5BYDA

Crystal structure of human ribokinase in p21 spacegroup
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
315
structure length
315
Chain Sequence
VAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLFLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ribokinase in P21 spacegroup
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribokinase
total genus 111
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.1.15: Ribokinase.
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 5bydA00
4K8PA 1LHPA 4S1IB 4S1IA 1LIIA 3LOOA 1RFUA 3CQDA 5B6AA 1GC5A 3OTXA 2R3BA 3GBUA 4O1GA 4S1MA 3B1QA 3RSQA 5F11A 3RSFA 3JULA 3LJSA 3UMOA 3K5WA 2ABQA 3NCAA 4EBUA 2PKKA 2F7KA 4KAHA 1UA4A 3ZS7A 3MBHA 4B8SA 1L2LA 1V1BA 4XDAA 3RRJA 4XF6A 3RTBA 3RTCA 3Q92A 3B1OA 1V19A 4PVVA 4X8FA 2DDWA 5BYFA 1YGKA 3K9EA 3UBOA 3RQXA 3H49A 4JKUA 5EY7A 4EN4A 5EYNA 3RS9A 1BX4A 3B1PA 3BF5A 4K8TA 3IBQA 3UQDA 1U2XA 3KEUA 3NBWA 4KBEA 3RQ6A 2JG5A 1DGMA 3GO6A 3IH0A 1V1SA 1VM7A 3RS8A 3RSGA 3KZHA 4E8WA 3NM3A 3HPDA 3HYOA 1JXIA 2HW1A 4JJPA 4YL5A 3RPZA 1EKQA 3IKHA 3RQ5A 3RSSA 3VAQA 4B8RA 3B1RA 4GM6A 2NWHA 4K93A 3RT9A 5C41A 4XCKA 2PKMA 1WYEA 3RRBA 2DCNA 3HICA 4K9IA 1LIJA 3IN1A 4XF7A 1VI9A 1RKAA 3NL3A 3RTEA 2VARA 3RU2A 4EUMA 2I6AA 5CGAA 3DZVA 4E8ZA 5TRWA 3UQEA 3NM1A 3RTDA 3RRFA 3UMPA 4E84A 1RKDA 2I6BA 1TYYA 3EWMA 3RU3A 4DU5A 3FHYA 3W4SA 3UQ6A 4KADA 3H74A 3NL2A 3RPHA 2F02A 3RTAA 1ESQA 3LHXA 3GO7A 4K8KA 4LBGA 2R3EA 4C5JA 1TZ3A 2AA0A 1LIOA 2AJPA 3VASA 5CGEA 2JG1A 3RQQA 1LIKA 3FHXA 5CM5A 3RQ2A 2HQQA 1GQTA 3PL2A 2ABSA 4KANA 4C5LA 4E3AA 1JXHA 1LHRA 3RM5A 5F0ZA 2Q5RA 4EOHA 5C40A 5TQIA 4JKSA 3QA2A 4O1LA 1RKSA 2A9ZA 3RO4A 3RT7A 4C5KA 1YHJA 4KALA 1KYHA 3N1CA 2C4EA 2AJRA 2YXTA 4N08A 5C3ZA 1RFTA 3IQ0A 3DRWA 4K9CA 1TZ6A 1YGJA 4LCAA 4E8YA 4E69A 4S1HA 2DDOA 2YXUA 3I3YA 5C3YA 2DDMA 5BYCA 2XTBA 4K8CA 1UB0A 3QAIA 3BGKA 2I5BA 1EKKA 4C5NA 3KTNA 2QCVA 3PZSA 4UBEA 4YWRA 2A9YA 1C3QA 1ESJA 1RFVA 4LC4A 3IE7A 2PKFA 3RREA 4WJMA 2RBCA 3RTGA 3RY7A 3UQ9A 2FV7A 3NC9A 3Q1YA 3NBVA 2AX3A 3KD6A 2AFBA 2V78A 1VK4A 2AWDA 2PKNA 3NL5A 3B3LA 4LBXA 4N09A 5COJA 5BYDA 4C5MA 5BYEA 3B1NA 2C49A 2AB8A 3LKIA 3MBJA 3NC2A 4U7XA 1TD2A 4DC3A 2QHPA 1RK2A 2HLZA 1V1AA 2JGVA 3NL6A 3RQHA 3RQ8A
