A;  2IJG X;  1NA0 A;  3D9K A;  5D0Q D;  2QZA A;  3JXI A;  4L2L A;  2LO6 A;  1DVP A;  1E90 A;  5CBN A;  1X5B A;  1U3C A;  5KJK A;  2MRI A;  4DK5 A;  5CMY A;  5B1B E;  2YNQ A;  3QK0 A;  4LRZ A;  4JHR A;  3HXF A;  2L6J A;  3ABM E;  4I2Z A;  5FIN A;  2WMN A;  3DSS A;  5M72 A;  3DBS A;  5BPP A;  1KZP A;  1TNB A;  4GMJ A;  3ZEF A;  3QWP A;  2KCV A;  2NC9 A;  2X6K A;  1OCR E;  3CHO A;  4GTQ A;  3EU5 A;  2GW1 A;  4UWF A;  4KZ0 A;  4FA6 A;  3Q5M A;  5ENP D;  2ZU6 B;  2JEK A;  3CK8 A;  4CGW A;  2P9S G;  2MOW A;  3ESL A;  5CEC B;  3TWX A;  4N3B A;  4JEU A;  4FJZ A;  2PZI A;  5CRV A;  2LAI A;  1HU3 A;  4JB8 P;  1TNZ A;  4K0R A;  4G2V A;  4F1P A;  4I43 A;  2P9N G;  4OYS A;  4G26 A;  4UI9 C;  2E2E A;  5FT9 A;  4EBA A;  4WND A;  4J8Y A;  1HG2 A;  2KBX A;  4GB9 A;  3RK6 A;  3CK9 A;  5G55 A;  2EIJ E;  4DRX E;  4G8L A;  5H7P A;  3TJP A;  4HI9 A;  4YDY A;  4B89 A;  5J08 A;  3KAE A;  4U96 D;  3JUE A;  1HXI A;  3ZUV B;  1TN8 A;  3L17 A;  3MKQ A;  3V30 A;  4TXQ A;  2C0L A;  4LER A;  1U3D A;  3ZNG A;  1D8E A;  4U8Y D;  4DLQ A;  5CBO A;  2WXQ A;  3Q9N C;  1E7U A;  3MV2 B;  5A7D B;  4GCN A;  4PS8 A;  1HFA A;  3SHF A;  4B8C B;  3UKU G;  2NSZ A;  4BX9 A;  3PEU B;  3RKV A;  1NFI E;  4GPK A;  2J49 A;  4GTM A;  4HOS A;  1P5Q A;  3LJN A;  2KM4 A;  1XNF A;  2VGE A;  3QNK A;  5FQ7 A;  3RJV A;  3PZ1 A;  3B7B A;  3KSQ A;  1MX6 A;  1DCE A;  4AEZ C;  4GA2 A;  3J5Q B;  4C48 B;  3FUN A;  1PY1 A;  2WXP A;  1N95 A;  2WQH A;  3FHE A;  3AS4 A;  4APF A;  3O48 A;  3FTW A;  3B7U X;  3DPD A;  4D10 C;  5G04 C;  3PZ4 A;  3MA5 A;  2V0P A;  1YMP A;  4AIF A;  5G05 C;  1KT0 A;  3URZ A;  1H6K A;  2P9L G;  4BES A;  3EU9 A;  2AWI A;  3NF1 A;  5E75 A;  2CHZ A;  2LSU A;  4DX5 D;  2HE0 A;  4BT9 A;  5KCM A;  3R9M A;  1K8K G;  2XZT G;  4QFV A;  2QY7 A;  3GZ1 A;  2IU1 A;  3UX4 A;  4I6J A;  4B94 A;  4LNB A;  4ATZ D;  3I3N A;  1N94 A;  3NOG D;  2CHW A;  3CQG B;  5AJL A;  4J8F A;  3FUF A;  4TV3 A;  3QWW A;  2J9Q A;  3S7B A;  1N4R A;  3DPY A;  4E85 A;  2M63 A;  1YYH A;  1IHB A;  4GMR A;  3CIA A;  3PUK A;  5B1A E;  2BED A;  4EBA G;  4YDW A;  1WM5 A;  1TJC A;  2XZD