5BXZA

H17 bat influenza ns1 rna binding domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
b'PNPTTIAFQVDCYLWHLKKTLSMMGEVDAPFEDRLRREQKALKGRSMTLGIDIQSATQEGYYKIKSITE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Novel Bat Influenza Virus NS1 Proteins Bind Double-Stranded RNA and Antagonize Host Innate Immunity.
pubmed doi rcsb
source organism Influenza a virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10))
molecule tags Viral protein
total genus 26
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5bxzA00
2UUBO 5A2QN 3RT3C 4DV7O 2UU9O 4A5UB 4JI3O 5IWAO 4DV5O 4NXMO 2UXBO 4OPAA 5BR8O 4DV0O 4JI7O 4YY3O 1FJGO 4DR5O 1DK1A 4DUZO 3SDLA 4JI6O 3F5TA 4DR1O 1YZBA 4X64O 4X62O 1G1XB 2ZKOA 1XEQA 1D2DA 2E5LO 1HR0O 1N33O 4LF4O 4JYAO 2UXCO 2DJVA 5LL6Y 1I94O 3J7AU 4OPHA 1XMOO 2UUAO 2UXDO 5LMNO 4JI8O 4GKJO 4LF6O 1AILA 5BY1A 4DV4O 4OX9O 1XNQO 3T1HO 4K0KO 1AB3A 4AQYO 4B3RO 4X66O 5H5NA 1XMQO 1NS1A 1F7YA 5IT9N 2UUCO 2ZM6O 1XNRO 4JI0O 4DV2O 4LFCO 2DOSA 3OTOO 3M8AA 4LF9O 1J5EO 5BXZA 5LMUO 4DV3O 4LF5O 4B3SO 3R66A 4B3MO 4GKKO 1N34O 1HNXO 2VQEO 4JI2O 4B3TO 1KUQA 1X59A 2N74A 2Z0AA 1A32A 2LW7A 4YHHO 2VQFO 4JI5O 2HHHO 1IBKO 1IBMO 5FLXN 4JV5O 1N36O 4DV1O 1R6TA 4DR6O 4DV6O 2JRIA 4X65O 2AGAA 3O65A 3JAMN 1HNWO 1FYJA 1N32O 4DR4O 1HNZO 2F4VO 3T1YO 2FKXA 4DR2O 4KHPO 4DR3O 4LFAO 4LF8O 4LFBO 1FKAO 4NXNO 4DUYO 4DR7O 4JI1O 4JI4O 3J81N 3J80N 1R1BA 1IBLO 4LF7O
chains in the Genus database with same CATH superfamily
2WLLB 2HJFC 2ZNIA 2BE3A 4X88A 3MAQA 3JAWA 3BAAA 1OCZB 1H2LA 3E86A 4ZI7B 2YXYA 1BE3H 3E83A 1NR1A 3GWKC 2XOKG 4X1IA 1RP3B 3TJTA 1FPOA 1K92A 1PKXA 3OAAG 3ZRSA 4PHZA 2BSKA 2YSUB 3G80A 1G8MA 3T4DA 1JPXA 2ZDIC 4UCVA 1IVSA 2N05A 2UXCO 2DJVA 5L3GA 4NXMB 4LNUB 1NVPD 3ABTA 1Y74B 2UUAB 2Q68A 3RYHB 5CA0B 1VARA 2LQTA 3ABMB 5LMNO 1AR4A 5DN6G 4GKJO 3BA8A 3T1HB 5BY1A 1EN4A 5EC2C 1JA8A 4AQYO 4LCUC 3SYPA 1XMQO 1JCHA 3APOA 1ENVA 5LP6A 5KHJA 4IHJA 3CJHB 2IJHA 2ZNJA 1V55B 1Y76B 4GKKB 1SA0A 4WFHA 4J7KA 5JQGA 3R65A 2WA3A 3LNMB 2QSAA 4OX9B 1BGYH 4BIOA 3ZCCA 3JD4A 4JPRA 2CTQA 1H2MA 3N2KA 2OIEA 1K73W 1H8HG 4DV6O 4MVMA 3SJQC 1M9NA 3H1IH 1SERA 1H8EG 1OZ0A 3OT7A 3AG3B 5B1NA 3N27A 5JH7B 3JATB 3K5NA 4DUYB 3RVZA 1DTOA 5KX5B 4JI1O 4GZRB 4NTYA 2AHZA 3QVNA 2WAMA 3RGBA 2LFRA 5IWAB 1VIBA 3HKEA 4XDKA 4UB8Z 1FJGB 4DR5B 4YY3O 3I55V 4JI6B 4DW0A 1MA1A 1OCOB 3LUTB 2RN9A 2X7RB 3HKCA 1MZEA 1S5HC 5JVDB 1GTOA 4PDLA 4X62B 4ABMA 4X64O 2QJ1A 1N33O 2E75B 2LGWA 2ZR2A 4X20B 2M6YA 4MW8A 2JK5C 1XHXA 1AJNA 4G27B 4WBNA 1S77D 3JSNA 2EZPA 5FPOA 4O4JA 5GTIZ 5EIBC 1VF7A 1Z5WA 1PL0A 4D7SA 3K59A 5H5NA 4X1KB 2P22C 2GSMB 3SR2C 4UV9A 2YIAA 2Q8VA 4JYAB 2OCHA 2GHYA 3IFXA 1TVKA 4GUNA 1QCEA 2WLIA 4B3MB 3D36C 3JD2A 4E4EA 1KB9F 4U3JA 1PL4A 1LR1A 1HNXB 2YXLA 3UO2A 3L70H 4MS2A 1L8DA 4B3TO 1KP3A 1AVMA 4CC5A 4Z1MG 4FLUA 3ABLB 4JAUA 2EBOA 2QR4A 2HHHO 3AG1B 1QBZA 1JR9A 2BOCC 2IM9A 5L3FA 4RO2A 4H37A 5J2UB 2QKSA 3K79A 3CCVV 3ZHTA 4FLXA 4W4KA 3X2QC 4J9YB 3AG4C 4P30A 1M90W 2AZ0A 1K9MW 2RNBA 1SF9A 1TA8A 3W7UA 3WB1A 1IXBA 2A7WA 2GUZA 4R6ZA 2Q69A 3IC9A 1EZJA 1IBLB 2LFSA 4FZ0A 3ASNB 1YTFD 4HYOA 4I0XA 1E79G 3CRRA 4JI3B 1RM1B 4ZHQA 2YI8A 3JALB 4NXMO 3P30A 1U97A 3KCYA 4FLWA 3CCUV 4GX2A 4D6TH 1WA8B 3JYCA 4DYLA 1R6KA 5J9PC 1K97A 2KQXA 5LXTA 1SQBH 2K1EA 3JD3A 1Q82W 3FYIB 1Z5VA 3APQA 1JOYA 3N2GA 1VQ9V 2VS0A 4LC1A 1EM1A 1L0NH 4DRXA 3WB0A 4B7KA 4WF9V 3IAYA 1N8RW 2YIDA 3K08A 5LL6Y 2P7TC 1DF5A 4UCOA 1XHZA 1K33A 5EZYB 2P6JA 3UQ8A 4OX9O 4EEQA 5HFLA 1KC8W 4FJCC 1KQSU 1WAZA 4IGGA 4W4LA 1KYOF 3UO3A 4JI0O 5LGUA 4FLVA 1FXKA 1OCCB 2YUAA 3M8AA 3OTOO 2LW1A 2XAJA 3R66A 2OCCC 1FXKC 2UXDB 4JI2B 5LA6A 4L8JA 2N74A 4K0KB 1AR1B 4JZ2A 2VQFO 3ZRVA 3CRMA 3VQXA 5KMGB 4JV5O 3ETGA 4NTWA 1HNWB 2CH7A 2M7WA 2IW5A 1FYJA 4LF5B 1UPGA 5E1AC 4AILC 3CHXA 3T1YB 2G38A 2IJIA 1WB7A 3A2FA 4JI5B 2ZIOA 4FM2A 5A2QN 3P3NA 1EN5A 4RQFA 5H2FZ 4F6RB 4A5UB 1XBLA 1PNLA 4XDJA 1VQLV 2PI4A 2XAGA 5BR8O 4QGPA 4UCUA 2YC0A 4KHPB 4FZ1A 5KUKA 4UV8A 2CGNA 3F5TA 2ZQMA 4N21A 4O2AB 3F5WC 3A8TA 3ZMSA 5B66Z 4LF7B 5B1AC 5GONB 4LR3A 4CC6A 4JYAO 1CPYA 4I55A 1P84F 3VQVA 1I94B 4TV9A 2A3QA 3WB2A 4OPHA 3QTCA 4GX5A 5IJ9A 1QQCA 1UFIA 2D3OW 3H01A 1THZA 2RQ6A 2CDYA 2P4VA 1QLEC 4Z1VA 1DF4A 5IYZA 3E22B 5CA1B 1VQMV 3I5DA 3OEEG 2D2CB 3CMAV 2DYRC 2GV9A 3M7MX 2P90A 3L75H 3MDSA 