chains in the Genus database with same CATH superfamily
4K8PA 1UAGA 2GC5A 1LHPA 4BUBA 4S1IB 5A5EA 4S1IA 1LIIA 3LOOA 1RFUA 3CQDA 1GQQA 2GCBA 5B6AA 1GC5A 2UUOA 2R3BA 3GBUA 3OTXA 4O1GA 3B1QA 4S1MA 3RSQA 4B8RA 4C5NA 3RSFA 5F11A 3JULA 3LJSA 3UMOA 3K5WA 4ZIYA 2ABQA 2Y67A 3HN7A 2PKKA 3NCAA 2F7KA 4KAHA 4EBUA 1UA4A 3ZS7A 3MBHA 4B8SA 1L2LA 1V1BA 4XDAA 3RRJA 4C12A 4XF6A 3RTBA 3RTCA 3Q92A 3B1OA 1V19A 4PVVA 4X8FA 2DDWA 3ZM6A 5BYFA 1YGKA 3K9EA 3UBOA 4CVMA 1J6UA 3RQXA 4QF5A 3LK7A 3H49A 4JKUA 4BUCA 2GC6A 3PYZA 3QCZA 5EYNA 5EY7A 3RS9A 4EN4A 5A5FA 1BX4A 3B1PA 3BF5A 2VORA 4K8TA 3IBQA 3UQDA 1U2XA 3KEUA 3NBWA 4KBEA 3RQ6A 1E0DA 1DGMA 2JG5A 3GO6A 3IH0A 1V1SA 1FGSA 1VM7A 3RS8A 3RSGA 3KZHA 4QDIA 4E8WA 3NM3A 3HPDA 3HYOA 2Y1OA 4C13A 1JXIA 2HW1A 4JJPA 4YL5A 2AM1A 1EKQA 3IKHA 3RPZA 3RQ5A 3RSSA 3VAQA 3B1RA 4GM6A 2NWHA 4K93A 3RT9A 5C41A 1W7KA 4XCKA 2PKMA 1JBWA 1WYEA 3RRBA 2DCNA 3EAGA 3HICA 4K9IA 1LIJA 3IN1A 4XF7A 1VI9A 1RKAA 3NL3A 3RTEA 2VARA 3RU2A 4EUMA 1EEHA 2I6AA 5CGAA 3DZVA 4E8ZA 5TRWA 3UQEA 3NM1A 3RTDA 3RRFA 3UMPA 4CVKA 4E84A 1RKDA 2I6BA 1TYYA 3EWMA 3RU3A 4DU5A 4HV4A 1JBVA 3FHYA 2GCAA 3W4SA 3UAGA 4KADA 3UQ6A 1P3DA 3H74A 3NL2A 3RPHA 2F02A 3RTAA 2VOSA 1ESQA 3LHXA 1E8CA 3GO7A 4K8KA 4LBGA 5C3YA 3N2AA 2R3EA 4C5JA 1TZ3A 4E8YA 2AA0A 1LIOA 2AJPA 2UAGA 2XPCA 3VASA 2JG1A 3RQQA 5CGEA 1LIKA 3FHXA 5CM5A 2AM2A 3RQ2A 2HQQA 1GQTA 3PL2A 3RQHA 2ABSA 4KANA 3ZL8A 4C5LA 4E3AA 3NRSA 1JXHA 1LHRA 3RM5A 5F0ZA 2Q5RA 4EOHA 5C40A 5TQIA 4JKSA 3QA2A 4O1LA 1RKSA 2A9ZA 3RO4A 2JFFA 3RT7A 4C5KA 1YHJA 4KALA 2X5OA 1KYHA 3N1CA 2C4EA 2AJRA 2YXTA 4N08A 5C3ZA 1GQYA 1RFTA 3DRWA 3IQ0A 1TZ6A 1YGJA 2JFGA 4K9CA 4LCAA 4E69A 1O5ZA 4S1HA 2DDOA 2YXUA 3I3YA 1GG4A 4CVLA 2DDMA 2VTEA 5BYCA 5BYDA 3ZM5A 2XTBA 4K8CA 1UB0A 3QAIA 3BGKA 2I5BA 1EKKA 2F00A 1P31A 2QCVA 2XJAA 3KTNA 3PZSA 4UBEA 4YWRA 4UAGA 2A9YA 1C3QA 1W78A 2Y68A 1ESJA 1RFVA 4LC4A 3IE7A 2PKFA 3RREA 4WJMA 2RBCA 3RTGA 3RY7A 3UQ9A 2Y66A 2FV7A 3NC9A 3Q1YA 2WTZA 3NBVA 2UUPA 2VTDA 2AX3A 3KD6A 2AFBA 2V78A 1VK4A 2AWDA 2PKNA 3NL5A 3B3LA 4LBXA 4N09A 3HJ6A 5COJA 4C5MA 5BYEA 3B1NA 2C49A 2AB8A 3LKIA 3MBJA 3NC2A 4U7XA 1TD2A 4DC3A 2QHPA 1RK2A 2HLZA 1V1AA 2JGVA 2WJPA 3NL6A 2JFHA 3RQ8A
