5BYPA

Crystal structure of an uncharacterized protein (bacegg_01585) from bacteroides eggerthii dsm 20697 at 2.60 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
b'DWVGKWQLREYQYPDGKVQKVDSIFYGFQKGSFLAYCMNKSGSYEGFYGYYKLKDDEISITLWPDNSSGNEAAHEELVNSASYKNFFGWGDTGERTFKVEELTDKKMRLNYEGTKYVFRKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of an uncharacterized protein (BACEGG_01585) from Bacteroides eggerthii DSM 20697 at 2.60 A resolution
rcsb
source organism Bacteroides eggerthii dsm 20697
molecule tags Unknown function
total genus 27
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.280 Mainly Beta Beta Barrel Lipocalin Lipocalin 5bypA00
5BYPA 3HTYA 4QRLA
chains in the Genus database with same CATH superfamily
2BT9A 3PQSA 4HPBA 2ANSA 3KVNA 4NNSA 1EW3A 1VWJB 4HFOA 1RSTB 1BBPA 1N43A 1NQNA 1SY2A 3ZW1B 2C4IA 2RTCB 1RSUB 2C1SA 2IZEB 1N9YA 1JV4A 3BU9A 3FLLA 5EPQA 1SWKA 2A0AA 4NV8A 2FLJA 2A8GA 1HMTA 2XKLA 3BSZE 5BVQA 1SY0A 1MVGA 3LHNA 1VWCB 4MVKA 1VYOA 1SXXA 2X8TA 3I17A 1E02A 2JU8A 3C77X 1ZNHA 3FENA 4FBOA 3ZW0A 4O3XB 3TZSA 1SREA 5B5FA 3C76X 2JGSA 4K19A 1LDQA 1NQMA 4O3YA 4NW4A 1YIVA 2FTBA 2WPUA 2DM5A 2L9CA 3VE1A 1BSOA 1GGLA 4YCHA 3T6FA 1DF3A 3BLGA 2A2GA 2MWHA 2K62A 2L5PA 2QCBA 3PPTA 4GRJA 2G7BA 4IB8A 5BVSA 1JBHA 1Y0GA 4GNWA 3UEXA 1MEPA 3UAQA 2OVDA 3PK2A 3RY2A 1VPRA 4AW8A 3BDRA 3C78X 3NADA 1X8UA 2QO6A 2GTLO 4O3WA 3P02A 1KZWA 3O2YA 1LF7A 2RN4A 1GX8A 1SRIA 2X45A 3ZQ3A 1I05A 1SRJA 2AT5X 2ZSCA 1R0UA 4OS8A 2CZTA 2AH7X 3TGCA 4YGGA 1MX8A 3L4RA 5FFHA 1XKIA 2JU3A 4KT5A 1LCZA 3KZAA 2X4MA 3EW2A 2Z4HA 1GT1A 3U03A 1MX7A 2CM9A 4FGIB 3WXQA 2OY1O 4KC7A 1TOUA 3CKGA 4QNIA 1K3BA 5FENA 1LDOA 1EXSA 1ADLA 1HQPA 1SY1A 3Q34A 3AEHA 4ORWA 4YGHA 2OVAA 2HKDA 3MM0A 2AT6X 3S5XA 2R73A 3WZOA 4ZHDA 2KW1A 1IFCA 4O49A 3MBTA 3WOVA 1PMPA 1LKEA 3FIQA 5LJBA 5KICA 3VG5A 2AVIA 3MVFA 3T2WA 3S60A 2A13A 1HQQA 2WQ9A 3BS2A 1EI5A 1RLBE 3NBXX 3JSQA 2LB6A 1LIBA 5B27A 4IRWA 4U8UM 1LPJA 4WFVA 1AQBA 2RCTA 1X8NA 1JJUA 3HWGA 2KTSA 4QYNA 4GK9A 5KHPA 4GJSA 1FENA 4O4OA 4I3CA 2POAA 5EEDA 3WZPA 2RTBB 3FYFA 4I9RA 2DJFA 1VWBB 4U3QA 2FKJA 3B2HA 1RBPA 2KT4B 3K3LA 1SWCA 4AZOA 4OMWA 1SRGA 2AMMX 3OD9A 1GT3A 2CBRA 1KT6A 1ZNDA 1X8OA 3P6HA 2XSTA 1JJJA 4CDCA 1MDCA 4BX5A 5B5GA 2MO5A 4KC8A 1GX3A 1VWGB 1DV9A 1W6FA 1PM1X 5HZ9A 2NNDA 1QY0A 3CKFA 3ZW0B 1KXOA 1YWCA 2LFOA 3NPOA 3U0DA 1VWPB 2OY5O 1T68X 4GU8A 4ON1A 1E2TA 4EQAC 5HA1A 4XMCA 1GT5A 1CRBA 4WHIA 5B3MO 5B10O 1VWIB 1JMXA 1D2UA 2RCQA 4CPFA 1YUPA 3NQ3A 3ZUIA 4IB9A 2C1QA 3HOLA 2LA7A 5DPQA 5HCEC 1STPA 3RDMA 5H9LA 1B0OA 4OS0A 2IZBA 4KH8A 1XCAA 3EM0A 4ORXA 5F1EA 4ORYA 1Y9LA 5HTEA 1WBIA 1EIOA 5FQ6E 3STNA 5HCDC 1HXLA 5LKEA 4B55A 3OE3A 3PH6A 5L8OA 4EFGA 1E5PA 1ZNKA 2WUTA 3RBYA 1KL4A 2AT8X 1QFVA 1SWSA 2O62A 1T0VA 2DJGA 3HWEA 2JW1A 4TNNA 3VG7A 4O4UA 3WYPA 3FELA 4A1YA 4OS3A 4BX7A 5KIDA 3RE5A 1S2PA 3VG4A 4ALBA 2UZ2A 4YMYA 2IZLB 2YMSA 1SLGB 1LELA 4U8UN 2RTJA 2IZHB 2NP1A 2RTDB 3F6ZB 4N7CA 4O4SA 4AZNA 2RTKA 3CMPA 4OEMA 4AYHA 3RKGA 2RTNB 1VWQB 3V8UA 3SLOA 1SWNA 1FTPA 3P6FA 1O1VA 1B56A 3ELXA 5H9KA 5HCCC 1SXUA 4L1NA 1VWMB 2Q4NA 1DZMA 2OL7A 4I60A 1SWTA 2BS6A 1BSQA 1SRHA 3HWFA 4C5PA 1KZXA 2RTRB 3VHMA 3HWDA 4HWMA 4LKTA 1IIUA 4ORUA 1BM5A 4ZR2A 2HLVA 2RTIB 1JMZA 3B2JA 4GGRA 4CDDA 4ZGFA 2IFBA 4EKVA 3EW1A 3MG5A 2F01A 4Y0PA 3TF6A 3NQ9A 4A1HA 3SOTA 2FHLA 4QAEA 1DC9A 2RTFB 1N9MA 5D4AA 2G5LA 1A18A 5HZ5A 1OBQA 4QGVA 1OPAA 3SLJA 1SWEA 2OY8A 2OFRX 1SLDB 3OBLA 3ZWEA 3KFHA 2RTPB 1VWEB 2WEWA 1CBSA 2K23A 4LKPA 4QGWA 4Z28A 1SWFA 2RTLA 2WR6A 1KOIA 2BSZA 3APUA 3N91A 2AL0X 2QOMA 4BOEA 4A60A 3WBGA 4OKAA 5CSEA 1TVQA 4JHQA 4NYQA 4CV7A 4I95A 1MOYA 3SAOA 3T1DA 4ZJ0A 5BVTA 1SXYA 1ERBA 3RDUA 3EBKA 5FQ7E 4BX5B 2FRSA 1HMSA 1HY2A 1L6MA 2G8CO 3CQNA 1HBQA 4GNYA 2JU7A 1N0SA 3STMX 3FW4A 3RZYA 5DG4A 1EALA 1UYNX 1E06A 2OZQA 3QKGA 4GGTA 3T6LA 3T2XA 3JQOA 2A5BA 1I4UA 4M7MA 4YFRA 3MX7A 3BU1A 1PBYA 1UREA 3RDXA 1NP1A 3FDCA 4RUNA 4YFQA 5L3YA 1BJ7A 3OJYC 2RTOB 3IA8A 2RQ0A 4ALOA 2Q2PA 5IO7A 2FR3A 2IZDB 4LZVA 1I04A 4ML7B 1QY2A 1VYFA 2JMBA 1UYOX 2GH7A 4NLIA 1A3YA 2JOZA 2FR2A 1JIWI 3HPEA 4ORRA 1PBOA 5D47A 1Y9TA 1X8PA 1KFFA 