3CCMV 4J80A 5ITZB 2GDSA 5L3CA 1WJZA 3CXHF 4EFBA 4QPJA 4D7TA 1NBMG 5H9CA 4YJ2B 4MW3A 3H1KH 1K8AW 3BRCA 2P4KA 2LW7A 1L0LH 1URFA 2YS8A 4X1IB 1XI1A 3ETQA 5K1XA 1VQ6V 2HVJC 2A79B 4DV2B 2JRIA 4DXWA 1R6NA 4DR2B 4KXRA 1P7GA 3MHSC 3ZHQA 4F6EA 1NKDA 3CX5F 4NXNB 4RAIA 3ASNC 3AK3A 3ZHRA 3HPLC 3ZHVA 3RT3C 4DV7O 2UU9B 2YEVB 3BCCH 1H2KA 2HJDA 3KZIZ 2EIKB 1B04A 1IURA 2ILMA 4DV5O 2JIZG 4JZGA 4TSFG 5LP6B 1YITV 5F2VO 5L3EA 4IHJB 2WSSG 3JCUZ 4DR7B 1S5LZ 1IXMA 5B5EZ 1SA0B 2LGQA 3FB8C 3EVKA 1LUWA 3OR6C 2CAZC 1G1XB 5JQGB 1IDSA 2YIBA 1AJQA 4C7UA 1IX9A 2V1DA 3HKBA 1D5NA 4X9QA 4B7EA 2DWDC 4PA7A 4DV0B 2UXDO 1K5SA 4FLYA 3CXCU 1AILA 3B8NA 1S5JA 4K0KO 4PELA 4ZOLA 1OV9A 1E1RG 4LF4B 3W7TA 1BSMA 4JYCA 4LFCB 2ZIMA 5BXZA 5EBLC 5EC1C 1T5EA 4LF5O 4JAVA 2DQ0A 2YI9A 3HKEB 3L74H 3ZRWB 1COWG 1A32A 4CH6A 4JI5O 2A06H 3CCRV 5JCOC 2Y48A 2K9PA 4DR6B 2DE0X 1K3EA 1VF5B 1FXHA 2EX3A 1S0VA 4OGQB 3ETEA 1SRYA 1AROP 1BQ0A 3K5OA 2B5UA 4YIPA 1P4RA 4KHPO 2R9AA 4WBNB 5KAIZ 3VBBA 4YHHB 5B3SB 2OTJV 1PNKA 1V54C 1JJ2U 4LF7O 4UFZA 3QG5A 2JJ1G 3IC7A 4E2LA 4OPAA 2JGDA 1VQ5V 4UXNA 1PPJH 1VF6A 5LHGA 1TVKB 4DR3B 2WLIB 1AJPA 1ORQC 2HFEC 2R70A 4WFEA 1KP2A 2FL4A 2UUBB 3LDDA 1XUQA 1EN6A 5IJ0B 4GYCB 4R7CA 1XILA 2Y69B 3NR7A 1R73A 3TXSA 3CCSV 1K4DC 2QDOA 5B1BC 4P9PA 4UVBA 1SZXA 4LF6O 4J7JA 2CTPA 1WLEA 2ZDIA 2P67A 2QWRB 1HR0B 5KUMA 5GW7A 4FFBA 1GMGA 2E74B 2GUZB 3K57A 1XNRO 1YSCA 4DV2O 3SYQA 3CYOA 3EXAA 3K9AA 1SQVH 4ICGA 5CBGA 2LJ2A 4I0XB 3RYIA 3ASOB 5JJJB 2EINB 4ZHQB 1TAEA 4I50B 2EJ7A 4FFKA 2OTLV 1M4UA 1M57C 1S76D 4LH6A 2XUMA 5LXTB 5HFMA 4BIZA 2UXXA 5KHKA 4NKGB 3W7XA 4X65B 5CB4A 4KP4A 4DV3B 4QE9A 3QO8A 1EBOA 4PA3A 1CP9A 3KG2A 4DR4B 4HAMA 2XAFA 4NVPA 3DXRA 3VQWA 1XL4A 1ZTEA 3UKMA 1N4CA 4LFAO 5C93A 4H0LB 4DR7O 1YTFB 1K7DA 2DN9A 1WNSA 4RQEA 3JASB 2RDCA 2ZR3A 2H8PC 4K35A 4PD4F 5LYJA 3T1CA 2OT5A 3BABA 3S3WA 1R3KC 4B08A 4YIOA 3VOUA 2VWKA 1BHAA 3K58A 3Q4HA 4DV0O 3G6BA 1YF2A 4MVQA 2QKAA 1HP8A 3RYCB 4U3FH 4X1YA 1TUBB 5KHHA 3BY6A 1M5IA 1F4MA 3ZMUA 4LF4O 1YJNV 3ABKC 1XREA 5KA6A 4HBNA 3E8GA 2QWQB 4I5SA 4MVRA 1KMIZ 1GN3A 2RJZA 1NT2B 2KG7A 2Y0IA 3D8CA 2CH7B 4O2BA 3E89A 4Q20A 3UCSC 4LP8A 5TISZ 1V9PA 2HG5C 4HZ3A 3E8HA 2AXTZ 1FS0G 3B77A 3OMIB 5A9GA 1GK9A 2XTAA 1LNQA 3TETA 1Y6XA 2OWOA 1ZX3A 4YHHO 4P2ZA 1G6UA 1N36O 4EKWA 1VQ7V 3K3WA 3FB7C 4L87A 4OXSA 4WFFA 3OW2U 3D36A 5KAFZ 1Y4MA 3BA9A 3M99B 2QTOA 4AI8A 4I55B 5D5PA 2X6BA 4DR3O 3K03A 4JI4B 1W0JG 3J81N 3J80N 2UUBO 3LNNA 1GM8A 1VP7A 5IYZB 1VMGA 2ZXWB 4TV8A 1HNZB 2F4VB 3OMNB 2F66C 2GTSA 3ZRXA 3QNEA 2WLNA 1YEWA 4ZBMA 5EBMC 1YZBA 2R72A 3CRCA 2HR3A 4ZI7A 1GN4A 1HR0O 5IYDO 2DW4A 1GN6A 1OCZC 3KCXA 5J2TA 1Y67A 3DTUB 3IJ4A 2KB1A 4NB5A 2UUAO 3U11A 3SYAA 4DV4B 5LGTA 2BOBC 4K8XA 1SZTA 3T1HO 1PD3A 2JJ2G 2MK3A 4DR1B 2Z5UA 3CB2A 1NTKH 2E3CA 1Q7YW 1PNMA 3AEIA 2O57A 2JEUA 3ASOC 1VQ4V 5LMUB 3RN4A 1AR5A 2EINC 2PYLA 4DV3O 5CMUA 3ABMC 4DO2A 4GKKO 1XMOB 2ITDC 4YJ3A 3K9SA 3NXSA 1GH6A 1QR8A 4MVOA 2W6JG 4H44B 3CJHA 3ML0A 4X66B 4XDLA 1Y76A 2ATKC 3WG7B 4GCZA 1M56B 1WP7A 2R9IA 4DV1B 3K06A 3A0RA 4JYBA 4FM1A 1NQTA 1NTMH 1V55C 3RVYA 4FPPA 2QE7G 4Q6GA 4B3SB 4FM0A 3EFFK 1MMMA 2EIJB 3HKBB 5LOVA 3E8BA 2QM7A 4J42A 1FKAO 3D3QA 4DUYO 2DYSB 4O4LA 1DGSA 4FMTA 2HP8A 1QVGU 5JWPA 3ZJZA 1YJ9V 2UXBB 5IWAO 4ZOLB 1ROPA 3THOA 3AG3C 5KX5A 4PDMA 1FJGO 4DR5O 1DK1A 2F43G 3SJAC 4JI6O 1N0JA 3B2EE 2L6LA 4X62O 3RWRD 5EBWC 3CSXA 4PA6A 3JARA 2NN4A 3FAVA 5JVDA 1QR9A 3VQYA 1OCOC 3BEHA 4DUZB 1QU7A 2OIGA 2JEXA 1M1KW 3SPGA 4MVZA 4O4IA 3BHPA 3AG2B 1KD1W 5CA3A 1WN7A 3UT5A 2CE4A 3CRAA 2BTQA 5BMVA 3SYCA 3LSSA 3E2EA 2AZ2A 1FFXA 2QM4A 4B3MO 2ARHA 2MW2B 1HNXO 1JQ0A 3ZMZA 2QWNB 2JGDB 2IU0A 2IBZH 2JDIG 4GLXA 5FL7G 2EIMB 2B1IA 1Q6UA 5FNVB 1ZAUA 2PYJA 1BL8A 3CC7V 2P5OA 1OHHG 2ZE5A 3OMAB 5IYBO 1HNZO 5KHIA 1WP8A 2F4VO 3ABLC 4LFBB 3BFRA 3JAWB 5J2UA 3AG1C 2XAHA 1OCRB 1QLNA 5LHIA 2XHBA 1X4TA 4TOIA 1IBLO 2F23A 5DECA 4FVMA 1VQKV 2YICA 4JI3O 4EB6A 2BSKB 3L72H 2KKWA 1J95A 2WLKA 4BAYA 4FFBB 5H6QA 2YIBD 1BCCH 1YHQV 3WU2Z 1RSOA 4JAAA 3RYIB 4PJ0Z 4DR1O 2QWPB 5JJEB 2XNDG 4ZKIA 1D2DA 3CRQA 3E35A 3ZN1A 4UCSA 1RM1C 2KSDA 2WWWA 4O4HA 3AK1A 3LSQA 1NH2B 4PA9A 4UB6Z 1L1FA 4J7ZA 4JF3A 3OGIB 1XMOO 3B4SA 2BCCH 3MHHC 5H6RA 5CB4B 4J10A 1GN2A 3RW0A 2B1GA 4AQYB 3SJBC 2FTKA 1IZ3A 3DC6A 1XMQB 4X66O 3DXRB 3OE7G 1MABG 2NLJC 1NJIW 1SQQH 1GRJA 1B3QA 