5BXZA

H17 bat influenza ns1 rna binding domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
PNPTTIAFQVDCYLWHLKKTLSMMGEVDAPFEDRLRREQKALKGRSMTLGIDIQSATQEGYYKIKSITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Novel Bat Influenza Virus NS1 Proteins Bind Double-Stranded RNA and Antagonize Host Innate Immunity.
pubmed doi rcsb
source organism Influenza a virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10))
molecule tags Viral protein
total genus 26
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5bxzA00
2UXBO 5IWAO 4LF8O 4DR2O 4LFAO 2FKXA 4AQYO 3R66A 3J7AU 2JRIA 1F7YA 4DR5O 2HHHO 4GKJO 3T1YO 4OPHA 1IBMO 4JI1O 4B3SO 3J81N 2VQFO 2VQEO 4LFBO 4X64O 4JI6O 5BY1A 4DV2O 4LF9O 1XNQO 5A2QN 3O65A 1N33O 4DR4O 4DR6O 5LMUO 2UUBO 1XEQA 2LW7A 3SDLA 4KHPO 4JV5O 2UXDO 2UUAO 4LF6O 4LF4O 4GKKO 4JYAO 4K0KO 4NXNO 1FYJA 1IBKO 5LMNO 1HNXO 3JAMN 2ZM6O 1N34O 4A5UB 1HNZO 1A32A 4LFCO 2Z0AA 2UU9O 4JI3O 1AILA 1NS1A 4LF5O 1J5EO 4DV5O 4DV6O 1XMOO 5H5NA 4YHHO 4JI7O 1X59A 1KUQA 4DV0O 4DV3O 1IBLO 2E5LO 4X65O 4NXMO 1AB3A 3M8AA 1HNWO 3T1HO 4DV7O 5FLXN 4DR7O 3RT3C 4DV4O 4B3RO 5BXZA 2UXCO 2DJVA 3J80N 3OTOO 5LL6Y 1I94O 4JI5O 2N74A 4JI4O 4OPAA 4JI8O 1N36O 4B3TO 1XNRO 4JI2O 3F5TA 1HR0O 4B3MO 2F4VO 4OX9O 1R6TA 4DUZO 1R1BA 1DK1A 4YY3O 1G1XB 2UUCO 4X62O 4DV1O 5IT9N 4JI0O 1FKAO 5BR8O 1N32O 1D2DA 1XMQO 4X66O 1FJGO 4LF7O 1YZBA 4DR3O 2AGAA 2ZKOA 2DOSA 4DUYO 4DR1O
chains in the Genus database with same CATH superfamily
4DR2O 4J11A 3HKCB 4DR1B 1OCZC 3K03A 2UXBB 2LW1A 4XBFA 4LNUB 4LF8B 4UCOA 5HFLA 3KCYA 2YIDA 3JD0A 2AZ2A 2P67A 3ABUA 5B1NA 4GX0A 5LMNB 1FXKA 3ETQA 1VQ9V 4PA3A 3CE2A 2CGOA 2QWPB 4O4LB 1H8HG 2H94A 5FNVB 5DM6V 4JASA 4JYBA 2W0FC 1HNXO 4MTXA 1ORQC 2NR5A 1IBKB 1KD1W 3KCXA 1HNZO 4EKWA 1L1FA 4W4KA 4ZI7A 4MVQA 1BS3A 5ITZB 4IGGA 1ZLZA 3QTCA 2QM8A 2B9ZA 4GZRB 1YCIA 3K0DA 1R6NA 4X20B 4DV3O 2ZR3A 3AK1A 2ZNJA 3UCSC 1RFYA 1AB3A 3CPWU 3L72H 3O9OA 2E5LB 2GBOA 5BXZA 1HNWB 2P6JA 4N21A 3ZMSA 5KX5A 3CC7V 3SPHA 4FFBB 1GN2A 2X0LA 1I0HA 1PP9H 2JJ1G 4B3TB 2YUAA 2WLJA 4JI2B 2Y0IA 1PD3A 1Q3EA 3UO3A 3OEHG 1ZTEA 2F93B 2BSKB 3MAQA 1M90W 4U3FH 3ETGA 4HNAA 4I0XB 2AW9A 5BR8B 4DUYO 1QVFU 4ASUG 1YF2A 4IIJB 4TOIA 3F7VC 1YHQV 1JA8A 2FYUH 4Z2WA 5L3DA 3Q4HB 4X64O 1THZA 4I55A 2AZ0A 1IBMB 1G4YB 1VF5B 5A2QN 5GTIZ 1Q43A 4DRXA 3DGEA 3X2QB 3P3NA 2ZXWB 3W7WA 2PUSA 4DW0A 2GUZB 3JAMN 3LUTB 1S72V 1AJQA 2JJ2G 4ZOLA 2JEUA 2CTRA 4JTAB 2PF4E 3CJHB 3LDEA 2Z0AA 3LDDA 1J5EO 3CHXA 1JJ2U 4GUNA 2QKCA 4AI8A 1PM9A 3H9VA 2IJIA 3C3TA 4R8CA 4YY3B 5BMVA 3QF7A 4E4EA 3ZHUA 3N27A 1MA1A 1V55C 5LL6Y 1N4CA 2QSAA 4X89A 1COWG 1JX9A 3ASNC 1QLEB 1W0KG 1ZL8B 3OFNG 1BZKA 4GT1A 1K92A 2IU3A 2EIJC 3E2EA 3VQXA 2DW4A 2LO1A 1UPGA 1QQCA 4X1IB 3SPCA 2IH1C 1M5IA 3T1CA 1P7BA 3BA9A 1BCCH 5KHJA 3RGBA 4DR3O 4OGQB 4ICGA 5LP6A 1ENVA 1HDJA 4WFFA 1XOUA 3E8FA 5CA0A 3HKDB 2YIBD 3CMEV 3ABLC 3TXSA 4L8JA 1SS3A 4P30A 2EILB 3BFRA 2JEXA 1PL4A 4CS2A 2CUGA 2DYRB 4RO2A 4FM0A 3C90A 1DTOA 4LF9O 4LFBB 2BCCH 4FLXA 1T5EA 2RN9A 3E8GA 5D5QA 2QWQB 4FLVA 5KUKA 2YEVA 4Z1VA 5KLVH 3ABMB 4KHPO 4DR4B 4WFGA 3RYCA 4JYAO 1N0JA 1S76D 4EEQA 1LNQA 4IYHA 3JARB 1QBZA 4NXNB 3D3IA 3ABKB 4MW8A 2ITCC 1L8DA 3E89A 2A06H 4UV8A 3E22B 2DQ0A 4FLYA 1Z5WA 4ZHQA 4LFCO 4O2AB 4LR3A 3EVKA 1K34A 3H01A 4LF5O 4WFEA 5LOVB 4JI4B 4PDVA 3JD1A 3L9DA 5JH7A 5JJEB 4GX2A 1XDCA 2FTKA 4DV5B 1K5SA 3CSXA 3FB5C 1AI4A 1Z5VA 4DR7O 4NXMB 4DV4O 5CA1A 2PYLA 1ZWIC 2EINB 4JF3A 2WLIB 3F5WC 1VF6C 1SKVA 2A9HA 1HR0O 1WP8A 2F4VO 2HEPA 3ASOB 2AXTZ 5IYZB 5EZYA 1NBMG 4X1KA 3EXAA 4TV8A 2PY5A 2PTMA 1N32O 1ZX3A 4MVRA 2W6IG 3NR7A 3ZRWA 2Z3YA 4CH3A 4MT8A 3CP1A 1Q82W 4DR1O 1FJGB 1XNQB 2UXBO 4LF8O 1OCZB 1V9PA 4R6ZA 1AJPA 1FXKB 3T1HB 5JJJB 2BOBC 2VWJA 4D6TH 1SRYA 2RDCA 4P9OA 4BW5A 5KAIZ 4RWUA 4AQYB 3JAKA 3JYCA 4JI1O 4J42A 2VQFO 1H8EG 5TISZ 2GV9A 4PELA 4YIPA 2RJZA 4NTWA 4U7OA 1I5YA 1SESA 3GB7C 3STZC 5B1OA 2GSMB 2QDOA 1XHXA 1TVKA 3M7MX 3SDLA 3ZMUA 1VQ5V 4ZI7B 2X7RB 2QKAA 1FYJA 1IBKO 2XOKG 1OZ0A 3FYEB 1YIJV 1H2LA 2QKSA 2IM9A 2OTLV 3BVOA 2ZM6B 1QHTA 4J9ZB 3CCMV 1AP5A 3T2MA 2GTAA 2LGWA 5KX5B 2HVKC 4D7TA 3X2QC 4NYKA 2E5LO 4OX9B 4DV6B 2ZXWC 1S3JA 3LSUA 1AR1B 1HNWO 5C93A 3RT3C 1IBLB 2Q68A 3CMAV 1GKFA 2F95B 1YJWV 4I5SA 4JI0B 3CC2V 3SPGA 2WLLA 1I94O 4CS4A 3MDSA 1N36O 1BQ0A 4B3TO 4JI2O 4HNAB 1WP7A 1FXHA 