G;  2WXO A;  4AM9 A;  3JYS A;  2DIW A;  1Y6I A;  5CCL A;  4U8V D;  1LD8 A;  4AOF A;  2L0T B;  3ZFW A;  4ATG A;  3LJ3 A;  2GGF A;  4LCT A;  1NP7 A;  4GA1 A;  5FQ8 A;  5CRU A;  3FU3 A;  1O5M A;  5CMW A;  4CT4 A;  1UOH A;  2I2O A;  3PE3 A;  2VYI A;  5A6C A;  4I2W A;  5CCM A;  2WXM A;  3R7Q A;  1WDY A;  4KXK B;  1PC2 A;  1N4Q A;  2IQC A;  3MKR A;  5LFA A;  1E96 B;  4U0S A;  3MGB A;  2BF0 X;  2X6H A;  3LY8 A;  4RQI A;  4GYW A;  2IF4 A;  4NIK A;  4E6H A;  3AAA C;  3CLJ A;  1INZ A;  2HM8 A;  1OWP A;  3W9G A;  3PUJ A;  3APC A;  3OAW A;  2XRZ A;  4FP7 A;  4JVS A;  3ASD A;  3QWV A;  1EYH A;  4MLP A;  4FHK A;  4UWK A;  3HYM B;  5EID A;  2WXI A;  1QQE A;  3FTY A;  2I6H A;  2GRR B;  3EDT B;  3ZYK A;  3V79 K;  2R17 C;  4UWL A;  3FUL A;  4JL0 A;  3SBS A;  3N71 A;  4EHM A;  5ARG A;  3P1U A;  4GU5 A;  3KD7 A;  3LDZ A;  2H6H A;  3JCK C;  2BKK B;  3E4B A;  2YHE A;  1TNO A;  4A63 B;  3L16 A;  3E32 A;  3RIB A;  2V4H C;  3FTZ A;  3JXJ A;  1D9S A;  1N0Q A;  3SNX A;  3ZPJ A;  1MZC A;  3T8M A;  5FWQ A;  1A17 A;  4GML A;  4KZC A;  3FH7 A;  4C0M A;  2WQ7 A;  5BT1 A;  1N0R A;  3NB2 A;  5AAO A;  4FU3 A;  3CHQ A;  3O4Z A;  3J5P A;  1S0P A;  2CG2 A;  2F8X K;  2R05 A;  1Y8M A;  3LS8 A;  4N3A A;  3UT8 A;  2VSN A;  5ANR A;  3GZS A;  3RRN B;  2B0O E;  2P9P G;  3B7S A;  3MJW A;  1HH8 A;  2AXZ A;  1Z3Y A;  4JW1 A;  3SBT B;  3E37 A;  4KBQ A;  1X81 A;  2F37 A;  1SZA A;  2LSV A;  3ZYL A;  4AP2 A;  4U0U A;  4MKT A;  3CHM A;  3RU0 A;  3EHN A;  3Q7F A;  4LNG A;  3ESK A;  5AQ7 A;  2OVF A;  4DUI A;  4BTB A;  2WM9 A;  3TAX A;  4WNF A;  1VDY A;  2WXL A;  3MZL B;  5D0O D;  3C3R A;  1AP7 A;  3FU6 A;  1IQR A;  3BU8 A;  3UI2 A;  4N2S A;  1LF8 A;  3TG4 A;  3ASO E;  2EIL E;  4KT6 B;  3CVQ A;  3CR3 A;  3IHY A;  3PEV B;  4AXH A;  4URK A;  2L0I A;  2DYS E;  1YCS B;  4WUY A;  5DBK A;  1WG0 A;  4I1A A;  3FTX A;  1JPL A;  2JLB A;  3NZU A;  2EQX A;  2VSO E;  2ZGD A;  2Y3A A;  1MQS A;  5FIO A;  4G1T A;  4GTR A;  4JA9 A;  4ZHB A;  1B89 A;  1RZ4 A;  4M3O A;  4DI3 A;  4J8E A;  4CT0 A;  3ZN3 A;  3PZ3 A;  4HLL A;  1N9A A;  2FBN A;  2V5F A;  1ELR A;  3FTU A;  