3FB5C 2JS3A 1YIJV 4B3SO 3FB6C 2DQ3A 1Y66A 3N2KB 5LYJB 4JI2O 1X59A 1ZUQA 4RWUA 2Z0AA 5LBQA 3C90A 3Q4HB 4KUMA 1M56C 1DLBA 1WB8A 4X1YB 2UUCB 1OCCC 4DV6B 3I56V 4LF9B 1J5EB 2W0XA 3O65A 4CBCA 1HNWO 2EIJC 3H1JH 4JTAB 3T1YO 4TUYA 1VQ8V 4JGSA 1ZSPA 1O9HA 4JI1B 2PTMA 2KG7B 3ZHUA 5CBHA 5JCOA 3OD4A 3HKCB 3E8FA 1AI4A 2PGGA 3DC5A 1MOFA 4PDRA 2EILB 2IU3A 1I08A 1KKDA 2Y4UA 5EYPA 5D5QA 3LDCA 3P32A 3CMEV 3CEIA 4DUZO 3ZN0A 2E76B 5IY5B 1H2GA 3HKDA 4FLTA 4O4JB 2Q7GA 2QTSA 3B8MA 2Z3YA 4QNHB 3IGAC 1KECA 1Q6IA 1NZ6A 3OFNG 1Q3EA 3K5LA 1I94O 4X8AA 1ZL8A 4JI7B 3CC4V 1Q86W 5E79Z 3G6EV 3ZMTA 2A9HA 1JMKC 4ZIBA 3C3TA 1I5XA 4HNAA 4MVUA 4U3JB 2E5LB 1AP5A 4BW5A 1QVFU 2NR5A 1VEWA 2PZSA 2YXHA 1NTZH 1NH2D 5CA1A 3X2QB 2ZE8A 4B3TB 3AG4B 1KUQA 4PA4A 3BVOA 1K34A 2YDEA 3G4SV 2HHHB 1BZKA 2Q67A 3CS5A 4UCTA 1R6TA 4YJ2A 1BHBA 1SESA 1AI5A 2AGAA 1TUEB 1ZLZA 2QWOB 4DW1A 2FKXA 4DR2O 1OCRC 5J2TB 4X89A 4H33A 3SGIA 3FYEB 3ZMVA 3ZHSA 4NXNO 1JX9A 4IIJA 3OGCC 1H38A 4NR1A 2UU9O 3ICXA 2IJJA 2DMXA 4JYYA 2L35A 3N2GB 2RMKB 5BZBA 4DRXB 1US6A 3FKSG 4CZZA 3A0BZ 2CUGA 2YEVA 4QJFB 4BIUA 2Q5ZA 3SYOA 4CS2A 4CS3A 1BT8A 4YJ3B 2ZKOA 2ZCEA 2EIKC 5LGNA 3ABUA 4UVCA 4MTGA 4J9ZB 5LP6C 2OYQA 2N04A 5C8YA 2FYUH 1KKCA 2OCCB 2QGNA 1FXKB 3K5MA 4NYKA 2EULA 1XL6A 2JVDA 5EIBD 2RCVA 5LA6B 3W7WA 2Y4TA 5LOVB 2FMLA 4LWSA 4PV1B 2HEPA 3CC2V 2UUCO 3JD0A 4JI0B 2LO1A 3OTOB 3W7SA 3G71V 4O4LB 2CTWA 4U7OA 3ZEDA 4AHCA 4LF9O 4LFCO 1J5EO 2GTAA 1SC5B 4MVSA 1JFFA 4QE7A 1Q6HA 5DEDA 3STZC 2VQFB 5EK0A 4JV5B 3RYFA 3B40A 1SKVA 1E1QG 3GWOA 2ZM6B 2Q7EA 4DR6O 5IDJA 3KKYA 3ZRWA 2ITCC 3FD9A 3JARB 1Z2GA 2X0LA 1PM9A 2EJRA 1MZFA 1QNMA 3FAVB 4KL1A 4NTXA 2V7QG 1YVWA 4UVAA 5DM6V 2W6IG 2Q73A 2EILC 5B1AB 3C3SA 1PP9H 4O4IB 1OJHA 2A0LA 2XASA 1M93A 4TQFA 5BR8B 4GX1A 2HLDG 4JI7O 5IY5C 1N32B 3UT5B 2BTQB 2V4DA 2DWEC 4I4TA 5BMVB 3ETDA 1FXVA 4CH3A 1W0KG 2AHYA 1FFXB 2NNUA 5B3SC 4TV9B 1SQXH 5IJ9B 3ZIAG 1QLEB 2E5LO 1R3IC 2H3OA 4ASUG 2DYRB 3JAKA 5JJNB 1P7BA 1PV0A 3CWBH 3T4ZA 2WLLA 3S3XA 1AB3A 5IJ0A 4WFBV 4F4LA 4WFGA 5L3BA 2Y69C 3K04A 2DOSA 4I9WA 2PY5A 1HDJA 4IYHA 4EB6B 1XNQB 3FFQA 5B1OA 5FLXN 1YCIA 2JGUA 1RSOB 4LNUA 5AG2A 1Y74A 5CA0A 3RYHA 1W2BU 4P9OA 3SPHA 4X65O 2PF4E 1AI7A 4I50A 4CH4A 3OUSA 3A0HZ 2VRZA 3TCUA 4O4HB 5GTHZ 4DR4O 2VQEB 1WPBA 1R3LC 2CK3G 4G28B 1JJOA 1GO3F 5KA5A 1UJWB 1IBKB 1IBMB 1U96A 2ZE7A 4DV7B 4BR6A 1YI2V 5L3DA 1GM7A 4DV5B 3O9OA 2F1MA 3RFRA 1RFYA 3LSUA 3JASA 3AK2A 3SDLA 4MSWC 4U7NA 4WFAV 4LF8B 3OTFA 4TQDA 2QA4V 2C2AA 2HVKC 1RPRA 2H94A 2XAQA 1XEQA 1FAFA 2ZINA 2ADQB 3L9DA 4XBFA 3TK1A 1QHTA 4KFMA 4JASA 5JH7A 3JATA 3RYCA 2IH3C 1TUBA 2PI5A 4LH7A 3GB7C 1MG1A 4LBEC 1SQPH 1YJWV 4EFEA 2ZD9A 4UCRA 3H1LH 2AW9A 5K1PA 4TUYB 4RUEA 1NS1A 3H9VA 1I7FA 1CXZB 1F7YA 4I9QA 2PUSA 1NU1H 2ZM6O 4Z2WA 1B6QA 3HR0A 3K0DA 2B9ZA 3TXQA 1CEZA 4PI0A 4JI8B 4YXWG 1GKFA 3B09A 4X20A 1HWYA 1BMFG 2CTRA 1MSWD 1GAXA 5EYPB 3U10A 3G67A 1V54B 3HKDB 2IJKA 2W0FC 4IL6Z 2GBOA 3OM3B 1B06A 1N34B 1N32O 4X1KA 1ZL8B 3EHBB 1LUVA 2IH1C 1H2NA 1KU9A 4JI4O 1GM9A 5CBFA 1VQOV 3CCQV 4RUFA 4HNAB 4G2KA 4CH5A 4PI2A 1N0NA 4IYIA 3SPJA 1BQZA 2UXNA 4FLZA 5B1BB 4PDVA 3QO5A 2WPDG 3ZBHA 1Q5OA 4QPKA 1FD9A 2FB5A 3SJCC 3DSQA 3DGEA 2CGOA 5LHHA 2X6CA 4B3RB 2ZT9B 5KHGA 4BW9A 4H13B 3JD1A 1XQ8A 4CS4A 2ZXWC 3SPIA 3CCJV 2F93B 3L73H 1D5AA 3J7AU 2ZE6A 4LF6B 2Q0OC 1YDXA 4TT3G 4DV4O 1XNQO 2Q6AA 3D3IA 2X6AA 1AP6A 3JALA 4MTOA 2F95B 1Q81W 1SETA 1M57B 3CPWU 1XNRB 2WLJA 2UXCB 1WA8A 4IIJB 2QKCA 1ZWIC 4MTFA 2EZOA 5LMUO 3UM7A 2ADPA 3CD6V 3MD0A 2Q7HA 5FPRA 4R8CA 5LMNB 2VQEO 4GKJB 2Q9LA 1F4NA 2HKOA 2ODMA 1IBKO 1IBMO 4K3AA 3OEHG 1S3JA 4DV1O 5EZYA 1SQGA 3QF7A 3HB3B 4FIPC 3JAMN 4MTXA 3TGUH 1TGOA 3ZS8C 4WCEV 1JVMA 4JTDB 4K8ZA 4LFAB 2QM8A 5C8YB 1XOUA 4LF8O 3CE2A 3WG7C 1NR7A 1R1BA 3U0ZA 1BS3A 1NVPB 4R50A 1VQNV 2Y0PA 3CCLV 3K0GA 2UXBO 3ABKB 2WLMA 4LWSB 4QIWF 1AI6A 2JS5A 1R3JC 3ZX6A 3L71H 1HW7A 3SPCA 4DK0A 3P3PA 5KMGA 2DYSC 1SS3A 3H1HH 5IE9A 3BPZA 1Q43A 2R9RB 1EFRG 1JFFB 4O2BB 1H2SB 3F7VC 4J11A 1VQPV 5CN0A 1G4YB 3FX7A 4DK1A 3RYFB 1NI8A 2XT9A 3OUFA 1MSDA 4MT8A 4UUJC 1Q8IA 3OR7C 3CCEV 4YY3B 4JI8O 1KBHA 4N23A 3PJSK 3STLC 2Q4PA 4F6RA 1K5QA 4GX0A 4X64B 5IYCO 1XDCA 4J41A 1N33B 5IT9N 5KLVH 1MNGA 1F51A 3LDEA 3GVMA 3RBZA 1RPOA 1I0HA 1P49A 4O2AA 1N34O 1I5YA 2QEXV 1S72V 3F7YC 1O9GA 2P06A 2WLHA 4IT5A 5GONA 2WA4A 2Q0AA 3JSLA 3AG2C 4I4TB 1N36B 4FK5C 3AG7A 1WPXA 4I7ZB 4JTCB 3WFVA 4TWKA 3CP1A 3T2MA 3QO7A 2LP7A 4BWAA 1Q90D 1YXBA 3E22A 3JAKB 2ETNA 1SQFA 5FNVA 1FFTB 1EZVH 1K4CC 1VF6C 3PN1A 4LFBO 2EIMC 1W59A 2VWJA 5ITZA 1F23A 4GT1A 4TV8B 3JCZA 2BTOA 4B3RO