chains in the Genus database with same CATH topology
4K8PA 1LHPA 4S1IB 4S1IA 1LIIA 3LOOA 1RFUA 3CQDA 5B6AA 1GC5A 3OTXA 2R3BA 3GBUA 4O1GA 4S1MA 3B1QA 3RSQA 5F11A 3RSFA 3JULA 3LJSA 3UMOA 3K5WA 2ABQA 3NCAA 4EBUA 2PKKA 2F7KA 4KAHA 1UA4A 3ZS7A 3MBHA 4B8SA 1L2LA 1V1BA 4XDAA 3RRJA 4XF6A 3RTBA 3RTCA 3Q92A 3B1OA 1V19A 4PVVA 4X8FA 2DDWA 5BYFA 1YGKA 3K9EA 3UBOA 3RQXA 3H49A 4JKUA 5EY7A 4EN4A 5EYNA 3RS9A 1BX4A 3B1PA 3BF5A 4K8TA 3IBQA 3UQDA 1U2XA 3KEUA 3NBWA 4KBEA 3RQ6A 2JG5A 1DGMA 3GO6A 3IH0A 1V1SA 1VM7A 3RS8A 3RSGA 3KZHA 4E8WA 3NM3A 3HPDA 3HYOA 1JXIA 2HW1A 4JJPA 4YL5A 3RPZA 1EKQA 3IKHA 3RQ5A 3RSSA 3VAQA 4B8RA 3B1RA 4GM6A 2NWHA 4K93A 3RT9A 5C41A 4XCKA 2PKMA 1WYEA 3RRBA 2DCNA 3HICA 4K9IA 1LIJA 3IN1A 4XF7A 1VI9A 1RKAA 3NL3A 3RTEA 2VARA 3RU2A 4EUMA 2I6AA 5CGAA 3DZVA 4E8ZA 5TRWA 3UQEA 3NM1A 3RTDA 3RRFA 3UMPA 4E84A 1RKDA 2I6BA 1TYYA 3EWMA 3RU3A 4DU5A 3FHYA 3W4SA 3UQ6A 4KADA 3H74A 3NL2A 3RPHA 2F02A 3RTAA 1ESQA 3LHXA 3GO7A 4K8KA 4LBGA 2R3EA 4C5JA 1TZ3A 2AA0A 1LIOA 2AJPA 3VASA 5CGEA 2JG1A 3RQQA 1LIKA 3FHXA 5CM5A 3RQ2A 2HQQA 1GQTA 3PL2A 2ABSA 4KANA 4C5LA 4E3AA 1JXHA 1LHRA 3RM5A 5F0ZA 2Q5RA 4EOHA 5C40A 5TQIA 4JKSA 3QA2A 4O1LA 1RKSA 2A9ZA 3RO4A 3RT7A 4C5KA 1YHJA 4KALA 1KYHA 3N1CA 2C4EA 2AJRA 2YXTA 4N08A 5C3ZA 1RFTA 3IQ0A 3DRWA 4K9CA 1TZ6A 1YGJA 4LCAA 4E8YA 4E69A 4S1HA 2DDOA 2YXUA 3I3YA 5BYDA 5C3YA 2DDMA 5BYCA 2XTBA 4K8CA 1UB0A 3QAIA 3BGKA 2I5BA 1EKKA 4C5NA 3KTNA 2QCVA 3PZSA 4UBEA 4YWRA 2A9YA 1C3QA 1ESJA 1RFVA 4LC4A 3IE7A 2PKFA 3RREA 4WJMA 2RBCA 3RTGA 3RY7A 3UQ9A 2FV7A 3NC9A 3Q1YA 3NBVA 2AX3A 3KD6A 2AFBA 2V78A 1VK4A 2AWDA 2PKNA 3NL5A 3B3LA 4LBXA 4N09A 3HJ6A 5COJA 4C5MA 5BYEA 3B1NA 2C49A 2AB8A 3LKIA 3MBJA 3NC2A 4U7XA 1TD2A 4DC3A 2QHPA 1RK2A 2HLZA 1V1AA 2JGVA 3NL6A 3RQHA 3RQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8P A;  1LHP A;  4S1I B;  4S1I A;  1LII A;  3LOO A;  1RFU A;  