4I3BA 3WZQA 2YG2A 1RXJA 4DNEA 5AJBA 2GC9A 4U8UO 1JZUA 1I78A 3P6GA 3WJEA 4UU3A 1S7DA 4BGFA 3CQRA 4KCAA 4Z6JA 2AT3X 3SZHA 3P6DA 1LIFA 1KT5A 4BQUA 4GH7A 3S5VA 5AQ6A 1IFBA 2Z4IA 1RXKA 2RTGB 4IAWA 4BX7B 3AUMO 2OYBO 1KL3A 1CBIA 1KL5A 2F09A 4KIIA 1NBXA 1G5WA 4JO6A 1SWDA 4MIRA 3PQUA 4Y0SA 3CBCA 4TQ2A 3RY1A 1I06A 1W4TA 1ICNA 2W2FA 1STSB 1W5RA 3H3IA 2R74A 3NX1A 4ZGUA 4TKJA 4U46A 2LBAA 2MF6A 4ID2A 3WJBA 1AB0A 5EDBA 1AVDA 1SWHA 2Q2MA 3O19A 4GD9A 1EPBA 2RTEB 1VWOB 1Z24A 3EMMA 4QYPA 4IAXA 4ZH6A 1DZJA 2OFMX 3BX7A 2ZAIA 2A5CA 1HMRA 1N7YA 3TGBA 2WEXA 4Z2VA 4CSBA 2L68A 1OBUA 1VWKB 3DSZA 1EPAA 3F9DA 3IFBA 3PEDA 2RA6A 1O1UA 2BLGA 2FHNX 2RD7C 2VFCA 3ELZA 5JR8A 4COTA 2KD2A 1TOWA 4QGXA 3EYCA 4CPHA 4TKBA 4GKCA 3Q6LA 4YGZA 5F7GA 4RUUA 3ZZVA 4CK4A 1Y55X 5IO5A 3BRNA 3P6EA 1SLFB 1BWYA 3WJCA 1X8QA 2ACPX 4GDAA 1QG5A 4XMHA 4ODDA 4Y59A 4Y0RA 1OEKA 2JN3A 5EZ2A 4HPCA 1U0XA 4Z2OA 4UU2A 3FMZA 2LBVA 5CE4A 1Y52X 4QZTA 1E00A 1LIDA 4YVBA 1GT4A 3ZW2A 1ICMA 2A3FX 4FBRA 3FA9A 1VWHB 2BC3A 1HN2A 2AKQA 3P6CA 1X71A 2NNEA 1QY1A 3ZI8A 4DCBA 4WBKA 2CM4A 2A2UA 5IRAA 2ASNX 1ALBA 3U9PC 3G7XA 3FIDA 1SWLA 3B2KA 1BRPA 3NP1A 4L3RA 5HZQA 5AJCA 4NYRA 1I9HA 1VWRB 2MHDA 3AKNA 1GKAA 1BEBA 2CBSA 3KFFA 4MEEA 4R0BA 1GM6A 1SWJA 3D96A 1KGLA 3FR4A 5LJEA 2PY1A 4GJVA 4U9CA 1RAVA 2G78A 1KT4A 4YCEA 4ZH9A 4CPEA 1LICA 1QABE 1NC9A 1PTSA 1SWRA 5LJGA 1A57A 4NLJA 5L8NA 2FS6A 2W2AA 1ACDA 1SWOA 2I5VO 2IZKA 3PECA 4GE1A 2X46A 4GGZA 3HK1A 2W2BA 1DFVA 1UZ2X 1FEMA 1Y53X 4BBOA 4NV7A 2X8FA 3AKMA 4XMFA 4BX6A 3FR2A 4BJ8A 2QM9A 1KT7A 1SWAA 5F58A 1SY3A 1QFTA 3FEPA 2VDFA 1MUPA 4IABA 1FELA 1SWUA 1GXAA 1TW4A 1B4MA 4MVIA 1VWNB 2FS7A 2FGSA 3D97A 2BHVA 4YDAA 5EDCA 3WJFA 3KFGA 3BX8A 4TKHA 1EIIA 1KQXA 3SZJA 4ARHA 2E4JA 2M4LA 1H91A 3RWXA 1EQDA 1STRB 1YP7A 4I3DA 4QRLA 3UEWA 1U18A 4AZRA 3VHHA 1CBRA 4YH0A 3WZNA 3VE2A 3ZUOA 3B2IA 2CAMA 2Y32A 4EEJA 4ZFXA 1JQPA 2AF5A 3I0AA 1S44A 2QO4A 3APVA 4QZUA 3VHIA 5LJHA 4YBUA 3S26A 2WSJA 5EEEA 3O22A 3GAQA 4IMNA 4N7DA 2QO5A 4XMGA 5HA0A 5LJDA 5HAEA 1IKJA 1DF8A 4GUZA 5H9AA 5HWZA 4IMOA 3UEVA 5D45A 3VPJE 3D9WA 5HTDA 4IBAA 1T8VA 1K24A 4TLJA 4DQ3A 1WUBA 1ZNLA 3FA6A 1TXLA 4MVLA 5L8IA 2PI3O 3RDOA 2Y3FA 4I9SA 1KT3A 2X55A 3VU1A 5D48A 1MK5A 4NP1A 3EC5A 4Y5DA 5CHKA 4CPHB 2R56A 4D6AA 2P8GA 5FQ8E 1SMPI 3VGWA 4D6BA 1AVGI 2GTLM 3PDFA 3PH5A 4WFUA 1QQSA 2OFBA 4HPAA 2OL8O 1SWQA 4OELA 4ZHGA 2X56A 5K68A 4Z27A 1JJXA 1BLRA 5B11O 5HZ8A 3APWA 1IKEA 1RXHA 1SLEB 1NGLA 2GJ5A 5F6ZA 3D95A 5D8JA 1VWAB 4AZQA 1CBQA 4A8ZA 5LJCA 4JNJA 3SLTA 1LNMA 1LUQA 1SWPA 2EU7X 3DTQA 1PEEA 2HMBA 1X89A 4AZMA 5C0NA 5K06A 2X34A 1LFOA 2G79A 4IB6A 2X8SA 3ZW1A 1DZPA 1EUOA 2HNXA 2L67A 4QQ1A 4XMEA 1ERXA 2OFAA 4XMDA 3WVMA 1B8EA 1GKAB 5CYBA 5B2AO 2WWPA 3SZIA 1YP6A 1VWLB 1G74A 2IZIA 4IB7A 4NNTA 3BY0A 2F73A 3NQKA 1ZNEA 4O4XA 3GE2A 1A2DA 2OVEA 1VYGA 4CDEA 3FA8A 3FR5A 1SRFA 2CZUA 2FT9A 4PSQA 3FW5A 4MVEA 1OEEA 2QOSC 3HTYA 4O9SA 3EBWA 1JYDA 1ZNGA 4ZHFA 1YWBA 1YWDA 1OBPA 3LV4A 3TGAA 5K67A 3E3CA 1LIEA 4EXZA 2IZJA 1SXWA 4GDZA 4INNA 1AELA 1IW2A 1BRQA 1OPBA 2ZAGA 5IRUA 1KQWA 4I6SA 3X00A 4YDBA 3STKA 1DZKA 2I5ZO 4Z2PA 1FDQA 2Q9SA 1GX9A 3HOEA 4LQZA 3RE6A 2KTDA 4YKOA 2Q39A 2IZGB 1FE3A 3FA7A 4GETA 1IJ8A 1QWDA 1VWFB 4TJZA 5F2BA 2Y3EA 2ALLX 3KFIA 1HBPA 1CJ5A 2MM3A 2ACOA 1P6PA 4BCSA 1AVEA 2HYSA 2OVSA 4CPIA 2OY7A 4FBVA 1FJ1E 2IZFB 4M6SA 3WJGA 3FEKA 2RTQB 4PJ2A 2VFBA 4HPDA 3PP6A 3WYQA 2AT0X 1SWBA 2FWVA 2UYWA 5BYPA 3NR3A 4ZHCA 2OF8A 2OF9A 1NP4A 2GTLN 4FQBB 3LTWA 5AEOA 5FAZA 4AZPA 4ZHHA 1SA8A 1JYJA 4YBPA 1G85A 2FKGA 4GZVA 5LKFA 4ORSA 1U17A 4DQ4A 3WJDA 5IO6A 3APXA 3D4RA 2WQAE 4MISA 1G7NA 2GTFX 2NNQA 3UEUA 1OEJA 4YFPA 2RTAA 2MJIA 3CR6A 1ZRYA 5B29A 5LJKA 3F8AA 4ES7A 2HZRA 4O3ZA 1ML7A 3VG6A 4CDFA 3NX2A 4JGLA 3QQ2A 2RTMA 1NDJA 4BVMA 2HZQA 1N4JA 3JS1A 1HXZA 1LCVA 5HBSA 2LKKA 2BS5A 4OMXA 4YKMA 2IZAA 5IRWA 1D3SA 2QMIA 3CWKA 2IZCB 4BX6B 1LCWA 4ZCBA 2X32A 5H8TA 1OSPO 3RDSA 3VG2A 3P24A 1O8VA 5F6BA 5JD2A 3VG3A 5IXGA 3CBSA 1BSYA 3RSWA 1MM9A 1SWGA 3B2LA 1VWDB 3KQ0A 4EDEA 4LZUA 4Y0QA 3RDQA 5HZ6A 2N93A 5H9NA 1YWAA 2OL6O 2RTHB
chains in the Genus database with same CATH topology