4AHCA 2ADQB 1NU1H 4DUZB 4X62O 2Z5UA 2IH3C 5BR8O 1JCHA 4CZZA 1WB8A 5JCOC 2BTQA 4YJ2A 3W7XA 1YDXA 1JVMA 4JI6B 2QWOB 1NTZH 2A0LA 4I55B 3ZX6A 1GTOA 1QLEC 3LSQA 3E8HA 3G67A 4UCVA 4K0KB 4RAIA 3RW0A 1IBMO 3DC6A 4DRXB 3CRRA 3J81N 4O4JA 1K4DC 4E2LA 2KG7A 3S3XA 4LC1A 2VQEB 1O9HA 2FL4A 2CK3G 5LGTA 4UUJC 4NR1A 3SYCA 4ZOLB 5B1AB 1MABG 1SF9A 1YEWA 1VQMV 1N33B 1FS0G 1G8MA 1WLEA 1AP6A 3APQA 2EILC 4HYOA 1WPBA 1TAEA 2ETNA 1RSOA 1DGSA 4JAUA 4UCTA 2V7QG 4RQEA 1XL6A 1A32A 2HG5C 5BMVB 2LGQA 3OW2U 3ABTA 3FB6C 3L75H 4QPJA 4H44B 4J7ZA 3L70H 2B1IA 3GWOA 2P90A 3ABMC 5L3CA 3OAAG 1TUEB 1XMOB 1KP2A 5E1AC 4YXWG 2PI5A 1XQ8A 2JS5A 2WA3A 1FPOA 4UCSA 2PGGA 4CC5A 3D3QA 5GTHZ 3ABKC 2Q5ZA 4MVMA 3JALA 4X66B 1OCRB 4FLUA 2XHBA 1IXBA 3OTFA 2F43G 5FPOA 3UO2A 5JVDA 5LP6B 3JSNA 1G1XB 5CA0B 1OHHG 3K58A 3ZMZA 3TK1A 5EC2C 1IVSA 3IC7A 3T1YB 2L6LA 4TSFG 2Q7HA 3BABA 1NKDA 4LF7B 3ZHSA 1LUWA 4X88A 2FMLA 4DXWA 2CE4A 1XL4A 4X1YA 4PHZA 3ASOC 3CX5F 3G4SV 2YEVB 4LP8A 1R3LC 1Q6UA 1VIBA 3CCRV 4LFBO 3RYCB 2HR3A 1QVGU 1SQXH 5BY1A 1HP8A 4JZGA 4TUYA 5FL7G 3O65A 4DR4O 2A7WA 2JGUA 2QM4A 3OD4A 5L3EA 3SJBC 3QVNA 1NZ6A 4LH6A 3VBBA 4ZHQB 3CC4V 4QPKA 1FXKC 4NXNO 4JV5B 3AG3B 1VP7A 1N0NA 5JH7B 2KQXA 5DEDA 1SQPH 2O57A 2XT9A 5IJ0A 1M56C 4JI5B 3IGAC 4DV5O 3ZRXA 2K1EA 4HBNA 5CA1B 4NXMO 4UXNA 1UFIA 1K3EA 3M8AA 3EFFK 1NTKH 2HKOA 4NKGB 1GO3F 1YSCA 5EZYB 2F1MA 4X1KB 4TV8B 5B1BB 4B08A 4H0LB 2UXCB 1GAXA 3CWBH 4QGPA 3ZRWB 1B04A 3R65A 1LR1A 2BTOA 1BE3H 1N8RW 5GONA 1XUQA 3OGCC 5J2UA 2ZE7A 4KFMA 4BIOA 1BHAA 1OCCB 4NVPA 5IE9A 3SYAA 2OIGA 1FJGO 3RVYA 2X6CA 3JAKB 4W4LA 3G71V 4UB6Z 3T1HO 1PPJH 1K4CC 3OUFA 4LBEC 3TETA 2CDYA 3TJTA 3LNMB 2UUBB 4AQYO 2CGNA 1PV0A 4PA7A 5IWAB 2BE3A 5F2VO 2YC0A 1TVKB 4KUMA 3JSLA 4OPHA 2HLDG 3RYIA 2QEXV 5KHHA 1MZEA 3FAVA 2XTAA 2P22C 1QR9A 5CA3A 3RFRA 1H2MA 2JS3A 5IDJA 3CXHF 1R6KA 1AI5A 2ZM6O 2CTPA 4U7NA 4A5UB 3QO8A 5L3GA 4D7SA 1TUBA 1EBOA 4O2BA 5D5PA 3RVZA 3ZHTA 5B66Z 3SYOA 1MMMA 4DV6O 2WLLB 5B1AC 4J7JA 1IBLO 3K59A 2A3QA 4YHHB 3D36A 4H37A 4CH5A 2IBZH 5IY5B 2E75B 1BL8A 2KB1A 3JASA 2X6BA 5L3FA 1JPXA 1RPRA 2E74B 2BTQB 4MTFA 4YJ2B 4DUZO 1M4UA 3HB3B 4LFAB 3WB1A 4JZ2A 4PJ0Z 3NXSA 2Q7EA 1OJHA 2N05A 3K3WA 3RN4A 4EB6A 2VS0A 4O4HA 5LHHA 5CBFA 5JQGA 3OM3B 2OYQA 4QNHB 4O4JB 2WLMA 1OCRC 3APOA 2K9PA 2KG7B 4I4TA 3BY6A 5A9GA 4MVUA 1F7YA 2HHHO 2V4DA 5LP6C 2YDEA 4O4IA 4FZ1A 2ATKC 4MTOA 1ZUQA 1H2GA 2VQEO 1YITV 4GKJB 1TA8A 5FPRA 4YJ3A 1RPOA 5LBQA 4MVOA 4PI2A 1N33O 3K5OA 1RSOB 2HFEC 3ZMVA 1K8AW 4F4LA 1U97A 3DXRA 3SGIA 2JGDA 4GKKO 4JAVA 3BRCA 1H2NA 4JI7B 2A79B 2UUAB 1Y66A 5CBHA 4Z1MG 1OV9A 4I9WA 4B3RB 3OTOB 1RM1C 1XMOO 4KXRA 5H5NA 3U11A 3OUSA 1YI2V 3JALB 2EJ7A 2UXNA 4MW3A 3WU2Z 3MD0A 1QNMA 5JVDB 5IYCO 3AG3C 4KL1A 5EIBC 4B7KA 3SJAC 3ZHVA 2XASA 4K3AA 3B09A 4MVSA 3H1JH 2MW2B 5KHIA 4UVCA 4OPAA 3A0HZ 1IDSA 1BMFG 3M99B 2P06A 1R1BA 4FFKA 3LNNA 4DR2B 3H1IH 1SETA 3FD9A 1M9NA 3IJ4A 1VARA 4DV1O 4QE7A 3T4ZA 4X1YB 2EBOA 4LF7O 4TV9A 5EK0A 1Q8IA 5B1BC 4JYCA 1NJIW 4IHJA 2G38A 1SQBH 4TUYB 2EX3A 3SJCC 3K5NA 3U0ZA 4JYYA 1HWYA 1W59A 3JD3A 3CCEV 2V1DA 1V54C 3E8BA 5DECA 1IX9A 1OCCC 4WF9V 1WAZA 2ILMA 1D5NA 3BPZA 1XREA 1HNZB 1I5XA 2EIKC 2R72A 4NB5A 2LW7A 2P4KA 2ZNIA 4JV5O 5KA6A 3B40A 5LMUB 2ZD9A 2YSUB 4N23A 4FJCC 5IJ0B 3G6BA 3QO7A 1AR4A 2DWDC 1SERA 5LMNO 1BSMA 2H8PC 4J9YB 5KHKA 1VEWA 1WNSA 3K0GA 1M56B 1K7DA 1Q6IA 1NQTA 4GYCB 3UKMA 2DMXA 5IJ9A 3CCLV 1I08A 3CRAA 3OMIB 2R9IA 2HJFC 2R9RB 4FK5C 2UXCO 1WN7A 3J80N 1R3KC 5GONB 2E76B 2Q0OC 5J2UB 2LQTA 3JCUZ 4I7ZB 2ZDIA 3RWRD 2PZSA 4YIOA 4DUYB 1R3JC 3WB2A 2ZE8A 3AG2C 3KG2A 1WB7A 3WFVA 4PDMA 1XNRB 2HP8A 4R7CA 2CAZC 3FFQA 3W7SA 5L3BA 4QE9A 3B8NA 4R50A 3STLC 4CC6A 4LCUC 2W6JG 5B3SB 3E35A 4PV1B 5IY5C 4X64B 1AJNA 5JWPA 3OR7C 1Q81W 3LSSA 4WFHA 1F4NA 2Q73A 1YJNV 3RYIB 5IWAO 3THOA 3W7TA 3FAVB 1K97A 2D2CB 3N2KA 5CBGA 2M7WA 4JPRA 3ZJZA 4PA4A 1VMGA 1SQFA 2XNDG 4DR5B 2F66C 5H6QA 4B3SB 1K5QA 1KC8W 4XDLA 1B06A 5C8YA 1FFXA 2N04A 4DR6B 3OR6C 1TUBB 4O2BB 5KMGA 2UXDB 1FFTB 1X4TA 3WB0A 4X9QA 1S5LZ 1G6UA 1GN4A 4FM1A 2QTOA 3TGUH 1ZAUA 3I55V 3CCQV 4FLZA 2YICA 5LYJA 2Q0AA 4PDRA 2HVJC 2YI8A 2UU9B 2ITDC 4YHHO 5LXTA 3JASB 1F4MA 2WWWA 2LJ2A 1Q90D 1GH6A 3D8CA 2DJVA 2YS8A 5KHGA 3ZRSA 1B3QA 5KUMA 2N74A 4QJFB 4Q20A 1KP3A 1DF4A 1S5JA 4EB6B 4O4HB 5JQGB 4YY3O 3CRQA 3RYHA 1MNGA 4EFBA 3K9AA 4B3MB 