3CQD A;  5B6A A;  1GC5 A;  3OTX A;  2R3B A;  3GBU A;  4O1G A;  4S1M A;  3B1Q A;  3RSQ A;  5F11 A;  3RSF A;  3JUL A;  3LJS A;  3UMO A;  3K5W A;  2ABQ A;  3NCA A;  4EBU A;  2PKK A;  2F7K A;  4KAH A;  1UA4 A;  3ZS7 A;  3MBH A;  4B8S A;  1L2L A;  1V1B A;  4XDA A;  3RRJ A;  4XF6 A;  3RTB A;  3RTC A;  3Q92 A;  3B1O A;  1V19 A;  4PVV A;  4X8F A;  2DDW A;  5BYF A;  1YGK A;  3K9E A;  3UBO A;  3RQX A;  3H49 A;  4JKU A;  5EY7 A;  4EN4 A;  5EYN A;  3RS9 A;  1BX4 A;  3B1P A;  3BF5 A;  4K8T A;  3IBQ A;  3UQD A;  1U2X A;  3KEU A;  3NBW A;  4KBE A;  3RQ6 A;  2JG5 A;  1DGM A;  3GO6 A;  3IH0 A;  1V1S A;  1VM7 A;  3RS8 A;  3RSG A;  3KZH A;  4E8W A;  3NM3 A;  3HPD A;  3HYO A;  1JXI A;  2HW1 A;  4JJP A;  4YL5 A;  3RPZ A;  1EKQ A;  3IKH A;  3RQ5 A;  3RSS A;  3VAQ A;  4B8R A;  3B1R A;  4GM6 A;  2NWH A;  4K93 A;  3RT9 A;  5C41 A;  4XCK A;  2PKM A;  1WYE A;  3RRB A;  2DCN A;  3HIC A;  4K9I A;  1LIJ A;  3IN1 A;  4XF7 A;  1VI9 A;  1RKA A;  3NL3 A;  3RTE A;  2VAR A;  3RU2 A;  4EUM A;  2I6A A;  5CGA A;  3DZV A;  4E8Z A;  5TRW A;  3UQE A;  3NM1 A;  3RTD A;  3RRF A;  3UMP A;  4E84 A;  1RKD A;  2I6B A;  1TYY A;  3EWM A;  3RU3 A;  4DU5 A;  3FHY A;  3W4S A;  3UQ6 A;  4KAD A;  3H74 A;  3NL2 A;  3RPH A;  2F02 A;  3RTA A;  1ESQ A;  3LHX A;  3GO7 A;  4K8K A;  4LBG A;  2R3E A;  4C5J A;  1TZ3 A;  2AA0 A;  1LIO A;  2AJP A;  3VAS A;  5CGE A;  2JG1 A;  3RQQ A;  1LIK A;  3FHX A;  5CM5 A;  3RQ2 A;  2HQQ A;  1GQT A;  3PL2 A;  2ABS A;  4KAN A;  4C5L A;  4E3A A;  1JXH A;  1LHR A;  3RM5 A;  5F0Z A;  2Q5R A;  4EOH A;  5C40 A;  5TQI A;  4JKS A;  3QA2 A;  4O1L A;  1RKS A;  2A9Z A;  3RO4 A;  3RT7 A;  4C5K A;  1YHJ A;  4KAL A;  1KYH A;  3N1C A;  2C4E A;  2AJR A;  2YXT A;  4N08 A;  5C3Z A;  1RFT A;  3IQ0 A;  3DRW A;  4K9C A;  1TZ6 A;  1YGJ A;  4LCA A;  4E8Y A;  4E69 A;  4S1H A;  2DDO A;  2YXU A;  3I3Y A;  5C3Y A;  2DDM A;  5BYC A;  2XTB A;  4K8C A;  1UB0 A;  3QAI A;  3BGK A;  2I5B A;  1EKK A;  4C5N A;  3KTN A;  2QCV A;  3PZS A;  4UBE A;  4YWR A;  2A9Y A;  1C3Q A;  1ESJ A;  1RFV A;  4LC4 A;  3IE7 A;  2PKF A;  3RRE A;  4WJM