5BZWB

Crystal structure of pcdn-27b, an antibody from the pcdn family of hiv-1 antibodies
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
230
structure length
230
Chain Sequence
QVQLQQWGAGLLKPSETLSLTCAVYNESLSAFSWSWIRQFPGQGLEWIGEIDHTTSSNYNPSLKRRINISIDTSKKQFSLKLYSVTAADTAVYYCARGGRKVYHAYWSGYVNNCFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 2B3 HIV Antibody light chain
publication title Early Antibody Lineage Diversification and Independent Limb Maturation Lead to Broad HIV-1 Neutralization Targeting the Env High-Mannose Patch.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2015-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bzwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bzwB01
1B6DA 2HKFH 3D85A 3ROLB 3ZL4L 1WCQA 4DZ8B 1CL7I 1INDH 3WD5L 3O6LL 4QLRA 3EJYC 1L6XA 1L7IL 1FO0B 4OSUH 2W0FA 3O2DA 3GSXA 3PABB 3T0EC 3UTTA 4K7PX 4NT6B 3BWAB 3QIUB 4XCYA 1Q9OB 4ORZC 1MHCA 4KZDH 4XCNA 1D5MA 2YD1A 5B39G 5BRZA 3PV6B 4IRSA 1ZSDB 3I6KA 3NA9L 1YUHB 4XNYL 4KKAC 4U05A 5D1ZD 1A7NH 5A43C 4JJ5B 1QFPA 1S7UB 3UEZA 1IAOA 3L3IA 5IGXH 1ZGLA 4MD0A 1PYWA 2GEEA 3DGGB 1H3PH 3UP1A 3DMMD 2EDWA 2Z8RA 1CICD 1Q94B 3PHOB 1DUYB 1G7LA 3ARFB 4NQXB 2F54D 2ESVB 4PRHB 4DQOL 2ESVE 5LWYH 4PRHE 2BRQA 1R5VA 2J12B 1SBSH 3AXLA 3V0WH 4ZFFB 1D6EB 2PR4L 2B4CL 1E4JA 3JWDH 4FQLH 5LCVL 3ILQD 4OM1L 2QR0B 4H88L 4S0SD 1MELA 1M4KA 1U91A 4G6FB 5D7JA 2VERN 1HINL 4XXCA 2G60H 3RQ3A 1G6RB 1UWXH 2XKSA 3MUGB 4XPTL 1G7QB 4JVUA 4HDIA 4G8IB 1RJLA 2M1KA 3BD5A 1P5VA 1KCUH 2OXGA 4OCRH 2XTJB 4KK5C 1UM5L 2XTJE 3O81A 3GBNL 3A0OA 4H25A 3AY4C 3VCLA 3PNWB 43C9A 4OCSH 3JTTA 2C1PA 3DX6B 4XNXL 1EIBA 1JP5A 3MQIA 4X4ME 3B4NA 5DGRA 5J3HC 1CXKA 4AZ8A 1KJVA 2YPLD 3BKYL 5CLWA 3AC0A 3UTZB 3VGHA 4KKCC 1LDPL 3KGRA 2NY3B 1CXFA 4XNUL 3EYOA 4K3EL 3GSNH 4GBXB 1MHHA 3EJYD 3CZJA 2EKSA 4PY7B 3VFWA 1MY5A 1RK0A 4XX1E 3PWJB 2WW8A 3T0ED 1MI5D 1R3JA 2XZZA 4YDVB 1YA5A 4LRNL 4OLUL 4F33A 2A6IB 3BQUB 4KY1L 3T1FA 5EPMA 1ZT4A 4RWYH 1LK3L 4R90H 3RL1A 4KKAD 3REVA 3U7WL 3LKSA 1FC2D 3NZHH 1G0YR 5A1AA 5CBAB 5MENA 4JRWA 2VB5A 4S1RH 2R56L 1YEIH 3OKKB 2H6PA 2DQHL 4FQCH 2H2SC 1NL0H 1R0AL 3NTCL 1LP9A 3HG1A 2AJSL 2UUDH 1QLEL 3CSBA 2GJZB 1K6QH 1LMKA 4BZ2H 1BQLH 5DJ8A 4K3JH 3ALPA 2XNAB 3QXAA 2P48B 3D69B 1QHOA 2HFEA 1H3VA 1ADQA 3HPJB 5H2BA 4PJDA 2NY6C 1PZUB 3CX2A 4Y19D 3U2SB 4IMKA 3TN0C 3EO1A 2R2CA 4BQ8A 3NFSL 1KPVB 3SGDI 1DBBL 3IB4A 2NLJB 4NRYB 2BVYA 2EEBA 2A74B 4AEFA 1PQZB 3BUTA 4NHCL 4JRYA 5F1SA 4FTVB 3SDAB 3QCVH 1OQOA 4JFDE 4JGMA 3CH8A 5FYKD 3T4AB 2FO4A 1BF8A 2V9QA 1XGYH 4NQCB 4NQCE 1IGML 1U8JA 4KK5D 2V2TB 3DX7A 1Y18A 1UB6A 3HMXH 4NQED 1AGBA 1XCQA 5JR1H 1BHGA 2OK0L 4M3JA 1LE5B 2R0LL 1YPZB 4GKSA 4NWTH 4M5ZL 1TQBB 1NEZA 35C8L 3TBTA 5J3HD 1OSZA 4NJ9H 3S35L 4GAGL 3TH3T 1YNKL 2IADB 1N2RB 4KKCD 1RK1B 5GGVH 2NNAA 4PRPB 5KOMC 4PRPE 4XP9L 1HK6A 3HNTH 4MNQD 5DS8A 1A2YA 4L9LC 4OTXL 5BJTA 1UWEH 5FYKH 5E9DA 2AS5M 1AXSB 4ZXBC 1LE9B 3DV6B 5I6XC 3ARWA 4LSDA 1XMWA 2HYMA 4D0BA 3FQWA 4NCDA 1C16A 1I7TB 3VXOB 4U7MA 4P48A 1DANT 3RPIB 3B9KC 1CGUA 2M26A 5EOCL 3FRUA 3T2NH 4MCZA 2VLRD 2WK2A 4R0LC 2XZAL 4KXZH 1F8TH 5ID1A 7CGTA 43CAB 5K9QI 1XGUB 3MJ7A 3T8XA 1ONQB 2ZPKL 2D2OA 2LU3A 3QEGL 2ATPA 3QNXA 3Q6GH 4LNRA 2H2SD 5GS0L 1H3UA 2CDEA 4NO0B 2AW2A 3BMWA 3IDMB 3IJHB 3DGCR 3S36L 4CDHA 2MOVA 4QGYA 1OAQH 5L0QB 5HDBF 1FYTB 4MVBC 1DDHA 1FYTE 4UZGA 1OPGL 1N4XL 2NY6D 3AS1A 1IM3A 3AS0A 3EYFA 5GGRB 3TN0D 5ITFB 4ZFGL 5A3IC 1IAII 4I0PA 4HUVB 3BRFA 4YIQB 1MFBL 4L4VD 3PWUA 1LEGA 3I02B 1WFUA 1WAAF 2IH3B 3P4MA 5EOTA 2R8SH 4KMQA 2JKXA 2D0GA 3ULSB 1KIRA 1SBBA 2PO6A 1MRCL 1YC8A 4WWKB 3FONA 1FZKA 4P2RD 3DURB 5IG7B 3VDAA 2NY7H 3B5GA 1XF3B 2AJYH 5KN5A 3PJSA 3CMGA 3H7LA 5F7DB 5F89A 3BP5A 4HXBL 5KVGL 4OZHB 1CGWA 1JPFA 4OZHE 2AGJL 5K59E 4M7LL 2JIXB 3C8HA 4U6HA 4YDKH 1FFPB 1UEMA 1C08A 5C92A 4U1SB 3QIUC 4ZUWA 1F3DJ 1G6VK 3QDGA 1FIGL 1NJ9B 4QTIL 1WIUA 4V2BA 3DVIA 4Y7MA 4Q0XH 4JKPH 1OWRM 1NQBA 4DVRH 5HSFA 4CN1A 2BNUB 5I1LB 4ZXBD 5DD0H 2VL5A 4DCQB 2CMRL 4X9BA 1EEUA 4YHIB 4BFGA 3DO3A 3CLFH 3TWCH 3VXQA 4M61B 4WFFE 3B9KD 4XPHL 2XFXB 2G2RB 3ARFC 1F90L 5E1AB 5C0JA 2PYEA 2UUDK 3CCHA 4QHMB 2NY4B 3BHBA 1IMHC 3RAJH 2CO6B 1CF8L 2NZ9C 1FORL 5C0CB 4HMDA 5C0CE 3QCUH 4JZNA 3KWWB 3O3DB 5DYOB 3L3JB 4HGWB 3BGFB 5EC1B 3QQ3B 8FABA 4Y16A 5I8EA 4ZFOB 3WIFA 1A6AB 2CUIA 2PETA 4MVBD 5EN2B 3ZYJA 2HTKC 2QQKH 3WUWA 5A3ID 1JGLH 5IJVB 3WXWH 2XTJC 4JFQA 1MCWW 2R29H 2P5WA 3TNNA 5IIEB 1D9KB 3X11B 2K7PA 3EDFA 1N5AB 2NR6C 3FQRA 1NMCB 2OCFD 3OBAA 3L3OA 1GIGL 4JO4H 2AAVA 5C0DB 3VA2C 1DFBL 4J1UB 1CFQB 5HGBB 2F58L 4RFEB 1PZ5A 3MV8B 3MV8E 4NWUH 4OFKA 1KXVC 4EEEA 4BQCA 1ZANL 4G43B 2NY3C 3MLXH 4Z95H 3CFEB 4MZ3A 3BUYA 3OKEB 4GBXC 2A6DA 4HJJH 2C3WA 3LPGA 1G1CA 4EDWL 4I0KA 5C0EB 1Z9LA 4HUNB 4NZUL 2JE8A 3D85B 1U2HA 5EUOF 1U58A 4XMPL 3QIUD 4RSVA 1NUGA 1KF9B 3BQUC 1S7RA 3UJTL 