2YXHA 1XILA 3MHHC 4I4TB 4EFEA 1SA0A 2ZR2A 4DW1A 4UVBA 3WG7B 3U10A 4U3JA 3CCJV 1YZBA 2XAJA 2AGAA 4O4IB 4I9QA 3RYFA 3SJQC 4YJ3B 4F6EA 2IW5A 4UCRA 2Y4UA 3J7AU 3P32A 3OT7A 1AROP 2ZE6A 4GKJO 4JYAB 4TQFA 4DYLA 3DXRB 2DWEC 3DC5A 2JGDB 1MSDA 2XAGA 2EZPA 4FZ0A 4TT3G 3AG1C 3ICXA 1PNKA 4LFCB 3JATA 2RMKB 3JAWA 1XHZA 2UUAO 3ETEA 3CRCA 3FX7A 4RQFA 5EIBD 5H9CA 5BZBA 3OEEG 3IAYA 1JOYA 3TXQA 5LGUA 4IYIA 4UVAA 2RQ6A 1RM1B 1Y67A 3SPJA 1NH2D 1Q7YW 4MTGA 3K04A 5CB4A 3HR0A 3QG5A 3TCUA 2L35A 5GW7A 1QU7A 2D3OW 4GX1A 5FLXN 4WFBV 2Q6AA 2C2AA 2E3CA 3HPLC 4X65B 1S77D 1SZXA 4H33A 1E79G 1F51A 3UM7A 1U96A 5KAFZ 4JI4O 1DF5A 3F5TA 4NTXA 1GM7A 4FPPA 4TV9B 1URFA 4PDLA 1S5HC 1VQOV 1EN6A 1NH2B 3MHSC 2P5OA 1KBHA 1ROPA 1SQGA 2QM7A 4PI0A 5J2TA 4IHJB 3BA8A 2P4VA 4JI1B 2VQFB 2ZKOA 4G27B 1P7GA 4UFZA 2GTSA 1YTFB 3ZRVA 4LWSA 4ZKIA 3HKBA 1BT8A 2WPDG 4ZIBA 2Q67A 2JRIA 2R9AA 4FLWA 1OCOB 2YI9A 1KMIZ 1K33A 1V54B 1VF7A 1W2BU 5B3SC 1M57B 1XNQO 2EULA 2RCVA 1VQ6V 2EIKB 5LMUO 4CBCA 5J9PC 1US6A 2LP7A 3K57A 4PA6A 2EIMB 3RBZA 2PI4A 1O9GA 4LF4B 2ZIMA 3ML0A 3UT5A 4LF6B 4BR6A 3ZN1A 5IJ9B 3L74H 3A2FA 4TWKA 2ADPA 4JGSA 4CH6A 1I94B 1NS1A 4I50A 3UQ8A 1N36B 4NTYA 1JFFA 3BAAA 4JI3B 1Y76A 1QR8A 5EC1C 1EM1A 1I7FA 1NTMH 4DV0B 2MK3A 4X62B 1EN5A 1FXVA 3GWKC 2CTWA 3DSQA 3HKEA 2OIEA 1J95A 4L87A 1Q5OA 5JJNB 3T4DA 3D36C 5LA6A 1XNRO 1EFRG 3AG2B 3E83A 2AHZA 1RP3B 4OX9O 1R6TA 4P9PA 1WA8A 4AILC 4BWAA 1GRJA 1EN4A 2CH7A 3C3SA 4BIUA 2FB5A 5EBMC 4JI0O 1SZTA 1DLBA 2UUCB 2JIZG 1JMKC 2IJHA 3N2KB 4KP4A 3ZBHA 1VQNV 1L0LH 3H1HH 1XMQB 1WJZA 3FB7C 2FKXA 3L73H 2Y69B 3R66A 2OTJV 4K8ZA 1IXMA 4DR5O 2Q69A 4J10A 2Y48A 3CEIA 3JCZA 2QGNA 4RUFA 5EBWC 5C8YB 1FFXB 4B3SO 2JDIG 3AK3A 1NI8A 2QE7G 5EBLC 4JI6O 5KMGB 3WG7C 3ZHRA 2QWNB 3N2GA 4DR6O 1KKDA 3IC9A 3QNEA 4DV2B 3SR2C 4WBNA 1Y74A 3K9SA 2Y0PA 2UXDO 3I56V 4K0KO 2BOCC 1H2KA 3VQYA 3BEHA 5LYJB 1KQSU 5LXTB 1BHBA 3FKSG 2Q4PA 3JD2A 2WLNA 2ZQMA 2UU9O 2Q9LA 1N34B 1AILA 2XAQA 1X59A 3KZIZ 5H6RA 4BW9A 1VQKV 2QA4V 2DE0X 4XDKA 1GMGA 1SQVH 4DO2A 3KKYA 3RYHB 4OXSA 4DV7B 4JTDB 1SA0B 4UB8Z 1KYOF 2Q8VA 2OCHA 4U3JB 3ZCCA 4B3MO 2IU0A 4JI8B 4CS3A 5LHIA 1Z2GA 3A0BZ 3RYFB 3K5MA 2WA4A 2B1GA 2OCCB 4RUEA 1VQ8V 1E1RG 5IYDO 1GN3A 2NNUA 1GM9A 1BGYH 2DYSB 4X66O 1NR7A 3ZN0A 3AG4B 1VQLV 3JD4A 1EZJA 2DOSA 1CP9A 1M1KW 1SQQH 1H2SB 3AEIA 3H1LH 2QTSA 5EYPA 4HAMA 2M6YA 2ZCEA 4F6RA 2YIAA 2X6AA 3T1YO 3JATB 2ARHA 3B2EE 3VQVA 3JAWB 2EJRA 3PJSK 1YJ9V 3HKCA 3BCCH 2KKWA 3OGIB 4LNUA 2XAHA 3AG1B 4QIWF 4IL6Z 3CB2A 3H1KH 4MVZA 2QJ1A 2ZT9B 2P7TC 2LFRA 4PA9A 3ZHQA 2H3OA 2ZIOA 1GK9A 3AG7A 1OCOC 1ZSPA 5CB4B 5HFMA 1MSWD 3P30A 1HNXB 3L71H 2HJDA 1PNMA 1M57C 4O4LA 5FNVA 2OWOA 4G2KA 4DK0A 1S0VA 1BQZA 2IJKA 5CN0A 2EIMC 3P3PA 4X65O 1Q6HA 4TQDA 1W0JG 4FM2A 2ODMA 4FLTA 1NR1A 1VF6A 4DV3B 3OMAB 5ITZA 1CEZA 2F23A 3CS5A 3CYOA 4K35A 4JI5O 3PN1A 4X20A 5J2TB 3CD6V 1D5AA 1JQ0A 2AHYA 2UXXA 3SYPA 1AI6A 4C7UA 1NVPD 2ZDIC 4LWSB 4FFBA 1CXZB 3HKBB 1GM8A 1EZVH 2VRZA 1Y4MA 3CRMA 2RNBA 5AG2A 4H13B 4MS2A 3K06A 2BSKA 2DN9A 4WCEV 4I0XA 4ABMA 1JR9A 3A8TA 4J41A 1IURA 4JAAA 1NVPB 1M93A 1R73A 5CMUA 1VQ4V 2B5UA 3CCVV 3IFXA 3B8MA 1R3IC 3ZMTA 4IIJA 3UT5B 1FAFA 1L0NH 2NN4A 2UUBO 3ZS8C 2EZOA 1XEQA 5DN6G 4LF6O 4LF4O 3Q4HA 1KKCA 4GLXA 1E1QG 4LH7A 2Y69C 4G28B 3SYQA 1QLNA 1QCEA 4I50B 3G80A 2R70A 4X8AA 1XI1A 2XUMA 1JFFB 5KA5A 1Y76B 2Q7GA 2DQ3A 4JTCB 2WAMA 1PKXA 1XBLA 3DTUB 4JI3O 1MG1A 1UJWB 1Y6XA 3E86A 2GUZA 4IT5A 3S3WA 4HZ3A 3HKEB 3K08A 4DV0O 1J5EB 2Y4TA 1Q86W 5LA6B 2KSDA 3CJHA 1PL0A 3B77A 3BHPA 5B5EZ 1GN6A 2WLKA 5K1PA 1WA8B 3K79A 2ZE5A 2W0XA 3OMNB 2CH7B 1PNLA 1KECA 2GHYA 4XDJA 3F7YC 5JCOA 2NLJC 5IYBO 2UUCO 3ZEDA 1P49A 4PD4F 1H38A 2HHHB 5IT9N 1VQ7V 1P84F 4P2ZA 1XMQO 1B6QA 1ZL8A 3ZIAG 3VQWA 1F23A 3SPIA 4DR3B 2QWRB 1K9MW 3GVMA 4X1IA 4LFAO 2QR4A 3ETDA 1TGOA 1LUVA 3B4SA 2LFSA 2VWKA 3N2GB 4GKKB 3CXCU 4FMTA 4GCZA 4WBNB 1Y74B 2OCCC 2DYRC 3EHBB 3HKDA 1NT2B 1CPYA 2DYSC 4DV2O 2JK5C 1P4RA 3I5DA 3AG4C 1HW7A 2YXLA 4LF9B 3AK2A 2PYJA 1SC5B 1FD9A 1MOFA 3VOUA 2IJJA 1MZFA 1JJOA 1KB9F 4KHPB 4B7EA 1AI7A 4MSWC 1WPXA 1V55B 2GDSA 4WFAV 1KU9A 3CCUV 1N34O 3FYIB 1K73W 2YIBA 2OT5A 3FB8C 3ASNB 1YVWA 3JARA 4GX5A 5H2FZ 3K5LA 2WLHA 4JI7O 5E79Z 1AR5A 2EIJB 1KUQA 4LF5B 3OE7G 2YXYA 3E22A 4ZBMA 4O2AA 4J80A 4DV7O 4J7KA 4K8XA 4FVMA 4B3RO 2CTQA 2WSSG 4DV1B 5LOVA 4BIZA 1VQPV 2JVDA 3OTOO 4CH4A 4DR7B 3A0RA 4DV4B 3ABLB 4FIPC 4JI8O 3W7UA 2EINC 4DK1A 2XAFA 3QO5A 5K1XA 4Q6GA 1IZ3A 4UCUA 1DK1A 1HR0B 2F4VB 2ZINA 5EYPB 3LDCA 1FKAO 2WLIA 1D2DA 4BAYA 1YXBA 5LGNA 4F6RB 4UV9A 5LHGA 1N32B 1AVMA 3G6EV 5IYZA 1YTFD 3CCSV
