5BYDA

Crystal structure of human ribokinase in p21 spacegroup
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
315
structure length
315
Chain Sequence
VAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLFLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ribokinase in P21 spacegroup
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribokinase
total genus 111
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.1.15: Ribokinase.
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 5bydA00
1RFUA 1LIJA 3NC2A 2RBCA 4C5NA 1EKKA 1V1BA 2PKFA 3BGKA 3RQQA 4S1MA 4EOHA 3RTGA 4DC3A 4K9IA 1VM7A 4PVVA 1TD2A 2ABSA 4DU5A 3QAIA 5C40A 3IN1A 3RQ2A 1TZ6A 3UQ6A 4O1LA 4K8KA 4B8SA 5C3YA 1UB0A 4YWRA 3RT9A 1ESQA 2HQQA 1RK2A 3GBUA 3B1QA 3MBHA 2AWDA 3B1RA 3RTBA 1LIIA 3DZVA 5F0ZA 2QCVA 4E84A 2YXUA 3N1CA 3RSQA 1LIOA 3K9EA 1YGJA 3RY7A 4XF7A 5C41A 3RU2A 4E8ZA 3NBVA 2A9YA 3RU3A 3UMPA 3RSSA 1GQTA 4EN4A 3RTDA 2AA0A 5CM5A 3IQ0A 1RKSA 4O1GA 3NL6A 1RKAA 4GM6A 3VASA 4LCAA 5BYFA 5CGAA 1L2LA 3NCAA 1RKDA 3RS8A 3LKIA 5F11A 3MBJA 3RPHA 2PKNA 3KEUA 2HLZA 5BYCA 4JKSA 3NL5A 3CQDA 4WJMA 1JXIA 3UBOA 1YHJA 3Q92A 1YGKA 4K9CA 2AJPA 3NL3A 3RSFA 4S1HA 3GO7A 3RTCA 3H74A 4B8RA 4XCKA 2QHPA 3K5WA 4C5LA 4E3AA 3BF5A 3RRJA 4K93A 2V78A 3B1OA 2AB8A 2PKKA 1RFTA 1TZ3A 3RO4A 3I3YA 3RQ5A 3VAQA 5BYEA 1LHPA 1JXHA 4KAHA 3LHXA 2C4EA 1C3QA 2R3EA 3H49A 4U7XA 3RQXA 3HYOA 3UQDA 3IH0A 2I6BA 1LIKA 4N09A 4EUMA 1DGMA 2A9ZA 3HPDA 5TRWA 3RS9A 3PL2A 5EY7A 3RRBA 4C5KA 1WYEA 1KYHA 3KD6A 2AX3A 2F02A 2JG5A 2AFBA 3LJSA 4C5JA 4X8FA 4E8WA 4KANA 2DDOA 1U2XA 4JJPA 3KZHA 2HW1A 5C3ZA 1LHRA 4K8TA 2Q5RA 4KALA 1V19A 5B6AA 1VK4A 1RFVA 3RTEA 3FHXA 3LOOA 4N08A 3DRWA 3IKHA 4E69A 3RREA 3B3LA 3OTXA 3UQ9A 1TYYA 1UA4A 2NWHA 3B1NA 3NBWA 2F7KA 5EYNA 3UQEA 2PKMA 3RQ8A 2XTBA 4LBXA 5CGEA 5COJA 4S1IA 3HICA 4JKUA 4C5MA 4LBGA 3GO6A 3RPZA 4XDAA 4YL5A 3RRFA 2I6AA 2AJRA 4KADA 3UMOA 3JULA 4EBUA 1VI9A 3QA2A 3NL2A 2I5BA 3NC9A 2DDMA 3KTNA 2JG1A 2ABQA 2R3BA 3NM1A 4UBEA 3IE7A 2DDWA 3ZS7A 2JGVA 3RTAA 3PZSA 1BX4A 1ESJA 4XF6A 3FHYA 3IBQA 3RQ6A 1V1SA 4K8CA 1V1AA 1GC5A 2YXTA 2C49A 4E8YA 3NM3A 4S1IB 4K8PA 5TQIA 3RSGA 4KBEA 3RQHA 3EWMA 3W4SA 3Q1YA 1EKQA 5BYDA 3B1PA 4LC4A 2FV7A 2VARA 3RT7A 2DCNA 3RM5A