2BT9A 3PQSA 4HPBA 2ANSA 4NNSA 1EW3A 4HFOA 1BBPA 1SY2A 3ZW1B 5EPQA 1JV4A 3BU9A 3FLLA 2A0AA 2FLJA 1HMTA 2XKLA 3BSZE 5BVQA 1SY0A 1MVGA 3LHNA 4MVKA 1SXXA 2X8TA 3I17A 1E02A 2JU8A 3C77X 1ZNHA 3FENA 4FBOA 3ZW0A 4O3XB 3TZSA 3C76X 4K19A 4O3YA 4NW4A 1YIVA 2FTBA 2DM5A 2L9CA 3VE1A 1BSOA 1GGLA 4YCHA 1DF3A 3BLGA 2A2GA 2MWHA 2K62A 2L5PA 3PPTA 4GRJA 4IB8A 2G7BA 5BVSA 1JBHA 4GNWA 3UEXA 3UAQA 2OVDA 1VPRA 4AW8A 3BDRA 3C78X 3NADA 1X8UA 2QO6A 2GTLO 4O3WA 3P02A 1KZWA 3O2YA 1LF7A 2RN4A 1GX8A 2X45A 3ZQ3A 1I05A 4OS8A 2AT5X 1R0UA 2AH7X 2CZTA 3TGCA 4YGGA 1MX8A 3L4RA 5FFHA 1XKIA 2JU3A 4KT5A 3KZAA 2Z4HA 1GT1A 3U03A 1MX7A 2CM9A 4FGIB 3WXQA 4KC7A 1TOUA 4QNIA 5FENA 1EXSA 1ADLA 1HQPA 1SY1A 4ORWA 4YGHA 2OVAA 3S5XA 4ZHDA 2AT6X 2R73A 2KW1A 1IFCA 4O49A 3MBTA 3WOVA 1PMPA 1LKEA 3FIQA 5LJBA 3VG5A 3MVFA 3S60A 2A13A 2WQ9A 3BS2A 1EI5A 1RLBE 3NBXX 3JSQA 2LB6A 1LIBA 5B27A 4WFVA 4U8UM 1LPJA 1AQBA 2RCTA 1X8NA 3HWGA 2KTSA 4QYNA 4GK9A 5KHPA 1FENA 4O4OA 4I3CA 2POAA 5EEDA 3FYFA 4I9RA 4U3QA 3B2HA 1RBPA 2KT4B 3K3LA 4AZOA 4OMWA 2AMMX 3OD9A 1GT3A 2CBRA 1KT6A 1ZNDA 1X8OA 3P6HA 2XSTA 1JJJA 1MDCA 2MO5A 4KC8A 1DV9A 1PM1X 5HZ9A 2NNDA 1QY0A 3ZW0B 1KXOA 1YWCA 2LFOA 3NPOA 3U0DA 1T68X 4GU8A 4ON1A 4EQAC 5HA1A 4XMCA 1GT5A 1CRBA 4WHIA 1D2UA 2RCQA 1YUPA 3NQ3A 3ZUIA 4IB9A 3HOLA 2LA7A 5DPQA 5HCEC 5H9LA 1B0OA 4OS0A 4ORXA 4KH8A 1XCAA 3EM0A 5F1EA 5HTEA 4ORYA 1Y9LA 1EIOA 5FQ6E 3STNA 5HCDC 5LKEA 3OE3A 3PH6A 5L8OA 4EFGA 1E5PA 1ZNKA 2WUTA 3RBYA 2AT8X 1QFVA 3VG7A 2O62A 1T0VA 3HWEA 2JW1A 4TNNA 4A1YA 4O4UA 3FELA 4OS3A 5KIDA 1S2PA 3VG4A 4ALBA 4YMYA 2YMSA 4AZNA 4U8UN 3F6ZB 2NP1A 4N7CA 4O4SA 3CMPA 4AYHA 3RKGA 3V8UA 1FTPA 3P6FA 1O1VA 1B56A 3ELXA 5H9KA 5HCCC 1SXUA 4L1NA 2Q4NA 1DZMA 1KZXA 2BS6A 1BSQA 3HWFA 3HWDA 4HWMA 4LKTA 1IIUA 4ORUA 1BM5A 4ZR2A 2HLVA 4ZGFA 3B2JA 2IFBA 3TF6A 4Y0PA 4A1HA 3NQ9A 3SOTA 4QAEA 1DC9A 5D4AA 1A18A 5HZ5A 1OBQA 4QGVA 1OPAA 2OFRX 3OBLA 3ZWEA 3KFHA 2WEWA 1CBSA 2K23A 4LKPA 4QGWA 2WR6A 1KOIA 3APUA 3N91A 2AL0X 4BOEA 4A60A 3WBGA 1TVQA 4NYQA 4CV7A 4I95A 3T1DA 3SAOA 4ZJ0A 5BVTA 1SXYA 1ERBA 3EBKA 5FQ7E 2FRSA 1HMSA 1L6MA 3CQNA 1HBQA 4GNYA 2JU7A 1N0SA 3STMX 3FW4A 3RZYA 5DG4A 1EALA 3QKGA 1E06A 2OZQA 3JQOA 1I4UA 4M7MA 4YFRA 3MX7A 3BU1A 1UREA 1NP1A 4RUNA 4YFQA 1BJ7A 3OJYC 5IO7A 3IA8A 2RQ0A 4ALOA 2Q2PA 2FR3A 4LZVA 1I04A 4ML7B 1QY2A 1VYFA 2JMBA 4NLIA 1A3YA 2JOZA 2FR2A 1JIWI 4ORRA 5D47A 1PBOA 1Y9TA 1X8PA 4I3BA 2YG2A 5AJBA 2GC9A 4U8UO 1JZUA 3P6GA 3WJEA 4UU3A 1S7DA 3CQRA 4KCAA 2AT3X 3P6DA 1LIFA 1KT5A 4BQUA 4GH7A 3S5VA 5AQ6A 1IFBA 2Z4IA 4IAWA 1CBIA 1G5WA 4KIIA 2F09A 4Y0SA 4MIRA 3PQUA 3CBCA 4TQ2A 1I06A 1ICNA 2W2FA 3H3IA 2R74A 3NX1A 4ZGUA 4TKJA 2LBAA 4ID2A 3WJBA 1AB0A 5EDBA 2Q2MA 3O19A 1EPBA 3EMMA 1Z24A 4QYPA 4ZH6A 4IAXA 1DZJA 2OFMX 3BX7A 2ZAIA 1HMRA 3TGBA 2WEXA 4CSBA 2L68A 1OBUA 4IMNA 3DSZA 1EPAA 3F9DA 3IFBA 3PEDA 2RA6A 1O1UA 2BLGA 2RD7C 5JR8A 3ELZA 4COTA 2KD2A 1TOWA 4QGXA 3EYCA 4TKBA 4GKCA 3Q6LA 4YGZA 5F7GA 4RUUA 3ZZVA 4CK4A 5IO5A 3BRNA 3P6EA 1BWYA 3WJCA 1X8QA 2ACPX 4XMHA 1QG5A 4ODDA 4Y0RA 1OEKA 2JN3A 5EZ2A 4HPCA 1U0XA 4UU2A 3FMZA 2LBVA 5CE4A 4QZTA 1E00A 1LIDA 1GT4A 3ZW2A 1ICMA 2A3FX 4FBRA 3FA9A 1HN2A 2AKQA 3P6CA 1X71A 2NNEA 1QY1A 3ZI8A 4WBKA 2CM4A 2A2UA 3U9PC 2ASNX 1ALBA 3G7XA 3B2KA 1BRPA 3NP1A 4L3RA 5HZQA 5AJCA 4NYRA 2MHDA 3AKNA 3KFFA 1GKAA 1BEBA 2CBSA 4R0BA 1GM6A 3D96A 1KGLA 3FR4A 5LJEA 2PY1A 4U9CA 4ZH9A 2G78A 4YCEA 1KT4A 1LICA 1QABE 5LJGA 1A57A 4NLJA 5L8NA 2FS6A 2W2AA 1ACDA 4GE1A 3PECA 2X46A 3HK1A 2W2BA 1DFVA 1UZ2X 1FEMA 4XMFA 2X8FA 3AKMA 3FR2A 2QM9A 1KT7A 5F58A 1SY3A 1QFTA 3FEPA 1MUPA 4IABA 1FELA 1GXAA 1TW4A 1B4MA 4MVIA 2FS7A 3D97A 2BHVA 4YDAA 5EDCA 3WJFA 3KFGA 3BX8A 4TKHA 1EIIA 1KQXA 4ARHA 2E4JA 2M4LA 1H91A 3RWXA 1EQDA 1YP7A 4QRLA 4I3DA 3UEWA 1U18A 4AZRA 1CBRA 4YH0A 3ZUOA 3VE2A 3B2IA 4EEJA 4ZFXA 3I0AA 1S44A 2QO4A 3APVA 4QZUA 5LJHA 4YBUA 3S26A 2WSJA 5EEEA 3O22A 3GAQA 4N7DA 4XMGA 2QO5A 5HA0A 5LJDA 5HAEA 1IKJA 5H9AA 5HWZA 4IMOA 3UEVA 5D45A 3VPJE 5HTDA 4IBAA 1T8VA 4TLJA 4DQ3A 1ZNLA 3FA6A 1TXLA 4MVLA 5L8IA 4I9SA 1KT3A 3VU1A 5D48A 4NP1A 2R56A 4D6AA 2P8GA 5FQ8E 1SMPI 4D6BA 1AVGI 2GTLM 3PH5A 4WFUA 1QQSA 4HPAA 4ZHGA 1JJXA 1BLRA 5HZ8A 