5AIJ A;  5A23 A;  2DVW A;  2XPI A;  2UY1 B;  2XEN A;  1OWM A;  2KAT A;  4CEM A;  1N4S A;  2C2L A;  1DC2 A;  3CVL A;  3IXE A;  3SGH A;  2A5U A;  4UUC A;  3LEW A;  1NZN A;  3C5R A;  5KJN A;  3ZU7 B;  2KC7 A;  3G2U A;  3EJN A;  4V3I A;  4NUR A;  4RLY A;  2I1J A;  2P9U G;  1KPS B;  1QBQ A;  4OVV A;  3DEO A;  1RW2 A;  3PNL B;  2F0Y A;  1KT1 A;  5ENS D;  3PNT B;  5LCW C;  5AJD A;  3TWV A;  2WPV A;  2J8S D;  4A1G A;  3KSL A;  3ZXP A;  3L6A A;  4A3T A;  5LCW J;  3FUH A;  2H6F A;  1N4P A;  1DNP A;  2PQN A;  5T8I A;  4I9E A;  3MYV A;  2PQR A;  5LP0 A;  3HVE A;  3HHM A;  4N39 A;  1H19 A;  3R7R A;  3HXB A;  3D3M A;  3OXG A;  2DCP A;  4DLO A;  3DEP A;  3QB2 A;  1WAO 1;  1XGW A;  4HI8 A;  3Q79 A;  4I1O B;  4N3C A;  1E8X A;  3LPZ A;  3NZS A;  3MKQ B;  3UQ3 A;  5HI7 A;  3TWS A;  3PE4 A;  2OCC E;  3MEK A;  4JHK A;  1BD8 A;  4XX5 A;  4CRW A;  3NOC D;  4HXI A;  4ANW A;  1IQU A;  4XI9 A;  4BEP A;  3CVV A;  4HOR A;  2B6C A;  5G2N A;  3KS2 A;  1V54 E;  2UY1 A;  4L1B A;  3ASN E;  2VGY A;  2YQ8 A;  3S7D A;  5ANL A;  3I4G A;  3D9M A;  4J8D A;  1H2V C;  4NAC A;  4GYO A;  1N11 A;  2DBA A;  2R2L A;  2YIN A;  5ENQ D;  3U4T A;  3AJI A;  1FVH A;  1FVF A;  4EZK A;  3Q15 A;  4GTP A;  4EZJ A;  3BG0 B;  3QC1 A;  2CFU A;  4U0Z A;  2LUH A;  1ZB1 A;  3I4R B;  1S64 A;  2QC9 A;  2WXJ A;  4KVM A;  3L22 A;  1UN9 A;  5JJ6 A;  3APF A;  5D66 A;  3QAR A;  3CKB A;  5CED B;  5EX0 A;  5ITZ F;  3KEA A;  5E76 A;  1YA0 A;  4NRH B;  3CHS A;  3FH5 A;  5BXO A;  4Z68 A;  2WXN A;  1O1R A;  2OOE A;  2LAH A;  4EQF A;  2UWJ G;  4A3V A;  3FU5 A;  3JQ0 A;  5J90 A;  1W3B A;  1OWO A;  4PS3 A;  5ENT D;  3GZ2 A;  4HOQ A;  4L9P A;  5JHB A;  2XEV A;  3KEZ A;  1Z3X A;  1SQM A;  3S2A A;  5BV1 A;  4P29 A;  4K5A B;  1FT1 A;  4OVU A;  4KYO B;  4RVB A;  4TUM A;  2GRO B;  2BKG A;  3EIJ A;  1OCZ E;  2VJ8 A;  3CHP A;  3L82 A;  1TN6 A;  2H6G A;  1ZBP A;  3B13 A;  4BER A;  3LY7 A;  4RSY A;  3HXE A;  3UM0 A;  4DX2 A;  3PZD A;  3D9I A;  5JJT A;  1LD7 A;  3CKC A;  3UUX A;  4UWG A;  2EIM E;  2AJA A;  2VGX A;  3LKU A;  3Q73 A;  3MX3 A;  5T4Y A;  4OAV B;  4HRN A;  3Q9U C;  5FZS A;  