1CZ8H 3ZKQD 1ZEAH 4KJQC 2W0FB 3GSXB 1A7OH 3CX5K 4WI9A 3UTTB 3V6BR 1DL7H 3UTTE 1T4KA 4XCYB 15C8L 2J6EA 2B1AH 4I77L 1MHCB 2E7LA 4XCNB 5FB8A 4BSWA 1D5MB 5BRZB 1QRNE 5BRZE 3QDHA 1N59A 2VE6A 3I6KB 3NCYS 4IRSB 4PB9H 4TSCH 5A2IH 4UUJA 4E5XA 1HQ4A 4N9GA 3B2VL 2XRAH 5T3ZH 3GK8L 2VAAB 3IETA 1H0DA 4GG6A 1A6UL 4LASL 4RFOH 5DWUL 1FO0H 1EO8H 2R9HC 3NMEA 3VA6A 3S88H 4BK4A 1IAOB 3L3IB 3WIHA 2LAAA 4MJ4A 4MD0B 1ZGLB 1PYWB 5JW4R 4M9OA 2ESVD 4PRHD 5BVPH 1G0XA 1MAMH 2EE9A 3BN9C 1G7LB 2FX8H 3CVHA 1OHQA 4YFLI 4MAUH 4OZIA 4N1CA 4O58L 3ILPA 4QOKA 4YFEA 1P7QA 4HIXH 3KXFA 1QBAA 1R5VB 3AXLB 2DLIA 3B6SA 4G6FD 1QQDA 3SDAC 2FHCA 2DQCL 1YPZF 3NIGE 1G1YA 3FMGH 4QCIA 1YJDC 1ODAA 1DQMH 4PTTA 1U91B 5D7JB 3VH8A 1JZ4A 2XTJD 3CD4A 1FLRL 2OR8A 2NR6D 3O4LA 4Y88A 2VDOL 4YHKH 1TJIL 4JFOA 5I1KH 4H0IA 4CKVX 4HDIB 1RJLB 4ERSH 3P4OA 1ACZA 1YNLL 3WS6A 1TQBC 3ECBA 4XPFL 1JHTA 2YK1H 2B1HL 3F58L 4H25B 4MGXA 1N0XH 3N9GL 1I9RH 3VCLB 43C9B 3H9SA 5D2LF 4Z8FH 3JTTB 2C1PB 1CD8A 3H3KA 4PY8J 3EYSH 5JLZA 5GIRA 4LLAA 3V95A 3VFUA 2NY3D 4WHYH 4GBXD 1AXTH 1KJVB 2HFTA 3ALWA 5EO0B 5I15H 3RUGE 1V3LA 3B8SA 1HNGA 5KS9A 5JW3L 3FJTA 1N3NA 1CXEA 3EYOB 5LXGH 3K4AA 1MHHB 2DQTL 2HLFC 3V4PL 2EKSB 3BQUD 3VFWB 2FIRT 1A8JH 1FVDA 1RK0B 4KJQD 4YFDB 3LB6C 4KU1A 3U4BL 5D7IA 1IAIL 4ONHA 1ZAGA 3KPQA 1R3JB 4ETYA 4O02H 4S1QL 4NJAL 5A2KH 4F33B 5I1EH 2NY2B 3PWLB 3T1FB 5EPMB 2EIBA 4UILL 4WU5A 1ZT4B 1ORSA 2AK1H 3JWNC 3RL1B 3REVB 4GOSA 5DHXB 4OLVL 3QO1A 1SY6A 2BSRA 2K7QA 3LKSB 4P9MH 3ZKMC 2NQCA 3VI3F 1P4IL 3QPXH 4NKIH 4R4BA 4MMZC 5MENB 3MLPA 4GSDL 5MENE 3OGCA 1QBBA 2LE9A 1WWBX 4X9IA 2WUCH 4CMHB 2H6PB 2R9HD 2DMCA 5L0QC 1LP9B 2A9NH 3MJ9A 3WDIA 1LP9E 4YHLH 3HG1B 3VRIA 3HG1E 2C9AA 5JTWA 3BN9D 1DANU 1ZA6A 1MQ8A 5DJ8B 3QXAB 1MCKA 3L1OL 5LBSL 2HFEB 2AP2A 3SKMA 4S1SL 5H2BB 4PJDB 2I24N 1KPRA 1BX2A 4PJDE 4GW4A 4N0CC 4NOFA 3NN8A 4PB0L 3N1PC 3SDAD 3EO1B 1SJVA 5FHAH 4YBQC 4WWKC 1YEGL 3O6FA 1P84J 4OB5H 4NQCD 3QH3A 4JRYB 3OB8A 5D6CB 2ARWA 1ZLSH 4GW5B 1HH6A 1K4CA 3F65A 3TM6A 2HMIC 2FO4B 2CDFA 1U8JB 5CEXA 5FEBA 5DMIH 1KLUA 5IJKC 4XP4L 1Y18B 4QHNA 1UB6B 3QO0A 4UINH 1AGBB 1XCQB 3MLYH 3MA7A 4JKWA 2ICWJ 3P0YL 2HA1A 4GKSB 4LK4A 4PRPD 1JZ7A 4X9FA 1NEZB 3TBTB 2BVOA 5F93C 1OSZB 4GMTH 2IALA 2NNAB 1YJDH 3WFBH 2QSCH 3FAWA 1OAZH 4GAJH 5CJ8A 3LKOB 3WNLA 3MACL 1A2YB 2HLFD 5DS8B 3TV3H 5JXAL 1KBGL 2H32A 4WV1A 5BJTB 4Y89A 5HDLA 5I0ZA 5E9DB 3LB6D 5E9DE 1RURH 3HAEA 2NX5A 4DN4H 2VXVL 4H8WL 2DMBA 4D0BB 1NCTA 3FQWB 1X5JA 1C16B 5BZDA 3HS0A 4TPRH 2NY4C 2ADIA 1T89A 1Y0LA 1WVZA 2UY6A 5DJ0A 1H8OA 3FRUB 4NO0D 4ONGL 3HR6A 3ZKMD 4Z7VA 1EVUA 3ROOA 2FBJH 3BGFC 2D7TH 5ID1B 2J4WL 3MJ7B 3T8XB 4M00A 2ATPB 5I1CH 3QNXB 4CGTA 1DJSA 1K8DA 4LNRB 4PJFF 2CDEB 4GLRH 2C4XA 1FYTD 3T2PA 1IQDA 4LRIC 2FO1A 5IMMA 3CFCH 4PV9A 3R1GL 1QFWM 1EMTL 2PTVA 4DW2L 4Y4FA 1DLFL 3GSQA 1D9KC 3LRHA 3T3PE 5I1IH 1NMCC 2BSED 2E7MA 3N1FC 4N0CD 4YDJA 1IM3B 3EYFB 5BXFA 3CDCA 4PJBE 4I0PB 1S7SA 4YBQD 4KHXH 4WWKD 2D0HA 3PWUB 1LEGB 1A0QH 1I75A 1A3LH 1OCWH 2Q3AA 3P4MB 5EOTB 1C1EH 1KIRB 2FX7L 5CILH 2PO6B 1ZHKA 4GFTB 3FONB 1FZKB 4OIIH 5J89A 3WYRA 5I75B 4AL8H 5HYIA 2JJTA 2HMID 2VZVA 2XTLA 3MREA 2JIXD 4S2SA 1NGQH 5F7NC 5KN5B 1LILA 3PJSB 5BO1H 5F89B 4LLDA 3BP5B 1QYGH 4AMKH 5IBTL 5E70A 1JPFB 4FFYL 5KOVC 1N64H 5BQ7A 1OAYH 2DIJA 3T0XA 4U6HB 5FK9A 2XXMB 3VI4F 4J6RL 1C08B 2YD2A 1UACH 4ZUWB 2CK0L 5IBLC 3S37H 3N1MC 1QPXA 5C3TA 1RFDH 3QDGB 4IRSC 3A6OA 5DQJA 4CVZA 4PRBA 2DKUA 4UDUA 5CIPA 5DMYA 5D72L 2W0LA 4FZEL 4WFFD 2N7BA 2R0ZL 2VL5B 5JIIA 2BK8A 3ULUE 4D2NA 3HNSL 3VXQB 2NY4D 1CBVH 2RCSL 5KJRH 1ZT7A 5C0CD 5C7XH 1D5IH 4PGEA 3ZDYE 1J1OH 5C0JB 3CCHB 1LO0L 3BHBB 3SE9L 5C1MB 1MQKH 3KYKH 4CU7A 2F74A 2OMNA 2FLBT 2X4SA 4K94L 4JZNB 4J3VA 3D5OF 2I9TA 4WI2A 4FXLA 4J3SA 2ICES 8FABB 1GGBL 2AERT 4TSAL 4Y16B 5I8EB 2A77L 1F13A 1C5CH 3WIIL 3WIFB 4ZOCA 4UT9L 5D7JC 1DUZA 2MPAH 2X4NA 4XXCC 5B39A 1D9KD 5GISH 3CVIH 3EZJB 3FN9A 1G9NC 2IPKB 3WUWB 1A9BA 4ODVH 5KTEH 1X4XA 4Y0GA 3GIVA 3LY6A 2V17H 5TDPA 1KB9K 3UTSA 3MV8D 2P5WB 5FM5M 3TNNB 2P5WE 3FQRB 3L3OB 2BERA 3WO4B 4DZBA 3LN9A 5E4EB 2IFGA 1RUAL 5FUZH 1PZ5B 4JPWL 3GSRA 5KZCB 4M6AA 3NACL 2J88H 3TBYA 5E08H 1NBYA 1W72A 4QKXB 1PD6A 3D85D 1JF6A 3IAQA 3MGOA 3EYVB 3INUL 3BUYB 4XXDA 2A6DB 2R69L 4I48A 4AENA 3MUHL 3HI1A 1IGIL 3E8UL 4KTEL 1RHHA 4Y4HA 2R1XA 3UTTD 4O4YH 1U58B 4QXGL 1WBYA 5IBLD 4HIHA 3DSNA 4ESKA 5K9KA 1V5JA 1S7RB 1RUQH 2Z8VC 1YQVH 2NY2C 5BRZD 5JMRA 4IRSD 3CLEL 4HZLA 1N5YL 1T4KB 4KJWC 4R8WL 4YDIH 2YUVA 4F3FA 3LHPL 1V8HA 5FB8B 4BSWB 4EVNA 1T03H 1N59B 2VE6B 4IDLA 1KCVH 4UUJB 4E5XB 1HQ4B 1UZ8A 4N9GB 5TE4L 3SGEI 3TT3H 4JG1L 3IETB 1I7ZA 2IGFL 1H0DB 4GG6B 2BX5A 4GG6E 1I9IL 1MJUL 5J1TC 4LSVH 4XHJC 2CR3A 4ZTPL 5C2BH 3LQAL 1XGQA 1FE8L 2OR9H 5I1HL 1NBVH 1YEDA 5HXMA 5F1OB 1R3HA 1PSKL 3QR2A 3VD3A 1NSNH 5TPWL 2DTML 3B5TA 4OZIB 1CWVA 5AAWA 2ZNWA 1BFTA 3HMWH 2Y5EA 