chains in the Genus database with same CATH topology
2UXBO 5IWAO 4LF8O 4DR2O 4LFAO 2FKXA 4AQYO 3R66A 3J7AU 2JRIA 1F7YA 4DR5O 2HHHO 4GKJO 3T1YO 4OPHA 1IBMO 4JI1O 4B3SO 3J81N 2VQFO 2VQEO 4LFBO 4X64O 4JI6O 5BY1A 4DV2O 4LF9O 1XNQO 5A2QN 3O65A 1N33O 4DR4O 4DR6O 5LMUO 2UUBO 1XEQA 2LW7A 3SDLA 4KHPO 4JV5O 2UXDO 2UUAO 4LF6O 4LF4O 4GKKO 4JYAO 4K0KO 4NXNO 1FYJA 1IBKO 5LMNO 1HNXO 3JAMN 2ZM6O 1N34O 4A5UB 1HNZO 1A32A 4LFCO 2Z0AA 2UU9O 4JI3O 1AILA 1NS1A 4LF5O 1J5EO 4DV5O 4DV6O 1XMOO 5H5NA 4YHHO 4JI7O 1X59A 1KUQA 4DV0O 4DV3O 1IBLO 2E5LO 4X65O 4NXMO 1AB3A 3M8AA 1HNWO 3T1HO 4DV7O 5FLXN 4DR7O 3RT3C 4DV4O 4B3RO 5BXZA 2UXCO 2DJVA 3J80N 3OTOO 5LL6Y 1I94O 4JI5O 2N74A 4JI4O 4OPAA 4JI8O 1N36O 4B3TO 1XNRO 4JI2O 3F5TA 1HR0O 4B3MO 2F4VO 4OX9O 1R6TA 4DUZO 1R1BA 1DK1A 4YY3O 1G1XB 2UUCO 4X62O 4DV1O 5IT9N 4JI0O 1FKAO 5BR8O 1N32O 1D2DA 1XMQO 4X66O 1FJGO 4LF7O 1YZBA 4DR3O 2AGAA 2ZKOA 2DOSA 4DUYO 4DR1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB O;  5IWA O;  4LF8 O;  4DR2 O;  4LFA O;  2FKX A;  4AQY O;  3R66 A;  3J7A U;  2JRI A;  1F7Y A;  4DR5 O;  2HHH O;  4GKJ O;  3T1Y O;  4OPH A;  1IBM O;  4JI1 O;  4B3S O;  3J81 N;  2VQF O;  2VQE O;  4LFB O;  4X64 O;  4JI6 O;  5BY1 A;  4DV2 O;  4LF9 O;  1XNQ O;  5A2Q N;  3O65 A;  1N33 O;  4DR4 O;  4DR6 O;  5LMU O;  2UUB O;  1XEQ A;  2LW7 A;  3SDL A;  4KHP O;  4JV5 O;  2UXD O;  2UUA O;  4LF6 O;  4LF4 O;  4GKK O;  4JYA O;  4K0K O;  4NXN O;  1FYJ A;  1IBK O;  5LMN O;  1HNX O;  3JAM N;  2ZM6 O;  1N34 O;  4A5U B;  1HNZ O;  1A32 A;  4LFC O;  2Z0A A;  2UU9 O;  4JI3 O;  1AIL A;  1NS1 A;  4LF5 O;  1J5E O;  4DV5 O;  4DV6 O;  1XMO O;  5H5N A;  4YHH O;  4JI7 O;  1X59 A;  1KUQ A;  4DV0 O;  4DV3 O;  1IBL O;  2E5L O;  4X65 O;  4NXM O;  1AB3 A;  3M8A A;  1HNW O;  3T1H O;  4DV7 O;  5FLX N;  4DR7 O;  3RT3 C;  4DV4 O;  4B3R O;  5BXZ A;  2UXC O;  2DJV A;  3J80 N;  3OTO O;  5LL6 Y;  1I94 O;  4JI5 O;  2N74 A;  4JI4 O;  4OPA A;  4JI8 O;  1N36 O;  4B3T O;  1XNR O;  4JI2 O;  3F5T A;  1HR0 O;  4B3M O;  2F4V O;  4OX9 O;  1R6T A;  4DUZ O;  1R1B A;  1DK1 A;  4YY3 O;  1G1X B;  2UUC O;  4X62 O;  4DV1 O;  5IT9 N;  4JI0 O;  1FKA O;  5BR8 O;  1N32 O;  1D2D A;  1XMQ O;  4X66 O;  1FJG O;  4LF7 O;  1YZB A;  4DR3 O;  2AGA A;  2ZKO A;  2DOS A;  4DUY O;  4DR1 O; 
#chains in the Genus database with same CATH topology
 4DR2 O;  4J11 A;  3HKC B;  4DR1 B;  1OCZ C;  3K03 A;  2UXB B;  2LW1 A;  4XBF A;  4LNU B;  4LF8 B;  4UCO A;  5HFL A;  3KCY A;  2YID A;  3JD0 A;  2AZ2 A;  2P67 A;  3ABU A;  5B1N A;  4GX0 A;  5LMN B;  1FXK A;  3ETQ A;  1VQ9 V;  4PA3 A;  3CE2 A;  2CGO A;  2QWP B;  4O4L B;  1H8H G;  2H94 A;  5FNV B;  5DM6 V;  4JAS A;  4JYB A;  2W0F C;  1HNX O;  4MTX A;  1ORQ C;  2NR5 A;  1IBK B;  1KD1 W;  3KCX A;  1HNZ O;  4EKW A;  1L1F A;  4W4K A;  4ZI7 A;  4MVQ A;  1BS3 A;  5ITZ B;  4IGG A;  1ZLZ A;  3QTC A;  2QM8 A;  2B9Z A;  4GZR B;  1YCI A;  3K0D A;  1R6N A;  4X20 B;  4DV3 O;  2ZR3 A;  3AK1 A;  2ZNJ A;  3UCS C;  1RFY A;  1AB3 A;  3CPW U;  3L72 H;  3O9O A;  2E5L B;  2GBO A;  5BXZ A;  1HNW B;  2P6J A;  4N21 A;  3ZMS A;  5KX5 A;  3CC7 V;  3SPH A;  4FFB B;  1GN2 A;  2X0L A;  1I0H A;  1PP9 H;  2JJ1 G;  4B3T B;  2YUA A;  2WLJ A;  4JI2 B;  2Y0I A;  1PD3 A;  1Q3E A;  3UO3 A;  3OEH G;  1ZTE A;  2F93 B;  2BSK B;  3MAQ A;  1M90 W;  4U3F H;  3ETG A;  4HNA A;  4I0X B;  2AW9 A;  5BR8 B;  4DUY O;  1QVF U;  4ASU G;  1YF2 A;  4IIJ B;  4TOI A;  3F7V C;  1YHQ V;  1JA8 A;  2FYU H;  4Z2W A;  5L3D A;  3Q4H B;  4X64 O;  1THZ A;  4I55 A;  2AZ0 A;  1IBM B;  1G4Y B;  1VF5 B;  5A2Q N;  5GTI Z;  1Q43 A;  4DRX A;  3DGE A;  3X2Q B;  3P3N A;  2ZXW B;  3W7W A;  2PUS A;  4DW0 A;  2GUZ B;  3JAM N;  3LUT B;  1S72 V;  1AJQ A;  2JJ2 G;  4ZOL A;  2JEU A;  2CTR A;  4JTA B;  2PF4 E;  3CJH B;  3LDE A;  2Z0A A;  3LDD A;  1J5E O;  3CHX A;  1JJ2 U;  4GUN A;  2QKC A;  4AI8 A;  1PM9 A;  3H9V A;  2IJI A;  3C3T A;  4R8C A;  4YY3 B;  5BMV A;  3QF7 A;  4E4E A;  3ZHU A;  3N27 A;  1MA1 A;  1V55 C;  5LL6 Y;  1N4C A;  2QSA A;  4X89 A;  1COW G;  1JX9 A;  