1H6O A;  4XIF A;  5JHA A;  1JWG A;  4GTS A;  1E8Y A;  4TRQ A;  3QAQ A;  4PS7 A;  2ZIR A;  3FTV A;  4DX7 D;  4AJW A;  4O6F A;  4JA7 A;  1BLX B;  4HB5 A;  5LX8 A;  3EHM A;  1H0A A;  4I17 A;  1EF1 C;  5AQA A;  3Q75 A;  4WNE A;  3FDH A;  3DWL G;  5JA4 D;  3V2O A;  4EPZ A;  3ABL E;  2VTB A;  1FT2 A;  5HRY A;  4EEC A;  3U3W A;  2C0M A;  4I6E A;  4HRM B;  3CQC B;  2WXR A;  3APD A;  1OCO E;  3FUE A;  4WAF A;  2E0I A;  2J4D A;  2XPY A;  3EIQ C;  4XKC A;  4ANV A;  3IHV A;  5AAR A;  4JD2 G;  3FU0 A;  3FUD A;  3HDX A;  2IFU A;  4U8H A;  2ZGG A;  5D2M C;  2FO7 A;  4G8K A;  2J07 A;  4HOU A;  3AG1 E;  2FF4 A;  4ANX A;  1SA5 A;  1SZ9 A;  4GYY A;  4FLH A;  4HLE A;  2GRN B;  5KNH D;  2KZT A;  3WXX A;  3GYZ A;  3ZYQ A;  3ZGQ A;  1EPU A;  3WG7 E;  3VTY A;  4U95 D;  4M7C A;  5G05 J;  2R03 A;  2GRQ B;  4GZC A;  4B8A A;  3FP3 A;  3UMV A;  5KJM A;  3SZ7 A;  3DSU A;  2CFZ A;  3UKR G;  1MX4 A;  3AS5 A;  2HYZ A;  1OUV A;  4Q94 A;  4N5C A;  1MJ0 A;  2J08 A;  2J09 A;  2KZT B;  5C1D A;  1Z5S C;  5B3S E;  2AXV A;  3LXU X;  3IKO B;  4NQ0 A;  1QNF A;  1E8W A;  4HFG A;  3RO2 A;  2AXU A;  3C98 A;  4APO A;  3B7T A;  4U63 A;  3V2X A;  1N52 A;  3E34 A;  4O1P A;  3VTX A;  3UT4 A;  2Y0B G;  2X6J A;  3D9N A;  3UT7 A;  2QYJ A;  2WXF A;  4Q96 A;  4ILI A;  4WWP A;  5ENO D;  1UW4 B;  4AY5 A;  3B95 A;  3JQ1 A;  3I5P A;  2A5E A;  3CGH A;  3L9T A;  2OEV A;  2J4B A;  1HX8 A;  4YDE A;  4PUC A;  4BWR A;  3DSW A;  4ACL A;  3T9K A;  3ASG A;  4TUU A;  3E30 A;  3HRA A;  2XQ0 A;  1MX2 A;  2WXG A;  3LVQ E;  4YVQ C;  3Q4A B;  3C3O A;  4WWN A;  1H6P A;  5BW8 C;  3PS6 A;  2WVI A;  2HO1 A;  2PM7 A;  2YHC A;  3C3Q A;  3BG1 B;  4MRU A;  5HS0 A;  1KLX A;  5HQ8 A;  2ZIS A;  3DXM G;  3CVP A;  4CZ2 D;  3FUM A;  3NQP A;  4FJY A;  3FUK A;  4QQI A;  4UI9 K;  2VQ2 A;  3CVN A;  2KCL A;  3LY9 A;  5FQ6 A;  4DJA A;  2XGS A;  2XCB A;  3TWR A;  3ML9 A;  1GW6 A; 
#chains in the Genus database with same CATH homology