A;  2RBC A;  3RTG A;  3RY7 A;  3UQ9 A;  2FV7 A;  3NC9 A;  3Q1Y A;  3NBV A;  2AX3 A;  3KD6 A;  2AFB A;  2V78 A;  1VK4 A;  2AWD A;  2PKN A;  3NL5 A;  3B3L A;  4LBX A;  4N09 A;  5COJ A;  5BYD A;  4C5M A;  5BYE A;  3B1N A;  2C49 A;  2AB8 A;  3LKI A;  3MBJ A;  3NC2 A;  4U7X A;  1TD2 A;  4DC3 A;  2QHP A;  1RK2 A;  2HLZ A;  1V1A A;  2JGV A;  3NL6 A;  3RQH A;  3RQ8 A; 
#chains in the Genus database with same CATH topology
 4K8P A;  1UAG A;  2GC5 A;  1LHP A;  4BUB A;  4S1I B;  5A5E A;  4S1I A;  1LII A;  3LOO A;  1RFU A;  3CQD A;  1GQQ A;  2GCB A;  5B6A A;  1GC5 A;  2UUO A;  2R3B A;  3GBU A;  3OTX A;  4O1G A;  3B1Q A;  4S1M A;  3RSQ A;  4B8R A;  4C5N A;  3RSF A;  5F11 A;  3JUL A;  3LJS A;  3UMO A;  3K5W A;  4ZIY A;  2ABQ A;  2Y67 A;  3HN7 A;  2PKK A;  3NCA A;  2F7K A;  4KAH A;  4EBU A;  1UA4 A;  3ZS7 A;  3MBH A;  4B8S A;  1L2L A;  1V1B A;  4XDA A;  3RRJ A;  4C12 A;  4XF6 A;  3RTB A;  3RTC A;  3Q92 A;  3B1O A;  1V19 A;  4PVV A;  4X8F A;  2DDW A;  3ZM6 A;  5BYF A;  1YGK A;  3K9E A;  3UBO A;  4CVM A;  1J6U A;  3RQX A;  4QF5 A;  3LK7 A;  3H49 A;  4JKU A;  4BUC A;  2GC6 A;  3PYZ A;  3QCZ A;  5EYN A;  5EY7 A;  3RS9 A;  4EN4 A;  5A5F A;  1BX4 A;  3B1P A;  3BF5 A;  2VOR A;  4K8T A;  3IBQ A;  3UQD A;  1U2X A;  3KEU A;  3NBW A;  4KBE A;  3RQ6 A;  1E0D A;  1DGM A;  2JG5 A;  3GO6 A;  3IH0 A;  1V1S A;  1FGS A;  1VM7 A;  3RS8 A;  3RSG A;  3KZH A;  4QDI A;  4E8W A;  3NM3 A;  3HPD A;  3HYO A;  2Y1O A;  4C13 A;  1JXI A;  2HW1 A;  4JJP A;  4YL5 A;  2AM1 A;  1EKQ A;  3IKH A;  3RPZ A;  3RQ5 A;  3RSS A;  3VAQ A;  3B1R A;  4GM6 A;  2NWH A;  4K93 A;  3RT9 A;  5C41 A;  1W7K A;  4XCK A;  2PKM A;  1JBW A;  1WYE A;  3RRB A;  2DCN A;  3EAG A;  3HIC A;  4K9I A;  1LIJ A;  3IN1 A;  4XF7 A;  1VI9 A;  1RKA A;  3NL3 A;  3RTE A;  2VAR A;  3RU2 A;  4EUM A;  1EEH A;  2I6A A;  5CGA A;  3DZV A;  4E8Z A;  5TRW A;  3UQE A;  3NM1 A;  3RTD A;  3RRF A;  3UMP A;  4CVK A;  4E84 A;  1RKD A;  2I6B A;  1TYY A;  3EWM A;  3RU3 A;  4DU5 A;  4HV4 A;  1JBV A;  3FHY A;  2GCA A;  3W4S A;  3UAG A;  4KAD A;  3UQ6 A;  1P3D A;  3H74 A;  