chains in the Genus database with same CATH superfamily
1RFUA 1LIJA 3NC2A 4CVKA 2RBCA 4C5NA 1EKKA 1V1BA 4UAGA 2PKFA 3BGKA 3RQQA 4S1MA 4EOHA 3RTGA 1W7KA 4K9IA 1VM7A 2JFFA 1TD2A 2ABSA 4PVVA 3QAIA 4DC3A 4DU5A 5C40A 3IN1A 3RQ2A 1TZ6A 3UQ6A 4O1LA 4K8KA 4B8SA 5C3YA 1UB0A 4YWRA 3RT9A 1ESQA 2HQQA 1GQQA 1RK2A 2VTEA 3B1QA 3GBUA 2AWDA 1W78A 1JBVA 2XJAA 3B1RA 3MBHA 3NRSA 3RTBA 1LIIA 3DZVA 5F0ZA 2QCVA 1E0DA 4QF5A 4E84A 2YXUA 3N1CA 3RSQA 1LIOA 3K9EA 1YGJA 3RY7A 4XF7A 4BUCA 3HJ6A 3RU2A 1O5ZA 3NBVA 2WJPA 4E8ZA 5C41A 2A9YA 3RU3A 3UMPA 3RSSA 1GQTA 3LK7A 4EN4A 3RTDA 2AA0A 5CM5A 3IQ0A 2XPCA 2VOSA 1RKSA 3RRFA 4O1GA 3NL6A 1RKAA 2Y66A 4GM6A 3VASA 3UMOA 4LCAA 5BYFA 5CGAA 1L2LA 1GQYA 1RKDA 2UUOA 3LKIA 3NCAA 3RS8A 5F11A 2Y68A 3MBJA 3RPHA 2PKNA 3KEUA 2HLZA 5BYCA 4JKSA 3NL5A 3CQDA 3HN7A 4WJMA 1JXIA 3UBOA 1EEHA 1YHJA 3Q92A 1YGKA 4K9CA 2AJPA 3NL3A 3RSFA 4S1HA 1P31A 3GO7A 3RTCA 3H74A 4B8RA 4XCKA 3UAGA 2QHPA 3K5WA 4C5LA 4E3AA 3N2AA 3BF5A 4QDIA 3RRJA 2GCBA 4K93A 2V78A 3B1OA 2AB8A 4HV4A 2PKKA 2GCAA 1RFTA 1TZ3A 4CVMA 3RO4A 3I3YA 3RQ5A 3VAQA 3EAGA 5BYEA 1LHPA 1JXHA 4KAHA 2X5OA 3ZL8A 3LHXA 4CVLA 2C4EA 2JFGA 1C3QA 2R3EA 3H49A 4U7XA 1GG4A 3HYOA 3RQXA 4BUBA 3UQDA 3IH0A 2VTDA 2I6BA 1LIKA 4N09A 4EUMA 1DGMA 2A9ZA 3HPDA 5TRWA 3RS9A 3PL2A 5EY7A 3RRBA 4C5KA 1WYEA 1KYHA 3KD6A 5A5FA 2AX3A 2F02A 2AFBA 2JG5A 1UAGA 3LJSA 4C5JA 4X8FA 4E8WA 2Y1OA 2DDOA 4KANA 1U2XA 4JJPA 3KZHA 2HW1A 2Y67A 5C3ZA 1LHRA 4K8TA 2Q5RA 4KALA 1V19A 1P3DA 5B6AA 4C12A 1VK4A 1RFVA 2F00A 3FHXA 3LOOA 4N08A 3DRWA 3IKHA 3RTEA 3ZM6A 3RREA 3ZM5A 1FGSA 3B3LA 3OTXA 3UQ9A 1TYYA 1UA4A 2AM1A 2NWHA 2JFHA 3B1NA 3NBWA 5A5EA 2AM2A 2WTZA 4ZIYA 2F7KA 5EYNA 3QCZA 3UQEA 2PKMA 3RQ8A 2XTBA 4LBXA 5CGEA 5COJA 4S1IA 3HICA 4JKUA 3RT7A 4C5MA 4LBGA 3GO6A 1J6UA 2UUPA 3RPZA 4XDAA 1JBWA 4YL5A 2I6AA 2AJRA 3PYZA 4KADA 3JULA 2GC5A 1VI9A 3QA2A 3NL2A 2I5BA 3NC9A 2DDMA 3KTNA 2ABQA 2GC6A 2JG1A 2R3BA 3NM1A 3IE7A 4UBEA 2DDWA 3ZS7A 2JGVA 3RTAA 2VORA 3PZSA 1BX4A 4E69A 1ESJA 4XF6A 3FHYA 3IBQA 3RQ6A 1V1SA 4K8CA 1V1AA 1GC5A 2YXTA 2C49A 4EBUA 4E8YA 3NM3A 4S1IB 4K8PA 5TQIA 3RSGA 4KBEA 3RQHA 4C13A 3EWMA 3W4SA 3Q1YA 1EKQA 1E8CA 3B1PA 4LC4A 5BYDA 2FV7A 2VARA 2UAGA 2DCNA 3RM5A