3APWA 1IKEA 1NGLA 2GJ5A 5F6ZA 3D95A 5D8JA 4AZQA 1CBQA 4A8ZA 5LJCA 1LNMA 1PEEA 2EU7X 3DTQA 2HMBA 1X89A 4AZMA 5C0NA 5K06A 1LFOA 2G79A 4IB6A 2X8SA 3ZW1A 1DZPA 1EUOA 2HNXA 2L67A 4QQ1A 4XMEA 1ERXA 4XMDA 3WVMA 1B8EA 1GKAB 5CYBA 2WWPA 1YP6A 1G74A 4IB7A 4NNTA 3BY0A 2F73A 3NQKA 1ZNEA 4O4XA 3GE2A 1A2DA 2OVEA 1VYGA 3FA8A 3FR5A 2CZUA 4PSQA 2FT9A 3FW5A 4MVEA 1OEEA 2QOSC 3HTYA 4O9SA 3EBWA 1JYDA 1ZNGA 4ZHFA 1YWBA 1YWDA 1OBPA 3LV4A 3TGAA 3E3CA 1LIEA 4EXZA 1SXWA 4GDZA 4INNA 1AELA 1IW2A 1BRQA 1OPBA 2ZAGA 1KQWA 4I6SA 4YDBA 3STKA 1DZKA 1FDQA 2Q9SA 1GX9A 3HOEA 4LQZA 2KTDA 4YKOA 2Q39A 3FA7A 1FE3A 4GETA 1QWDA 4TJZA 2ALLX 3KFIA 1HBPA 1CJ5A 2MM3A 2ACOA 1P6PA 2HYSA 2OVSA 4FBVA 3WJGA 4M6SA 3FEKA 4PJ2A 4HPDA 3PP6A 2AT0X 5BYPA 2FWVA 3NR3A 4ZHCA 1NP4A 2GTLN 4FQBB 5AEOA 5FAZA 4AZPA 4ZHHA 1SA8A 1JYJA 4YBPA 1G85A 4GZVA 5LKFA 4ORSA 1U17A 4DQ4A 3WJDA 5IO6A 3APXA 3D4RA 2WQAE 4MISA 1G7NA 2GTFX 2NNQA 3UEUA 1OEJA 4YFPA 5B29A 2MJIA 3CR6A 1ZRYA 5LJKA 3F8AA 4ES7A 2HZRA 4O3ZA 1ML7A 3VG6A 3NX2A 4JGLA 4BVMA 2HZQA 3JS1A 5HBSA 2LKKA 2BS5A 4OMXA 4YKMA 1D3SA 2QMIA 3CWKA 4ZCBA 5H8TA 3VG2A 3P24A 1O8VA 5F6BA 3VG3A 3CBSA 1BSYA 3RSWA 3B2LA 3KQ0A 4EDEA 4LZUA 4Y0QA 5HZ6A 2N93A 5H9NA 1YWAA 5KICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BYP A;  3HTY A;  4QRL A; 
#chains in the Genus database with same CATH topology
 2BT9 A;  3PQS A;  4HPB A;  2ANS A;  3KVN A;  4NNS A;  1EW3 A;  1VWJ B;  4HFO A;  1RST B;  1BBP A;  1N43 A;  1NQN A;  1SY2 A;  3ZW1 B;  2C4I A;  2RTC B;  1RSU B;  2C1S A;  2IZE B;  1N9Y A;  1JV4 A;  3BU9 A;  3FLL A;  5EPQ A;  1SWK A;  2A0A A;  4NV8 A;  2FLJ A;  2A8G A;  1HMT A;  2XKL A;  3BSZ E;  5BVQ A;  1SY0 A;  1MVG A;  3LHN A;  1VWC B;  4MVK A;  1VYO A;  1SXX A;  2X8T A;  3I17 A;  1E02 A;  2JU8 A;  3C77 X;  1ZNH A;  3FEN A;  4FBO A;  3ZW0 A;  4O3X B;  3TZS A;  1SRE A;  5B5F A;  3C76 X;  2JGS A;  4K19 A;  1LDQ A;  1NQM A;  4O3Y A;  4NW4 A;  1YIV A;  2FTB A;  2WPU A;  2DM5 A;  2L9C A;  3VE1 A;  1BSO A;  1GGL A;  4YCH A;  3T6F A;  1DF3 A;  3BLG A;  2A2G A;  2MWH A;  2K62 A;  2L5P A;  2QCB A;  3PPT A;  4GRJ A;  2G7B A;  4IB8 A;  5BVS A;  1JBH A;  1Y0G A;  4GNW A;  3UEX A;  1MEP A;  3UAQ A;  2OVD A;  3PK2 A;  3RY2 A;  1VPR A;  4AW8 A;  3BDR A;  3C78 X;  3NAD A;  1X8U A;  2QO6 A;  2GTL O;  4O3W A;  3P02 A;  1KZW A;  3O2Y A;  1LF7 A;  2RN4 A;  1GX8 A;  1SRI A;  2X45 A;  3ZQ3 A;  1I05 A;  1SRJ A;  2AT5 X;  2ZSC A;  1R0U A;  4OS8 A;  2CZT A;  2AH7 X;  3TGC A;  4YGG A;  1MX8 A;  3L4R A;  5FFH A;  1XKI A;  2JU3 A;  4KT5 A;  1LCZ A;  3KZA A;  2X4M A;  3EW2 A;  2Z4H A;  1GT1 A;  3U03 A;  1MX7 A;  2CM9 A;  4FGI B;  3WXQ A;  2OY1 O;  4KC7 A;  1TOU A;  3CKG A;  4QNI A;  1K3B A;  5FEN A;  1LDO A;  1EXS A;  1ADL A;  1HQP A;  1SY1 A;  3Q34 A;  3AEH A;  4ORW A;  4YGH A;  2OVA A;  2HKD A;  3MM0 A;  2AT6 X;  3S5X A;  2R73 A;  3WZO A;  4ZHD A;  2KW1 A;  1IFC A;  4O49 A;  3MBT A;  3WOV A;  1PMP A;  1LKE A;  3FIQ A;  5LJB A;  5KIC A;  3VG5 A;  2AVI A;  3MVF A;  3T2W A;  3S60 A;  2A13 A;  1HQQ A;  2WQ9 A;  3BS2 A;  1EI5 A;  1RLB E;  3NBX X;  3JSQ A;  2LB6 A;  1LIB A;  5B27 A;  4IRW A;  4U8U M;  1LPJ A;  4WFV A;  1AQB A;  2RCT A;  1X8N A;  1JJU A;  3HWG A;  2KTS A;  4QYN A;  4GK9 A;  5KHP A;  4GJS A;  1FEN A;  4O4O A;  4I3C A;  2POA A;  5EED A;  3WZP A;  2RTB B;  3FYF A;  4I9R A;  2DJF A;  1VWB B;  4U3Q A;  2FKJ A;  3B2H A;  1RBP A;  2KT4 B;  3K3L A;  1SWC A;  4AZO A;  4OMW A;  1SRG A;  2AMM X;  3OD9 A;  1GT3 A;  2CBR A;  1KT6 A;  1ZND A;  1X8O A;  3P6H A;  2XST A;  1JJJ A;  4CDC A;  1MDC A;  4BX5 A;  5B5G A;  2MO5 A;  4KC8 A;  1GX3 A;  1VWG B;  1DV9 A;  1W6F A;  1PM1 X;  5HZ9 A;  2NND A;  1QY0 A;  3CKF A;  3ZW0 B;  1KXO A;  1YWC A;  2LFO A;  3NPO A;  3U0D A;  1VWP B;  2OY5 O;  1T68 X;  4GU8 A;  4ON1 A;  1E2T A;  4EQA C;  5HA1 A;  4XMC A;  1GT5 A;  1CRB A;  4WHI A;  5B3M O;  5B10 O;  1VWI B;  1JMX A;  1D2U A;  2RCQ A;  4CPF A;  1YUP A;  3NQ3 A;  3ZUI A;  4IB9 A;  2C1Q A;  3HOL A;  2LA7 A;  5DPQ A;  5HCE C;  1STP A;  3RDM A;  5H9L A;  1B0O A;  4OS0 A;  2IZB A;  4KH8 A;  1XCA A;  3EM0 A;  4ORX A;  