3NL2 A;  3RPH A;  2F02 A;  3RTA A;  2VOS A;  1ESQ A;  3LHX A;  1E8C A;  3GO7 A;  4K8K A;  4LBG A;  5C3Y A;  3N2A A;  2R3E A;  4C5J A;  1TZ3 A;  4E8Y A;  2AA0 A;  1LIO A;  2AJP A;  2UAG A;  2XPC A;  3VAS A;  2JG1 A;  3RQQ A;  5CGE A;  1LIK A;  3FHX A;  5CM5 A;  2AM2 A;  3RQ2 A;  2HQQ A;  1GQT A;  3PL2 A;  3RQH A;  2ABS A;  4KAN A;  3ZL8 A;  4C5L A;  4E3A A;  3NRS A;  1JXH A;  1LHR A;  3RM5 A;  5F0Z A;  2Q5R A;  4EOH A;  5C40 A;  5TQI A;  4JKS A;  3QA2 A;  4O1L A;  1RKS A;  2A9Z A;  3RO4 A;  2JFF A;  3RT7 A;  4C5K A;  1YHJ A;  4KAL A;  2X5O A;  1KYH A;  3N1C A;  2C4E A;  2AJR A;  2YXT A;  4N08 A;  5C3Z A;  1GQY A;  1RFT A;  3DRW A;  3IQ0 A;  1TZ6 A;  1YGJ A;  2JFG A;  4K9C A;  4LCA A;  4E69 A;  1O5Z A;  4S1H A;  2DDO A;  2YXU A;  3I3Y A;  1GG4 A;  4CVL A;  2DDM A;  2VTE A;  5BYC A;  5BYD A;  3ZM5 A;  2XTB A;  4K8C A;  1UB0 A;  3QAI A;  3BGK A;  2I5B A;  1EKK A;  2F00 A;  1P31 A;  2QCV A;  2XJA A;  3KTN A;  3PZS A;  4UBE A;  4YWR A;  4UAG A;  2A9Y A;  1C3Q A;  1W78 A;  2Y68 A;  1ESJ A;  1RFV A;  4LC4 A;  3IE7 A;  2PKF A;  3RRE A;  4WJM A;  2RBC A;  3RTG A;  3RY7 A;  3UQ9 A;  2Y66 A;  2FV7 A;  3NC9 A;  3Q1Y A;  2WTZ A;  3NBV A;  2UUP A;  2VTD A;  2AX3 A;  3KD6 A;  2AFB A;  2V78 A;  1VK4 A;  2AWD A;  2PKN A;  3NL5 A;  3B3L A;  4LBX A;  4N09 A;  3HJ6 A;  5COJ A;  4C5M A;  5BYE A;  3B1N A;  2C49 A;  2AB8 A;  3LKI A;  3MBJ A;  3NC2 A;  4U7X A;  1TD2 A;  4DC3 A;  2QHP A;  1RK2 A;  2HLZ A;  1V1A A;  2JGV A;  2WJP A;  3NL6 A;  2JFH A;  3RQ8 A; 
#chains in the Genus database with same CATH homology
 4K8P A;  1LHP A;  4S1I B;  4S1I A;  1LII A;  3LOO A;  1RFU A;  3CQD A;  5B6A A;  1GC5 A;  3OTX A;  2R3B A;  3GBU A;  4O1G A;  4S1M A;  3B1Q A;  3RSQ A;  5F11 A;  3RSF A;  3JUL A;  3LJS A;  3UMO A;  3K5W A;  2ABQ A;  3NCA A;  4EBU A;  2PKK A;  2F7K A;  4KAH A;  1UA4 A;  3ZS7 A;  3MBH A;  4B8S A;  1L2L A;  1V1B A;  4XDA A;  3RRJ A;  4XF6 A;  3RTB A;  3RTC A;  3Q92 A;  3B1O A;  1V19 A;  4PVV A;  4X8F A;  2DDW A;  5BYF A;  1YGK A;  3K9E A;  3UBO A;  3RQX A;  3H49 A;  4JKU A;  5EY7 A;  