chains in the Genus database with same CATH topology
2UUBO 5A2QN 3RT3C 4DV7O 2UU9O 4A5UB 4JI3O 5IWAO 4DV5O 4NXMO 2UXBO 4OPAA 5BR8O 4DV0O 4JI7O 4YY3O 1FJGO 4DR5O 1DK1A 4DUZO 3SDLA 4JI6O 3F5TA 4DR1O 1YZBA 4X64O 4X62O 1G1XB 2ZKOA 1XEQA 1D2DA 2E5LO 1HR0O 1N33O 4LF4O 4JYAO 2UXCO 2DJVA 5LL6Y 1I94O 3J7AU 4OPHA 1XMOO 2UUAO 2UXDO 5LMNO 4JI8O 4GKJO 4LF6O 1AILA 5BY1A 4DV4O 4OX9O 1XNQO 3T1HO 4K0KO 1AB3A 4AQYO 4B3RO 4X66O 5H5NA 1XMQO 1NS1A 1F7YA 5IT9N 2UUCO 2ZM6O 1XNRO 4JI0O 4DV2O 4LFCO 2DOSA 3OTOO 3M8AA 4LF9O 1J5EO 5BXZA 5LMUO 4DV3O 4LF5O 4B3SO 3R66A 4B3MO 4GKKO 1N34O 1HNXO 2VQEO 4JI2O 4B3TO 1KUQA 1X59A 2N74A 2Z0AA 1A32A 2LW7A 4YHHO 2VQFO 4JI5O 2HHHO 1IBKO 1IBMO 5FLXN 4JV5O 1N36O 4DV1O 1R6TA 4DR6O 4DV6O 2JRIA 4X65O 2AGAA 3O65A 3JAMN 1HNWO 1FYJA 1N32O 4DR4O 1HNZO 2F4VO 3T1YO 2FKXA 4DR2O 4KHPO 4DR3O 4LFAO 4LF8O 4LFBO 1FKAO 4NXNO 4DUYO 4DR7O 4JI1O 4JI4O 3J81N 3J80N 1R1BA 1IBLO 4LF7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB O;  5A2Q N;  3RT3 C;  4DV7 O;  2UU9 O;  4A5U B;  4JI3 O;  5IWA O;  4DV5 O;  4NXM O;  2UXB O;  4OPA A;  5BR8 O;  4DV0 O;  4JI7 O;  4YY3 O;  1FJG O;  4DR5 O;  1DK1 A;  4DUZ O;  3SDL A;  4JI6 O;  3F5T A;  4DR1 O;  1YZB A;  4X64 O;  4X62 O;  1G1X B;  2ZKO A;  1XEQ A;  1D2D A;  2E5L O;  1HR0 O;  1N33 O;  4LF4 O;  4JYA O;  2UXC O;  2DJV A;  5LL6 Y;  1I94 O;  3J7A U;  4OPH A;  1XMO O;  2UUA O;  2UXD O;  5LMN O;  4JI8 O;  4GKJ O;  4LF6 O;  1AIL A;  5BY1 A;  4DV4 O;  4OX9 O;  1XNQ O;  3T1H O;  4K0K O;  1AB3 A;  4AQY O;  4B3R O;  4X66 O;  5H5N A;  1XMQ O;  1NS1 A;  1F7Y A;  5IT9 N;  2UUC O;  2ZM6 O;  1XNR O;  4JI0 O;  4DV2 O;  4LFC O;  2DOS A;  3OTO O;  3M8A A;  4LF9 O;  1J5E O;  5BXZ A;  5LMU O;  4DV3 O;  4LF5 O;  4B3S O;  3R66 A;  4B3M O;  4GKK O;  1N34 O;  1HNX O;  2VQE O;  4JI2 O;  4B3T O;  1KUQ A;  1X59 A;  2N74 A;  2Z0A A;  1A32 A;  2LW7 A;  4YHH O;  2VQF O;  4JI5 O;  2HHH O;  1IBK O;  1IBM O;  5FLX N;  4JV5 O;  1N36 O;  4DV1 O;  1R6T A;  4DR6 O;  4DV6 O;  2JRI A;  4X65 O;  2AGA A;  3O65 A;  3JAM N;  1HNW O;  1FYJ A;  1N32 O;  4DR4 O;  1HNZ O;  2F4V O;  3T1Y O;  2FKX A;  4DR2 O;  4KHP O;  4DR3 O;  4LFA O;  4LF8 O;  4LFB O;  1FKA O;  4NXN O;  4DUY O;  4DR7 O;  4JI1 O;  4JI4 O;  3J81 N;  3J80 N;  1R1B A;  1IBL O;  4LF7 O; 
#chains in the Genus database with same CATH topology
 2WLL B;  2HJF C;  2ZNI A;  2BE3 A;  4X88 A;  3MAQ A;  3JAW A;  3BAA A;  1OCZ B;  1H2L A;  3E86 A;  4ZI7 B;  2YXY A;  1BE3 H;  3E83 A;  1NR1 A;  3GWK C;  2XOK G;  4X1I A;  1RP3 B;  3TJT A;  1FPO A;  1K92 A;  1PKX A;  3OAA G;  3ZRS A;  4PHZ A;  2BSK A;  2YSU B;  3G80 A;  1G8M A;  3T4D A;  1JPX A;  2ZDI C;  4UCV A;  1IVS A;  2N05 A;  2UXC O;  2DJV A;  5L3G A;  4NXM B;  4LNU B;  1NVP D;  3ABT A;  1Y74 B;  2UUA B;  2Q68 A;  3RYH B;  5CA0 B;  1VAR A;  2LQT A;  3ABM B;  5LMN O;  1AR4 A;  5DN6 G;  4GKJ O;  3BA8 A;  3T1H B;  5BY1 A;  1EN4 A;  5EC2 C;  1JA8 A;  4AQY O;  4LCU C;  3SYP A;  1XMQ O;  1JCH A;  3APO A;  1ENV A;  5LP6 A;  5KHJ A;  4IHJ A;  3CJH B;  2IJH A;  2ZNJ A;  1V55 B;  1Y76 B;  4GKK B;  1SA0 A;  4WFH A;  4J7K A;  5JQG A;  3R65 A;  2WA3 A;  3LNM B;  2QSA A;  4OX9 B;  1BGY H;  4BIO A;  3ZCC A;  3JD4 A;  4JPR A;  2CTQ A;  1H2M A;  3N2K A;  2OIE A;  1K73 W;  1H8H G;  4DV6 O;  4MVM A;  3SJQ C;  1M9N A;  3H1I H;  1SER A;  1H8E G;  1OZ0 A;  3OT7 A;  3AG3 B;  5B1N A;  3N27 A;  5JH7 B;  3JAT B;  3K5N A;  4DUY B;  3RVZ A;  1DTO A;  5KX5 B;  4JI1 O;  4GZR B;  4NTY A;  2AHZ A;  3QVN A;  2WAM A;  3RGB A;  2LFR A;  5IWA B;  1VIB A;  3HKE A;  4XDK A;  4UB8 Z;  1FJG B;  4DR5 B;  4YY3 O;  3I55 V;  4JI6 B;  4DW0 A;  1MA1 A;  1OCO B;  3LUT B;  2RN9 A;  2X7R B;  3HKC A;  1MZE A;  1S5H C;  5JVD B;  1GTO A;  4PDL A;  4X62 B;  4ABM A;  4X64 O;  2QJ1 A;  1N33 O;  2E75 B;  2LGW A;  2ZR2 A;  4X20 B;  2M6Y A;  4MW8 A;  2JK5 C;  1XHX A;  1AJN A;  4G27 B;  4WBN A;  1S77 D;  3JSN A;  2EZP A;  5FPO A;  4O4J A;  5GTI Z;  5EIB C;  1VF7 A;  1Z5W A;  1PL0 A;  4D7S A;  3K59 A;  5H5N A;  4X1K B;  2P22 C;  2GSM B;  