4OZIE 5DD5L 3DRQA 5DRNA 1A6ZA 4QOKB 4HG4J 3F62A 4QOKE 1P7QB 1IJ9A 4QXUH 3KXFB 3ZYOA 4PY8I 3KXFE 2H9GA 3BFOA 3B6SB 1MCCA 1QQDB 5D7JD 2MWCA 3W5NA 3U9UA 1W2KT 5E6IA 2GAZA 5HVFB 4IRZL 3HNVH 1K85A 3BZ4A 1YEKL 4QCIB 4NNPL 3K2UL 4PTTB 2EO9A 2QL1A 3VH8B 3RWIA 4UV4H 1A7RH 1KC5L 1X9QA 4Y8DC 2IPUK 4DUWA 3O4LB 5GS1A 5AD0A 3O4LE 1YEFH 4JFOB 1MVUA 4PJGF 4H20L 4MA7H 4KZEL 3P4OB 4O9HL 1KJ3L 3ECBB 3OTTA 4D9LL 5KVMC 1PFCA 3DPBA 1JHTB 1HHKB 4V1DA 3H9SB 3UTPE 3ZT7A 3H9SE 2CPCA 2FSEA 3ZHDA 5JLZB 5GIRB 3VFUB 2DD8H 2HT3C 2CKBL 3N0PB 4KGLA 4X8JA 3C8KA 4HPYH 3B9EA 3GBLA 5EBWA 5T5NG 3NH7L 1G9NH 2VZ1A 5KS9B 2JF1A 5KS9E 1N3NB 5DD6B 1WSST 2P44B 2D03H 1ES0B 4JY5H 4I3RL 2MCPH 2D7OA 3VFVA 1GOHA 1FVDB 2EH8L 2NY2D 4RAVA 2MKWA 3KPQB 4M6OH 3S4SG 4KJWD 4XCEA 5MEND 1FRGL 4KXZI 2OZ4A 4WU5B 3VGFA 2R1WA 1ORSB 3HUJF 3L5XH 2ZKHL 4H0GA 3QO1B 2BSRB 4L8BA 1Z0MA 3H3PH 3HG1D 4R4BB 3FAXA 4FQPA 5I73B 1RUKL 7FABH 3OGCB 1NKRA 3R06A 3GI9L 2DI8A 1SHMA 1FL5A 3THML 4XHJD 5JW4M 5D1XD 4YHNA 3CDGA 3VRIB 4Z7NE 3OWEA 3P0VH 1ZA6B 2APVA 3C09B 4MXWH 1FHGA 4I0PC 4KQ3H 3TLRA 1QG3A 3MRFA 3SKMB 1BWWA 1KPRB 1BX2B 4GW4B 4LVNB 3NN8B 1QSEA 4JRYD 1F3DH 4K9EH 1OD9A 4QHKI 2PO6C 3F6IA 3GHEL 2PTTA 5I75C 3IS1X 3O6FB 1HKLL 2XQBH 4PLKC 3QH3B 3QCTL 1JGUH 2QTEA 5TE7H 2KH2B 4XVSL 2KBGA 1HH6B 1K4CB 1MCNA 1ADQH 4J3XA 3Q3GA 4C4KO 1YMHA 1ZGLP 5CEXB 4F37F 4LIQE 2GI7A 1P9MA 1KLUB 2XG4A 2IPTH 4PGBA 4QHNB 2D0FA 4YUEH 1NFKA 1SEQL 3MLZL 3MA7B 1Q9LA 1RZJL 3SKNA 2HT3D 4YE4L 3NFPA 1BD2A 1TNMA 2GKIA 4DGVL 2BVOB 5KSVA 4PGDA 1PEZA 2Z31A 1MHEA 2IALB 5E9DD 1MWAA 1IAKA 4G6JH 4HCRA 4MQTB 3ULUC 2AI0H 4WCYH 1TVHB 2W9EH 1NCDH 3IAPA 1A02N 2ICEA 2H32B 4WV1B 3AGVA 4ODXA 5DHYA 3PGDA 3PDDA 2ZWLT 4R26L 1DQJA 3HAEB 4MLSA 2NX5B 1TCRA 1MIEH 5HHNA 3HC3H 2NX5E 1MFCH 2C7UA 5BZDB 4OD1H 4ZS7L 3E3QE 3GSUA 4ZUVA 1B90A 2ADIB 1RZFH 1CFVH 3ARYA 1Y0LB 1MAKA 5DJ0B 2VXTH 2VXQH 4C83A 4MYWB 4Z7VB 3CSPA 4Z7VE 3ROOB 5FM4A 4K7PH 4OGYH 4JHWL 1FNFA 3W39A 1DSFH 1PEWA 3RI5K 4Y16C 3P11H 1K8DB 3G6JA 3OAZK 3JWOC 3RVXC 4LEXH 1IQDB 1NH6A 1GGCH 5IMMB 4PV9B 4OJFL 3MBED 4I0PD 1OF2A 4HJ0C 5GS3A 4FXKB 4Y4FB 3GDBA 4J8RA 4HH9A 5ID0A 5DR5H 1GOFA 4YDJB 5BXFB 3WO4C 4AEHL 5E4EC 4YEFA 1YEJL 2I5YH 1S7SB 2DMKA 2PO6D 2UVFA 1TTFA 1H3WM 4PLKD 2X1WL 4WEUD 1FN4A 2XICA 3BE1L 4ODSL 1S9VA 1BAFL 1CCZA 1RIUL 4BELD 1ZHKB 3WE6A 3I3EA 3AS2A 2EC9T 3LV3A 1NDMA 4WENB 1MFEL 3BKML 1J7VR 5F1NA 5HHPA 4XCCL 1ACYL 2VLJA 4RA0C 3MREB 4LKXA 2WV3A 4S2SB 2OTPA 1KV3A 3TNMA 1E6OL 5FYLE 4LLDB 2YN3A 1QFHA 1AJ7H 1X44A 5BQ7B 3W2DL 5LG1A 1LQSR 3QDGD 5FK9B 3UC0L 4JZOA 4ZTOL 2X1XR 4RNRA 3CFJA 4OF7A 1TTUA 4L9DA 2E7LC 1UVQA 4NM4H 5SV3A 1EEZA 1BEYH 2Y7QA 3SCMA 2EXWC 5DQJB 3SHSA 3WSQH 1U6AL 4CVZB 3ULUD 3RL2A 5IEHA 1NGWA 2W07A 4PRBB 3SPVA 1DBKL 2YPKA 4UDUB 5CIPB 3G5ZA 5HDQL 4AIXA 1SJXA 1MLBA 3FFCA 3BIBX 1DBJL 1UYWL 1XGYL 3B5HA 4DAGL 4QNPE 4HGKC 1VB9A 5DJCA 5CINH 1FFNA 2O61A 3HMXL 4OUUA 1ZT7B 3ARDA 4PGEB 3RZCA 3IDYB 3BEWA 4RQQA 3I6LE 4PJHA 3R8BB 5M7QA 5IB2A 4AEEA 5DMKA 1U92A 4Y16D 5MHSE 2F8VA 2F74B 4QRQA 5B22A 3IYLW 2X4SB 5IM7A 1Q8MA 3RVXD 2I9TB 3PL6A 3SN6N 2D4DA 3ZE1F 3A67L 4NN6B 4HJ0D 5EOQH 5DGQA 2VDRH 3BP7A 1DUZB 3D0VA 4O51A 2P5WD 4XPGL 5B39B 3KNBA 5F9OL 1KB5L 5FDWA 1U2CA 1H3TA 1A9BB 4KVNL 2F5AH 1BQHG 3DROA 1CLOL 2DQDL 3GIVB 4WI5A 5TDPB 1RZ7L 3UTSB 3VXUE 3WS6C 4OI8A 3TPUA 3UTSE 2N56A 4K71B 4YO0A 2OP4L 4EOWL 5KZCD 4PJEB 2XA8H 4UDTA 4PJEE 1UA6H 4WRLA 4DZBB 1NAKH 4CN6A 1EHLL 5D7IF 2VZSA 1JPTL 2VJXA 3GSRB 3QUMH 4HEPG 1J1XH 3BDBA 3TBYB 1OAUH 2ZJSL 1IQWH 1NBYB 1W72B 1TZHB 3FFDA 3MGOB 2LTQB 1J1PH 4HWEH 4HWUA 4XXDB 5CEZH 3MPCA 4I48B 3LEYL 4AENB 3RBGA 3IGAA 3HI1B 4Y4HB 2R1XB 5DD3L 4G6KH 1AQDA 1WBYB 4NQDA 5AWNL 4HIHB 5K9KB 2AQ1A 1FP5A 4WFED 3ARRA 4DTGH 1WZ1H 4G80A 1FFQA 2EXWD 4JE4B 4MZ2A 5DVMA 3JSSA 4HZLB 4OF3A 5I8KL 2BNQA 1U0QA 2UZIH 4F3FB 2BY1A 1T0MA 5I73C 2UWEA 4EVNB 4NSKA 4BA8A 2B0SL 1UZ8B 2Y06L 4NPYA 2KUTA 1I7ZB 2VMFA 4O2FA 4NHUA 3C09C 1RUML 4F15B 2H1PH 4YHML 4M1GH 4QOKD 4J2XA 1XGQB 4K07A 1P7QD 3QJHA 5E2VH 2DQUL 1KPUA 3UJJL 2PNDA 3KXFD 1YEDB 2AEWA 1R3HB 4LVNC 5F7MC 4UIKL 1FAIH 2ADGA 1SYVA 1A6ZB 3DRQB 5DRNB 5LAXA 2FJHA 3WNPA 2J8UF 4MHHI 2BSSA 3O6FC 2V5YA 4JN2A 2H9GB 3GRWL 5GJTH 1IFHH 3Q2CA 3U9UB 4XNQA 3WIHH 4GRWE 5E6IB 3IS0X 3O4LD 4UNUA 2GAZB 3RBSA 3HLAA 2IBGA 3BZ4B 4YH6A 1DBAL 2VN7A 4G9FA 3CVHH 3RWIB 4P57A 3GIZL 5FGCB 1YYLH 1AD0A 5E94A 5FGCE 5EZIL 2NPLX 3QZWB 5GS1B 5CJOH 5AD0B 3UTPD 1MVUB 1R5IB 3H9SD 4LLVA 1T7ZA 3P30L 4JB9H 4LAJH 1CDYA 1KIPA 4G42A 2FX9H 3E1F1 2B5IB 4YEEA 3C8DA 5DZNA 2FSEB 2DLHA 2O5ZH 1QA9A 1L4IA 4F7TA 3MLVL 4D3CL 4G6ML 4DK3A 4JDTL 3O3EA 3C8KB 4X8JB 4EQ2A 1WIPA 1F4WL 2HJLA 3DYMA 4X6EA 4WV1C 5EBWB 3MOQA 3FO0H 3RA7L 4P5KA 4HSQA 3VU2A 1KYOK 2YKLL 4FABH 4L8CA 4JFYA 4HC1L 3L5HA 1T1XA 4EQ3A 3E3QC 4CVUA 3DVNA 3VFVB 4RAVB 1MPAL 5ITBL 5I1GH 2AQ2A 1T89C 5CD5C 3VFGL 1I8LA 