chains in the Genus database with same CATH topology
1RFUA 1LIJA 3NC2A 2RBCA 4C5NA 1EKKA 1V1BA 2PKFA 3BGKA 3RQQA 4S1MA 4EOHA 3RTGA 4DC3A 4K9IA 1VM7A 4PVVA 1TD2A 2ABSA 4DU5A 3QAIA 5C40A 3IN1A 3RQ2A 1TZ6A 3UQ6A 4O1LA 4K8KA 4B8SA 5C3YA 1UB0A 4YWRA 3RT9A 1ESQA 2HQQA 1RK2A 3GBUA 3B1QA 3MBHA 2AWDA 3B1RA 3RTBA 1LIIA 3DZVA 5F0ZA 2QCVA 4E84A 2YXUA 3N1CA 3RSQA 1LIOA 3K9EA 1YGJA 3RY7A 4XF7A 5C41A 3HJ6A 3RU2A 4E8ZA 3NBVA 2A9YA 3RU3A 3UMPA 3RSSA 1GQTA 4EN4A 3RTDA 2AA0A 5CM5A 3IQ0A 1RKSA 4O1GA 3NL6A 1RKAA 4GM6A 3VASA 4LCAA 5BYFA 5CGAA 1L2LA 3NCAA 1RKDA 3RS8A 3LKIA 5F11A 3MBJA 3RPHA 2PKNA 3KEUA 2HLZA 5BYCA 4JKSA 3NL5A 3CQDA 4WJMA 1JXIA 3UBOA 1YHJA 3Q92A 1YGKA 4K9CA 2AJPA 3NL3A 3RSFA 4S1HA 3GO7A 3RTCA 3H74A 4B8RA 4XCKA 2QHPA 3K5WA 4C5LA 4E3AA 3BF5A 3RRJA 4K93A 2V78A 3B1OA 2AB8A 2PKKA 1RFTA 1TZ3A 3RO4A 3I3YA 3RQ5A 3VAQA 5BYEA 1LHPA 1JXHA 4KAHA 3LHXA 2C4EA 1C3QA 2R3EA 3H49A 4U7XA 3RQXA 3HYOA 3UQDA 3IH0A 2I6BA 1LIKA 4N09A 4EUMA 1DGMA 2A9ZA 3HPDA 5TRWA 3RS9A 3PL2A 5EY7A 3RRBA 4C5KA 1WYEA 1KYHA 3KD6A 2AX3A 2F02A 2JG5A 2AFBA 3LJSA 4C5JA 4X8FA 4E8WA 4KANA 2DDOA 1U2XA 4JJPA 3KZHA 2HW1A 5C3ZA 1LHRA 4K8TA 2Q5RA 4KALA 1V19A 5B6AA 1VK4A 1RFVA 3RTEA 3FHXA 3LOOA 4N08A 3DRWA 3IKHA 4E69A 3RREA 3B3LA 3OTXA 3UQ9A 1TYYA 1UA4A 2NWHA 3B1NA 3NBWA 2F7KA 5EYNA 3UQEA 2PKMA 3RQ8A 2XTBA 4LBXA 5CGEA 5COJA 4S1IA 3HICA 4JKUA 4C5MA 4LBGA 3GO6A 3RPZA 4XDAA 4YL5A 3RRFA 2I6AA 2AJRA 4KADA 3UMOA 3JULA 4EBUA 1VI9A 3QA2A 3NL2A 2I5BA 3NC9A 2DDMA 3KTNA 2JG1A 2ABQA 2R3BA 3NM1A 4UBEA 3IE7A 2DDWA 3ZS7A 2JGVA 3RTAA 3PZSA 1BX4A 1ESJA 4XF6A 3FHYA 3IBQA 3RQ6A 1V1SA 4K8CA 1V1AA 1GC5A 2YXTA 2C49A 4E8YA 3NM3A 4S1IB 4K8PA 5TQIA 3RSGA 4KBEA 3RQHA 3EWMA 3W4SA 3Q1YA 1EKQA 5BYDA 3B1PA 4LC4A 2FV7A 2VARA 3RT7A 2DCNA 3RM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFU A;  1LIJ A;  3NC2 A;  2RBC A;  4C5N A;  1EKK A;  1V1B A;  