4EN4 A;  5EYN A;  3RS9 A;  1BX4 A;  3B1P A;  3BF5 A;  4K8T A;  3IBQ A;  3UQD A;  1U2X A;  3KEU A;  3NBW A;  4KBE A;  3RQ6 A;  2JG5 A;  1DGM A;  3GO6 A;  3IH0 A;  1V1S A;  1VM7 A;  3RS8 A;  3RSG A;  3KZH A;  4E8W A;  3NM3 A;  3HPD A;  3HYO A;  1JXI A;  2HW1 A;  4JJP A;  4YL5 A;  3RPZ A;  1EKQ A;  3IKH A;  3RQ5 A;  3RSS A;  3VAQ A;  4B8R A;  3B1R A;  4GM6 A;  2NWH A;  4K93 A;  3RT9 A;  5C41 A;  4XCK A;  2PKM A;  1WYE A;  3RRB A;  2DCN A;  3HIC A;  4K9I A;  1LIJ A;  3IN1 A;  4XF7 A;  1VI9 A;  1RKA A;  3NL3 A;  3RTE A;  2VAR A;  3RU2 A;  4EUM A;  2I6A A;  5CGA A;  3DZV A;  4E8Z A;  5TRW A;  3UQE A;  3NM1 A;  3RTD A;  3RRF A;  3UMP A;  4E84 A;  1RKD A;  2I6B A;  1TYY A;  3EWM A;  3RU3 A;  4DU5 A;  3FHY A;  3W4S A;  3UQ6 A;  4KAD A;  3H74 A;  3NL2 A;  3RPH A;  2F02 A;  3RTA A;  1ESQ A;  3LHX A;  3GO7 A;  4K8K A;  4LBG A;  2R3E A;  4C5J A;  1TZ3 A;  2AA0 A;  1LIO A;  2AJP A;  3VAS A;  5CGE A;  2JG1 A;  3RQQ A;  1LIK A;  3FHX A;  5CM5 A;  3RQ2 A;  2HQQ A;  1GQT A;  3PL2 A;  2ABS A;  4KAN A;  4C5L A;  4E3A A;  1JXH A;  1LHR A;  3RM5 A;  5F0Z A;  2Q5R A;  4EOH A;  5C40 A;  5TQI A;  4JKS A;  3QA2 A;  4O1L A;  1RKS A;  2A9Z A;  3RO4 A;  3RT7 A;  4C5K A;  1YHJ A;  4KAL A;  1KYH A;  3N1C A;  2C4E A;  2AJR A;  2YXT A;  4N08 A;  5C3Z A;  1RFT A;  3IQ0 A;  3DRW A;  4K9C A;  1TZ6 A;  1YGJ A;  4LCA A;  4E8Y A;  4E69 A;  4S1H A;  2DDO A;  2YXU A;  3I3Y A;  5BYD A;  5C3Y A;  2DDM A;  5BYC A;  2XTB A;  4K8C A;  1UB0 A;  3QAI A;  3BGK A;  2I5B A;  1EKK A;  4C5N A;  3KTN A;  2QCV A;  3PZS A;  4UBE A;  4YWR A;  2A9Y A;  1C3Q A;  1ESJ A;  1RFV A;  4LC4 A;  3IE7 A;  2PKF A;  3RRE A;  4WJM A;  2RBC A;  3RTG A;  3RY7 A;  3UQ9 A;  2FV7 A;  3NC9 A;  3Q1Y A;  3NBV A;  2AX3 A;  3KD6 A;  2AFB A;  2V78 A;  1VK4 A;  2AWD A;  2PKN A;  3NL5 A;  3B3L A;  4LBX A;  4N09 A;  3HJ6 A;  5COJ A;  4C5M A;  5BYE A;  3B1N A;  2C49 A;  2AB8 A;  3LKI A;  3MBJ A;  3NC2 A;  4U7X A;  1TD2 A;  4DC3 A;  2QHP A;  1RK2 A;  2HLZ A;  1V1A A;  2JGV A;  3NL6 A;  3RQH A;  3RQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...