5F1E A;  4ORY A;  1Y9L A;  5HTE A;  1WBI A;  1EIO A;  5FQ6 E;  3STN A;  5HCD C;  1HXL A;  5LKE A;  4B55 A;  3OE3 A;  3PH6 A;  5L8O A;  4EFG A;  1E5P A;  1ZNK A;  2WUT A;  3RBY A;  1KL4 A;  2AT8 X;  1QFV A;  1SWS A;  2O62 A;  1T0V A;  2DJG A;  3HWE A;  2JW1 A;  4TNN A;  3VG7 A;  4O4U A;  3WYP A;  3FEL A;  4A1Y A;  4OS3 A;  4BX7 A;  5KID A;  3RE5 A;  1S2P A;  3VG4 A;  4ALB A;  2UZ2 A;  4YMY A;  2IZL B;  2YMS A;  1SLG B;  1LEL A;  4U8U N;  2RTJ A;  2IZH B;  2NP1 A;  2RTD B;  3F6Z B;  4N7C A;  4O4S A;  4AZN A;  2RTK A;  3CMP A;  4OEM A;  4AYH A;  3RKG A;  2RTN B;  1VWQ B;  3V8U A;  3SLO A;  1SWN A;  1FTP A;  3P6F A;  1O1V A;  1B56 A;  3ELX A;  5H9K A;  5HCC C;  1SXU A;  4L1N A;  1VWM B;  2Q4N A;  1DZM A;  2OL7 A;  4I60 A;  1SWT A;  2BS6 A;  1BSQ A;  1SRH A;  3HWF A;  4C5P A;  1KZX A;  2RTR B;  3VHM A;  3HWD A;  4HWM A;  4LKT A;  1IIU A;  4ORU A;  1BM5 A;  4ZR2 A;  2HLV A;  2RTI B;  1JMZ A;  3B2J A;  4GGR A;  4CDD A;  4ZGF A;  2IFB A;  4EKV A;  3EW1 A;  3MG5 A;  2F01 A;  4Y0P A;  3TF6 A;  3NQ9 A;  4A1H A;  3SOT A;  2FHL A;  4QAE A;  1DC9 A;  2RTF B;  1N9M A;  5D4A A;  2G5L A;  1A18 A;  5HZ5 A;  1OBQ A;  4QGV A;  1OPA A;  3SLJ A;  1SWE A;  2OY8 A;  2OFR X;  1SLD B;  3OBL A;  3ZWE A;  3KFH A;  2RTP B;  1VWE B;  2WEW A;  1CBS A;  2K23 A;  4LKP A;  4QGW A;  4Z28 A;  1SWF A;  2RTL A;  2WR6 A;  1KOI A;  2BSZ A;  3APU A;  3N91 A;  2AL0 X;  2QOM A;  4BOE A;  4A60 A;  3WBG A;  4OKA A;  5CSE A;  1TVQ A;  4JHQ A;  4NYQ A;  4CV7 A;  4I95 A;  1MOY A;  3SAO A;  3T1D A;  4ZJ0 A;  5BVT A;  1SXY A;  1ERB A;  3RDU A;  3EBK A;  5FQ7 E;  4BX5 B;  2FRS A;  1HMS A;  1HY2 A;  1L6M A;  2G8C O;  3CQN A;  1HBQ A;  4GNY A;  2JU7 A;  1N0S A;  3STM X;  3FW4 A;  3RZY A;  5DG4 A;  1EAL A;  1UYN X;  1E06 A;  2OZQ A;  3QKG A;  4GGT A;  3T6L A;  3T2X A;  3JQO A;  2A5B A;  1I4U A;  4M7M A;  4YFR A;  3MX7 A;  3BU1 A;  1PBY A;  1URE A;  3RDX A;  1NP1 A;  3FDC A;  4RUN A;  4YFQ A;  5L3Y A;  1BJ7 A;  3OJY C;  2RTO B;  3IA8 A;  2RQ0 A;  4ALO A;  2Q2P A;  5IO7 A;  2FR3 A;  2IZD B;  4LZV A;  1I04 A;  4ML7 B;  1QY2 A;  1VYF A;  2JMB A;  1UYO X;  2GH7 A;  4NLI A;  1A3Y A;  2JOZ A;  2FR2 A;  1JIW I;  3HPE A;  4ORR A;  1PBO A;  5D47 A;  1Y9T A;  1X8P A;  1KFF A;  4I3B A;  3WZQ A;  2YG2 A;  1RXJ A;  4DNE A;  5AJB A;  2GC9 A;  4U8U O;  1JZU A;  1I78 A;  3P6G A;  3WJE A;  4UU3 A;  1S7D A;  4BGF A;  3CQR A;  4KCA A;  4Z6J A;  2AT3 X;  3SZH A;  3P6D A;  1LIF A;  1KT5 A;  4BQU A;  4GH7 A;  3S5V A;  5AQ6 A;  1IFB A;  2Z4I A;  1RXK A;  2RTG B;  4IAW A;  4BX7 B;  3AUM O;  2OYB O;  1KL3 A;  1CBI A;  1KL5 A;  2F09 A;  4KII A;  1NBX A;  1G5W A;  4JO6 A;  1SWD A;  4MIR A;  3PQU A;  4Y0S A;  3CBC A;  4TQ2 A;  3RY1 A;  1I06 A;  1W4T A;  1ICN A;  2W2F A;  1STS B;  1W5R A;  3H3I A;  2R74 A;  3NX1 A;  4ZGU A;  4TKJ A;  4U46 A;  2LBA A;  2MF6 A;  4ID2 A;  3WJB A;  1AB0 A;  5EDB A;  1AVD A;  1SWH A;  2Q2M A;  3O19 A;  4GD9 A;  1EPB A;  2RTE B;  1VWO B;  1Z24 A;  3EMM A;  4QYP A;  4IAX A;  4ZH6 A;  1DZJ A;  2OFM X;  3BX7 A;  2ZAI A;  2A5C A;  1HMR A;  1N7Y A;  3TGB A;  2WEX A;  4Z2V A;  4CSB A;  2L68 A;  1OBU A;  1VWK B;  3DSZ A;  1EPA A;  3F9D A;  3IFB A;  3PED A;  2RA6 A;  1O1U A;  2BLG A;  2FHN X;  2RD7 C;  2VFC A;  3ELZ A;  5JR8 A;  4COT A;  2KD2 A;  1TOW A;  4QGX A;  3EYC A;  4CPH A;  4TKB A;  4GKC A;  3Q6L A;  4YGZ A;  5F7G A;  4RUU A;  3ZZV A;  4CK4 A;  1Y55 X;  5IO5 A;  3BRN A;  3P6E A;  1SLF B;  1BWY A;  3WJC A;  1X8Q A;  2ACP X;  4GDA A;  1QG5 A;  4XMH A;  4ODD A;  4Y59 A;  4Y0R A;  1OEK A;  2JN3 A;  5EZ2 A;  4HPC A;  1U0X A;  4Z2O A;  4UU2 A;  3FMZ A;  2LBV A;  5CE4 A;  1Y52 X;  4QZT A;  1E00 A;  1LID A;  4YVB A;  1GT4 A;  3ZW2 A;  1ICM A;  2A3F X;  4FBR A;  3FA9 A;  1VWH B;  2BC3 A;  1HN2 A;  2AKQ A;  3P6C A;  1X71 A;  2NNE A;  1QY1 A;  3ZI8 A;  4DCB A;  4WBK A;  2CM4 A;  2A2U A;  5IRA A;  2ASN X;  1ALB A;  3U9P C;  3G7X A;  3FID A;  1SWL A;  3B2K A;  1BRP A;  3NP1 A;  4L3R A;  5HZQ A;  5AJC A;  4NYR A;  1I9H A;  1VWR B;  2MHD A;  3AKN A;  1GKA A;  1BEB A;  2CBS A;  3KFF A;  4MEE A;  4R0B A;  