5BYCA

Crystal structure of human ribokinase in c2 spacegroup
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
318
Chain Sequence
QWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLFLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of unliganded human ribokinase in C2 spacegroup
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribokinase
total genus 115
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 2.7.1.15: Ribokinase.
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 5bycA00
3IBQA 5F0ZA 2HW1A 1VK4A 2AX3A 3KTNA 3HYOA 1RKSA 2DDWA 2I5BA 3NBVA 2QHPA 4B8SA 1ESJA 1TZ3A 4E8YA 3B1QA 4LCAA 4E8ZA 3RTGA 3RTEA 1YGJA 2AJRA 4O1GA 3RRBA 3UQEA 5COJA 2PKNA 2HLZA 4KBEA 1TZ6A 4C5KA 3DZVA 3RREA 4X8FA 3B1RA 3NM3A 4XCKA 1RKAA 3LKIA 2PKFA 3NL2A 3VASA 3RS8A 4B8RA 3UMPA 3KD6A 3NL5A 1UB0A 5BYDA 1TD2A 4EN4A 1LHPA 3NCAA 3NL6A 4LBGA 4C5MA 4LBXA 2PKMA 3RO4A 2VARA 2JGVA 2DCNA 3RQ2A 3NC9A 4K93A 3CQDA 2JG1A 4YWRA 2QCVA 2DDOA 2AA0A 2F02A 2YXUA 1YGKA 3RSQA 4KANA 4U7XA 4XF7A 3RSSA 3LHXA 2DDMA 2R3BA 3RT7A 3B1NA 4E3AA 4EUMA 1L2LA 1WYEA 4S1HA 4E8WA 3RPHA 3GO6A 1LIIA 3QA2A 4O1LA 3B1OA 1BX4A 5CM5A 5TRWA 3W4SA 4E69A 5C3YA 5C40A 3N1CA 3RT9A 4LC4A 5CGAA 2AFBA 3NL3A 3GBUA 3EWMA 3RTCA 4XDAA 1YHJA 3I3YA 3DRWA 3IE7A 3NM1A 4DC3A 1V1AA 3IQ0A 4XF6A 4DU5A 4JKSA 4K8TA 2C49A 2AJPA 3VAQA 3BF5A 3RU2A 3K5WA 3H49A 1C3QA 4KAHA 3RSGA 3PZSA 4E84A 3GO7A 4N09A 4GM6A 3RTAA 3OTXA 3K9EA 4EBUA 5C41A 2PKKA 5BYCA 2A9ZA 3RRJA 1VI9A 3RS9A 3RQ5A 4C5LA 1LIKA 4YL5A 2HQQA 1LIJA 3RM5A 1GC5A 5EY7A 5B6AA 3B1PA 1EKQA 3RQHA 3UQDA 2C4EA 2AWDA 1U2XA 3IH0A 3ZS7A 3RQ8A 1LHRA 2I6BA 4C5JA 2XTBA 1KYHA 3LJSA 4KALA 2A9YA 3NBWA 3UBOA 5BYFA 4C5NA 4JJPA 4S1IA 5CGEA 1VM7A 3IN1A 1JXIA 3MBHA 5F11A 5EYNA 4UBEA 2R3EA 3Q1YA 1EKKA 3RTBA 2JG5A 3B3LA 2Q5RA 3HPDA 4K8PA 1ESQA 3RQQA 1GQTA 3FHXA 1V1SA 4K9CA 4N08A 5TQIA 3RQ6A 3HICA 3FHYA 2F7KA 1RFVA 3IKHA 4S1MA 3MBJA 2V78A 3RRFA 1V1BA 1DGMA 2AB8A 3UMOA 4KADA 3LOOA 4K9IA 1JXHA 1RK2A 1RKDA 1TYYA 2I6AA 2ABQA 2YXTA 2FV7A 4K8KA 4S1IB 3RY7A 5C3ZA 1RFUA 3KZHA 2ABSA 3JULA 1V19A 4EOHA 2NWHA 2RBCA 5BYEA 4K8CA 3KEUA 3RU3A 1LIOA 3BGKA 1UA4A 1RFTA 3RQXA 3RTDA 3UQ6A 3QAIA 3PL2A 3H74A 4PVVA 3RSFA 3UQ9A 4JKUA 3NC2A 3RPZA 3Q92A 4WJMA