2PKF A;  3BGK A;  3RQQ A;  4S1M A;  4EOH A;  3RTG A;  4DC3 A;  4K9I A;  1VM7 A;  4PVV A;  1TD2 A;  2ABS A;  4DU5 A;  3QAI A;  5C40 A;  3IN1 A;  3RQ2 A;  1TZ6 A;  3UQ6 A;  4O1L A;  4K8K A;  4B8S A;  5C3Y A;  1UB0 A;  4YWR A;  3RT9 A;  1ESQ A;  2HQQ A;  1RK2 A;  3GBU A;  3B1Q A;  3MBH A;  2AWD A;  3B1R A;  3RTB A;  1LII A;  3DZV A;  5F0Z A;  2QCV A;  4E84 A;  2YXU A;  3N1C A;  3RSQ A;  1LIO A;  3K9E A;  1YGJ A;  3RY7 A;  4XF7 A;  5C41 A;  3RU2 A;  4E8Z A;  3NBV A;  2A9Y A;  3RU3 A;  3UMP A;  3RSS A;  1GQT A;  4EN4 A;  3RTD A;  2AA0 A;  5CM5 A;  3IQ0 A;  1RKS A;  4O1G A;  3NL6 A;  1RKA A;  4GM6 A;  3VAS A;  4LCA A;  5BYF A;  5CGA A;  1L2L A;  3NCA A;  1RKD A;  3RS8 A;  3LKI A;  5F11 A;  3MBJ A;  3RPH A;  2PKN A;  3KEU A;  2HLZ A;  5BYC A;  4JKS A;  3NL5 A;  3CQD A;  4WJM A;  1JXI A;  3UBO A;  1YHJ A;  3Q92 A;  1YGK A;  4K9C A;  2AJP A;  3NL3 A;  3RSF A;  4S1H A;  3GO7 A;  3RTC A;  3H74 A;  4B8R A;  4XCK A;  2QHP A;  3K5W A;  4C5L A;  4E3A A;  3BF5 A;  3RRJ A;  4K93 A;  2V78 A;  3B1O A;  2AB8 A;  2PKK A;  1RFT A;  1TZ3 A;  3RO4 A;  3I3Y A;  3RQ5 A;  3VAQ A;  5BYE A;  1LHP A;  1JXH A;  4KAH A;  3LHX A;  2C4E A;  1C3Q A;  2R3E A;  3H49 A;  4U7X A;  3RQX A;  3HYO A;  3UQD A;  3IH0 A;  2I6B A;  1LIK A;  4N09 A;  4EUM A;  1DGM A;  2A9Z A;  3HPD A;  5TRW A;  3RS9 A;  3PL2 A;  5EY7 A;  3RRB A;  4C5K A;  1WYE A;  1KYH A;  3KD6 A;  2AX3 A;  2F02 A;  2JG5 A;  2AFB A;  3LJS A;  4C5J A;  4X8F A;  4E8W A;  4KAN A;  2DDO A;  1U2X A;  4JJP A;  3KZH A;  2HW1 A;  5C3Z A;  1LHR A;  4K8T A;  2Q5R A;  4KAL A;  1V19 A;  5B6A A;  1VK4 A;  1RFV A;  3RTE A;  3FHX A;  3LOO A;  4N08 A;  3DRW A;  3IKH A;  4E69 A;  3RRE A;  3B3L A;  3OTX A;  3UQ9 A;  1TYY A;  1UA4 A;  2NWH A;  3B1N A;  3NBW A;  2F7K A;  5EYN A;  3UQE A;  2PKM A;  3RQ8 A;  2XTB A;  4LBX A;  5CGE A;  5COJ A;  4S1I A;  3HIC A;  4JKU A;  4C5M A;  4LBG A;  3GO6 A;  3RPZ A;  4XDA A;  4YL5 A;  3RRF A;  2I6A A;  2AJR A;  4KAD A;  3UMO A;  3JUL A;  4EBU A;  1VI9 A;  3QA2 A;  3NL2 A;  2I5B A;  3NC9 A;  2DDM A;  3KTN A;  2JG1 A;  2ABQ A;  2R3B