1GM6 A;  1SWJ A;  3D96 A;  1KGL A;  3FR4 A;  5LJE A;  2PY1 A;  4GJV A;  4U9C A;  1RAV A;  2G78 A;  1KT4 A;  4YCE A;  4ZH9 A;  4CPE A;  1LIC A;  1QAB E;  1NC9 A;  1PTS A;  1SWR A;  5LJG A;  1A57 A;  4NLJ A;  5L8N A;  2FS6 A;  2W2A A;  1ACD A;  1SWO A;  2I5V O;  2IZK A;  3PEC A;  4GE1 A;  2X46 A;  4GGZ A;  3HK1 A;  2W2B A;  1DFV A;  1UZ2 X;  1FEM A;  1Y53 X;  4BBO A;  4NV7 A;  2X8F A;  3AKM A;  4XMF A;  4BX6 A;  3FR2 A;  4BJ8 A;  2QM9 A;  1KT7 A;  1SWA A;  5F58 A;  1SY3 A;  1QFT A;  3FEP A;  2VDF A;  1MUP A;  4IAB A;  1FEL A;  1SWU A;  1GXA A;  1TW4 A;  1B4M A;  4MVI A;  1VWN B;  2FS7 A;  2FGS A;  3D97 A;  2BHV A;  4YDA A;  5EDC A;  3WJF A;  3KFG A;  3BX8 A;  4TKH A;  1EII A;  1KQX A;  3SZJ A;  4ARH A;  2E4J A;  2M4L A;  1H91 A;  3RWX A;  1EQD A;  1STR B;  1YP7 A;  4I3D A;  4QRL A;  3UEW A;  1U18 A;  4AZR A;  3VHH A;  1CBR A;  4YH0 A;  3WZN A;  3VE2 A;  3ZUO A;  3B2I A;  2CAM A;  2Y32 A;  4EEJ A;  4ZFX A;  1JQP A;  2AF5 A;  3I0A A;  1S44 A;  2QO4 A;  3APV A;  4QZU A;  3VHI A;  5LJH A;  4YBU A;  3S26 A;  2WSJ A;  5EEE A;  3O22 A;  3GAQ A;  4IMN A;  4N7D A;  2QO5 A;  4XMG A;  5HA0 A;  5LJD A;  5HAE A;  1IKJ A;  1DF8 A;  4GUZ A;  5H9A A;  5HWZ A;  4IMO A;  3UEV A;  5D45 A;  3VPJ E;  3D9W A;  5HTD A;  4IBA A;  1T8V A;  1K24 A;  4TLJ A;  4DQ3 A;  1WUB A;  1ZNL A;  3FA6 A;  1TXL A;  4MVL A;  5L8I A;  2PI3 O;  3RDO A;  2Y3F A;  4I9S A;  1KT3 A;  2X55 A;  3VU1 A;  5D48 A;  1MK5 A;  4NP1 A;  3EC5 A;  4Y5D A;  5CHK A;  4CPH B;  2R56 A;  4D6A A;  2P8G A;  5FQ8 E;  1SMP I;  3VGW A;  4D6B A;  1AVG I;  2GTL M;  3PDF A;  3PH5 A;  4WFU A;  1QQS A;  2OFB A;  4HPA A;  2OL8 O;  1SWQ A;  4OEL A;  4ZHG A;  2X56 A;  5K68 A;  4Z27 A;  1JJX A;  1BLR A;  5B11 O;  5HZ8 A;  3APW A;  1IKE A;  1RXH A;  1SLE B;  1NGL A;  2GJ5 A;  5F6Z A;  3D95 A;  5D8J A;  1VWA B;  4AZQ A;  1CBQ A;  4A8Z A;  5LJC A;  4JNJ A;  3SLT A;  1LNM A;  1LUQ A;  1SWP A;  2EU7 X;  3DTQ A;  1PEE A;  2HMB A;  1X89 A;  4AZM A;  5C0N A;  5K06 A;  2X34 A;  1LFO A;  2G79 A;  4IB6 A;  2X8S A;  3ZW1 A;  1DZP A;  1EUO A;  2HNX A;  2L67 A;  4QQ1 A;  4XME A;  1ERX A;  2OFA A;  4XMD A;  3WVM A;  1B8E A;  1GKA B;  5CYB A;  5B2A O;  2WWP A;  3SZI A;  1YP6 A;  1VWL B;  1G74 A;  2IZI A;  4IB7 A;  4NNT A;  3BY0 A;  2F73 A;  3NQK A;  1ZNE A;  4O4X A;  3GE2 A;  1A2D A;  2OVE A;  1VYG A;  4CDE A;  3FA8 A;  3FR5 A;  1SRF A;  2CZU A;  2FT9 A;  4PSQ A;  3FW5 A;  4MVE A;  1OEE A;  2QOS C;  3HTY A;  4O9S A;  3EBW A;  1JYD A;  1ZNG A;  4ZHF A;  1YWB A;  1YWD A;  1OBP A;  3LV4 A;  3TGA A;  5K67 A;  3E3C A;  1LIE A;  4EXZ A;  2IZJ A;  1SXW A;  4GDZ A;  4INN A;  1AEL A;  1IW2 A;  1BRQ A;  1OPB A;  2ZAG A;  5IRU A;  1KQW A;  4I6S A;  3X00 A;  4YDB A;  3STK A;  1DZK A;  2I5Z O;  4Z2P A;  1FDQ A;  2Q9S A;  1GX9 A;  3HOE A;  4LQZ A;  3RE6 A;  2KTD A;  4YKO A;  2Q39 A;  2IZG B;  1FE3 A;  3FA7 A;  4GET A;  1IJ8 A;  1QWD A;  1VWF B;  4TJZ A;  5F2B A;  2Y3E A;  2ALL X;  3KFI A;  1HBP A;  1CJ5 A;  2MM3 A;  2ACO A;  1P6P A;  4BCS A;  1AVE A;  2HYS A;  2OVS A;  4CPI A;  2OY7 A;  4FBV A;  1FJ1 E;  2IZF B;  4M6S A;  3WJG A;  3FEK A;  2RTQ B;  4PJ2 A;  2VFB A;  4HPD A;  3PP6 A;  3WYQ A;  2AT0 X;  1SWB A;  2FWV A;  2UYW A;  5BYP A;  3NR3 A;  4ZHC A;  2OF8 A;  2OF9 A;  1NP4 A;  2GTL N;  4FQB B;  3LTW A;  5AEO A;  5FAZ A;  4AZP A;  4ZHH A;  1SA8 A;  1JYJ A;  4YBP A;  1G85 A;  2FKG A;  4GZV A;  5LKF A;  4ORS A;  1U17 A;  4DQ4 A;  3WJD A;  5IO6 A;  3APX A;  3D4R A;  2WQA E;  4MIS A;  1G7N A;  2GTF X;  2NNQ A;  3UEU A;  1OEJ A;  4YFP A;  2RTA A;  2MJI A;  3CR6 A;  1ZRY A;  5B29 A;  5LJK A;  3F8A A;  4ES7 A;  2HZR A;  4O3Z A;  1ML7 A;  3VG6 A;  4CDF A;  3NX2 A;  4JGL A;  3QQ2 A;  2RTM A;  1NDJ A;  4BVM A;  2HZQ A;  1N4J A;  3JS1 A;  1HXZ A;  1LCV A;  5HBS A;  2LKK A;  2BS5 A;  4OMX A;  4YKM A;  2IZA A;  5IRW A;  1D3S A;  2QMI A;  3CWK A;  2IZC B;  4BX6 B;  1LCW A;  4ZCB A;  2X32 A;  5H8T A;  1OSP O;  3RDS A;  3VG2 A;  3P24 A;  1O8V A;  5F6B A;  5JD2 A;  3VG3 A;  5IXG A;  3CBS A;  1BSY A;  3RSW A;  1MM9 A;  1SWG A;  3B2L A;  1VWD B;  3KQ0 A;  4EDE A;  4LZU A;  4Y0Q A;  3RDQ A;  5HZ6 A;  2N93 A;  5H9N A;  1YWA A;  2OL6 O;  2RTH B; 