chains in the Genus database with same CATH superfamily
3IBQA 5F0ZA 2HW1A 1VK4A 2AX3A 4HV4A 3ZM5A 3KTNA 3HYOA 1J6UA 1RKSA 2DDWA 2I5BA 3NBVA 2QHPA 2WJPA 4B8SA 1ESJA 1TZ3A 4E8YA 3B1QA 4LCAA 4E8ZA 3RTGA 1FGSA 3RTEA 1YGJA 2AJRA 1EEHA 4O1GA 3RRBA 3N2AA 3UQEA 4C12A 5COJA 2GCAA 2HLZA 2PKNA 4KBEA 1TZ6A 4C5KA 3DZVA 3RREA 4X8FA 1P31A 1GQQA 3B1RA 2GC5A 3NM3A 2UUPA 1RKAA 3LKIA 2PKFA 3NL2A 4XCKA 3VASA 2Y1OA 2JFFA 3RS8A 4QF5A 4B8RA 3UMPA 3KD6A 3NL5A 3PYZA 4CVMA 1UB0A 5A5EA 1JBWA 5BYDA 1TD2A 3LK7A 4ZIYA 4EN4A 1LHPA 2Y68A 3NCAA 3NL6A 4LBGA 4LBXA 4C5MA 2PKMA 3RO4A 2VARA 2JGVA 2DCNA 3RQ2A 3NC9A 4K93A 3CQDA 2JG1A 4YWRA 2QCVA 2DDOA 2AA0A 2JFGA 2F02A 2YXUA 1YGKA 3RSQA 5CGAA 4KANA 4U7XA 4XF7A 2F00A 1E0DA 2XPCA 3RSSA 3LHXA 2DDMA 2R3BA 3RT7A 3B1NA 4E3AA 3ZL8A 4EUMA 1L2LA 1WYEA 4S1HA 4UAGA 4E8WA 3RPHA 3GO6A 1LIIA 3QA2A 2VTDA 2UAGA 1BX4A 3B1OA 4O1LA 5CM5A 5TRWA 3UMOA 3W4SA 2GCBA 3N1CA 4LC4A 3RT9A 4E69A 2AFBA 5C40A 2Y67A 3HN7A 3GBUA 2VORA 2X5OA 3EWMA 3NL3A 4XDAA 1YHJA 3RTCA 4CVLA 3I3YA 3DRWA 3IE7A 3NM1A 4DC3A 1V1AA 3IQ0A 4XF6A 4DU5A 2GC6A 4JKSA 4K8TA 2C49A 2VTEA 2AJPA 3VAQA 3BF5A 3RU2A 3K5WA 3H49A 1C3QA 4KAHA 3RSGA 3EAGA 3PZSA 4E84A 3GO7A 4N09A 5A5FA 4GM6A 3RTAA 3OTXA 1GQYA 3K9EA 3NRSA 4EBUA 5C41A 2PKKA 4BUCA 5BYCA 2A9ZA 3RRJA 1VI9A 3RS9A 1GG4A 3RQ5A 4C5LA 1LIKA 5C3YA 4YL5A 2HQQA 1LIJA 3RM5A 1GC5A 5EY7A 5B6AA 3B1PA 1EKQA 3RQHA 1W78A 3UQDA 2C4EA 2AM2A 2AWDA 1U2XA 3IH0A 1UAGA 3ZS7A 3RQ8A 1LHRA 2I6BA 4C5JA 2XTBA 1KYHA 3LJSA 4CVKA 4KALA 2A9YA 3NBWA 3UBOA 5BYFA 4C5NA 4JJPA 4S1IA 5CGEA 1P3DA 1W7KA 1VM7A 3IN1A 1JXIA 3MBHA 5F11A 2AM1A 2JFHA 5EYNA 4UBEA 2R3EA 3Q1YA 1EKKA 3RTBA 1O5ZA 2JG5A 2Q5RA 3B3LA 3HPDA 4K8PA 1ESQA 3RQQA 1GQTA 2XJAA 1V1SA 3FHXA 4K9CA 4N08A 4QDIA 5TQIA 3RQ6A 3HICA 3FHYA 2F7KA 4BUBA 1E8CA 1RFVA 3IKHA 4S1MA 3MBJA 2V78A 3RRFA 1V1BA 1DGMA 2AB8A 3UAGA 4KADA 3LOOA 4K9IA 1JXHA 1RK2A 1RKDA 1TYYA 2I6AA 2ABQA 2YXTA 2FV7A 4K8KA 4S1IB 3RY7A 2VOSA 5C3ZA 1RFUA 3HJ6A 3KZHA 2ABSA 3JULA 1V19A 2WTZA 2NWHA 2RBCA 3QCZA 4EOHA 5BYEA 4K8CA 2UUOA 2Y66A 3KEUA 3RU3A 1LIOA 3BGKA 1UA4A 1RFTA 3RQXA 3RTDA 3UQ6A 3QAIA 3PL2A 3H74A 4PVVA 3RSFA 1JBVA 4JKUA 3UQ9A 3NC2A 3RPZA 4C13A 3Q92A 3ZM6A 4WJMA