3SR2 C;  4UV9 A;  2YIA A;  2Q8V A;  4JYA B;  2OCH A;  2GHY A;  3IFX A;  1TVK A;  4GUN A;  1QCE A;  2WLI A;  4B3M B;  3D36 C;  3JD2 A;  4E4E A;  1KB9 F;  4U3J A;  1PL4 A;  1LR1 A;  1HNX B;  2YXL A;  3UO2 A;  3L70 H;  4MS2 A;  1L8D A;  4B3T O;  1KP3 A;  1AVM A;  4CC5 A;  4Z1M G;  4FLU A;  3ABL B;  4JAU A;  2EBO A;  2QR4 A;  2HHH O;  3AG1 B;  1QBZ A;  1JR9 A;  2BOC C;  2IM9 A;  5L3F A;  4RO2 A;  4H37 A;  5J2U B;  2QKS A;  3K79 A;  3CCV V;  3ZHT A;  4FLX A;  4W4K A;  3X2Q C;  4J9Y B;  3AG4 C;  4P30 A;  1M90 W;  2AZ0 A;  1K9M W;  2RNB A;  1SF9 A;  1TA8 A;  3W7U A;  3WB1 A;  1IXB A;  2A7W A;  2GUZ A;  4R6Z A;  2Q69 A;  3IC9 A;  1EZJ A;  1IBL B;  2LFS A;  4FZ0 A;  3ASN B;  1YTF D;  4HYO A;  4I0X A;  1E79 G;  3CRR A;  4JI3 B;  1RM1 B;  4ZHQ A;  2YI8 A;  3JAL B;  4NXM O;  3P30 A;  1U97 A;  3KCY A;  4FLW A;  3CCU V;  4GX2 A;  4D6T H;  1WA8 B;  3JYC A;  4DYL A;  1R6K A;  5J9P C;  1K97 A;  2KQX A;  5LXT A;  1SQB H;  2K1E A;  3JD3 A;  1Q82 W;  3FYI B;  1Z5V A;  3APQ A;  1JOY A;  3N2G A;  1VQ9 V;  2VS0 A;  4LC1 A;  1EM1 A;  1L0N H;  4DRX A;  3WB0 A;  4B7K A;  4WF9 V;  3IAY A;  1N8R W;  2YID A;  3K08 A;  5LL6 Y;  2P7T C;  1DF5 A;  4UCO A;  1XHZ A;  1K33 A;  5EZY B;  2P6J A;  3UQ8 A;  4OX9 O;  4EEQ A;  5HFL A;  1KC8 W;  4FJC C;  1KQS U;  1WAZ A;  4IGG A;  4W4L A;  1KYO F;  3UO3 A;  4JI0 O;  5LGU A;  4FLV A;  1FXK A;  1OCC B;  2YUA A;  3M8A A;  3OTO O;  2LW1 A;  2XAJ A;  3R66 A;  2OCC C;  1FXK C;  2UXD B;  4JI2 B;  5LA6 A;  4L8J A;  2N74 A;  4K0K B;  1AR1 B;  4JZ2 A;  2VQF O;  3ZRV A;  3CRM A;  3VQX A;  5KMG B;  4JV5 O;  3ETG A;  4NTW A;  1HNW B;  2CH7 A;  2M7W A;  2IW5 A;  1FYJ A;  4LF5 B;  1UPG A;  5E1A C;  4AIL C;  3CHX A;  3T1Y B;  2G38 A;  2IJI A;  1WB7 A;  3A2F A;  4JI5 B;  2ZIO A;  4FM2 A;  5A2Q N;  3P3N A;  1EN5 A;  4RQF A;  5H2F Z;  4F6R B;  4A5U B;  1XBL A;  1PNL A;  4XDJ A;  1VQL V;  2PI4 A;  2XAG A;  5BR8 O;  4QGP A;  4UCU A;  2YC0 A;  4KHP B;  4FZ1 A;  5KUK A;  4UV8 A;  2CGN A;  3F5T A;  2ZQM A;  4N21 A;  4O2A B;  3F5W C;  3A8T A;  3ZMS A;  5B66 Z;  4LF7 B;  5B1A C;  5GON B;  4LR3 A;  4CC6 A;  4JYA O;  1CPY A;  4I55 A;  1P84 F;  3VQV A;  1I94 B;  4TV9 A;  2A3Q A;  3WB2 A;  4OPH A;  3QTC A;  4GX5 A;  5IJ9 A;  1QQC A;  1UFI A;  2D3O W;  3H01 A;  1THZ A;  2RQ6 A;  2CDY A;  2P4V A;  1QLE C;  4Z1V A;  1DF4 A;  5IYZ A;  3E22 B;  5CA1 B;  1VQM V;  3I5D A;  3OEE G;  2D2C B;  3CMA V;  2DYR C;  2GV9 A;  3M7M X;  2P90 A;  3L75 H;  3MDS A;  3CCM V;  4J80 A;  5ITZ B;  2GDS A;  5L3C A;  1WJZ A;  3CXH F;  4EFB A;  4QPJ A;  4D7T A;  1NBM G;  5H9C A;  4YJ2 B;  4MW3 A;  3H1K H;  1K8A W;  3BRC A;  2P4K A;  2LW7 A;  1L0L H;  1URF A;  2YS8 A;  4X1I B;  1XI1 A;  3ETQ A;  5K1X A;  1VQ6 V;  2HVJ C;  2A79 B;  4DV2 B;  2JRI A;  4DXW A;  1R6N A;  4DR2 B;  4KXR A;  1P7G A;  3MHS C;  3ZHQ A;  4F6E A;  1NKD A;  3CX5 F;  4NXN B;  4RAI A;  3ASN C;  3AK3 A;  3ZHR A;  3HPL C;  3ZHV A;  3RT3 C;  4DV7 O;  2UU9 B;  2YEV B;  3BCC H;  1H2K A;  2HJD A;  3KZI Z;  2EIK B;  1B04 A;  1IUR A;  2ILM A;  4DV5 O;  2JIZ G;  4JZG A;  4TSF G;  5LP6 B;  1YIT V;  5F2V O;  5L3E A;  4IHJ B;  2WSS G;  3JCU Z;  4DR7 B;  1S5L Z;  1IXM A;  5B5E Z;  1SA0 B;  2LGQ A;  3FB8 C;  3EVK A;  1LUW A;  3OR6 C;  2CAZ C;  1G1X B;  5JQG B;  1IDS A;  2YIB A;  1AJQ A;  4C7U A;  1IX9 A;  2V1D A;  3HKB A;  1D5N A;  4X9Q A;  4B7E A;  2DWD C;  4PA7 A;  4DV0 B;  2UXD O;  1K5S A;  4FLY A;  3CXC U;  1AIL A;  3B8N A;  1S5J A;  4K0K O;  4PEL A;  4ZOL A;  1OV9 A;  1E1R G;  4LF4 B;  3W7T A;  1BSM A;  4JYC A;  4LFC B;  2ZIM A;  5BXZ A;  5EBL C;  5EC1 C;  1T5E A;  4LF5 O;  4JAV A;  2DQ0 A;  2YI9 A;  3HKE B;  3L74 H;  3ZRW B;  1COW G;  1A32 A;  4CH6 A;  4JI5 O;  2A06 H;  3CCR V;  5JCO C;  2Y48 A;  2K9P A;  4DR6 B;  2DE0 X;  1K3E A;  1VF5 B;  1FXH A;  2EX3 A;  1S0V A;  4OGQ B;  3ETE A;  1SRY A;  1ARO P;  1BQ0 A;  3K5O A;  2B5U A;  4YIP A;  1P4R A;  4KHP O;  2R9A A;  4WBN B;  5KAI Z;  3VBB A;  4YHH B;  5B3S B;  2OTJ V;  1PNK A;  1V54 C;  1JJ2 U;  4LF7 O;  4UFZ A;  3QG5 A;  2JJ1 G;  3IC7 A;  4E2L A;  4OPA A;  2JGD A;  1VQ5 V;  4UXN A;  1PPJ H;  1VF6 A;  5LHG A;  1TVK B;  4DR3 B;  2WLI B;  1AJP A;  1ORQ C;  2HFE C;  2R70 A;  4WFE A;  1KP2 A;  2FL4 A;  2UUB B;  3LDD A;  1XUQ A;  1EN6 A;  