#chains in the Genus database with same CATH homology
 2BT9 A;  3PQS A;  4HPB A;  2ANS A;  4NNS A;  1EW3 A;  4HFO A;  1BBP A;  1SY2 A;  3ZW1 B;  5EPQ A;  1JV4 A;  3BU9 A;  3FLL A;  2A0A A;  2FLJ A;  1HMT A;  2XKL A;  3BSZ E;  5BVQ A;  1SY0 A;  1MVG A;  3LHN A;  4MVK A;  1SXX A;  2X8T A;  3I17 A;  1E02 A;  2JU8 A;  3C77 X;  1ZNH A;  3FEN A;  4FBO A;  3ZW0 A;  4O3X B;  3TZS A;  3C76 X;  4K19 A;  4O3Y A;  4NW4 A;  1YIV A;  2FTB A;  2DM5 A;  2L9C A;  3VE1 A;  1BSO A;  1GGL A;  4YCH A;  1DF3 A;  3BLG A;  2A2G A;  2MWH A;  2K62 A;  2L5P A;  3PPT A;  4GRJ A;  4IB8 A;  2G7B A;  5BVS A;  1JBH A;  4GNW A;  3UEX A;  3UAQ A;  2OVD A;  1VPR A;  4AW8 A;  3BDR A;  3C78 X;  3NAD A;  1X8U A;  2QO6 A;  2GTL O;  4O3W A;  3P02 A;  1KZW A;  3O2Y A;  1LF7 A;  2RN4 A;  1GX8 A;  2X45 A;  3ZQ3 A;  1I05 A;  4OS8 A;  2AT5 X;  1R0U A;  2AH7 X;  2CZT A;  3TGC A;  4YGG A;  1MX8 A;  3L4R A;  5FFH A;  1XKI A;  2JU3 A;  4KT5 A;  3KZA A;  2Z4H A;  1GT1 A;  3U03 A;  1MX7 A;  2CM9 A;  4FGI B;  3WXQ A;  4KC7 A;  1TOU A;  4QNI A;  5FEN A;  1EXS A;  1ADL A;  1HQP A;  1SY1 A;  4ORW A;  4YGH A;  2OVA A;  3S5X A;  4ZHD A;  2AT6 X;  2R73 A;  2KW1 A;  1IFC A;  4O49 A;  3MBT A;  3WOV A;  1PMP A;  1LKE A;  3FIQ A;  5LJB A;  3VG5 A;  3MVF A;  3S60 A;  2A13 A;  2WQ9 A;  3BS2 A;  1EI5 A;  1RLB E;  3NBX X;  3JSQ A;  2LB6 A;  1LIB A;  5B27 A;  4WFV A;  4U8U M;  1LPJ A;  1AQB A;  2RCT A;  1X8N A;  3HWG A;  2KTS A;  4QYN A;  4GK9 A;  5KHP A;  1FEN A;  4O4O A;  4I3C A;  2POA A;  5EED A;  3FYF A;  4I9R A;  4U3Q A;  3B2H A;  1RBP A;  2KT4 B;  3K3L A;  4AZO A;  4OMW A;  2AMM X;  3OD9 A;  1GT3 A;  2CBR A;  1KT6 A;  1ZND A;  1X8O A;  3P6H A;  2XST A;  1JJJ A;  1MDC A;  2MO5 A;  4KC8 A;  1DV9 A;  1PM1 X;  5HZ9 A;  2NND A;  1QY0 A;  3ZW0 B;  1KXO A;  1YWC A;  2LFO A;  3NPO A;  3U0D A;  1T68 X;  4GU8 A;  4ON1 A;  4EQA C;  5HA1 A;  4XMC A;  1GT5 A;  1CRB A;  4WHI A;  1D2U A;  2RCQ A;  1YUP A;  3NQ3 A;  3ZUI A;  4IB9 A;  3HOL A;  2LA7 A;  5DPQ A;  5HCE C;  5H9L A;  1B0O A;  4OS0 A;  4ORX A;  4KH8 A;  1XCA A;  3EM0 A;  5F1E A;  5HTE A;  4ORY A;  1Y9L A;  1EIO A;  5FQ6 E;  3STN A;  5HCD C;  5LKE A;  3OE3 A;  3PH6 A;  5L8O A;  4EFG A;  1E5P A;  1ZNK A;  2WUT A;  3RBY A;  2AT8 X;  1QFV A;  3VG7 A;  2O62 A;  1T0V A;  3HWE A;  2JW1 A;  4TNN A;  4A1Y A;  4O4U A;  3FEL A;  4OS3 A;  5KID A;  1S2P A;  3VG4 A;  4ALB A;  4YMY A;  2YMS A;  4AZN A;  4U8U N;  3F6Z B;  2NP1 A;  4N7C A;  4O4S A;  3CMP A;  4AYH A;  3RKG A;  3V8U A;  1FTP A;  3P6F A;  1O1V A;  1B56 A;  3ELX A;  5H9K A;  5HCC C;  1SXU A;  4L1N A;  2Q4N A;  1DZM A;  1KZX A;  2BS6 A;  1BSQ A;  3HWF A;  3HWD A;  4HWM A;  4LKT A;  1IIU A;  4ORU A;  1BM5 A;  4ZR2 A;  2HLV A;  4ZGF A;  3B2J A;  2IFB A;  3TF6 A;  4Y0P A;  4A1H A;  3NQ9 A;  3SOT A;  4QAE A;  1DC9 A;  5D4A A;  1A18 A;  5HZ5 A;  1OBQ A;  4QGV A;  1OPA A;  2OFR X;  3OBL A;  3ZWE A;  3KFH A;  2WEW A;  1CBS A;  2K23 A;  4LKP A;  4QGW A;  2WR6 A;  1KOI A;  3APU A;  3N91 A;  2AL0 X;  4BOE A;  4A60 A;  3WBG A;  1TVQ A;  4NYQ A;  4CV7 A;  4I95 A;  3T1D A;  3SAO A;  4ZJ0 A;  5BVT A;  1SXY A;  1ERB A;  3EBK A;  5FQ7 E;  2FRS A;  1HMS A;  1L6M A;  3CQN A;  1HBQ A;  4GNY A;  2JU7 A;  1N0S A;  3STM X;  3FW4 A;  3RZY A;  5DG4 A;  1EAL A;  3QKG A;  1E06 A;  2OZQ A;  3JQO A;  1I4U A;  4M7M A;  4YFR A;  3MX7 A;  3BU1 A;  1URE A;  1NP1 A;  4RUN A;  4YFQ A;  1BJ7 A;  3OJY C;  5IO7 A;  3IA8 A;  2RQ0 A;  4ALO A;  2Q2P A;  2FR3 A;  4LZV A;  1I04 A;  4ML7 B;  1QY2 A;  1VYF A;  2JMB A;  4NLI A;  1A3Y A;  2JOZ A;  2FR2 A;  1JIW I;  4ORR A;  5D47 A;  1PBO A;  1Y9T A;  1X8P A;  4I3B A;  2YG2 A;  5AJB A;  2GC9 A;  4U8U O;  1JZU A;  3P6G A;  3WJE A;  4UU3 A;  1S7D A;  3CQR A;  4KCA A;  2AT3 X;  3P6D A;  1LIF A;  1KT5 A;  4BQU A;  4GH7 A;  3S5V A;  5AQ6 A;  1IFB A;  2Z4I A;  4IAW A;  1CBI A;  1G5W A;  4KII A;  2F09 A;  4Y0S A;  4MIR A;  3PQU A;  3CBC A;  4TQ2 A;  1I06 A;  1ICN A;  2W2F A;  3H3I A;  2R74 A;  3NX1 A;  4ZGU A;  4TKJ A;  2LBA