chains in the Genus database with same CATH topology
3IBQA 5F0ZA 2HW1A 1VK4A 2AX3A 3KTNA 3HYOA 1RKSA 2DDWA 2I5BA 3NBVA 2QHPA 4B8SA 1ESJA 1TZ3A 4E8YA 3B1QA 4LCAA 4E8ZA 3RTGA 3RTEA 1YGJA 2AJRA 4O1GA 3RRBA 3UQEA 5COJA 2PKNA 2HLZA 4KBEA 1TZ6A 4C5KA 3DZVA 3RREA 4X8FA 3B1RA 3NM3A 4XCKA 1RKAA 3LKIA 2PKFA 3NL2A 3VASA 3RS8A 4B8RA 3UMPA 3KD6A 3NL5A 1UB0A 5BYDA 1TD2A 4EN4A 1LHPA 3NCAA 3NL6A 4LBGA 4C5MA 4LBXA 2PKMA 3RO4A 2VARA 2JGVA 2DCNA 3RQ2A 3NC9A 4K93A 3CQDA 2JG1A 4YWRA 2QCVA 2DDOA 2AA0A 2F02A 2YXUA 1YGKA 3RSQA 4KANA 4U7XA 4XF7A 3RSSA 3LHXA 2DDMA 2R3BA 3RT7A 3B1NA 4E3AA 4EUMA 1L2LA 1WYEA 4S1HA 4E8WA 3RPHA 3GO6A 1LIIA 3QA2A 4O1LA 3B1OA 1BX4A 5CM5A 5TRWA 3W4SA 4E69A 5C3YA 5C40A 3N1CA 3RT9A 4LC4A 5CGAA 2AFBA 3NL3A 3GBUA 3EWMA 3RTCA 4XDAA 1YHJA 3I3YA 3DRWA 3IE7A 3NM1A 4DC3A 1V1AA 3IQ0A 4XF6A 4DU5A 4JKSA 4K8TA 2C49A 2AJPA 3VAQA 3BF5A 3RU2A 3K5WA 3H49A 1C3QA 4KAHA 3RSGA 3PZSA 4E84A 3GO7A 4N09A 4GM6A 3RTAA 3OTXA 3K9EA 4EBUA 5C41A 2PKKA 5BYCA 2A9ZA 3RRJA 1VI9A 3RS9A 3RQ5A 4C5LA 1LIKA 4YL5A 2HQQA 1LIJA 3RM5A 1GC5A 5EY7A 5B6AA 3B1PA 1EKQA 3RQHA 3UQDA 2C4EA 2AWDA 1U2XA 3IH0A 3ZS7A 3RQ8A 1LHRA 2I6BA 4C5JA 2XTBA 1KYHA 3LJSA 4KALA 2A9YA 3NBWA 3UBOA 5BYFA 4C5NA 4JJPA 4S1IA 5CGEA 1VM7A 3IN1A 1JXIA 3MBHA 5F11A 5EYNA 4UBEA 2R3EA 3Q1YA 1EKKA 3RTBA 2JG5A 3B3LA 2Q5RA 3HPDA 4K8PA 1ESQA 3RQQA 1GQTA 3FHXA 1V1SA 4K9CA 4N08A 5TQIA 3RQ6A 3HICA 3FHYA 2F7KA 1RFVA 3IKHA 4S1MA 3MBJA 2V78A 3RRFA 1V1BA 1DGMA 2AB8A 3UMOA 4KADA 3LOOA 4K9IA 1JXHA 1RK2A 1RKDA 1TYYA 2I6AA 2ABQA 2YXTA 2FV7A 4K8KA 4S1IB 3RY7A 5C3ZA 1RFUA 3HJ6A 3KZHA 2ABSA 3JULA 1V19A 4EOHA 2NWHA 2RBCA 5BYEA 4K8CA 3KEUA 3RU3A 1LIOA 3BGKA 1UA4A 1RFTA 3RQXA 3RTDA 3UQ6A 3QAIA 3PL2A 3H74A 4PVVA 3RSFA 3UQ9A 4JKUA 3NC2A 3RPZA 3Q92A 4WJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBQ A;  5F0Z A;  2HW1 A;  1VK4 A;  2AX3 A;  3KTN A;  3HYO A;  