 4HB5 A;  4GPM A;  2HE0 A;  5ITZ F;  3AAA C;  1K1A A;  1MJ0 A;  3KEA A;  2F8X K;  1BI8 B;  2ZGD A;  3EHQ A;  5AQA A;  4B93 B;  4HQD A;  3JXI A;  4K5B A;  5FIO A;  3W9G A;  2XZT G;  1SW6 A;  5BXO A;  2FO1 E;  4LG6 A;  5EIB E;  3DEP A;  4QFV A;  3HG0 D;  3V30 A;  3V2O A;  5CBN A;  2B0O E;  4HI8 A;  5JA4 D;  4Z68 A;  4ZHB A;  1OY3 D;  3TWQ A;  3SO8 A;  5HRY A;  2L6B A;  3ZNG A;  2XEE A;  4HLL A;  4DX6 D;  4LSZ E;  4ATZ D;  4U8Y D;  1BU9 A;  3TWS A;  5CBO A;  3NOG D;  3Q9N C;  2PNN A;  2F37 A;  4HRM B;  3V2X A;  4O1P A;  5FIN A;  1IXV A;  2P2C P;  4J7W A;  2DWZ A;  2Y0B G;  3UTM A;  5ENT D;  2DVW A;  2F8Y A;  5EID A;  5BXU A;  1K3Z D;  2QYJ A;  1BD8 A;  5KBA A;  4OAU C;  2XEN A;  4HRL A;  2MYO A;  3NBN B;  1YYH A;  1IHB A;  4GMR A;  3NOC D;  5EIL A;  1DC2 A;  5ENO D;  2XEH A;  4N5Q A;  3IXE A;  4K5A B;  4BEP A;  1NFI E;  5JMN D;  3T8K A;  1G3N B;  5AQ7 A;  3B95 A;  3V79 K;  4DX1 A;  4UUC A;  1IKN D;  4YDW A;  4DUI A;  2A5E A;  1TR4 A;  5EN5 D;  1BI7 B;  4TUM A;  3C5R A;  3LJN A;  2XZD G;  5AAR A;  2BKG A;  5AN8 A;  5AQB A;  2KXP C;  1AWC B;  3ZU7 B;  2VGE A;  5ENP D;  4U8V D;  4BER A;  2ETB A;  2BKK B;  4O1O A;  5KWD A;  3B7B A;  2ZGG A;  1K1B A;  1MX6 A;  2RFM A;  4A63 B;  3EHR A;  4DX2 A;  2NYJ A;  4G8K A;  4O60 A;  4RLY A;  3T9K A;  3J5Q B;  5CEC B;  4C48 B;  1AP7 A;  3TWX A;  3TWT A;  3HRA A;  1MYO A;  5CEA A;  1N11 A;  1SVX A;  4K5C A;  3DEO A;  2AJA A;  3UI2 A;  1MX2 A;  5ENS D;  3V31 A;  1A5E A;  2V4H C;  1UOH A;  3JXJ A;  5ENQ D;  2JAB A;  4JB8 P;  1DCQ A;  1D9S A;  2RFA A;  3AJI A;  4HBD A;  1N0Q A;  4F1P A;  5KNH D;  5CER B;  3UXG A;  5HS0 A;  1WDY A;  2V5Q C;  5HKP A;  3TWV A;  4ZFH A;  2ETA A;  2DZN A;  4OAV B;  3TWU A;  4HNA D;  4LNU D;  2J8S D;  4F6R D;  4HRN A;  5ENR D;  5KNG A;  1QYM A;  3Q9U C;  3F6Q A;  4J8Y A;  1YMP A;  2DZO A;  2KBX A;  4CZ2 D;  4U95 D;  2QC9 A;  2ETC A;  4DRX E;  3D9H A;  4G8L A;  1OT8 A;  3W9F A;  1S70 B;  3ZKJ A;  4QQI A;  5AQ9 A;  4BSZ B;  2Y1L E;  4HI9 A;  1YCS B;  4YDY A;  5EYP F;  4BES A;  5D66 A;  3EU9 A;  4BET A;  1WG0 A;  4U96 D;  1MX4 A;  3JUE A;  1N0R A;  5AAO A;  4DX7 D;  3ZUV B;  4NIK A;  3TWW A;  3TWR A;  4CYM D;  5EYL A;  5CED B;  3J5P A;  4DX5 D;  1BLX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...