3ASN C;  1QLE B;  1W0K G;  1ZL8 B;  3OFN G;  1BZK A;  4GT1 A;  1K92 A;  2IU3 A;  2EIJ C;  3E2E A;  3VQX A;  2DW4 A;  2LO1 A;  1UPG A;  1QQC A;  4X1I B;  3SPC A;  2IH1 C;  1M5I A;  3T1C A;  1P7B A;  3BA9 A;  1BCC H;  5KHJ A;  3RGB A;  4DR3 O;  4OGQ B;  4ICG A;  5LP6 A;  1ENV A;  1HDJ A;  4WFF A;  1XOU A;  3E8F A;  5CA0 A;  3HKD B;  2YIB D;  3CME V;  3ABL C;  3TXS A;  4L8J A;  1SS3 A;  4P30 A;  2EIL B;  3BFR A;  2JEX A;  1PL4 A;  4CS2 A;  2CUG A;  2DYR B;  4RO2 A;  4FM0 A;  3C90 A;  1DTO A;  4LF9 O;  4LFB B;  2BCC H;  4FLX A;  1T5E A;  2RN9 A;  3E8G A;  5D5Q A;  2QWQ B;  4FLV A;  5KUK A;  2YEV A;  4Z1V A;  5KLV H;  3ABM B;  4KHP O;  4DR4 B;  4WFG A;  3RYC A;  4JYA O;  1N0J A;  1S76 D;  4EEQ A;  1LNQ A;  4IYH A;  3JAR B;  1QBZ A;  4NXN B;  3D3I A;  3ABK B;  4MW8 A;  2ITC C;  1L8D A;  3E89 A;  2A06 H;  4UV8 A;  3E22 B;  2DQ0 A;  4FLY A;  1Z5W A;  4ZHQ A;  4LFC O;  4O2A B;  4LR3 A;  3EVK A;  1K34 A;  3H01 A;  4LF5 O;  4WFE A;  5LOV B;  4JI4 B;  4PDV A;  3JD1 A;  3L9D A;  5JH7 A;  5JJE B;  4GX2 A;  1XDC A;  2FTK A;  4DV5 B;  1K5S A;  3CSX A;  3FB5 C;  1AI4 A;  1Z5V A;  4DR7 O;  4NXM B;  4DV4 O;  5CA1 A;  2PYL A;  1ZWI C;  2EIN B;  4JF3 A;  2WLI B;  3F5W C;  1VF6 C;  1SKV A;  2A9H A;  1HR0 O;  1WP8 A;  2F4V O;  2HEP A;  3ASO B;  2AXT Z;  5IYZ B;  5EZY A;  1NBM G;  4X1K A;  3EXA A;  4TV8 A;  2PY5 A;  2PTM A;  1N32 O;  1ZX3 A;  4MVR A;  2W6I G;  3NR7 A;  3ZRW A;  2Z3Y A;  4CH3 A;  4MT8 A;  3CP1 A;  1Q82 W;  4DR1 O;  1FJG B;  1XNQ B;  2UXB O;  4LF8 O;  1OCZ B;  1V9P A;  4R6Z A;  1AJP A;  1FXK B;  3T1H B;  5JJJ B;  2BOB C;  2VWJ A;  4D6T H;  1SRY A;  2RDC A;  4P9O A;  4BW5 A;  5KAI Z;  4RWU A;  4AQY B;  3JAK A;  3JYC A;  4JI1 O;  4J42 A;  2VQF O;  1H8E G;  5TIS Z;  2GV9 A;  4PEL A;  4YIP A;  2RJZ A;  4NTW A;  4U7O A;  1I5Y A;  1SES A;  3GB7 C;  3STZ C;  5B1O A;  2GSM B;  2QDO A;  1XHX A;  1TVK A;  3M7M X;  3SDL A;  3ZMU A;  1VQ5 V;  4ZI7 B;  2X7R B;  2QKA A;  1FYJ A;  1IBK O;  2XOK G;  1OZ0 A;  3FYE B;  1YIJ V;  1H2L A;  2QKS A;  2IM9 A;  2OTL V;  3BVO A;  2ZM6 B;  1QHT A;  4J9Z B;  3CCM V;  1AP5 A;  3T2M A;  2GTA A;  2LGW A;  5KX5 B;  2HVK C;  4D7T A;  3X2Q C;  4NYK A;  2E5L O;  4OX9 B;  4DV6 B;  2ZXW C;  1S3J A;  3LSU A;  1AR1 B;  1HNW O;  5C93 A;  3RT3 C;  1IBL B;  2Q68 A;  3CMA V;  1GKF A;  2F95 B;  1YJW V;  4I5S A;  4JI0 B;  3CC2 V;  3SPG A;  2WLL A;  1I94 O;  4CS4 A;  3MDS A;  1N36 O;  1BQ0 A;  4B3T O;  4JI2 O;  4HNA B;  1WP7 A;  1FXH A;  4AHC A;  2ADQ B;  1NU1 H;  4DUZ B;  4X62 O;  2Z5U A;  2IH3 C;  5BR8 O;  1JCH A;  4CZZ A;  1WB8 A;  5JCO C;  2BTQ A;  4YJ2 A;  3W7X A;  1YDX A;  1JVM A;  4JI6 B;  2QWO B;  1NTZ H;  2A0L A;  4I55 B;  3ZX6 A;  1GTO A;  1QLE C;  3LSQ A;  3E8H A;  3G67 A;  4UCV A;  4K0K B;  4RAI A;  3RW0 A;  1IBM O;  3DC6 A;  4DRX B;  3CRR A;  3J81 N;  4O4J A;  1K4D C;  4E2L A;  2KG7 A;  3S3X A;  4LC1 A;  2VQE B;  1O9H A;  2FL4 A;  2CK3 G;  5LGT A;  4UUJ C;  4NR1 A;  3SYC A;  4ZOL B;  5B1A B;  1MAB G;  1SF9 A;  1YEW A;  1VQM V;  1N33 B;  1FS0 G;  1G8M A;  1WLE A;  1AP6 A;  3APQ A;  2EIL C;  4HYO A;  1WPB A;  1TAE A;  2ETN A;  1RSO A;  1DGS A;  4JAU A;  4UCT A;  2V7Q G;  4RQE A;  1XL6 A;  1A32 A;  2HG5 C;  5BMV B;  2LGQ A;  3OW2 U;  3ABT A;  3FB6 C;  3L75 H;  4QPJ A;  4H44 B;  4J7Z A;  3L70 H;  2B1I A;  3GWO A;  2P90 A;  3ABM C;  5L3C A;  3OAA G;  1TUE B;  1XMO B;  1KP2 A;  5E1A C;  4YXW G;  2PI5 A;  1XQ8 A;  2JS5 A;  2WA3 A;  1FPO A;  4UCS A;  2PGG A;  4CC5 A;  3D3Q A;  5GTH Z;  3ABK C;  2Q5Z A;  4MVM A;  3JAL A;  4X66 B;  1OCR B;  4FLU A;  2XHB A;  1IXB A;  3OTF A;  2F43 G;  5FPO A;  3UO2 A;  5JVD A;  5LP6 B;  3JSN A;  1G1X B;  5CA0 B;  1OHH G;  3K58 A;  3ZMZ A;  3TK1 A;  5EC2 C;  1IVS A;  3IC7 A;  3T1Y B;  2L6L A;  4TSF G;  2Q7H A;  3BAB A;  1NKD A;  4LF7 B;  3ZHS A;  1LUW A;  4X88 A;  2FML A;  4DXW A;  2CE4 A;  1XL4 A;  4X1Y A;  4PHZ A;  3ASO C;  3CX5 F;  3G4S V;  2YEV B;  4LP8 A;  1R3L C;  1Q6U A;  1VIB A;  3CCR V;  4LFB O;  3RYC B;  2HR3 A;  1QVG U;  1SQX H;  5BY1 A;  1HP8 A;  4JZG A;  4TUY A;  5FL7 G;  3O65 A;  4DR4 O;  2A7W A;  2JGU A;  2QM4 A;  3OD4 A;  5L3E A;  3SJB C;  3QVN A;  1NZ6 A;  4LH6 A;  3VBB A;  4ZHQ B;  3CC4 V;  4QPK A;  1FXK C;  4NXN O;  4JV5 B;  3AG3 B;  1VP7 A;  