A;  4ID2 A;  3WJB A;  1AB0 A;  5EDB A;  2Q2M A;  3O19 A;  1EPB A;  3EMM A;  1Z24 A;  4QYP A;  4ZH6 A;  4IAX A;  1DZJ A;  2OFM X;  3BX7 A;  2ZAI A;  1HMR A;  3TGB A;  2WEX A;  4CSB A;  2L68 A;  1OBU A;  4IMN A;  3DSZ A;  1EPA A;  3F9D A;  3IFB A;  3PED A;  2RA6 A;  1O1U A;  2BLG A;  2RD7 C;  5JR8 A;  3ELZ A;  4COT A;  2KD2 A;  1TOW A;  4QGX A;  3EYC A;  4TKB A;  4GKC A;  3Q6L A;  4YGZ A;  5F7G A;  4RUU A;  3ZZV A;  4CK4 A;  5IO5 A;  3BRN A;  3P6E A;  1BWY A;  3WJC A;  1X8Q A;  2ACP X;  4XMH A;  1QG5 A;  4ODD A;  4Y0R A;  1OEK A;  2JN3 A;  5EZ2 A;  4HPC A;  1U0X A;  4UU2 A;  3FMZ A;  2LBV A;  5CE4 A;  4QZT A;  1E00 A;  1LID A;  1GT4 A;  3ZW2 A;  1ICM A;  2A3F X;  4FBR A;  3FA9 A;  1HN2 A;  2AKQ A;  3P6C A;  1X71 A;  2NNE A;  1QY1 A;  3ZI8 A;  4WBK A;  2CM4 A;  2A2U A;  3U9P C;  2ASN X;  1ALB A;  3G7X A;  3B2K A;  1BRP A;  3NP1 A;  4L3R A;  5HZQ A;  5AJC A;  4NYR A;  2MHD A;  3AKN A;  3KFF A;  1GKA A;  1BEB A;  2CBS A;  4R0B A;  1GM6 A;  3D96 A;  1KGL A;  3FR4 A;  5LJE A;  2PY1 A;  4U9C A;  4ZH9 A;  2G78 A;  4YCE A;  1KT4 A;  1LIC A;  1QAB E;  5LJG A;  1A57 A;  4NLJ A;  5L8N A;  2FS6 A;  2W2A A;  1ACD A;  4GE1 A;  3PEC A;  2X46 A;  3HK1 A;  2W2B A;  1DFV A;  1UZ2 X;  1FEM A;  4XMF A;  2X8F A;  3AKM A;  3FR2 A;  2QM9 A;  1KT7 A;  5F58 A;  1SY3 A;  1QFT A;  3FEP A;  1MUP A;  4IAB A;  1FEL A;  1GXA A;  1TW4 A;  1B4M A;  4MVI A;  2FS7 A;  3D97 A;  2BHV A;  4YDA A;  5EDC A;  3WJF A;  3KFG A;  3BX8 A;  4TKH A;  1EII A;  1KQX A;  4ARH A;  2E4J A;  2M4L A;  1H91 A;  3RWX A;  1EQD A;  1YP7 A;  4QRL A;  4I3D A;  3UEW A;  1U18 A;  4AZR A;  1CBR A;  4YH0 A;  3ZUO A;  3VE2 A;  3B2I A;  4EEJ A;  4ZFX A;  3I0A A;  1S44 A;  2QO4 A;  3APV A;  4QZU A;  5LJH A;  4YBU A;  3S26 A;  2WSJ A;  5EEE A;  3O22 A;  3GAQ A;  4N7D A;  4XMG A;  2QO5 A;  5HA0 A;  5LJD A;  5HAE A;  1IKJ A;  5H9A A;  5HWZ A;  4IMO A;  3UEV A;  5D45 A;  3VPJ E;  5HTD A;  4IBA A;  1T8V A;  4TLJ A;  4DQ3 A;  1ZNL A;  3FA6 A;  1TXL A;  4MVL A;  5L8I A;  4I9S A;  1KT3 A;  3VU1 A;  5D48 A;  4NP1 A;  2R56 A;  4D6A A;  2P8G A;  5FQ8 E;  1SMP I;  4D6B A;  1AVG I;  2GTL M;  3PH5 A;  4WFU A;  1QQS A;  4HPA A;  4ZHG A;  1JJX A;  1BLR A;  5HZ8 A;  3APW A;  1IKE A;  1NGL A;  2GJ5 A;  5F6Z A;  3D95 A;  5D8J A;  4AZQ A;  1CBQ A;  4A8Z A;  5LJC A;  1LNM A;  1PEE A;  2EU7 X;  3DTQ A;  2HMB A;  1X89 A;  4AZM A;  5C0N A;  5K06 A;  1LFO A;  2G79 A;  4IB6 A;  2X8S A;  3ZW1 A;  1DZP A;  1EUO A;  2HNX A;  2L67 A;  4QQ1 A;  4XME A;  1ERX A;  4XMD A;  3WVM A;  1B8E A;  1GKA B;  5CYB A;  2WWP A;  1YP6 A;  1G74 A;  4IB7 A;  4NNT A;  3BY0 A;  2F73 A;  3NQK A;  1ZNE A;  4O4X A;  3GE2 A;  1A2D A;  2OVE A;  1VYG A;  3FA8 A;  3FR5 A;  2CZU A;  4PSQ A;  2FT9 A;  3FW5 A;  4MVE A;  1OEE A;  2QOS C;  3HTY A;  4O9S A;  3EBW A;  1JYD A;  1ZNG A;  4ZHF A;  1YWB A;  1YWD A;  1OBP A;  3LV4 A;  3TGA A;  3E3C A;  1LIE A;  4EXZ A;  1SXW A;  4GDZ A;  4INN A;  1AEL A;  1IW2 A;  1BRQ A;  1OPB A;  2ZAG A;  1KQW A;  4I6S A;  4YDB A;  3STK A;  1DZK A;  1FDQ A;  2Q9S A;  1GX9 A;  3HOE A;  4LQZ A;  2KTD A;  4YKO A;  2Q39 A;  3FA7 A;  1FE3 A;  4GET A;  1QWD A;  4TJZ A;  2ALL X;  3KFI A;  1HBP A;  1CJ5 A;  2MM3 A;  2ACO A;  1P6P A;  2HYS A;  2OVS A;  4FBV A;  3WJG A;  4M6S A;  3FEK A;  4PJ2 A;  4HPD A;  3PP6 A;  2AT0 X;  5BYP A;  2FWV A;  3NR3 A;  4ZHC A;  1NP4 A;  2GTL N;  4FQB B;  5AEO A;  5FAZ A;  4AZP A;  4ZHH A;  1SA8 A;  1JYJ A;  4YBP A;  1G85 A;  4GZV A;  5LKF A;  4ORS A;  1U17 A;  4DQ4 A;  3WJD A;  5IO6 A;  3APX A;  3D4R A;  2WQA E;  4MIS A;  1G7N A;  2GTF X;  2NNQ A;  3UEU A;  1OEJ A;  4YFP A;  5B29 A;  2MJI A;  3CR6 A;  1ZRY A;  5LJK A;  3F8A A;  4ES7 A;  2HZR A;  4O3Z A;  1ML7 A;  3VG6 A;  3NX2 A;  4JGL A;  4BVM A;  2HZQ A;  3JS1 A;  5HBS A;  2LKK A;  2BS5 A;  4OMX A;  4YKM A;  1D3S A;  2QMI A;  3CWK A;  4ZCB A;  5H8T A;  3VG2 A;  3P24 A;  1O8V A;  5F6B A;  3VG3 A;  3CBS A;  1BSY A;  3RSW A;  3B2L A;  3KQ0 A;  4EDE A;  4LZU A;  4Y0Q A;  5HZ6 A;  2N93 A;  5H9N A;  1YWA A;  5KIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...