1RKS A;  2DDW A;  2I5B A;  3NBV A;  2QHP A;  4B8S A;  1ESJ A;  1TZ3 A;  4E8Y A;  3B1Q A;  4LCA A;  4E8Z A;  3RTG A;  3RTE A;  1YGJ A;  2AJR A;  4O1G A;  3RRB A;  3UQE A;  5COJ A;  2PKN A;  2HLZ A;  4KBE A;  1TZ6 A;  4C5K A;  3DZV A;  3RRE A;  4X8F A;  3B1R A;  3NM3 A;  4XCK A;  1RKA A;  3LKI A;  2PKF A;  3NL2 A;  3VAS A;  3RS8 A;  4B8R A;  3UMP A;  3KD6 A;  3NL5 A;  1UB0 A;  5BYD A;  1TD2 A;  4EN4 A;  1LHP A;  3NCA A;  3NL6 A;  4LBG A;  4C5M A;  4LBX A;  2PKM A;  3RO4 A;  2VAR A;  2JGV A;  2DCN A;  3RQ2 A;  3NC9 A;  4K93 A;  3CQD A;  2JG1 A;  4YWR A;  2QCV A;  2DDO A;  2AA0 A;  2F02 A;  2YXU A;  1YGK A;  3RSQ A;  4KAN A;  4U7X A;  4XF7 A;  3RSS A;  3LHX A;  2DDM A;  2R3B A;  3RT7 A;  3B1N A;  4E3A A;  4EUM A;  1L2L A;  1WYE A;  4S1H A;  4E8W A;  3RPH A;  3GO6 A;  1LII A;  3QA2 A;  4O1L A;  3B1O A;  1BX4 A;  5CM5 A;  5TRW A;  3W4S A;  4E69 A;  5C3Y A;  5C40 A;  3N1C A;  3RT9 A;  4LC4 A;  5CGA A;  2AFB A;  3NL3 A;  3GBU A;  3EWM A;  3RTC A;  4XDA A;  1YHJ A;  3I3Y A;  3DRW A;  3IE7 A;  3NM1 A;  4DC3 A;  1V1A A;  3IQ0 A;  4XF6 A;  4DU5 A;  4JKS A;  4K8T A;  2C49 A;  2AJP A;  3VAQ A;  3BF5 A;  3RU2 A;  3K5W A;  3H49 A;  1C3Q A;  4KAH A;  3RSG A;  3PZS A;  4E84 A;  3GO7 A;  4N09 A;  4GM6 A;  3RTA A;  3OTX A;  3K9E A;  4EBU A;  5C41 A;  2PKK A;  5BYC A;  2A9Z A;  3RRJ A;  1VI9 A;  3RS9 A;  3RQ5 A;  4C5L A;  1LIK A;  4YL5 A;  2HQQ A;  1LIJ A;  3RM5 A;  1GC5 A;  5EY7 A;  5B6A A;  3B1P A;  1EKQ A;  3RQH A;  3UQD A;  2C4E A;  2AWD A;  1U2X A;  3IH0 A;  3ZS7 A;  3RQ8 A;  1LHR A;  2I6B A;  4C5J A;  2XTB A;  1KYH A;  3LJS A;  4KAL A;  2A9Y A;  3NBW A;  3UBO A;  5BYF A;  4C5N A;  4JJP A;  4S1I A;  5CGE A;  1VM7 A;  3IN1 A;  1JXI A;  3MBH A;  5F11 A;  5EYN A;  4UBE A;  2R3E A;  3Q1Y A;  1EKK A;  3RTB A;  2JG5 A;  3B3L A;  2Q5R A;  3HPD A;  4K8P A;  1ESQ A;  3RQQ A;  1GQT A;  3FHX A;  1V1S A;  4K9C A;  4N08 A;  5TQI A;  3RQ6 A;  3HIC A;  3FHY A;  2F7K A;  1RFV A;  3IKH A;  4S1M A;  3MBJ A;  2V78 A;  3RRF A;  1V1B A;  1DGM A;  2AB8 A;  3UMO A;  4KAD A;  3LOO A;  4K9I A;  1JXH A;  1RK2 