3UYOD 1UC6A 3BYYA 4HUXA 4X80H 4U0QB 1CGSH 4XCEB 3BESR 4LSUL 5CUSH 5L7XH 4H1LH 1WF5A 2R1WB 1G7IA 1JI1A 4PREA 2HLAA 3EZ8A 4Z0XA 3NIDE 4L8BB 4TVSa 2BZDA 4GLRI 4WVRA 3R06B 1B2WL 1FL5B 4CUCA 1HHHA 2AJXL 3RX7A 3SGJA 4CDGC 1YEEL 3DBXA 5F7KC 3BJLA 1LDSA 4Y4FC 4OD3L 4XP1H 4YHNB 1P6AB 3CDGB 1KFAH 1IEBA 3P9LA 5EULV 2CXGA 4W6XB 3FHAA 5IW1A 1KULA 2E27L 3MRFB 2MJWA 1AC0A 1QSEB 1D6VH 2G9HA 1QSEE 5GRYA 1ZWIA 3U36A 2PTTB 1MREH 3MJ9H 5DJAA 1CFNB 2JJTC 3M1BA 4RMUA 3O3AA 4HKBA 1FFRA 2XZQL 1RY7B 2BNRA 5HVGB 5GGQL 4HULB 3Q3GB 1YMHB 1UEYA 3BN3B 4JVWA 1WJ3A 2FZ3A 4PGBB 1MNUH 5HPMA 1Q9LB 3ZZ1A 3HZVA 3SKNB 3NFPB 1BD2B 5I9QB 4ALAH 1I7RA 1BD2E 5EFIA 4MNHA 4X5WA 5KSVB 3V6ZA 3TF7C 2EC9U 4PGDB 2Z31B 4EUPG 1MHEB 4PBWD 4M7LT 4UV7H 3MCLL 5CMAB 5ILTH 1MWAB 1FPTH 1QBLH 3W0WA 5D71L 2FEDC 2NX5D 2DYPA 4W4NA 4CADA 4ODXB 5DHYB 5I1DA 1J18A 2WUBH 3PGDB 1OQXA 5CD5D 1BJ1J 1T0PB 5GGTL 1DQJB 5KW9L 3H7BA 1GRWA 1TCRB 3IDYC 3HE6A 5HHNB 3MYJA 2C7UB 5E8NA 3ZMRA 3V8OA 4Z7UA 4ZUVB 5CZKA 3GBML 2W0PA 4Z8FL 5DUMH 2EEDA 1CLYH 3EYSL 4PP1C 4C83B 1F97A 3BKJL 4K3DH 3PQYA 4KAQL 1G6RL 2H32H 2VISA 4PTUA 3W39B 3C2AL 1KYOJ 4HMCA 4NN6C 4LHUG 2WLYA 4Y4FD 3G6JB 3LCYA 3G6JE 1EAPA 2N1KA 3MNWA 2OBGA 4OLWH 5I74B 1OF2B 5D7KE 3SO3B 3RVUC 5B38G 1FL3A 2R4RH 4J8RB 3TT1L 3GEWB 4K71C 4HH9B 1OM3L 3Q0HA 1D5ZA 5ID0B 4I3GA 4OCLC 4NM8H 2EDFA 3FT2A 1F58H 3QIBA 1C8PA 2AK1L 5IROA 3VW3H 1BFVH 3V4VL 2VNCA 5HI4C 4X8XA 4ZD3H 2WSKA 1VGEL 4H26A 1FN4B 5ERWA 5FM8A 1S9VB 5FYLD 3WHXA 3WE6B 2C4FU 3VGBA 2LTQC 2AXHA 3ULVE 3LV3B 3A6BH 1V7NH 1NDMB 2FHFA 5J9PA 4YBHA 3S34H 4YHLL 5F1NB 2E6PA 5HHPB 2VLJB 5M94B 1NPUA 3MRPA 5ALCL 4LKXB 4WI8A 2AKRA 3MCG1 4TQEL 3TNMB 4Y4HC 2ZZUT 5EA0H 4Q7DA 3CIQA 3LKPA 1QKZL 3UAJC 1A14H 5B4MC 4YX2H 1INEL 1DBML 5IW6B 3TH4T 1IGFL 4JZOB 1MFDH 5GGRY 4RNRB 3CFJB 1JPSL 1UVQB 5DF0A 1GGTA 2VOTA 3HN3A 4JRXA 1EEZB 2Y7QB 3SCMB 1EEYA 2Z9TA 2FEDD 2IANA 1CLCA 3RL2B 1NGWB 3SPVB 5IEHB 4XT1C 4JFPA 2YPKB 2FGWH 3G5ZB 5CSGA 1MLBB 1MCQA 1OAKH 5DJ2A 3FFCB 3FFCE 3WFDH 4HXAH 4KRPB 5TH2A 5HYQA 3CSYA 1ORQB 3I6LD 5DJCB 1FFNB 2IG2H 1CE6A 5FA4A 2O61B 3T4YA 5MHSD 3K8LA 3RGVB 4LPYA 4OUUB 3BZFA 4FQHA 4PP1D 3RZCB 2I60L 3BEWB 1RIVL 4RQQB 4PJHB 5CGTA 1MFAH 4RCAA 4PJHE 5IB2B 5DMKB 4L5FH 2P4AB 1U92B 4BQBA 1EGJA 4QRQB 4U6YA 1QO3A 3MLWL 1MRFH 3WFBL 4YXKL 3O6ML 4WUUA 5F7EH 5E6IC 1JHLL 3PL6B 3P0GB 2PYFA 3PGCA 3KLDA 2QLVB 3KVQA 5JQ6H 2GT9A 5C86A 1ZLWK 3BP7B 3RVUD 3VXUD 5KVDL 2QHRL 3D0VB 4JFXA 4O51B 4XPAL 3UTSD 1M05A 5TE6L 3KNBB 1CLZL 3HTLX 3B9VA 2Q86A 4NBYB 5GS1C 2XKUA 5FDWB 1ZVYA 3EO0A 4YDLB 3BPOB 1VPOH 3DROB 12E8L 3KPSA 1A7PL 1X5FA 4XPBL 5MEQA 3TPUB 2W1NA 2GCYA 4YO0B 2DBLH 1FL6A 2B5IC 5HI4D 4UDTB 5ALBH 4W81A 2P5EA 5DLMH 4PUBL 1CT8B 5BZWB 3TYGH 5I1CL 4LU5H 2FD6L 4F8QA 2DIAA 4MAYA 3WJLA 2R0KL 3PV7A 1MCIA 3FFDB 4Y4HD 2UVEA 5H35A 1HSBA 5E99L 3R4DA 2CDGA 3S3PA 3IGAB 5B4MD 3UAJD 3I9GL 3GHBL 5I30L 2JELH 3LAFA 4NQDB 1OW0A 4NQDE 4I4WA 1HYRC 2HVKA 4G80B 1JRHI 2XYCA 1W72H 5F96L 4BZ1H 3GNML 5LJYH 1JYWA 2BNQB 2V6HA 1DQDL 2BNQE 2EYTA 4Q58C 2XY2A 2H41A 4MS8C 1T0MB 2OJZL 2IAMA 2G75A 2UWEB 3O11A 3HC4L 2UWEE 4NSKB 2MCG1 1KN2L 4U1LA 2DIBA 3VMNA 2ENSA 3MNVA 3H9HA 4JGJA 4L1DA 4NPYB 1B0WA 4XVTH 1RULH 2MFNA 3OAUL 1XCTA 1YECH 4AJ0A 3D0LA 3MA9H 4PJ5A 4TRPH 4O2FB 4NHUB 3LRSA 5F8QC 3KPNA 3BI9X 4LCIL 5ISZA 5FCUH 2DLFL 1ZTXL 3QJHB 4F57H 2DM2A 1KPUB 3M45A 4G7YL 2P7TA 2W0KA 4WFHD 2VDML 3MXWL 1NBQA 5DI8A 2ADGB 1SYVB 5E6ID 5LAXB 2FJHB 1XGRA 1AFVL 2DDQH 4UOW0 3S4SA 5KSUA 4JN2B 4QRTA 2GQHA 4Z0BH 4WTZA 3DIFA 4XNQB 1EFXA 3FO9A 2OS7A 4R4FL 3VXPA 3U6RA 4GKZA 1NMAH 2Y72A 4DGIL 1JYXA 3HLAB 1S7XA 3GKWH 5IK3A 1B4JL 4JQIH 3EJJX 1MCOH 4G9FB 1CDCA 4G9FE 4P57B 3SOBL 4BZYA 1P9MC 4G3YH 1AD0B 5E94B 1A7QH 4M7KL 3BAEH 1FZOA 1MQKL 4NRZA 3BT2L 3CK0H 3ZYZA 4UU9B 4J3TA 5L2JA 2CRYA 5I9QC 1BGXH 1T1YA 4G42B 4PIRF 2NMSA 3UJIL 1NANH 2Z31C 4JO1H 5C6TH 1J0ZA 2EH7H 1QA9B 4Q6YA 4F7TB 5EU5A 5JW4Q 2VH5H 3O3EB 1F4YL 1S9YA 1M1SA 3U9PH 4WHTA 4QTHA 2HJLB 4X6EB 4HAFA 1A3RL 1OL0A 3RVVC 1LO4H 2A1WL 4AEIL 1KTRL 4XGZA 4IOFC 1GYAA 4YZFE 2E3VA 3BMVA 4P5KB 3MMEA 4QO1A 4LPCA 1K8IA 1IVLA 4L8CB 4JFYB 1T1XB 3DVNB 3QHFL 4AG4L 1K3ZA 5IMKA 5CEYA 1OWWA 3EFDH 5B8CA 1RPQA 4HUXB 1OTUC 4MS8D 3JV6A 5HYEA 4U1MA 1TETH 1WISA 4KJYA 1G7IB 4X7FC 4XB8A 4PREB 2HLAB 4XBPA 4Z0XB 3GMLA 4X98A 5HJ3A 4DKFL 1OSPH 1KJMA 5DRWA 2YR3A 1A5FL 4QHUA 2F5BL 1HHHB 4XNZB 4ONOA 1UKTA 5I74C 1QBML 2ZG2A 3DBXB 5IVZA 2Q20A 3SO3C 3ARXA 1IEBB 3BP6A 1X5KA 3P9LB 5FV2A 5CAYB 3S6CA 3MV9A 1QSED 1RUQL 2OZ4H 4ZDHA 3SDXB 5EU7E 3SDXE 5IW1B 4OKDA 3MFFA 1F42A 5DUPH 3FB5A 1FGVH 4Q2ZA 2G9HB 3BISA 3S36X 1I3RA 4J3WA 4UT7H 3TO2B 1ZWIB 3U36B 3LIZH 3ULVC 5DJAB 3BH8A 3M1BB 4TUOA 2KKQA 4HQQL 5L9DL 4NN5B 2GJ6A 4YPGA 3O3AB 3GSNA 2R2HA 4X7DC 3O2DL 5T1DH 3QUZA 2B2XH 2BNRB 4KQ4L 3PWNA 5CKGA 3KPMA 2BNRE 3RJQB 4KVCH 2Y4SA 1I9JH 5FXCH 2COQA 5CKAA 4ODTL 