1N0N A;  5JH7 B;  2KQX A;  5DED A;  1SQP H;  2O57 A;  2XT9 A;  5IJ0 A;  1M56 C;  4JI5 B;  3IGA C;  4DV5 O;  3ZRX A;  2K1E A;  4HBN A;  5CA1 B;  4NXM O;  4UXN A;  1UFI A;  1K3E A;  3M8A A;  3EFF K;  1NTK H;  2HKO A;  4NKG B;  1GO3 F;  1YSC A;  5EZY B;  2F1M A;  4X1K B;  4TV8 B;  5B1B B;  4B08 A;  4H0L B;  2UXC B;  1GAX A;  3CWB H;  4QGP A;  3ZRW B;  1B04 A;  3R65 A;  1LR1 A;  2BTO A;  1BE3 H;  1N8R W;  5GON A;  1XUQ A;  3OGC C;  5J2U A;  2ZE7 A;  4KFM A;  4BIO A;  1BHA A;  1OCC B;  4NVP A;  5IE9 A;  3SYA A;  2OIG A;  1FJG O;  3RVY A;  2X6C A;  3JAK B;  4W4L A;  3G71 V;  4UB6 Z;  3T1H O;  1PPJ H;  1K4C C;  3OUF A;  4LBE C;  3TET A;  2CDY A;  3TJT A;  3LNM B;  2UUB B;  4AQY O;  2CGN A;  1PV0 A;  4PA7 A;  5IWA B;  2BE3 A;  5F2V O;  2YC0 A;  1TVK B;  4KUM A;  3JSL A;  4OPH A;  2HLD G;  3RYI A;  2QEX V;  5KHH A;  1MZE A;  3FAV A;  2XTA A;  2P22 C;  1QR9 A;  5CA3 A;  3RFR A;  1H2M A;  2JS3 A;  5IDJ A;  3CXH F;  1R6K A;  1AI5 A;  2ZM6 O;  2CTP A;  4U7N A;  4A5U B;  3QO8 A;  5L3G A;  4D7S A;  1TUB A;  1EBO A;  4O2B A;  5D5P A;  3RVZ A;  3ZHT A;  5B66 Z;  3SYO A;  1MMM A;  4DV6 O;  2WLL B;  5B1A C;  4J7J A;  1IBL O;  3K59 A;  2A3Q A;  4YHH B;  3D36 A;  4H37 A;  4CH5 A;  2IBZ H;  5IY5 B;  2E75 B;  1BL8 A;  2KB1 A;  3JAS A;  2X6B A;  5L3F A;  1JPX A;  1RPR A;  2E74 B;  2BTQ B;  4MTF A;  4YJ2 B;  4DUZ O;  1M4U A;  3HB3 B;  4LFA B;  3WB1 A;  4JZ2 A;  4PJ0 Z;  3NXS A;  2Q7E A;  1OJH A;  2N05 A;  3K3W A;  3RN4 A;  4EB6 A;  2VS0 A;  4O4H A;  5LHH A;  5CBF A;  5JQG A;  3OM3 B;  2OYQ A;  4QNH B;  4O4J B;  2WLM A;  1OCR C;  3APO A;  2K9P A;  2KG7 B;  4I4T A;  3BY6 A;  5A9G A;  4MVU A;  1F7Y A;  2HHH O;  2V4D A;  5LP6 C;  2YDE A;  4O4I A;  4FZ1 A;  2ATK C;  4MTO A;  1ZUQ A;  1H2G A;  2VQE O;  1YIT V;  4GKJ B;  1TA8 A;  5FPR A;  4YJ3 A;  1RPO A;  5LBQ A;  4MVO A;  4PI2 A;  1N33 O;  3K5O A;  1RSO B;  2HFE C;  3ZMV A;  1K8A W;  4F4L A;  1U97 A;  3DXR A;  3SGI A;  2JGD A;  4GKK O;  4JAV A;  3BRC A;  1H2N A;  4JI7 B;  2A79 B;  2UUA B;  1Y66 A;  5CBH A;  4Z1M G;  1OV9 A;  4I9W A;  4B3R B;  3OTO B;  1RM1 C;  1XMO O;  4KXR A;  5H5N A;  3U11 A;  3OUS A;  1YI2 V;  3JAL B;  2EJ7 A;  2UXN A;  4MW3 A;  3WU2 Z;  3MD0 A;  1QNM A;  5JVD B;  5IYC O;  3AG3 C;  4KL1 A;  5EIB C;  4B7K A;  3SJA C;  3ZHV A;  2XAS A;  4K3A A;  3B09 A;  4MVS A;  3H1J H;  2MW2 B;  5KHI A;  4UVC A;  4OPA A;  3A0H Z;  1IDS A;  1BMF G;  3M99 B;  2P06 A;  1R1B A;  4FFK A;  3LNN A;  4DR2 B;  3H1I H;  1SET A;  3FD9 A;  1M9N A;  3IJ4 A;  1VAR A;  4DV1 O;  4QE7 A;  3T4Z A;  4X1Y B;  2EBO A;  4LF7 O;  4TV9 A;  5EK0 A;  1Q8I A;  5B1B C;  4JYC A;  1NJI W;  4IHJ A;  2G38 A;  1SQB H;  4TUY B;  2EX3 A;  3SJC C;  3K5N A;  3U0Z A;  4JYY A;  1HWY A;  1W59 A;  3JD3 A;  3CCE V;  2V1D A;  1V54 C;  3E8B A;  5DEC A;  1IX9 A;  1OCC C;  4WF9 V;  1WAZ A;  2ILM A;  1D5N A;  3BPZ A;  1XRE A;  1HNZ B;  1I5X A;  2EIK C;  2R72 A;  4NB5 A;  2LW7 A;  2P4K A;  2ZNI A;  4JV5 O;  5KA6 A;  3B40 A;  5LMU B;  2ZD9 A;  2YSU B;  4N23 A;  4FJC C;  5IJ0 B;  3G6B A;  3QO7 A;  1AR4 A;  2DWD C;  1SER A;  5LMN O;  1BSM A;  2H8P C;  4J9Y B;  5KHK A;  1VEW A;  1WNS A;  3K0G A;  1M56 B;  1K7D A;  1Q6I A;  1NQT A;  4GYC B;  3UKM A;  2DMX A;  5IJ9 A;  3CCL V;  1I08 A;  3CRA A;  3OMI B;  2R9I A;  2HJF C;  2R9R B;  4FK5 C;  2UXC O;  1WN7 A;  3J80 N;  1R3K C;  5GON B;  2E76 B;  2Q0O C;  5J2U B;  2LQT A;  3JCU Z;  4I7Z B;  2ZDI A;  3RWR D;  2PZS A;  4YIO A;  4DUY B;  1R3J C;  3WB2 A;  2ZE8 A;  3AG2 C;  3KG2 A;  1WB7 A;  3WFV A;  4PDM A;  1XNR B;  2HP8 A;  4R7C A;  2CAZ C;  3FFQ A;  3W7S A;  5L3B A;  4QE9 A;  3B8N A;  4R50 A;  3STL C;  4CC6 A;  4LCU C;  2W6J G;  5B3S B;  3E35 A;  4PV1 B;  5IY5 C;  4X64 B;  1AJN A;  5JWP A;  3OR7 C;  1Q81 W;  3LSS A;  4WFH A;  1F4N A;  2Q73 A;  1YJN V;  3RYI B;  5IWA O;  3THO A;  3W7T A;  3FAV B;  1K97 A;  2D2C B;  3N2K A;  5CBG A;  2M7W A;  4JPR A;  3ZJZ A;  4PA4 A;  1VMG A;  1SQF A;  2XND G;  4DR5 B;  2F66 C;  5H6Q A;  4B3S B;  1K5Q A;  1KC8 W;  4XDL A;  1B06 A;  5C8Y A;  1FFX A;  2N04 A;  4DR6 B;  3OR6 C;  1TUB B;  4O2B B;  5KMG A;  2UXD B;  1FFT B;  1X4T A;  3WB0 A;  4X9Q A;  1S5L Z;  1G6U A;  1GN4 A;  4FM1 A;  2QTO A;  3TGU H;  1ZAU A;  3I55 V;  3CCQ V;  4FLZ A;  2YIC A;  5LYJ A;  2Q0A A;  4PDR A;  2HVJ C;  2YI8 A;  2UU9 B;  2ITD C;  4YHH O;  5LXT A;  3JAS B;  1F4M A;  2WWW A;  2LJ2 A;  1Q90 D;  1GH6 A;  3D8C A;  2DJV A;  2YS8 A;  5KHG A;  3ZRS A;  1B3Q A;  5KUM A;  2N74 A;  4QJF B;  4Q20 A;  1KP3 A;  1DF4 A;  1S5J A;  4EB6 B;  4O4H B;  5JQG B;  4YY3 O;  3CRQ A;  3RYH A;  1MNG A;  4EFB A;  3K9A A;  4B3M B;  2YXH A;  1XIL A;  3MHH C;  4I4T B;  4EFE A;  1SA0 A;  2ZR2 A;  4DW1 A;  4UVB A;  3WG7 B;  3U10 A;  4U3J A;  3CCJ V;  1YZB A;  2XAJ A;  2AGA A;  4O4I B;  4I9Q A;  3RYF A;  3SJQ C;  4YJ3 B;  4F6E A;  2IW5 A;  4UCR A;  2Y4U A;  3J7A U;  3P32 A;  3OT7 A;  1ARO P;  2ZE6 A;  4GKJ O;  4JYA B;  4TQF A;  4DYL A;  3DXR B;  2DWE C;  3DC5 A;  2JGD B;  1MSD A;  2XAG A;  2EZP A;  4FZ0 A;  4TT3 G;  3AG1 C;  3ICX A;  1PNK A;  4LFC B;  3JAT A;  2RMK B;  3JAW A;  1XHZ A;  2UUA O;  3ETE A;  3CRC A;  3FX7 A;  4RQF A;  5EIB D;  5H9C A;  5BZB A;  3OEE G;  3IAY A;  1JOY A;  3TXQ A;  5LGU A;  4IYI A;  4UVA A;  2RQ6 A;  1RM1 B;  1Y67 A;  3SPJ A;  1NH2 D;  1Q7Y W;  4MTG A;  3K04 A;  5CB4 A;  3HR0 A;  3QG5 A;  3TCU A;  2L35 A;  5GW7 A;  1QU7 A;  2D3O W;  4GX1 A;  5FLX N;  4WFB V;  2Q6A A;  2C2A A;  2E3C A;  3HPL C;  4X65 B;  1S77 D;  1SZX A;  4H33 A;  1E79 G;  1F51 A;  3UM7 A;  1U96 A;  5KAF Z;  4JI4 O;  1DF5 A;  3F5T A;  4NTX A;  1GM7 A;  4FPP A;  4TV9 B;  1URF A;  4PDL A;  1S5H C;  1VQO V;  1EN6 A;  1NH2 B;  3MHS C;  2P5O A;  1KBH A;  1ROP A;  1SQG A;  2QM7 A;  4PI0 A;  5J2T A;  4IHJ B;  3BA8 A;  2P4V A;  4JI1 B;  2VQF B;  2ZKO A;  4G27 B;  1P7G A;  4UFZ A;  2GTS A;  1YTF B;  3ZRV A;  4LWS A;  4ZKI A;  3HKB A;  1BT8 A;  2WPD G;  4ZIB A;  2Q67 A;  2JRI A;  2R9A A;  4FLW A;  1OCO B;  2YI9 A;  1KMI Z;  1K33 A;  1V54 B;  1VF7 A;  1W2B U;  5B3S C;  1M57 B;  1XNQ O;  2EUL A;  2RCV A;  1VQ6 V;  2EIK B;  5LMU O;  4CBC A;  5J9P C;  1US6 A;  2LP7 A;  3K57 A;  4PA6 A;  2EIM B;  3RBZ A;  2PI4 A;  1O9G A;  4LF4 B;  2ZIM A;  3ML0 A;  3UT5 A;  4LF6 B;  4BR6 A;  3ZN1 A;  5IJ9 B;  3L74 H;  3A2F A;  4TWK A;  2ADP A;  4JGS A;  4CH6 A;  1I94 B;  1NS1 A;  4I50 A;  3UQ8 A;  1N36 B;  4NTY A;  1JFF A;  3BAA A;  4JI3 B;  1Y76 A;  1QR8 A;  5EC1 C;  1EM1 A;  1I7F A;  1NTM H;  4DV0 B;  2MK3 A;  4X62 B;  1EN5 A;  1FXV A;  3GWK C;  2CTW A;  3DSQ A;  3HKE A;  2OIE A;  1J95 A;  4L87 A;  1Q5O A;  5JJN B;  3T4D A;  3D36 C;  5LA6 A;  1XNR O;  1EFR G;  3AG2 B;  3E83 A;  2AHZ A;  1RP3 B;  4OX9 O;  1R6T A;  4P9P A;  1WA8 A;  4AIL C;  4BWA A;  1GRJ A;  1EN4 A;  2CH7 A;  3C3S A;  4BIU A;  2FB5 A;  5EBM C;  4JI0 O;  1SZT A;  1DLB A;  2UUC B;  2JIZ G;  1JMK C;  2IJH A;  3N2K B;  4KP4 A;  3ZBH A;  1VQN V;  1L0L H;  3H1H H;  1XMQ B;  1WJZ A;  3FB7 C;  2FKX A;  3L73 H;  2Y69 B;  3R66 A;  2OTJ V;  4K8Z A;  1IXM A;  4DR5 O;  2Q69 A;  4J10 A;  2Y48 A;  3CEI A;  3JCZ A;  2QGN A;  4RUF A;  5EBW C;  5C8Y B;  1FFX B;  4B3S O;  2JDI G;  3AK3 A;  1NI8 A;  2QE7 G;  5EBL C;  4JI6 O;  5KMG B;  3WG7 C;  3ZHR A;  2QWN B;  3N2G A;  4DR6 O;  1KKD A;  3IC9 A;  3QNE A;  4DV2 B;  3SR2 C;  4WBN A;  1Y74 A;  3K9S A;  2Y0P A;  2UXD O;  3I56 V;  4K0K O;  2BOC C;  1H2K A;  3VQY A;  3BEH A;  5LYJ B;  1KQS U;  5LXT B;  1BHB A;  3FKS G;  2Q4P A;  3JD2 A;  2WLN A;  2ZQM A;  2UU9 O;  2Q9L A;  1N34 B;  1AIL A;  2XAQ A;  1X59 A;  3KZI Z;  5H6R A;  4BW9 A;  1VQK V;  2QA4 V;  2DE0 X;  4XDK A;  1GMG A;  1SQV H;  4DO2 A;  3KKY A;  3RYH B;  4OXS A;  4DV7 B;  4JTD B;  1SA0 B;  4UB8 Z;  1KYO F;  2Q8V A;  2OCH A;  4U3J B;  3ZCC A;  4B3M O;  2IU0 A;  4JI8 B;  4CS3 A;  5LHI A;  1Z2G A;  3A0B Z;  3RYF B;  3K5M A;  2WA4 A;  2B1G A;  2OCC B;  4RUE A;  1VQ8 V;  1E1R G;  5IYD O;  1GN3 A;  2NNU A;  1GM9 A;  1BGY H;  2DYS B;  4X66 O;  1NR7 A;  3ZN0 A;  3AG4 B;  1VQL V;  3JD4 A;  1EZJ A;  2DOS A;  1CP9 A;  1M1K W;  1SQQ H;  1H2S B;  3AEI A;  3H1L H;  2QTS A;  5EYP A;  4HAM A;  2M6Y A;  2ZCE A;  4F6R A;  2YIA A;  2X6A A;  3T1Y O;  3JAT B;  2ARH A;  3B2E E;  3VQV A;  3JAW B;  2EJR A;  3PJS K;  1YJ9 V;  3HKC A;  3BCC H;  2KKW A;  3OGI B;  4LNU A;  2XAH A;  3AG1 B;  4QIW F;  4IL6 Z;  3CB2 A;  3H1K H;  4MVZ A;  2QJ1 A;  2ZT9 B;  2P7T C;  2LFR A;  4PA9 A;  3ZHQ A;  2H3O A;  2ZIO A;  1GK9 A;  3AG7 A;  1OCO C;  1ZSP A;  5CB4 B;  5HFM A;  1MSW D;  3P30 A;  1HNX B;  3L71 H;  2HJD A;  1PNM