A;  3NM1 A;  4UBE A;  3IE7 A;  2DDW A;  3ZS7 A;  2JGV A;  3RTA A;  3PZS A;  1BX4 A;  1ESJ A;  4XF6 A;  3FHY A;  3IBQ A;  3RQ6 A;  1V1S A;  4K8C A;  1V1A A;  1GC5 A;  2YXT A;  2C49 A;  4E8Y A;  3NM3 A;  4S1I B;  4K8P A;  5TQI A;  3RSG A;  4KBE A;  3RQH A;  3EWM A;  3W4S A;  3Q1Y A;  1EKQ A;  5BYD A;  3B1P A;  4LC4 A;  2FV7 A;  2VAR A;  3RT7 A;  2DCN A;  3RM5 A; 
#chains in the Genus database with same CATH topology
 1RFU A;  1LIJ A;  3NC2 A;  4CVK A;  2RBC A;  4C5N A;  1EKK A;  1V1B A;  4UAG A;  2PKF A;  3BGK A;  3RQQ A;  4S1M A;  4EOH A;  3RTG A;  1W7K A;  4K9I A;  1VM7 A;  2JFF A;  1TD2 A;  2ABS A;  4PVV A;  3QAI A;  4DC3 A;  4DU5 A;  5C40 A;  3IN1 A;  3RQ2 A;  1TZ6 A;  3UQ6 A;  4O1L A;  4K8K A;  4B8S A;  5C3Y A;  1UB0 A;  4YWR A;  3RT9 A;  1ESQ A;  2HQQ A;  1GQQ A;  1RK2 A;  2VTE A;  3B1Q A;  3GBU A;  2AWD A;  1W78 A;  1JBV A;  2XJA A;  3B1R A;  3MBH A;  3NRS A;  3RTB A;  1LII A;  3DZV A;  5F0Z A;  2QCV A;  1E0D A;  4QF5 A;  4E84 A;  2YXU A;  3N1C A;  3RSQ A;  1LIO A;  3K9E A;  1YGJ A;  3RY7 A;  4XF7 A;  4BUC A;  3HJ6 A;  3RU2 A;  1O5Z A;  3NBV A;  2WJP A;  4E8Z A;  5C41 A;  2A9Y A;  3RU3 A;  3UMP A;  3RSS A;  1GQT A;  3LK7 A;  4EN4 A;  3RTD A;  2AA0 A;  5CM5 A;  3IQ0 A;  2XPC A;  2VOS A;  1RKS A;  3RRF A;  4O1G A;  3NL6 A;  1RKA A;  2Y66 A;  4GM6 A;  3VAS A;  3UMO A;  4LCA A;  5BYF A;  5CGA A;  1L2L A;  1GQY A;  1RKD A;  2UUO A;  3LKI A;  3NCA A;  3RS8 A;  5F11 A;  2Y68 A;  3MBJ A;  3RPH A;  2PKN A;  3KEU A;  2HLZ A;  5BYC A;  4JKS A;  3NL5 A;  3CQD A;  3HN7 A;  4WJM A;  1JXI A;  3UBO A;  1EEH A;  1YHJ A;  3Q92 A;  1YGK A;  4K9C A;  2AJP A;  3NL3 A;  3RSF A;  4S1H A;  1P31 A;  3GO7 A;  3RTC A;  3H74 A;  4B8R A;  4XCK A;  3UAG A;  2QHP A;  3K5W A;  4C5L A;  4E3A A;  3N2A A;  3BF5 A;  4QDI A;  3RRJ A;  2GCB A;  4K93 A;  2V78 A;  3B1O A;  2AB8 A;  4HV4 A;  2PKK A;  2GCA A;  1RFT A;  1TZ3 A;  4CVM A;  3RO4 A;  3I3Y A;  3RQ5 A;  3VAQ A;  3EAG A;  5BYE A;  1LHP A;  1JXH A;  4KAH A;  2X5O A;  3ZL8 A;  3LHX A;  4CVL A;  2C4E A;  2JFG A;  1C3Q A;  2R3E A;  3H49 A;  4U7X A;  1GG4 A;  3HYO A;  3RQX A;  4BUB A;  3UQD A;  3IH0 A;  2VTD A;  2I6B A;  1LIK A;  4N09 A;  4EUM A;  1DGM A;  2A9Z A;  3HPD A;  5TRW A;  3RS9 A;  3PL2 A;  5EY7 A;  3RRB A;  4C5K A;  1WYE A;  1KYH A;  3KD6 A;  5A5F A;  2AX3 A;  2F02 A;  2AFB A;  2JG5 A;  1UAG A;  3LJS A;  4C5J A;  4X8F A;  4E8W A;  2Y1O A;  2DDO A;  4KAN A;  1U2X A;  4JJP A;  3KZH A;  2HW1 A;  2Y67 A;  5C3Z A;  1LHR A;  4K8T A;  2Q5R A;  4KAL A;  1V19 A;  1P3D A;  5B6A A;  4C12 A;  1VK4 A;  1RFV A;  2F00 A;  3FHX A;  3LOO A;  4N08 A;  3DRW A;  3IKH A;  3RTE A;  3ZM6 A;  3RRE A;  3ZM5 A;  1FGS A;  3B3L A;  3OTX A;  3UQ9 A;  1TYY A;  1UA4 A;  2AM1 A;  2NWH A;  2JFH A;  3B1N A;  3NBW A;  5A5E A;  2AM2 A;  2WTZ A;  4ZIY A;  2F7K A;  5EYN A;  3QCZ A;  3UQE A;  2PKM A;  3RQ8 A;  2XTB A;  4LBX A;  5CGE A;  5COJ A;  4S1I A;  3HIC A;  4JKU A;  3RT7 A;  4C5M A;  4LBG A;  3GO6 A;  1J6U A;  2UUP A;  3RPZ A;  4XDA A;  1JBW A;  4YL5 A;  2I6A A;  2AJR A;  3PYZ A;  4KAD A;  3JUL A;  2GC5 A;  1VI9 A;  3QA2 A;  3NL2 A;  2I5B A;  3NC9 A;  2DDM A;  3KTN A;  2ABQ A;  2GC6 A;  2JG1 A;  2R3B A;  3NM1 A;  3IE7 A;  4UBE A;  2DDW A;  3ZS7 A;  2JGV A;  3RTA A;  2VOR A;  3PZS A;  1BX4 A;  4E69 A;  1ESJ A;  4XF6 A;  3FHY A;  3IBQ A;  3RQ6 A;  1V1S A;  4K8C A;  1V1A A;  1GC5 A;  2YXT A;  2C49 A;  4EBU A;  4E8Y A;  3NM3 A;  4S1I B;  4K8P A;  5TQI A;  3RSG A;  4KBE A;  3RQH A;  4C13 A;  3EWM A;  3W4S A;  3Q1Y A;  1EKQ A;  1E8C A;  3B1P A;  4LC4 A;  5BYD A;  2FV7 A;  2VAR A;  2UAG A;  2DCN A;  3RM5 A; 
#chains in the Genus database with same CATH homology
 1RFU A;  1LIJ A;  3NC2 A;  2RBC A;  4C5N A;  1EKK A;  1V1B A;  2PKF A;  3BGK A;  3RQQ A;  4S1M A;  4EOH A;  3RTG A;  4DC3 A;  4K9I A;  1VM7 A;  4PVV A;  1TD2 A;  2ABS A;  4DU5 A;  3QAI A;  5C40 A;  3IN1 A;  3RQ2 A;  1TZ6 A;  3UQ6 A;  4O1L A;  4K8K A;  4B8S A;  5C3Y A;  1UB0 A;  4YWR A;  3RT9 A;  1ESQ A;  2HQQ A;  1RK2 A;  3GBU A;  3B1Q A;  3MBH A;  2AWD A;  3B1R A;  3RTB A;  1LII A;  3DZV A;  5F0Z A;  2QCV A;  4E84 A;  2YXU A;  3N1C A;  3RSQ A;  1LIO A;  3K9E A;  1YGJ A;  3RY7 A;  