1PG7L 2VZOA 4Q9QL 5E0QA 1BD2D 25C8H 3M17A 4JKKA 2FZ3B 2CLRB 5HPMB 1BF2A 2Z31D 5FHBH 1JK8A 4PS4H 5I8CA 3HZVB 5F21B 1SJHA 4HBCL 3SCMC 5D70H 1I7RB 5EFIB 4MNHB 4X5WB 3V6ZB 2BHZA 3RVVD 4JJHA 4RISH 4IOFD 5AZEH 1SJEA 4KRPC 3WNKA 3NZ8B 4P59L 3M8OH 3PDOA 3W0WB 3W0WE 2DYPB 5I1JH 3RIAK 4CADB 4XMLH 5I1DB 3RGVC 3MO1A 3H7BB 1KJ2L 1FDLH 2XN9A 3RZCC 1OTUD 3HE6B 3MYJB 5E8NB 4Z7UB 3T0WA 4DFIA 1BM3H 2NY1B 2FL5A 4MDJA 5ADOH 2F15A 2IQAA 2Z92A 2OYPA 3MUJA 1MWAH 4R4NC 1KEMH 3MBXH 4HCRH 5CSBA 4LEOA 3DHJA 4M48H 1MF2H 5AYQA 3PQYB 1QVOB 3PQYE 4PTUB 2VISB 2X4TA 3PL6C 5D8JL 4DGYH 5K9JL 1G9NL 3WUZA 5KVFH 2E5EA 5D7KD 3O2WL 4YGAB 3TO4A 4YR6A 1EAPB 3MNWB 5SWQA 4F9PA 2APFA 4UMGA 2FLRT 4TULH 5GQBA 4K7PY 4YDLC 3BPOC 3BSZH 1FL3B 3BVNA 1E4WL 4LSQL 4LSPH 1JRHL 3FT2B 3WXVL 5F9WB 3GI8H 3QIBB 4XVJH 3L5XL 4N8VG 2GY7B 3ULVD 4C57C 2DQJH 4JHBA 2VLJD 2W9DH 3CMOH 4H26B 4X83A 5ERWB 3VFOA 4MQSB 3IJSA 3MLRL 3WHXB 1WFNA 4GMSL 5L88L 4WFGE 1NLDH 2ZCHH 5J9PB 4KMTH 1AGDA 3MRPB 4MJ6B 3KPRA 1DE4A 2AKRB 3EIFA 1S9XA 3WFCL 1UG9A 4Z5RA 3MRGA 3LKPB 4HF5H 5J1AA 2CRZA 3JZ7A 4N8CL 3SCMD 5HBBA 3IDXH 1X5ZA 3ULVH 3FFCD 1BQHA 4JEGB 3ZTNH 4OT1H 2VR4A 2GSGA 4KRPD 3G5XA 3AREA 1EEYB 4JFPB 1S7TA 4M62L 2NY5L 4F7CA 5DJ2B 1E4XI 4K7FA 1MRDH 4OKVA 3RGVD 4NKQB 1A4KA 5TH2B 4U2ZA 5J11B 5HYQB 3J8F7 1AQKL 3CSYB 3RZCD 1GGIL 3KYNB 3UPCA 2NCMA 2X2YA 1CE6B 5FA4B 3T4YB 2FB4H 3BZFB 4FQHB 1BIHA 4R4ND 1U3ZA 1UENA 3SDYL 3QNZA 1Z9MA 4RDQF 5C0NC 3ZE2F 2Z8SA 3JV5A 5E2WH 4MX7A 4QXWA 4AH2A 3PL6D 5C0RH 1CYGA 3QUKA 4JM4L 1QUNA 4U6YB 2XWBA 1I1FB 1QO3B 4L3AA 1A7BA 1ZV5A 1RZKC 1MJ7L 4WUUB 4CAGA 2X4RA 4WUUE 1U3YA 3LPFA 5C9JA 4RMTA 2PYFB 3PGCB 4ZAKA 3STBA 3IVKA 3UBXA 2GT9B 3GMPA 4JFXB 3IFOA 4EBQH 1JTTA 1M05B 2CLZA 3RWHA 2BY0A 1UM4H 2Q86B 5DT1L 3EO0B 4X9GA 1A6PA 3KPSB 2AK4A 2B8OT 3KPSE 5MEQB 2GCYB 4HV8A 4RGOH 1FL6B 4HS8H 5TQ2L 2E9WA 2P5EB 1ZLVH 4U6VH 3AMLA 2YHGA 4OV6F 2OI9B 4K23H 5JIKA 4LEXL 4MAYB 4LCWA 2AEPH 3KYOA 4FP8L 2E8ZA 3G9VA 3E6FA 1HDMA 5H35B 1HSBB 1A6WH 2EDQA 4NQDD 4PGCA 4J4PA 1WEJH 2CDGB 4PV8A 1CGVA 2IFFL 2O5XH 1I8LC 3IDNA 3WKMH 2BNQD 4HFUL 4MXVF 2FATL 3FO1A 3TBWA 3F5WA 4PJAE 4I4WB 3SQOH 4XWGH 2MQ0A 2HVKB 4FOMA 3WNMA 1CK0H 2JCCF 1UWGH 4O2EA 2EYTB 3IDJA 1CU4L 2IAMB 2G75B 3RU8L 2Y36L 3O11B 3ZDXF 3BKCL 5IQ9A 4U1LB 4XNZC 3SGJC 3C9NA 3MNVB 3H9HB 5H37G 5IR1A 1V05A 1I1RA 1XCTB 2K3TA 1FNSL 3D0LB 4PJ5B 4PJ5E 5E7FA 5EU7C 2VKWA 3LRSB 1OB1A 5C0ND 5ISZB 1F02I 5ISZE 1KCRH 2P7TB 1HHIA 5DI8B 3I50L 1XGRB 1DR9A 4U4BA 4X6FA 4WJ5B 1JF5A 2VLLA 3S4SB 5KSUB 3ARVA 4NN5C 1DTUA 4QRTB 4G9FD 3F7RA 3LS5H 4KUZL 5CSZA 3DIFB 3VE0A 1EFXB 3FO9B 3VXPB 3U6RB 2FYYA 4GKZB 2VSCA 1S7XB 5IK3B 3TIDA 1EHNA 4TNVF 3VRLE 5DRZA 1XFPA 1U8MA 2X41A 4ZPTA 2A0LC 1I85A 1FZOB 2E9JA 4NRZB 3RPKA 2XG5A 3N85H 5F9AC 2VLKA 5L2JB 2RIKA 2H3NB 3T2QA 1T1YB 4G7VL 2EEAA 3S96A 1RZKH 2AEQH 3ULUL 2BVQA 2PTUA 4OD2A 2Q7YA 3MXVL 4R7NA 4Z7UF 3RKDC 5IKCA 1NGXA 3HRPA 1SVZA 4U7KA 5EU5B 4Q9RL 3FB7A 1WAAA 5IHUL 2YRZA 1S9YB 4WHTB 1T1ZA 1GL4B 4QTHB 4IM8A 3UDWA 1L9NA 4XGZB 4P9HC 5AEAA 4EJ1C 2X40A 5EOCJ 1K8IB 4HK3J 3BD3A 3HE6C 1CGYA 3LOWA 5EWIH 3BYTA 2NY1C 1G7MA 3MRIA 3FHQA 4XMKL 3OG4B 5IMKB 1MHPL 5CEYB 5LGHH 3O0RL 4LDOB 5B8CB 3JV6B 3JWOL 4M7JH 4U1MB 5JIHA 4KJYB 1OLLA 4N0YL 4FN0A 3MLSH 1XF1A 1F4XL 4XBPB 3GMLB 4X98B 5HJ3B 2H26A 1KJMB 5DRWB 4M7ZB 4IBLT 2VDNL 3QG7H 4WO4A 4M8VA 1P4BL 1MAJA 1KN4H 5IVZB 3SJVA 4EUPA 1ZK9A 5AZ2H 5JHLL 1RZIA 4FQXA 4M5YH 4MMXC 3SE4A 3BP6B 4GO6B 4A6YL 3MV9B 4JPVL 4ZDHB 2EE2A 5F9WC 2AVGA 3QIBC 3SGKA 5IROC 1TZGL 3ZHLA 5I8OH 3MFFB 4NBXB 4UTAH 5DHVH 4KPHL 3NCEB 3FB5B 5BOPA 4Q2ZB 1I3RB 1NCCL 2VC2L 1E4XL 1ZS8A 2BNRD 5ESAA 3BH8B 3L7EA 4TUOB 3H0TA 1HIML 4KV5E 2GJ6B 4YPGB 1RIHL 1G9MC 2GJ6E 3QRGH 3S37X 3GSNB 2DF3A 2R2HB 2A0LD 4F7EA 2X89D 2H1PL 3PWNB 1CXLA 3KPMB 2VTFA 3G5YA 2J6EL 3DETC 4LHUA 3OKDA 1AC6A 4LHJB 4M43L 3RJDA 3M17B 2ZOLA 5IESH 2OSLA 4O5LL 2VZTA 4HH8A 1JK8B 2J2ZA 3RKDD 5B38A 3HI6H 1SJHB 3W0WD 5E5RB 5T3XH 3DX9A 4GKOA 3MOBH 2DYPD 1KUMA 3JVGA 3KS0H 2AJUL 5GRUH 4TSBH 1SJEB 4GAYA 4BQ6A 5J11C 3ZKNC 3MOAL 3HE6D 4FQJL 4PJ7F 3TESA 2NY1D 4JKLA 4OQTL 3BRGC 3WLWC 4OFYA 5T1KA 1E27A 2P1YA 4B53A 3MO1B 2V2WA 4JN1L 1MI5E 2XN9B 5DC9B 2QHLA 5F7LB 5JIPA 3MRQA 1S3KH 1Z2KA 3PQYD 5EUOA 5IFHL 1VACA 2FL5B 2Y5TA 4MDJB 4M6NH 2IQAB 2Z92B 4WI7A 5IQ7H 1RJCA 4LEOB 4TTDC 4IMLA 2YRPA 1BIIB 2BDNH 1NC4A 4I13B 2E8YA 2X4TB 3NCJH 4P9HH 2EDKA 2CGRH 4WNQA 3IXAA 3X3FH 2GUOA 3TO4B 4YR6B 5FUOH 4M1DH 5SWQB 3X3GH 2DQIL 1VEOA 2YXFA 5BMFH 1BFSA 3BX7C 3QIBD 4ODHH 3GJEB 3BVNB 1CR9L 3AU1A 4OM0H 5MERA 5FUCE 1NGZA 3QRFM 3BDYL 1AO7A 2HRPH 3L3HB 1IC7L 1URLA 3O6KH 4PP2A 4WFGD 2KZ1B 4X7SL 2YUWA 2OI9C 1IILE 4MAYC 1DQLH 3NVQA 4JG0L 3WJLC 3VFOB 2VDPL 1QPPA 3QDAA 3IJSB 4MA8L 5J06A 3O2VL 3OL2A 4GQ9H 3PGFH 2HH0L 1AGDB 3GSOA 1A1NA 1CVRA 3DETD 3KPRB 2YD6A 3ESVF 1DE4B 3WFEL 3LEVH 1JNLH 1G7PA 1S9XB 