A;  1M57 C;  4O4L A;  5FNV A;  2OWO A;  4G2K A;  4DK0 A;  1S0V A;  1BQZ A;  2IJK A;  5CN0 A;  2EIM C;  3P3P A;  4X65 O;  1Q6H A;  4TQD A;  1W0J G;  4FM2 A;  2ODM A;  4FLT A;  1NR1 A;  1VF6 A;  4DV3 B;  3OMA B;  5ITZ A;  1CEZ A;  2F23 A;  3CS5 A;  3CYO A;  4K35 A;  4JI5 O;  3PN1 A;  4X20 A;  5J2T B;  3CD6 V;  1D5A A;  1JQ0 A;  2AHY A;  2UXX A;  3SYP A;  1AI6 A;  4C7U A;  1NVP D;  2ZDI C;  4LWS B;  4FFB A;  1CXZ B;  3HKB B;  1GM8 A;  1EZV H;  2VRZ A;  1Y4M A;  3CRM A;  2RNB A;  5AG2 A;  4H13 B;  4MS2 A;  3K06 A;  2BSK A;  2DN9 A;  4WCE V;  4I0X A;  4ABM A;  1JR9 A;  3A8T A;  4J41 A;  1IUR A;  4JAA A;  1NVP B;  1M93 A;  1R73 A;  5CMU A;  1VQ4 V;  2B5U A;  3CCV V;  3IFX A;  3B8M A;  1R3I C;  3ZMT A;  4IIJ A;  3UT5 B;  1FAF A;  1L0N H;  2NN4 A;  2UUB O;  3ZS8 C;  2EZO A;  1XEQ A;  5DN6 G;  4LF6 O;  4LF4 O;  3Q4H A;  1KKC A;  4GLX A;  1E1Q G;  4LH7 A;  2Y69 C;  4G28 B;  3SYQ A;  1QLN A;  1QCE A;  4I50 B;  3G80 A;  2R70 A;  4X8A A;  1XI1 A;  2XUM A;  1JFF B;  5KA5 A;  1Y76 B;  2Q7G A;  2DQ3 A;  4JTC B;  2WAM A;  1PKX A;  1XBL A;  3DTU B;  4JI3 O;  1MG1 A;  1UJW B;  1Y6X A;  3E86 A;  2GUZ A;  4IT5 A;  3S3W A;  4HZ3 A;  3HKE B;  3K08 A;  4DV0 O;  1J5E B;  2Y4T A;  1Q86 W;  5LA6 B;  2KSD A;  3CJH A;  1PL0 A;  3B77 A;  3BHP A;  5B5E Z;  1GN6 A;  2WLK A;  5K1P A;  1WA8 B;  3K79 A;  2ZE5 A;  2W0X A;  3OMN B;  2CH7 B;  1PNL A;  1KEC A;  2GHY A;  4XDJ A;  3F7Y C;  5JCO A;  2NLJ C;  5IYB O;  2UUC O;  3ZED A;  1P49 A;  4PD4 F;  1H38 A;  2HHH B;  5IT9 N;  1VQ7 V;  1P84 F;  4P2Z A;  1XMQ O;  1B6Q A;  1ZL8 A;  3ZIA G;  3VQW A;  1F23 A;  3SPI A;  4DR3 B;  2QWR B;  1K9M W;  3GVM A;  4X1I A;  4LFA O;  2QR4 A;  3ETD A;  1TGO A;  1LUV A;  3B4S A;  2LFS A;  2VWK A;  3N2G B;  4GKK B;  3CXC U;  4FMT A;  4GCZ A;  4WBN B;  1Y74 B;  2OCC C;  2DYR C;  3EHB B;  3HKD A;  1NT2 B;  1CPY A;  2DYS C;  4DV2 O;  2JK5 C;  1P4R A;  3I5D A;  3AG4 C;  1HW7 A;  2YXL A;  4LF9 B;  3AK2 A;  2PYJ A;  1SC5 B;  1FD9 A;  1MOF A;  3VOU A;  2IJJ A;  1MZF A;  1JJO A;  1KB9 F;  4KHP B;  4B7E A;  1AI7 A;  4MSW C;  1WPX A;  1V55 B;  2GDS A;  4WFA V;  1KU9 A;  3CCU V;  1N34 O;  3FYI B;  1K73 W;  2YIB A;  2OT5 A;  3FB8 C;  3ASN B;  1YVW A;  3JAR A;  4GX5 A;  5H2F Z;  3K5L A;  2WLH A;  4JI7 O;  5E79 Z;  1AR5 A;  2EIJ B;  1KUQ A;  4LF5 B;  3OE7 G;  2YXY A;  3E22 A;  4ZBM A;  4O2A A;  4J80 A;  4DV7 O;  4J7K A;  4K8X A;  4FVM A;  4B3R O;  2CTQ A;  2WSS G;  4DV1 B;  5LOV A;  4BIZ A;  1VQP V;  2JVD A;  3OTO O;  4CH4 A;  4DR7 B;  3A0R A;  4DV4 B;  3ABL B;  4FIP C;  4JI8 O;  3W7U A;  2EIN C;  4DK1 A;  2XAF A;  3QO5 A;  5K1X A;  4Q6G A;  1IZ3 A;  4UCU A;  1DK1 A;  1HR0 B;  2F4V B;  2ZIN A;  5EYP B;  3LDC A;  1FKA O;  2WLI A;  1D2D A;  4BAY A;  1YXB A;  5LGN A;  4F6R B;  4UV9 A;  5LHG A;  1N32 B;  1AVM A;  3G6E V;  5IYZ A;  1YTF D;  3CCS V; 
#chains in the Genus database with same CATH homology
 2UXB O;  5IWA O;  4LF8 O;  4DR2 O;  4LFA O;  2FKX A;  4AQY O;  3R66 A;  3J7A U;  2JRI A;  1F7Y A;  4DR5 O;  2HHH O;  4GKJ O;  3T1Y O;  4OPH A;  1IBM O;  4JI1 O;  4B3S O;  3J81 N;  2VQF O;  2VQE O;  4LFB O;  4X64 O;  4JI6 O;  5BY1 A;  4DV2 O;  4LF9 O;  1XNQ O;  5A2Q N;  3O65 A;  1N33 O;  4DR4 O;  4DR6 O;  5LMU O;  2UUB O;  1XEQ A;  2LW7 A;  3SDL A;  4KHP O;  4JV5 O;  2UXD O;  2UUA O;  4LF6 O;  4LF4 O;  4GKK O;  4JYA O;  4K0K O;  4NXN O;  1FYJ A;  1IBK O;  5LMN O;  1HNX O;  3JAM N;  2ZM6 O;  1N34 O;  4A5U B;  1HNZ O;  1A32 A;  4LFC O;  2Z0A A;  2UU9 O;  4JI3 O;  1AIL A;  1NS1 A;  4LF5 O;  1J5E O;  4DV5 O;  4DV6 O;  1XMO O;  5H5N A;  4YHH O;  4JI7 O;  1X59 A;  1KUQ A;  4DV0 O;  4DV3 O;  1IBL O;  2E5L O;  4X65 O;  4NXM O;  1AB3 A;  3M8A A;  1HNW O;  3T1H O;  4DV7 O;  5FLX N;  4DR7 O;  3RT3 C;  4DV4 O;  4B3R O;  5BXZ A;  2UXC O;  2DJV A;  3J80 N;  3OTO O;  5LL6 Y;  1I94 O;  4JI5 O;  2N74 A;  4JI4 O;  4OPA A;  4JI8 O;  1N36 O;  4B3T O;  1XNR O;  4JI2 O;  3F5T A;  1HR0 O;  4B3M O;  2F4V O;  4OX9 O;  1R6T A;  4DUZ O;  1R1B A;  1DK1 A;  4YY3 O;  1G1X B;  2UUC O;  4X62 O;  4DV1 O;  5IT9 N;  4JI0 O;  1FKA O;  5BR8 O;  1N32 O;  1D2D A;  1XMQ O;  4X66 O;  1FJG O;  4LF7 O;  1YZB A;  4DR3 O;  2AGA A;  2ZKO A;  2DOS A;  4DUY O;  4DR1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...