5IJ0 B;  4GYC B;  4R7C A;  1XIL A;  2Y69 B;  3NR7 A;  1R73 A;  3TXS A;  3CCS V;  1K4D C;  2QDO A;  5B1B C;  4P9P A;  4UVB A;  1SZX A;  4LF6 O;  4J7J A;  2CTP A;  1WLE A;  2ZDI A;  2P67 A;  2QWR B;  1HR0 B;  5KUM A;  5GW7 A;  4FFB A;  1GMG A;  2E74 B;  2GUZ B;  3K57 A;  1XNR O;  1YSC A;  4DV2 O;  3SYQ A;  3CYO A;  3EXA A;  3K9A A;  1SQV H;  4ICG A;  5CBG A;  2LJ2 A;  4I0X B;  3RYI A;  3ASO B;  5JJJ B;  2EIN B;  4ZHQ B;  1TAE A;  4I50 B;  2EJ7 A;  4FFK A;  2OTL V;  1M4U A;  1M57 C;  1S76 D;  4LH6 A;  2XUM A;  5LXT B;  5HFM A;  4BIZ A;  2UXX A;  5KHK A;  4NKG B;  3W7X A;  4X65 B;  5CB4 A;  4KP4 A;  4DV3 B;  4QE9 A;  3QO8 A;  1EBO A;  4PA3 A;  1CP9 A;  3KG2 A;  4DR4 B;  4HAM A;  2XAF A;  4NVP A;  3DXR A;  3VQW A;  1XL4 A;  1ZTE A;  3UKM A;  1N4C A;  4LFA O;  5C93 A;  4H0L B;  4DR7 O;  1YTF B;  1K7D A;  2DN9 A;  1WNS A;  4RQE A;  3JAS B;  2RDC A;  2ZR3 A;  2H8P C;  4K35 A;  4PD4 F;  5LYJ A;  3T1C A;  2OT5 A;  3BAB A;  3S3W A;  1R3K C;  4B08 A;  4YIO A;  3VOU A;  2VWK A;  1BHA A;  3K58 A;  3Q4H A;  4DV0 O;  3G6B A;  1YF2 A;  4MVQ A;  2QKA A;  1HP8 A;  3RYC B;  4U3F H;  4X1Y A;  1TUB B;  5KHH A;  3BY6 A;  1M5I A;  1F4M A;  3ZMU A;  4LF4 O;  1YJN V;  3ABK C;  1XRE A;  5KA6 A;  4HBN A;  3E8G A;  2QWQ B;  4I5S A;  4MVR A;  1KMI Z;  1GN3 A;  2RJZ A;  1NT2 B;  2KG7 A;  2Y0I A;  3D8C A;  2CH7 B;  4O2B A;  3E89 A;  4Q20 A;  3UCS C;  4LP8 A;  5TIS Z;  1V9P A;  2HG5 C;  4HZ3 A;  3E8H A;  2AXT Z;  1FS0 G;  3B77 A;  3OMI B;  5A9G A;  1GK9 A;  2XTA A;  1LNQ A;  3TET A;  1Y6X A;  2OWO A;  1ZX3 A;  4YHH O;  4P2Z A;  1G6U A;  1N36 O;  4EKW A;  1VQ7 V;  3K3W A;  3FB7 C;  4L87 A;  4OXS A;  4WFF A;  3OW2 U;  3D36 A;  5KAF Z;  1Y4M A;  3BA9 A;  3M99 B;  2QTO A;  4AI8 A;  4I55 B;  5D5P A;  2X6B A;  4DR3 O;  3K03 A;  4JI4 B;  1W0J G;  3J81 N;  3J80 N;  2UUB O;  3LNN A;  1GM8 A;  1VP7 A;  5IYZ B;  1VMG A;  2ZXW B;  4TV8 A;  1HNZ B;  2F4V B;  3OMN B;  2F66 C;  2GTS A;  3ZRX A;  3QNE A;  2WLN A;  1YEW A;  4ZBM A;  5EBM C;  1YZB A;  2R72 A;  3CRC A;  2HR3 A;  4ZI7 A;  1GN4 A;  1HR0 O;  5IYD O;  2DW4 A;  1GN6 A;  1OCZ C;  3KCX A;  5J2T A;  1Y67 A;  3DTU B;  3IJ4 A;  2KB1 A;  4NB5 A;  2UUA O;  3U11 A;  3SYA A;  4DV4 B;  5LGT A;  2BOB C;  4K8X A;  1SZT A;  3T1H O;  1PD3 A;  2JJ2 G;  2MK3 A;  4DR1 B;  2Z5U A;  3CB2 A;  1NTK H;  2E3C A;  1Q7Y W;  1PNM A;  3AEI A;  2O57 A;  2JEU A;  3ASO C;  1VQ4 V;  5LMU B;  3RN4 A;  1AR5 A;  2EIN C;  2PYL A;  4DV3 O;  5CMU A;  3ABM C;  4DO2 A;  4GKK O;  1XMO B;  2ITD C;  4YJ3 A;  3K9S A;  3NXS A;  1GH6 A;  1QR8 A;  4MVO A;  2W6J G;  4H44 B;  3CJH A;  3ML0 A;  4X66 B;  4XDL A;  1Y76 A;  2ATK C;  3WG7 B;  4GCZ A;  1M56 B;  1WP7 A;  2R9I A;  4DV1 B;  3K06 A;  3A0R A;  4JYB A;  4FM1 A;  1NQT A;  1NTM H;  1V55 C;  3RVY A;  4FPP A;  2QE7 G;  4Q6G A;  4B3S B;  4FM0 A;  3EFF K;  1MMM A;  2EIJ B;  3HKB B;  5LOV A;  3E8B A;  2QM7 A;  4J42 A;  1FKA O;  3D3Q A;  4DUY O;  2DYS B;  4O4L A;  1DGS A;  4FMT A;  2HP8 A;  1QVG U;  5JWP A;  3ZJZ A;  1YJ9 V;  2UXB B;  5IWA O;  4ZOL B;  1ROP A;  3THO A;  3AG3 C;  5KX5 A;  4PDM A;  1FJG O;  4DR5 O;  1DK1 A;  2F43 G;  3SJA C;  4JI6 O;  1N0J A;  3B2E E;  2L6L A;  4X62 O;  3RWR D;  5EBW C;  3CSX A;  4PA6 A;  3JAR A;  2NN4 A;  3FAV A;  5JVD A;  1QR9 A;  3VQY A;  1OCO C;  3BEH A;  4DUZ B;  1QU7 A;  2OIG A;  2JEX A;  1M1K W;  3SPG A;  4MVZ A;  4O4I A;  3BHP A;  3AG2 B;  1KD1 W;  5CA3 A;  1WN7 A;  3UT5 A;  2CE4 A;  3CRA A;  2BTQ A;  5BMV A;  3SYC A;  3LSS A;  3E2E A;  2AZ2 A;  1FFX A;  2QM4 A;  4B3M O;  2ARH A;  2MW2 B;  1HNX O;  1JQ0 A;  3ZMZ A;  2QWN B;  2JGD B;  2IU0 A;  2IBZ H;  2JDI G;  4GLX A;  5FL7 G;  2EIM B;  2B1I A;  1Q6U A;  5FNV B;  1ZAU A;  2PYJ A;  1BL8 A;  3CC7 V;  2P5O A;  1OHH G;  2ZE5 A;  3OMA B;  5IYB O;  1HNZ O;  5KHI A;  1WP8 A;  2F4V O;  3ABL C;  4LFB B;  3BFR A;  3JAW B;  5J2U A;  3AG1 C;  2XAH A;  1OCR B;  1QLN A;  5LHI A;  2XHB A;  1X4T A;  4TOI A;  1IBL O;  2F23 A;  5DEC A;  4FVM A;  1VQK V;  2YIC A;  4JI3 O;  4EB6 A;  2BSK B;  3L72 H;  2KKW A;  1J95 A;  2WLK A;  4BAY A;  4FFB B;  5H6Q A;  2YIB D;  1BCC H;  1YHQ V;  3WU2 Z;  1RSO A;  4JAA A;  3RYI B;  4PJ0 Z;  4DR1 O;  2QWP B;  5JJE B;  2XND G;  4ZKI A;  1D2D A;  3CRQ A;  3E35 A;  3ZN1 A;  4UCS A;  1RM1 