5AYUL 2N4IA 3KR3H 3MRGB 4G5ZH 4Z5RB 1KENH 2YD3A 2VXSL 1OW0C 1SY6L 5J1AB 1IT9H 3FQTA 1JTOA 4DN3H 4Y2DA 5EZJA 3IFLL 2DJUA 2X1OA 2NZIA 3E6HA 1NUDA 5C9KA 5ENWA 1BQHB 4LQ1A 5T5NF 2IAMC 2GSGB 3FN0H 3G5XB 3AREB 4OFDA 2N7AA 1F6LL 3FRPA 3V5HA 1H15A 1G9MH 3ZKND 3GMQB 2GFBA 1S7TB 3F8UB 5D2LA 4F7CB 1HWGB 4K7FB 3RHWK 3WLWD 2X42A 4OKVB 4UTBL 1A4KB 4HT1H 1T20A 4DEPB 3OR7A 5GHWL 2YD7A 4GRLA 1JFQL 1UJTA 2WZPD 5HI5C 2NY0B 3QNZB 4TTDD 3DX8A 4WUUD 4HUUA 4MX7B 3U0PB 4AH2B 2ZUXA 1TJHH 4I0CC 2X4OA 3QUKB 2XWBB 1MCPL 1CI5A 2DQEH 5ILTL 2DTSA 4LIQL 4OCYL 2X4RB 1GHFH 5C9JB 4LAQH 4ZAKB 3QPQC 4POYA 3IVKB 3UBXB 3QIWB 3GMPB 1A6TA 3FOMA 2K1MA 3KPSD 2IQ9L 3IFOB 3RWHB 2CLZB 5GGSA 3QAZB 4NO2A 1GSMA 4NCC1 4JO2L 4DKEL 2HG5A 3NAAL 5C08A 2ZSVB 2A6JA 4NC0B 5E95B 5CCKL 1EGJH 3ABZA 1IC5L 4UIMA 5DXWA 5D1QA 2V9RA 2AK4B 3D1MC 2X70A 3OKMA 4HV8B 3ZKXB 4MAYD 4NUGL 1YYMH 1MEXH 2H45A 1E6JL 1ZT1A 5CZVL 2VDKH 4TUKH 1FG2A 4LCWB 3KYOB 5IBUG 4LCWE 5E2JA 4IDJH 3E6FB 4U2YA 1U8HA 3SKJL 1HDMB 1LK2B 4LQFL 1T3FA 3S3JA 5JUEH 3SQBA 2EDBA 4NQSA 5FV1L 4PJIA 4PGCB 3I84A 5AUMA 2R0WL 4PV8B 1JGVH 3C6SA 4CU6A 3IDNB 5B8CC 1KELL 3TBWB 3FO1B 3F5WB 5GZOC 5MI0C 3LRGA 3U1SL 2YUXA 1QZ1A 3MRBA 4POUB 1YEHL 3I6GA 5J57B 1EK3A 3JWDC 2YEZA 3L6FA 3IDJB 4KDTA 3AUVA 4M7ZC 1T2QL 1V7NL 2D7NA 3BO8A 4PJ5D 3P40A 5IQ9B 2YPVL 4HD9A 3LH2H 5IB5A 5ISZD 2GJJA 1MIMH 1EBPA 3G6DH 5IR1B 3GSVA 1JL8A 3C5ZA 1OVZA 5HI5D 3LMJH 1OB1B 4CBPA 4B41A 1CTNA 3Q5TA 1REIA 5BOZG 2OL3H 4ODBD 2JJUA 3T0BA 1W0YT 4XX1G 4UB0H 2EYRA 5GXBB 1AE6L 5EDXA 1HHIB 5AAMA 1EFXD 5FYLL 4X6CF 2FGWL 1FSKB 3T3MF 1EJOH 3FTGA 3QPQD 4JFZL 1GJIA 2VLLB 2ERJB 3TPKA 4I1NB 4XC3H 6FABL 4DJMA 4HMEA 1FNGA 1U8PA 5CSZB 2QQLL 3VE0B 4KTDH 4OLZL 1LO5A 1LD9A 3V4UL 4EZMA 1UCBH 2FYYB 3QHZL 4J3UA 4PJFA 5BV7H 5FM5O 4FZ8L 2BFVH 5DRZB 1I8MA 1CDUA 1U8MB 1TJGH 4ZPTB 3CU1A 4RX4A 3I75B 3LPWA 3NIFF 1HYSC 4FFWC 5HDBE 3U0WL 2VLKB 3S7GA 5E8DH 1L0QA 2VLKE 3S96B 1JWUA 2BVQB 1GC1H 4OD2B 2Q7YB 5HGGS 2UY7A 3N1GC 4R7NB 3H9ZA 3KJ6L 4TUJA 5IKCB 1NGXB 3HZYA 3Q5YA 4Y5VA 5MEOA 3FB7B 4G8EA 1XR9A 2EDYA 5T3ZE 1WAAE 1T1ZB 3QXDA 1FGNL 5T33L 2MHAA 3RVTC 4KUCD 1QTYT 4GXUN 5EORL 5GZOD 4WWID 2YXMA 1FBIH 1G7MB 3MRIB 4YHZL 3NCCB 1OLZA 5T5FL 3KPOA 1J9CT 4ELMF 5HHXH 5FKAA 4LLUB 1BMGA 4HBQA 4WGVB 1JHKH 1VESA 1BPVA 3TO4C 1BVLA 3LDBB 3OPZL 3ZL4H 4WO4B 3FKUS 4F9PC 3CDYA 3WD5H 3O6LH 3CC5A 1YN6B 3SJVB 4EUPB 1J8KA 3SJVE 1L7IH 1BFOA 1QHPA 3H42L 1RZIB 4FQXB 4ODWA 1CDGA 5FUCC 5KVEL 2ZUYA 1V7ML 5SX4H 2MQCA 2ITCA 4ZOBA 1YY8A 2M8XA 4MD5A 4S10A 2ZCLL 3BEVA 3NA9H 4XNYH 2GJ6D 5H94A 2EDHA 2UV3A 1J0HA 4MD4A 4PRAA 4C54A 3T77A 1ZS8B 5ESAB 3L7EB 2X4UA 3H0TB 4WTWA 4FNLL 5CFHA 5GSRA 3VGAB 3O9WA 2DICA 5C70A 1SQ2N 1T5XA 1VFMA 1X5XA 3G5YB 3MX0A 4LHUB 4RGMB 3F7YA 4FFWD 1HXMA 3OKDB 1MCWM 3BW9A 1HWHB 1FV1B 1T66C 1ZE3C 4DQOH 4NZTL 2ZOLB 2OSLB 5HYFA 2I9LA 2PR4H 2B4CH 5DA4A 5D7SL 2L7JA 3AREC 4X9HA 1ZVSA 4EXPX 5LCVH 3DX9B 5ICZB 4OM1H 4K2UL 2DM7A 3CJJA 3MRKB 4H88H 1N6QH 4Z0BL 1Q9KA 2CKBA 2VITA 1MLCA 4X4ZA 3RVTD 1HINH 4Q6IA 1OP3K 1J5OL 4GAYB 4N8VA 4DEPC 1U36A 4L4TA 4NQTA 2IMNA 4FRWA 4XPTH 3GMMA 4EXKA 5ACMA 3P4NA 4LGSB 4WY7L 4PD4K 1JPST 4CNIA 3CZFA 5T1KB 1UM5H 1E27B 4QRRB 2FH6A 2V2WB 1S9WA 4QRRE 3GBNH 4YHOL 4JLRA 2NY0C 5DVKA 3MRQB 2Y6SC 4XNXH 5EUOB 4S0TD 1VACB 1AY1L 3P73A 4RGNB 5EUOE 2Y5TB 4RGNE 4ZUSA 2JLLA 1EUTA 4L1HA 3T0AA 4TVPL 3BKYH 4AT6A 2FWOA 4IMLB 2GITA 4ZQKA 3TO4D 3QYCA 1F4AA 1LDPH 1NC4B 5GS0C 4FQ1L 2XZCL 5C3LD 1BZ9A 4XNUH 5F6HI 5IMOA 4ZAKC 4K3EH 1WLHA 5ADPL 1TZIA 3T0DA 3BH9A 4WEBL 3QIWC 5DEFA 5D7LA 1F2QA 3IXAB 4WNQB 5TGBA 4OV5A 2GUOB 3QAZC 2ARJA 3CXHK 4WIQA 3MV11 1EO5A 2X7LA 4G8FA 4LRNH 4OLUH 4P99A 4KY1H 4TOYL 2RGSA 3RWGA 2C3XA 1J11A 3AU1B 3ZKXC 5GRJL 5MERB 3ZDZE 1LK3H 1NGZB 3U7WH 1AO7B 2X4QA 2JK5A 3ZTJG 2VSDA 3VDBA 1AO7E 4FTVE 4LBEA 1ED3A 4PP2B 1SM3L 2R56H 1AI1H 5C09A 2QQNL 1QFOA 1R0AH 3NTCH 5LQBL 3KPRD 1GCFA 2AJSH 1J87A 3HFML 2WWKO 3GSOB 4J4PC 1A1NB 5IMLB 3ARTA 5F72S 5C0GA 3HI5L 1YPZE 1T66D 2NTSP 4ONFL 1BP3B 1G7PB 5I0DA 4OFIA 3MTRA 4JQVA 5ECJE 3UX9B 3FQTB 3ZYIA 3NFSH 3ARED 2IWGA 1DBBH 3BOVA 1EERB 2Y23A 3CU7A 3VFPA 1HH9A 4PJGA 5FYJU 4UT7L 1MJ8L 2A6KA 3E6HB 4NHCH 5SWSA 5F1KC 5ENWB 4HLZG 2FHBA 1KTLA 4OQ1A 3V5HB 3HCVA 3CFIC 1H15B 2GFBB 5D93B 5J12B 1EZVY 5D2LB 3ES6A 4M8QA 5D2LE 2HFGL 1T20B 3D48R 1HEZA 2NY0D 3OR7B 1QFUL 2X10A 2Y6SD 2OK0H 4N5UA 1Z0NA 2R0LH 1KCLA 4QEGA 2YSSA 4GRLB 4GW1A 3WHE1 5FHBL 35C8H 4OLYL 3S35H 1VEPA 4GAGH 5CP3H 4M93B 1RU9L 1CE1L 3DX8B 1X7QA 4F58L 4C4KT 5F3BA 4HUUB 3RY6A 3MSPA 5GS0D 1FSKC 1KT2A 2BHUA 4ZAKD 1QFWI 4XP9H 2X4OB 2ERJC 3MLUL 3QIWD 1CL7L 4OTXH 2ORBL 4OGZA 3PE9A 3GKZA 3V7AG 2W60B 4JREB 2EXYC 4DOHB 4KWUA 3HUJA 2JB6A 5J13B 4M6ML 1UWXK 1PLGL 5DA0B 4YAQA 1A6TB 1VFBA 3VI3E 3FOMB 1D5XA 3GUTA 1MVFA 3CXDL 1P69B 5GGSB 4R3SA 4NO2B 5ESQA 1I85C 2HG5B 4HPOL 5C08B 1Q0YL 5EOCH 4Z9KB 5C08E 