A;  1RKD A;  1TYY A;  2I6A A;  2ABQ A;  2YXT A;  2FV7 A;  4K8K A;  4S1I B;  3RY7 A;  5C3Z A;  1RFU A;  3KZH A;  2ABS A;  3JUL A;  1V19 A;  4EOH A;  2NWH A;  2RBC A;  5BYE A;  4K8C A;  3KEU A;  3RU3 A;  1LIO A;  3BGK A;  1UA4 A;  1RFT A;  3RQX A;  3RTD A;  3UQ6 A;  3QAI A;  3PL2 A;  3H74 A;  4PVV A;  3RSF A;  3UQ9 A;  4JKU A;  3NC2 A;  3RPZ A;  3Q92 A;  4WJM A; 
#chains in the Genus database with same CATH topology
 3IBQ A;  5F0Z A;  2HW1 A;  1VK4 A;  2AX3 A;  4HV4 A;  3ZM5 A;  3KTN A;  3HYO A;  1J6U A;  1RKS A;  2DDW A;  2I5B A;  3NBV A;  2QHP A;  2WJP A;  4B8S A;  1ESJ A;  1TZ3 A;  4E8Y A;  3B1Q A;  4LCA A;  4E8Z A;  3RTG A;  1FGS A;  3RTE A;  1YGJ A;  2AJR A;  1EEH A;  4O1G A;  3RRB A;  3N2A A;  3UQE A;  4C12 A;  5COJ A;  2GCA A;  2HLZ A;  2PKN A;  4KBE A;  1TZ6 A;  4C5K A;  3DZV A;  3RRE A;  4X8F A;  1P31 A;  1GQQ A;  3B1R A;  2GC5 A;  3NM3 A;  2UUP A;  1RKA A;  3LKI A;  2PKF A;  3NL2 A;  4XCK A;  3VAS A;  2Y1O A;  2JFF A;  3RS8 A;  4QF5 A;  4B8R A;  3UMP A;  3KD6 A;  3NL5 A;  3PYZ A;  4CVM A;  1UB0 A;  5A5E A;  1JBW A;  5BYD A;  1TD2 A;  3LK7 A;  4ZIY A;  4EN4 A;  1LHP A;  2Y68 A;  3NCA A;  3NL6 A;  4LBG A;  4LBX A;  4C5M A;  2PKM A;  3RO4 A;  2VAR A;  2JGV A;  2DCN A;  3RQ2 A;  3NC9 A;  4K93 A;  3CQD A;  2JG1 A;  4YWR A;  2QCV A;  2DDO A;  2AA0 A;  2JFG A;  2F02 A;  2YXU A;  1YGK A;  3RSQ A;  5CGA A;  4KAN A;  4U7X A;  4XF7 A;  2F00 A;  1E0D A;  2XPC A;  3RSS A;  3LHX A;  2DDM A;  2R3B A;  3RT7 A;  3B1N A;  4E3A A;  3ZL8 A;  4EUM A;  1L2L A;  1WYE A;  4S1H A;  4UAG A;  4E8W A;  3RPH A;  3GO6 A;  1LII A;  3QA2 A;  2VTD A;  2UAG A;  1BX4 A;  3B1O A;  4O1L A;  5CM5 A;  5TRW A;  3UMO A;  3W4S A;  2GCB A;  3N1C A;  4LC4 A;  3RT9 A;  4E69 A;  2AFB A;  5C40 A;  2Y67 A;  3HN7 A;  3GBU A;  2VOR A;  2X5O A;  3EWM A;  3NL3 A;  4XDA A;  1YHJ A;  3RTC A;  4CVL A;  3I3Y A;  3DRW A;  3IE7 A;  3NM1 A;  4DC3 A;  1V1A A;  3IQ0 A;  4XF6 A;  4DU5 A;  2GC6 A;  4JKS A;  4K8T A;  2C49 A;  2VTE A;  2AJP A;  3VAQ A;  3BF5 A;  3RU2 A;  3K5W A;  3H49 A;  1C3Q A;  4KAH A;  3RSG A;  3EAG