C;  2KSD A;  2WWW A;  4O4H A;  3AK1 A;  3LSQ A;  1NH2 B;  4PA9 A;  4UB6 Z;  1L1F A;  4J7Z A;  4JF3 A;  3OGI B;  1XMO O;  3B4S A;  2BCC H;  3MHH C;  5H6R A;  5CB4 B;  4J10 A;  1GN2 A;  3RW0 A;  2B1G A;  4AQY B;  3SJB C;  2FTK A;  1IZ3 A;  3DC6 A;  1XMQ B;  4X66 O;  3DXR B;  3OE7 G;  1MAB G;  2NLJ C;  1NJI W;  1SQQ H;  1GRJ A;  1B3Q A;  3FB5 C;  2JS3 A;  1YIJ V;  4B3S O;  3FB6 C;  2DQ3 A;  1Y66 A;  3N2K B;  5LYJ B;  4JI2 O;  1X59 A;  1ZUQ A;  4RWU A;  2Z0A A;  5LBQ A;  3C90 A;  3Q4H B;  4KUM A;  1M56 C;  1DLB A;  1WB8 A;  4X1Y B;  2UUC B;  1OCC C;  4DV6 B;  3I56 V;  4LF9 B;  1J5E B;  2W0X A;  3O65 A;  4CBC A;  1HNW O;  2EIJ C;  3H1J H;  4JTA B;  3T1Y O;  4TUY A;  1VQ8 V;  4JGS A;  1ZSP A;  1O9H A;  4JI1 B;  2PTM A;  2KG7 B;  3ZHU A;  5CBH A;  5JCO A;  3OD4 A;  3HKC B;  3E8F A;  1AI4 A;  2PGG A;  3DC5 A;  1MOF A;  4PDR A;  2EIL B;  2IU3 A;  1I08 A;  1KKD A;  2Y4U A;  5EYP A;  5D5Q A;  3LDC A;  3P32 A;  3CME V;  3CEI A;  4DUZ O;  3ZN0 A;  2E76 B;  5IY5 B;  1H2G A;  3HKD A;  4FLT A;  4O4J B;  2Q7G A;  2QTS A;  3B8M A;  2Z3Y A;  4QNH B;  3IGA C;  1KEC A;  1Q6I A;  1NZ6 A;  3OFN G;  1Q3E A;  3K5L A;  1I94 O;  4X8A A;  1ZL8 A;  4JI7 B;  3CC4 V;  1Q86 W;  5E79 Z;  3G6E V;  3ZMT A;  2A9H A;  1JMK C;  4ZIB A;  3C3T A;  1I5X A;  4HNA A;  4MVU A;  4U3J B;  2E5L B;  1AP5 A;  4BW5 A;  1QVF U;  2NR5 A;  1VEW A;  2PZS A;  2YXH A;  1NTZ H;  1NH2 D;  5CA1 A;  3X2Q B;  2ZE8 A;  4B3T B;  3AG4 B;  1KUQ A;  4PA4 A;  3BVO A;  1K34 A;  2YDE A;  3G4S V;  2HHH B;  1BZK A;  2Q67 A;  3CS5 A;  4UCT A;  1R6T A;  4YJ2 A;  1BHB A;  1SES A;  1AI5 A;  2AGA A;  1TUE B;  1ZLZ A;  2QWO B;  4DW1 A;  2FKX A;  4DR2 O;  1OCR C;  5J2T B;  4X89 A;  4H33 A;  3SGI A;  3FYE B;  3ZMV A;  3ZHS A;  4NXN O;  1JX9 A;  4IIJ A;  3OGC C;  1H38 A;  4NR1 A;  2UU9 O;  3ICX A;  2IJJ A;  2DMX A;  4JYY A;  2L35 A;  3N2G B;  2RMK B;  5BZB A;  4DRX B;  1US6 A;  3FKS G;  4CZZ A;  3A0B Z;  2CUG A;  2YEV A;  4QJF B;  4BIU A;  2Q5Z A;  3SYO A;  4CS2 A;  4CS3 A;  1BT8 A;  4YJ3 B;  2ZKO A;  2ZCE A;  2EIK C;  5LGN A;  3ABU A;  4UVC A;  4MTG A;  4J9Z B;  5LP6 C;  2OYQ A;  2N04 A;  5C8Y A;  2FYU H;  1KKC A;  2OCC B;  2QGN A;  1FXK B;  3K5M A;  4NYK A;  2EUL A;  1XL6 A;  2JVD A;  5EIB D;  2RCV A;  5LA6 B;  3W7W A;  2Y4T A;  5LOV B;  2FML A;  4LWS A;  4PV1 B;  2HEP A;  3CC2 V;  2UUC O;  3JD0 A;  4JI0 B;  2LO1 A;  3OTO B;  3W7S A;  3G71 V;  4O4L B;  2CTW A;  4U7O A;  3ZED A;  4AHC A;  4LF9 O;  4LFC O;  1J5E O;  2GTA A;  1SC5 B;  4MVS A;  1JFF A;  4QE7 A;  1Q6H A;  5DED A;  3STZ C;  2VQF B;  5EK0 A;  4JV5 B;  3RYF A;  3B40 A;  1SKV A;  1E1Q G;  3GWO A;  2ZM6 B;  2Q7E A;  4DR6 O;  5IDJ A;  3KKY A;  3ZRW A;  2ITC C;  3FD9 A;  3JAR B;  1Z2G A;  2X0L A;  1PM9 A;  2EJR A;  1MZF A;  1QNM A;  3FAV B;  4KL1 A;  4NTX A;  2V7Q G;  1YVW A;  4UVA A;  5DM6 V;  2W6I G;  2Q73 A;  2EIL C;  5B1A B;  3C3S A;  1PP9 H;  4O4I B;  1OJH A;  2A0L A;  2XAS A;  1M93 A;  4TQF A;  5BR8 B;  4GX1 A;  2HLD G;  4JI7 O;  5IY5 C;  1N32 B;  3UT5 B;  2BTQ B;  2V4D A;  2DWE C;  4I4T A;  5BMV B;  3ETD A;  1FXV A;  4CH3 A;  1W0K G;  2AHY A;  1FFX B;  2NNU A;  5B3S C;  4TV9 B;  1SQX H;  5IJ9 B;  3ZIA G;  1QLE B;  2E5L O;  1R3I C;  2H3O A;  4ASU G;  2DYR B;  3JAK A;  5JJN B;  1P7B A;  1PV0 A;  3CWB H;  3T4Z A;  2WLL A;  3S3X A;  1AB3 A;  5IJ0 A;  4WFB V;  4F4L A;  4WFG A;  5L3B A;  2Y69 C;  3K04 A;  2DOS A;  4I9W A;  2PY5 A;  1HDJ A;  4IYH A;  4EB6 B;  1XNQ B;  3FFQ A;  5B1O A;  5FLX N;  1YCI A;  2JGU A;  1RSO B;  4LNU A;  5AG2 A;  1Y74 A;  5CA0 A;  3RYH A;  1W2B U;  4P9O A;  3SPH A;  4X65 O;  2PF4 E;  1AI7 A;  4I50 A;  4CH4 A;  3OUS A;  3A0H Z;  2VRZ A;  3TCU A;  4O4H B;  5GTH Z;  4DR4 O;  2VQE B;  1WPB A;  1R3L C;  2CK3 G;  4G28 B;  1JJO A;  1GO3 F;  5KA5 A;  1UJW B;  1IBK B;  1IBM B;  1U96 A;  2ZE7 A;  4DV7 B;  4BR6 A;  1YI2 V;  5L3D A;  1GM7 A;  4DV5 B;  3O9O A;  2F1M A;  3RFR A;  1RFY A;  3LSU A;  3JAS A;  3AK2 A;  3SDL A;  4MSW C;  4U7N A;  4WFA V;  4LF8 B;  3OTF A;  4TQD A;  2QA4 V;  2C2A A;  2HVK C;  1RPR A;  2H94 A;  2XAQ A;  1XEQ A;  1FAF A;  2ZIN A;  2ADQ B;  3L9D A;  4XBF A;  3TK1 A;  1QHT A;  4KFM A;  4JAS A;  5JH7 A;  3JAT A;  3RYC A;  2IH3 C;  1TUB A;  2PI5 A;  4LH7 A;  3GB7 C;  1MG1 A;  4LBE