1UXWA 2A6JB 2XZAH 2BOBA 4PJ8A 4UIMB 2ZUQB 3B43A 4HX1A 2ZPKH 2W92A 2X70B 3OKMB 3V6OA 3QEGH 2A83A 4OLXL 4UAOB 2GK0A 3EO9L 4LCWD 5GS0H 1ZA3A 2EIZA 4RMQA 3IT8D 2I07A 1Q72L 2JB5L 1ZT1B 4GRMA 4HS6A 2YPLA 3S36H 4J4PD 4B7IA 1FG2B 3WFHB 3QUXA 3UDWC 1S78C 1NFDF 5DSCA 1OPGH 1N4XH 1T3FB 2D9QB 4NQSB 4ZFGH 4PJIB 4PJIE 5AUMB 4PG9A 1L0XA 5TFSL 2MMXA 1MFBH 4I2XA 3C6SB 4OGXL 4L4JA 1UH4A 3DUHA 1KCSL 3NABL 2J3SA 4PRDA 1MRCH 3MRBB 3I6GB 3FQNA 1JZ3A 1EHXA 2YEZB 4L3CA 4M4RA 3OKOA 1II4E 1JYVA 3LDBC 3BO8B 1R5WA 4WO4C 2ARJQ 1I3GH 1IZKA 4HXBH 5IB5B 5KVGH 4Z7QF 2AGJH 2YUZA 4M7LH 1NCBL 4FQXC 3SE4C 3GSVB 2DWEA 3C5ZB 1WC7A 1VA9A 1RMFL 2F9BT 4FQIL 1ERNA 1BOGA 1M7XA 1R3IL 4QTIH 1I4FA 1F5WA 2EYRB 3GMNA 1M7IA 4XP6L 3QUMA 2EXYD 3RP1A 4M1CC 3MRMA 2CMRH 3NPZB 4YNYA 3FTGB 3I2CL 1A47A 3LSOA 4MB4A 3FQXA 4NZRL 3VGAC 5ABDE 1FNGB 1U8PB 5FA3A 3QISA 1LO5B 4XPHH 4CJ0A 4PJFB 1F90H 4PJFE 1KB5A 4ZYKA 2IH1A 2VLKD 4NKDA 1I8MB 1CF8H 1D3CA 1FORH 1SEBA 1Q9WA 3W11C 1IC1A 1B4RA 2ZG3A 3ARGA 2PCPA 5T3ZD 3C2SA 1JWUB 1IBGL 3IKCA 2FCBA 3RIFF 3D6GA 3MV7A 1T21A 4TUJB 1S78D 3HZYB 4OZGA 4Y5VB 2L4OA 4G8EB 4MNQA 1XR9B 5MEOB 1JNJA 3ZHKA 4XRCA 3QXDB 3OKNA 4KDWA 2ZUVA 2FDBP 1HZHL 2MHAB 4Z78A 4YQXL 1IGCL 2HWZL 1VFOA 1BLNA 1FZJA 4OI9A 5CJ5A 1GIGH 5LGJA 5F7HA 1DFBH 5B3NA 4R96A 2F58H 1JZ2A 4RGNC 3A6CL 4Y5YA 1JWSA 2ICWA 1QOKA 3FQUA 4U6VL 2BY2A 4WW2F 3KPOB 1ZANH 1GAFL 4WO4D 5FKAB 3VI4E 3ZDZF 2L0DA 3ARFD 3VFTA 3RWJA 2RBLA 3SJVD 4EDWH 1CQKA 2VDQL 5L6YL 2XI9A 4FQXD 1BVLB 4NZUH 2NZ9D 5CGYC 1WBZA 1LNUA 2HP4A 4PFEA 3EDJA 4XMPH 1G0DA 3CC5B 3UJTH 3R8QA 1BFOB 1ROWA 3SY0A 2FJGA 4ODWB 3DYPA 3P9WB 3LN5A 3SGDH 1PX4A 1WTGT 15C8H 5BCAA 2ZG1A 5JQHC 4I77H 5JXEA 1FCCA 2ITCB 5I19L 3PHQA 1YY8B 2F8OA 2HTKD 4M1CD 3LN4A 4MD5B 2ITDA 1KEGL 5IVOA 3KHQA 32C2A 3BEVB 3P2TA 5TQ0L 5H94B 3DI3B 3GK8H 3QULA 4MD4B 4PRAB 3K1KC 3C60A 5E03A 4EUPH 1A6UH 3T77B 1QLRA 1MFNA 3GRWA 4FQ2L 3OJVC 2E9BA 4LASH 4NP4H 5DWUH 5L2KA 4RIRA 2X4UB 4LHUD 5GSRB 2YC1A 3O9WB 3UYRH 3AAZA 4HIJA 4D0DA 1T5XB 4LSSL 3ALXA 5CLTA 4NC2B 4ZNCD 5EU4A 2SEBA 5FGRA 3W11D 1HI6A 2OTUA 4O58H 3F7YB 1HXMB 3D39A 3BW9B 4UNVA 2VR9A 2GK2A 4H1LA 1QFWL 2I9LB 2DQCH 3MCKA 4IHOA 4NNYA 4I9WE 2FJFA 4PG2A 4YHPA 1ZVSB 4U1GB 1XF2A 4GUPA 4CVWA 5E1HB 5L8LB 3CFDA 3V2AR 5D93C 4PGZA 5J12C 3V52L 1Q9KB 1UKSA 2CKBB 2VITB 1MLCB 4OFYD 5T1KD 1FLRH 4QRRD 4N8VB 4LCYA 4LSRL 3VXRA 4L4TB 2VDOH 1TXKA 1TJIH 3GMMB 4L4TE 5MP6L 3FCTA 3V6FA 3P4NB 4OIBA 5IFAL 5D6DA 2MKLC 4CNIB 3CZFB 4GRLC 4RGND 2KPNA 4HC1A 4XPFH 1S9WB 3QT2A 2B1HH 1SVCP 3F58H 2D31A 4JLRB 4JO3L 4M93C 3N9GH 4RDQG 1OARL 1NC4D 3P73B 4KI5F 4ZUSB 4GXVL 1EJ6A 1MCHA 4KK9C 3ESUF 1TVDA 4AT6B 4TNWF 2FWOB 2B39A 2GITB 4OCWL 1AH1A 4ZQKB 5E8OA 4JREC 5CGYD 3CX5J 4MA1B 1BZ9B 5IMOB 3MRHA 5J13C 5C8JA 1TZIB 1W0VA 3DARA 3BH9B 3UO1H 2DQGL 4AM0A 3V4PH 1PX3A 2DQTH 3P3YA 5DEFB 2HKHL 5D7LB 4OV5B 5TGBB 5D7LE 2E6JA 4KI5C 3U4BH 1IAIH 4NFCA 1UKQA 4D9QE 4I3SL 3UPRA 4S1QH 3U83A 2W65A 4U31A 2X7LB 2DKMA 4G8FB 1AO7D 4NJAH 4FTVD 4XWOC 3T09A 4NUJA 1S7WA 2ZUQC 3IRZA 4ZOEA 4UILH 3RWGB 1OGAA 1WICA 3QWOA 4UAOC 4OLVH 4PJIF 3MODL 2X4QB 4JRYE 1P4IH 2QJDA 1ED3B 4G8GA 4LBEB 2Q8BL 4GSDH 1WWAX 3W5MA 5F9JA 5HGAA 2NTFA 2P8LA 4YFLF 3IJYA 5C09B 5C09E 1A6VL 4KHTL 3RY5A 2Q8AH 2J8UA 4O00A 3T0VA 3SKOA 1JZ8A 4LARL 3L9RA 3DX7B 1XH3A 4LVEA 4KTYA 4HWBL 2CIIA 3L1OH 5C0GB 5LBSH 1JTPA 1UADC 5D9SA 4PBXA 4S1SH 4M9PA 4QHKJ 2Q6WA 4PB0H 5GJSL 4XAWL 5F1IA 1HHGA 3D87B 4FFZL 2X05A 5DK0A 1PKOA 2F19L 2G5BA 5FOJA 3TIEA 4ZUTA 1YEGH 4MCYA 5CJXA 3VFPB 1HH9B 4PJGB 4PJGE 5EZLA 2A6KB 5SWSB 5TF1L 5SWSE 4G6AC 5BW7A 4KKLC 4KDTC 1QRKA 2RAMA 1KTLB 3GJFH 4K8RL 3SE8H 3HCVB 2AJVL 5IT2L 5HHVL 3HC0A 3D25A 2ZSWA 3ES6B 4M8QB 3VG0L 1AP2A 4GRLD 1DUYA 1S5IL 3C5ZC 2V9TA 1HEZB 4MCZB 1HE7A 3P0YH 5GGTA 4Q97A 3EYQC 2YSSB 4PJXF 4D0CA 4GW1B 3JXAA 3EOAA 3GZKA 4OGAC 2EDLA 4KK9D 1G7HA 1X7QB 3WNOA 3X12A 9CGTA 5EBLA 4LSTL 1RUPL 1KT2B 3V9FA 1CGTA 3IU4L 3MACH 1DQQA 5JDSA 5JXAH 1KBGH 4P2QA 1DDHB 1VERA 4KI5D 2MSPA 5A16A 1A22B 5C08D 2HJFA 2JB6B 3HUJB 3HUJE 2VXVH 1JNNL 3QEQA 4H8WH 4XWOD 4YAQB 1VFBB 1D5XB 1AIFA 1BBDL 4R9HA 4TTGA 1AGEA 3TJHC 3GUTB 5D2NA 3GO1L 4R3SB 5ESQB 5DDHA 2BRRL 1UXWB 4ONGH 4BSVA 2BOBB 4PJ8B 4JPKL 4HX1B 2J4WH 2A83B 2GK0B 2WQRA 3NOIA 3OZ9L 1ZA3B 2EIZB 2I07B 4P9HL 4Y5VC 4GRMB 4HS6B 1JF1A 5EBGA 2YPLB 1EMTH 5FO9A 4MJ2A 4DW2H 5DQDL 5IB1A 3P77A 3QUXB 4U1HA 4M1DL 1DLFH 2WIMA 1FJ1A 5DSCB 1U8NA 1PG7W 2VXUH 1B0RA 1MUJA 2WBJA 3OF6A 4PG9B 4I2XB 4I2XE 4RAUA 3QDGE 4PRDB 1JV5A 2AV7A 2VDLL 4G6AD 1NLBL 2FX7H 4KKLD 5GRVL 1DVFA 1JWMA 2VUOA 2Q87A 2AABL 3TZVA 2EKJA 3FQNB 2WMPA 3EFFA 4L3CB 1C5BL 3OKOB 5INDA 1R5WB 5EZOL 3C5ZD 3U7YL 5IBTH 3PDGA 1BBJA 2PYEB 4FFYH 4ZMAT 4JM2F 2PYEE 4WHDA 4DVBA 3BD4A 3EYQD 2O5YL 4G5ZL 4J6RH 2DWEB 5C6PB 5JOFA 3BPLB 4OGAD 5F71A 3RIFK 2CK0H 1WC7B 3LQAC 4J3OC 1BVZA 1BOGB 2OLDA 1I4FB 2R4SL 3AS3A 4LGPB 