A;  3PZS A;  4E84 A;  3GO7 A;  4N09 A;  5A5F A;  4GM6 A;  3RTA A;  3OTX A;  1GQY A;  3K9E A;  3NRS A;  4EBU A;  5C41 A;  2PKK A;  4BUC A;  5BYC A;  2A9Z A;  3RRJ A;  1VI9 A;  3RS9 A;  1GG4 A;  3RQ5 A;  4C5L A;  1LIK A;  5C3Y A;  4YL5 A;  2HQQ A;  1LIJ A;  3RM5 A;  1GC5 A;  5EY7 A;  5B6A A;  3B1P A;  1EKQ A;  3RQH A;  1W78 A;  3UQD A;  2C4E A;  2AM2 A;  2AWD A;  1U2X A;  3IH0 A;  1UAG A;  3ZS7 A;  3RQ8 A;  1LHR A;  2I6B A;  4C5J A;  2XTB A;  1KYH A;  3LJS A;  4CVK A;  4KAL A;  2A9Y A;  3NBW A;  3UBO A;  5BYF A;  4C5N A;  4JJP A;  4S1I A;  5CGE A;  1P3D A;  1W7K A;  1VM7 A;  3IN1 A;  1JXI A;  3MBH A;  5F11 A;  2AM1 A;  2JFH A;  5EYN A;  4UBE A;  2R3E A;  3Q1Y A;  1EKK A;  3RTB A;  1O5Z A;  2JG5 A;  2Q5R A;  3B3L A;  3HPD A;  4K8P A;  1ESQ A;  3RQQ A;  1GQT A;  2XJA A;  1V1S A;  3FHX A;  4K9C A;  4N08 A;  4QDI A;  5TQI A;  3RQ6 A;  3HIC A;  3FHY A;  2F7K A;  4BUB A;  1E8C A;  1RFV A;  3IKH A;  4S1M A;  3MBJ A;  2V78 A;  3RRF A;  1V1B A;  1DGM A;  2AB8 A;  3UAG A;  4KAD A;  3LOO A;  4K9I A;  1JXH A;  1RK2 A;  1RKD A;  1TYY A;  2I6A A;  2ABQ A;  2YXT A;  2FV7 A;  4K8K A;  4S1I B;  3RY7 A;  2VOS A;  5C3Z A;  1RFU A;  3HJ6 A;  3KZH A;  2ABS A;  3JUL A;  1V19 A;  2WTZ A;  2NWH A;  2RBC A;  3QCZ A;  4EOH A;  5BYE A;  4K8C A;  2UUO A;  2Y66 A;  3KEU A;  3RU3 A;  1LIO A;  3BGK A;  1UA4 A;  1RFT A;  3RQX A;  3RTD A;  3UQ6 A;  3QAI A;  3PL2 A;  3H74 A;  4PVV A;  3RSF A;  1JBV A;  4JKU A;  3UQ9 A;  3NC2 A;  3RPZ A;  4C13 A;  3Q92 A;  3ZM6 A;  4WJM A; 
#chains in the Genus database with same CATH homology
 3IBQ A;  5F0Z A;  2HW1 A;  1VK4 A;  2AX3 A;  3KTN A;  3HYO A;  1RKS A;  2DDW A;  2I5B A;  3NBV A;  2QHP A;  4B8S A;  1ESJ A;  1TZ3 A;  4E8Y A;  3B1Q A;  4LCA A;  4E8Z A;  3RTG A;  3RTE A;  1YGJ A;  2AJR A;  4O1G A;  3RRB A;  3UQE A;  5COJ A;  2PKN A;  2HLZ A;  4KBE A;  1TZ6 A;  4C5K A;  3DZV A;  3RRE A;  4X8F A;  3B1R A;  3NM3 A;  4XCK A;  1RKA A;  3LKI A;  2PKF A;  3NL2 A;  3VAS A;  3RS8 A;  4B8R A;  3UMP A;  3KD6 A;  3NL5 A;  1UB0 A;  5BYD A;  1TD2 A;  4EN4 A;  1LHP A;  3NCA A;  