4XF7 A;  5C41 A;  3HJ6 A;  3RU2 A;  4E8Z A;  3NBV A;  2A9Y A;  3RU3 A;  3UMP A;  3RSS A;  1GQT A;  4EN4 A;  3RTD A;  2AA0 A;  5CM5 A;  3IQ0 A;  1RKS A;  4O1G A;  3NL6 A;  1RKA A;  4GM6 A;  3VAS A;  4LCA A;  5BYF A;  5CGA A;  1L2L A;  3NCA A;  1RKD A;  3RS8 A;  3LKI A;  5F11 A;  3MBJ A;  3RPH A;  2PKN A;  3KEU A;  2HLZ A;  5BYC A;  4JKS A;  3NL5 A;  3CQD A;  4WJM A;  1JXI A;  3UBO A;  1YHJ A;  3Q92 A;  1YGK A;  4K9C A;  2AJP A;  3NL3 A;  3RSF A;  4S1H A;  3GO7 A;  3RTC A;  3H74 A;  4B8R A;  4XCK A;  2QHP A;  3K5W A;  4C5L A;  4E3A A;  3BF5 A;  3RRJ A;  4K93 A;  2V78 A;  3B1O A;  2AB8 A;  2PKK A;  1RFT A;  1TZ3 A;  3RO4 A;  3I3Y A;  3RQ5 A;  3VAQ A;  5BYE A;  1LHP A;  1JXH A;  4KAH A;  3LHX A;  2C4E A;  1C3Q A;  2R3E A;  3H49 A;  4U7X A;  3RQX A;  3HYO A;  3UQD A;  3IH0 A;  2I6B A;  1LIK A;  4N09 A;  4EUM A;  1DGM A;  2A9Z A;  3HPD A;  5TRW A;  3RS9 A;  3PL2 A;  5EY7 A;  3RRB A;  4C5K A;  1WYE A;  1KYH A;  3KD6 A;  2AX3 A;  2F02 A;  2JG5 A;  2AFB A;  3LJS A;  4C5J A;  4X8F A;  4E8W A;  4KAN A;  2DDO A;  1U2X A;  4JJP A;  3KZH A;  2HW1 A;  5C3Z A;  1LHR A;  4K8T A;  2Q5R A;  4KAL A;  1V19 A;  5B6A A;  1VK4 A;  1RFV A;  3RTE A;  3FHX A;  3LOO A;  4N08 A;  3DRW A;  3IKH A;  4E69 A;  3RRE A;  3B3L A;  3OTX A;  3UQ9 A;  1TYY A;  1UA4 A;  2NWH A;  3B1N A;  3NBW A;  2F7K A;  5EYN A;  3UQE A;  2PKM A;  3RQ8 A;  2XTB A;  4LBX A;  5CGE A;  5COJ A;  4S1I A;  3HIC A;  4JKU A;  4C5M A;  4LBG A;  3GO6 A;  3RPZ A;  4XDA A;  4YL5 A;  3RRF A;  2I6A A;  2AJR A;  4KAD A;  3UMO A;  3JUL A;  4EBU A;  1VI9 A;  3QA2 A;  3NL2 A;  2I5B A;  3NC9 A;  2DDM A;  3KTN A;  2JG1 A;  2ABQ A;  2R3B A;  3NM1 A;  4UBE A;  3IE7 A;  2DDW A;  3ZS7 A;  2JGV A;  3RTA A;  3PZS A;  1BX4 A;  1ESJ A;  4XF6 A;  3FHY A;  3IBQ A;  3RQ6 A;  1V1S A;  4K8C A;  1V1A A;  1GC5 A;  2YXT A;  2C49 A;  4E8Y A;  3NM3 A;  4S1I B;  4K8P A;  5TQI A;  3RSG A;  4KBE A;  3RQH A;  3EWM A;  3W4S A;  3Q1Y A;  1EKQ A;  5BYD A;  3B1P A;  4LC4 A;  2FV7 A;  2VAR A;  3RT7 A;  2DCN A;  3RM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...