C;  1SQP H;  1YJW V;  4EFE A;  2ZD9 A;  4UCR A;  3H1L H;  2AW9 A;  5K1P A;  4TUY B;  4RUE A;  1NS1 A;  3H9V A;  1I7F A;  1CXZ B;  1F7Y A;  4I9Q A;  2PUS A;  1NU1 H;  2ZM6 O;  4Z2W A;  1B6Q A;  3HR0 A;  3K0D A;  2B9Z A;  3TXQ A;  1CEZ A;  4PI0 A;  4JI8 B;  4YXW G;  1GKF A;  3B09 A;  4X20 A;  1HWY A;  1BMF G;  2CTR A;  1MSW D;  1GAX A;  5EYP B;  3U10 A;  3G67 A;  1V54 B;  3HKD B;  2IJK A;  2W0F C;  4IL6 Z;  2GBO A;  3OM3 B;  1B06 A;  1N34 B;  1N32 O;  4X1K A;  1ZL8 B;  3EHB B;  1LUV A;  2IH1 C;  1H2N A;  1KU9 A;  4JI4 O;  1GM9 A;  5CBF A;  1VQO V;  3CCQ V;  4RUF A;  4HNA B;  4G2K A;  4CH5 A;  4PI2 A;  1N0N A;  4IYI A;  3SPJ A;  1BQZ A;  2UXN A;  4FLZ A;  5B1B B;  4PDV A;  3QO5 A;  2WPD G;  3ZBH A;  1Q5O A;  4QPK A;  1FD9 A;  2FB5 A;  3SJC C;  3DSQ A;  3DGE A;  2CGO A;  5LHH A;  2X6C A;  4B3R B;  2ZT9 B;  5KHG A;  4BW9 A;  4H13 B;  3JD1 A;  1XQ8 A;  4CS4 A;  2ZXW C;  3SPI A;  3CCJ V;  2F93 B;  3L73 H;  1D5A A;  3J7A U;  2ZE6 A;  4LF6 B;  2Q0O C;  1YDX A;  4TT3 G;  4DV4 O;  1XNQ O;  2Q6A A;  3D3I A;  2X6A A;  1AP6 A;  3JAL A;  4MTO A;  2F95 B;  1Q81 W;  1SET A;  1M57 B;  3CPW U;  1XNR B;  2WLJ A;  2UXC B;  1WA8 A;  4IIJ B;  2QKC A;  1ZWI C;  4MTF A;  2EZO A;  5LMU O;  3UM7 A;  2ADP A;  3CD6 V;  3MD0 A;  2Q7H A;  5FPR A;  4R8C A;  5LMN B;  2VQE O;  4GKJ B;  2Q9L A;  1F4N A;  2HKO A;  2ODM A;  1IBK O;  1IBM O;  4K3A A;  3OEH G;  1S3J A;  4DV1 O;  5EZY A;  1SQG A;  3QF7 A;  3HB3 B;  4FIP C;  3JAM N;  4MTX A;  3TGU H;  1TGO A;  3ZS8 C;  4WCE V;  1JVM A;  4JTD B;  4K8Z A;  4LFA B;  2QM8 A;  5C8Y B;  1XOU A;  4LF8 O;  3CE2 A;  3WG7 C;  1NR7 A;  1R1B A;  3U0Z A;  1BS3 A;  1NVP B;  4R50 A;  1VQN V;  2Y0P A;  3CCL V;  3K0G A;  2UXB O;  3ABK B;  2WLM A;  4LWS B;  4QIW F;  1AI6 A;  2JS5 A;  1R3J C;  3ZX6 A;  3L71 H;  1HW7 A;  3SPC A;  4DK0 A;  3P3P A;  5KMG A;  2DYS C;  1SS3 A;  3H1H H;  5IE9 A;  3BPZ A;  1Q43 A;  2R9R B;  1EFR G;  1JFF B;  4O2B B;  1H2S B;  3F7V C;  4J11 A;  1VQP V;  5CN0 A;  1G4Y B;  3FX7 A;  4DK1 A;  3RYF B;  1NI8 A;  2XT9 A;  3OUF A;  1MSD A;  4MT8 A;  4UUJ C;  1Q8I A;  3OR7 C;  3CCE V;  4YY3 B;  4JI8 O;  1KBH A;  4N23 A;  3PJS K;  3STL C;  2Q4P A;  4F6R A;  1K5Q A;  4GX0 A;  4X64 B;  5IYC O;  1XDC A;  4J41 A;  1N33 B;  5IT9 N;  5KLV H;  1MNG A;  1F51 A;  3LDE A;  3GVM A;  3RBZ A;  1RPO A;  1I0H A;  1P49 A;  4O2A A;  1N34 O;  1I5Y A;  2QEX V;  1S72 V;  3F7Y C;  1O9G A;  2P06 A;  2WLH A;  4IT5 A;  5GON A;  2WA4 A;  2Q0A A;  3JSL A;  3AG2 C;  4I4T B;  1N36 B;  4FK5 C;  3AG7 A;  1WPX A;  4I7Z B;  4JTC B;  3WFV A;  4TWK A;  3CP1 A;  3T2M A;  3QO7 A;  2LP7 A;  4BWA A;  1Q90 D;  1YXB A;  3E22 A;  3JAK B;  2ETN A;  1SQF A;  5FNV A;  1FFT B;  1EZV H;  1K4C C;  1VF6 C;  3PN1 A;  4LFB O;  2EIM C;  1W59 A;  2VWJ A;  5ITZ A;  1F23 A;  4GT1 A;  4TV8 B;  3JCZ A;  2BTO A;  4B3R O; 
#chains in the Genus database with same CATH homology
 2UUB O;  5A2Q N;  3RT3 C;  4DV7 O;  2UU9 O;  4A5U B;  4JI3 O;  5IWA O;  4DV5 O;  4NXM O;  2UXB O;  4OPA A;  5BR8 O;  4DV0 O;  4JI7 O;  4YY3 O;  1FJG O;  4DR5 O;  1DK1 A;  4DUZ O;  3SDL A;  4JI6 O;  3F5T A;  4DR1 O;  1YZB A;  4X64 O;  4X62 O;  1G1X B;  2ZKO A;  1XEQ A;  1D2D A;  2E5L O;  1HR0 O;  1N33 O;  4LF4 O;  4JYA O;  2UXC O;  2DJV A;  5LL6 Y;  1I94 O;  3J7A U;  4OPH A;  1XMO O;  2UUA O;  2UXD O;  5LMN O;  4JI8 O;  4GKJ O;  4LF6 O;  1AIL A;  5BY1 A;  4DV4 O;  4OX9 O;  1XNQ O;  3T1H O;  4K0K O;  1AB3 A;  4AQY O;  4B3R O;  4X66 O;  5H5N A;  1XMQ O;  1NS1 A;  1F7Y A;  5IT9 N;  2UUC O;  2ZM6 O;  1XNR O;  4JI0 O;  4DV2 O;  4LFC O;  2DOS A;  3OTO O;  3M8A A;  4LF9 O;  1J5E O;  5BXZ A;  5LMU O;  4DV3 O;  4LF5 O;  4B3S O;  3R66 A;  4B3M O;  4GKK O;  1N34 O;  1HNX O;  2VQE O;  4JI2 O;  4B3T O;  1KUQ A;  1X59 A;  2N74 A;  2Z0A A;  1A32 A;  2LW7 A;  4YHH O;  2VQF O;  4JI5 O;  2HHH O;  1IBK O;  1IBM O;  5FLX N;  4JV5 O;  1N36 O;  4DV1 O;  1R6T A;  4DR6 O;  4DV6 O;  2JRI A;  4X65 O;  2AGA A;  3O65 A;  3JAM N;  1HNW O;  1FYJ A;  1N32 O;  4DR4 O;  1HNZ O;  2F4V O;  3T1Y O;  2FKX A;  4DR2 O;  4KHP O;  4DR3 O;  4LFA O;  4LF8 O;  4LFB O;  1FKA O;  4NXN O;  4DUY O;  4DR7 O;  4JI1 O;  4JI4 O;  3J81 N;  3J80 N;  1R1B A;  1IBL O;  4LF7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...