3NL6 A;  4LBG A;  4C5M A;  4LBX A;  2PKM A;  3RO4 A;  2VAR A;  2JGV A;  2DCN A;  3RQ2 A;  3NC9 A;  4K93 A;  3CQD A;  2JG1 A;  4YWR A;  2QCV A;  2DDO A;  2AA0 A;  2F02 A;  2YXU A;  1YGK A;  3RSQ A;  4KAN A;  4U7X A;  4XF7 A;  3RSS A;  3LHX A;  2DDM A;  2R3B A;  3RT7 A;  3B1N A;  4E3A A;  4EUM A;  1L2L A;  1WYE A;  4S1H A;  4E8W A;  3RPH A;  3GO6 A;  1LII A;  3QA2 A;  4O1L A;  3B1O A;  1BX4 A;  5CM5 A;  5TRW A;  3W4S A;  4E69 A;  5C3Y A;  5C40 A;  3N1C A;  3RT9 A;  4LC4 A;  5CGA A;  2AFB A;  3NL3 A;  3GBU A;  3EWM A;  3RTC A;  4XDA A;  1YHJ A;  3I3Y A;  3DRW A;  3IE7 A;  3NM1 A;  4DC3 A;  1V1A A;  3IQ0 A;  4XF6 A;  4DU5 A;  4JKS A;  4K8T A;  2C49 A;  2AJP A;  3VAQ A;  3BF5 A;  3RU2 A;  3K5W A;  3H49 A;  1C3Q A;  4KAH A;  3RSG A;  3PZS A;  4E84 A;  3GO7 A;  4N09 A;  4GM6 A;  3RTA A;  3OTX A;  3K9E A;  4EBU A;  5C41 A;  2PKK A;  5BYC A;  2A9Z A;  3RRJ A;  1VI9 A;  3RS9 A;  3RQ5 A;  4C5L A;  1LIK A;  4YL5 A;  2HQQ A;  1LIJ A;  3RM5 A;  1GC5 A;  5EY7 A;  5B6A A;  3B1P A;  1EKQ A;  3RQH A;  3UQD A;  2C4E A;  2AWD A;  1U2X A;  3IH0 A;  3ZS7 A;  3RQ8 A;  1LHR A;  2I6B A;  4C5J A;  2XTB A;  1KYH A;  3LJS A;  4KAL A;  2A9Y A;  3NBW A;  3UBO A;  5BYF A;  4C5N A;  4JJP A;  4S1I A;  5CGE A;  1VM7 A;  3IN1 A;  1JXI A;  3MBH A;  5F11 A;  5EYN A;  4UBE A;  2R3E A;  3Q1Y A;  1EKK A;  3RTB A;  2JG5 A;  3B3L A;  2Q5R A;  3HPD A;  4K8P A;  1ESQ A;  3RQQ A;  1GQT A;  3FHX A;  1V1S A;  4K9C A;  4N08 A;  5TQI A;  3RQ6 A;  3HIC A;  3FHY A;  2F7K A;  1RFV A;  3IKH A;  4S1M A;  3MBJ A;  2V78 A;  3RRF A;  1V1B A;  1DGM A;  2AB8 A;  3UMO A;  4KAD A;  3LOO A;  4K9I A;  1JXH A;  1RK2 A;  1RKD A;  1TYY A;  2I6A A;  2ABQ A;  2YXT A;  2FV7 A;  4K8K A;  4S1I B;  3RY7 A;  5C3Z A;  1RFU A;  3HJ6 A;  3KZH A;  2ABS A;  3JUL A;  1V19 A;  4EOH A;  2NWH A;  2RBC A;  5BYE A;  4K8C A;  3KEU A;  3RU3 A;  1LIO A;  3BGK A;  1UA4 A;  1RFT A;  3RQX A;  3RTD A;  3UQ6 A;  3QAI A;  3PL2 A;  3H74 A;  4PVV A;  3RSF A;  3UQ9 A;  4JKU A;  3NC2 A;  3RPZ A;  3Q92 A;  4WJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...