4JFDA 5HY9A 5D72H 4F2MA 3GMNB 3LKRA 4FZEH 1M7IB 2R0ZH 5EIQA 1BWMA 3QUMB 5EO1A 2JJWA 3MRMB 4YNYB 2EDEA 4XP5L 3LSOB 3FQXB 1EH9A 1P7KA 3O9WC 1TFHA 4NZDA 1T83A 4JFQB 2BJML 5E2UL 2RCSH 5FA3B 3TJHD 5CEZE 4Z7WF 3AM8A 1MCSA 1LE5A 4RX4D 5I18L 1NAML 1LO0H 2E9IA 1KB5B 4ZYKB 2IH1B 3SE9H 5EC2A 4NKDB 3W82A 3ZO0A 1SEBB 1Q9WB 1LO2L 2HJKA 1JPGA 4K94H 4X6DF 3ARGB 2PCPB 4YWGL 1Z3GL 4U1GC 1V3JA 1GGBH 4TSAH 1E4KA 2A77H 4K3GA 3LD8B 4UT6L 3IKCB 3WIIH 1J10A 3MV7B 4XC1L 4HFWA 4UT9H 3MV7E 1T21B 4OZGB 1EV2E 1XF4A 4AIOA 1PG7X 2XPGA 3RWCA 2ADFL 4XRCB 4BSJA 3OKNB 1GH7A 4Z78B 1AHWA 1DZBA 1BLNB 3MNZA 1OAXL 2Y07L 1FZJB 3FN3A 3DUUA 5LGJB 3U4EA 4R96B 4WFEE 1RUAH 3K1DA 4QXTA 4JPWH 4Y5YB 5INCA 4K9EC 1YYML 1JWSB 1H3GA 2CKNA 3NACH 4CMHC 1OOAA 2ICWB 3FQUB 2A9ML 4XCFH 3PIQA 3DVFA 3IDMA 3RZWA 2QSVA 4JR9L 4MA1C 3V0VA 3QP3A 3INUH 1BJ8A 1CXHA 4IDJL 3VFTB 3RWJB 2R69H 3O3UN 1IGIH 3E8UH 5DD1L 4KTEH 1WBZB 5ESVA 1LNUB 3C08L 2R1YA 5F9DC 3CVHB 4IMKC 1XZ0A 4QXGH 2DQFA 2DM4A 3ILPB 2XQYG 3SY0B 2IH3A 2FJGB 4NCC2 3QQNA 3CLEH 2DN7A 4LP5A 3U46A 3LN5B 1N5YH 4R8WH 1UM6L 4URTB 4PPTA 4LLWA 3LHPH 3PHQB 3HAEG 3EOTL 3EYUL 3DSFL 3PP4L 4N0FA 3LN4B 2ITDB 3DECA 32C2B 3LS4H 4KK8C 5TE4H 1T1WA 3QULB 4JG1H 5KAQF 3C60B 2IGFH 1QLRB 1EZVX 1UT9A 5L2KB 4GS7B 4JHAH 1I9IH 4RIRB 5L2KE 1BOYA 1MJUH 2YC1B 4E0RA 3LQAH 3AAZB 3DUSA 5J6HA 3S9DB 4HIJB 1FE8H 4RZCA 5T1MA 5I1HH 4D0DB 3V79C 3ZE1E 3IU3A 1PSKH 2YMXL 4JQVC 2SEBB 5EU4B 1EFQA 1HI6B 2DTMH 3GGWA 5FYJE 4I9WD 2OTUB 5DD5H 3D39B 3D39E 3MV01 3PHSA 3CFKA 1RZJC 3WMSA 4YXLH 4H1LB 3H9YA 4NNYB 3MCKB 4IHOB 1X5IA 1KB9J 2FJFB 1D7FA 4YHPB 4L4TD 5DTFA 1XF2B 4GUPB 1GPOL 4IRZH 2C3HA 3CFDB 4NNPH 3K2UH 3IFNH 4S1DC 1KOAA 2CO7B 5EIIA 4GG8A 1KC5H 4H5SA 5D7IB 4ONHB 4LCYB 5D7IE 3VXRB 4PLJC 5K93A 3VXRE 1Z9SA 1OT2A 4QHMA 3FCTB 3V6FB 1NCAL 4H20H 4MQ7A 4XBEH 3UMTA 4O9HH 1KJ3H 3U48A 4D9LH 3D9AL 2AJ3A 2MTPA 2D31B 5E8DL 3TJEL 1Q1JL 1OP5H 3RY6C 2H8PA 3LZFL 3K8MA 4P0DA 2CKBH 1L7TL 1JZ6A 2ZCKL 1QNZL 2HFFA 2HKFL 3WDJA 3NH7H 5D7LD 1MCFA 4B50A 5E8OB 1INDL 4D9QD 4O2CA 2Q76A 1U42A 3JTSA 3MRHB 5C8JB 1W0VB 4AM0B 4OSUL 4I3RH 3ETBF 2EH8H 3VXTA 3H8NA 5E00A 3O41A 3UPRB 3DLQR 4KZDL 2W65B 3QDJA 3NBNA 4NUJB 2VQ1A 3B3IA 3MV8A 4PJ8C 1S7WB 1FRGH 5C0BA 3SE3A 2D7QA 3VFMA 2X1QA 2CXKA 1OGAB 3V6OC 1A7NL 1OGAE 3QWOB 2ZKHH 5C09D 4KK8D 3ZE0F 1JBJA 2IJ0C 4G8GB 1AGCA 3NGBB 1RUKH 3OKEA 4G8GE 1MCDA 3GI9H 3UBXI 5IGXL 4HW6A 5F9JB 3VFNA 5HGAB 3THMH 5C0EA 1H3PL 1AGFA 2CDFB 2NTFB 2P8LB 3IJYB 1X5AA 3QUXC 5J56B 2J8UB 3SKOB 1DP0A 1B9ZA 2J8UE 2LVEA 3EOBA 3L9RB 3IAGC 2EECA 3VRJA 3QO0B 5IB3A 1XH3B 2WAHA 1VFAA 5LWYL 2CIIB 1NCWH 5D9SB 1SBSL 4I5BA 4W6YB 3V0WL 1IEHA 4D8PA 1IKFH 3PXHA 4ZG1A 2Q6WB 1XF5A 5SWSD 1QRNA 3JWDL 1HHGB 5F1IB 4FQLL 5DK0B 3GHEH 2G5BB 3TIEB 4ZUTB 4LF3A 4MCYB 1HKLH 5IUSA 5J1SC 2VAAA 3QCTH 2G60L 5EZLB 1UZ6F 1YNTA 4S1DD 4XVSH 1KLFA 5B21A 4PLJD 5IVXF 4P23A 1KCUL 4LCCA 5GGVY 4OCRL 3DHMA 3D25B 3HC0B 2ZSWB 2AXJA 5L8KB 3IDUA 4P2YA 3TVMA 3HS0B 1AP2B 2EDXA 1FQ9C 1PKQA 4N90E 4HK0A 3BPLC 4OCSL 5FDYA 1SEQH 4XNMA 3MLZH 5IBUB 1RZJH 2V5MA 4HWZA 1KJ2A 4D0CB 4YE4H 5EIVA 4RMRA 1MCLA 3EOAB 4DGVH 3U0TA 1G7HB 5CJQH 5EB9A 2AV1A 3X12B 3GSNL 4BH7A 5EBLB 3VWKA 1N6QL 1WITA 4ZUUA 1CFBA 4J23A 1DQQB 1QSVA 5JDSB 5KSBF 4P2QB 4X4XA 4P2QE 3GSQB 5A16B 3GM8A 3WL9A 4R26H 2HJFB 4U1JA 1F3JA 5CS7A 1CDJA 1AR2A 1U41A 3QEQB 4PJ8D 3QEQE 4L8SA 4BFIA 4ZS7H 4RWYL 1AIFB 4R90L 1ZMYA 1AGEB 4OZGF 3RX8A 5D2NB 4UI2A 5DRXA 5D2NE 1S9KC 3DOSA 5J6GA 3NZHL 5DDHB 5AG9A 4S1RL 4K3HA 4BSVB 3ARGC 1YEIL 2V2XA 5BS0A 4JHWH 4FQCL 5EO0A 1NL0L 3RUGA 3F12A 3LD8C 1RZGA 2WQ8A 1NGPH 3QUXD 4ZO8A 3MJ8A 2BVPA 1K6QL 4BZ2L 1BQLL 1JF1B 4Z18A 4K3JL 4OJFH 5DC0A 5FO9B 5IB1B 4RBPH 1IAMA 3P77B 2BOCA 4U1HB 2J8OA 2WP3O 5ANMA 4Y5XA 1FJ1B 5HTSA 1U8NB 5H37H 1B0RB 1MUJB 1FLTX 4AEHH 3PWLA 1KXQE 2WBJB 3KLSA 1YEJH 5HYSG 4RAUB 1O0VA 4Y5YC 3EAKA 1KLGA 3QCVL 3VXMA 2K9UA 1JV5B 2AV7B 4ODSH 3BE1H 1BAFH 1RIUH 1AI1L 1DVFB 1MCEA 3C87A 3QZWG 1PY9A 1JWMB 3SGEH 3TZVB 1FVEA 2BP3A 1OP5K 1MFEH 3CFBA 3BKMH 4XCCH 1ACYH 2JJVA 2PYED 3EFFB 4E42A 4FS0A 5INDB 1E6OH 5JR1L 1F45A 3ELAT 2HTLC 4NO3A 2YRLA 5D1XA 5DMJB 3OJMB 4NWTL 1BBJB 2JTDA 4DVBB 3W2DH 2ZNXA 4NJ9L 3UC0H 3TH2T 1PVHA 5JOFB 4ZTOH 4FA8A 2FBOJ 5GGVL 5JXEC 1U8IA 1N0LA 3HNTL 3NCFB 3VWJA 4GJTB 1U6AH 2CH8A 3KHOA 3O8XA 5D6CA 1UWEL 1DBKH 4GW5A 5FYKL 4JFDB 5HDQH 3RVWC 5HY9B 1VADA 4F2MB 3LKRB 1X6NA 3WEXA 2X4NB 3C60C 5CEZD 1DBJH 4OFVA 5EO1B 1UYWH 1GGYA 4DAGH 4GS7C 1MCBA 2XWJA 1HNFA 1P7KB 1P2CA 4P4KA 2CLVA 5FAAA 5JO5A 2LV4A 3T2NL 1F8TL 3RTQA 3ARGD 5DK3A 1DQTA 2FR4A 5EC2B 3DVGA 3Q6GL 5SWZA 2A73A 2ED9A 5JPMA 2HJKB 1JPGB 3MV7D 1Y6MR 1T6VN 4PG2C 5IFJA 3LKNA 3LKOA 3L5IA 1T7WA 5F3HA 3QI9A 1T5WA 1OAQL 3A67H 4KDVA 4AYFA 3PUCA 5HVHB 4L3EA 4YXHH 3N50A 1V3KA 4HFWB 2WBWB 4XPGH 1RHHB 1XF4B 5F9OH 2BMKA 1KB5H 2XPGB 3RWCB 2XXCB 1ZXQA 3QXVA 4KVNH 5D6DC 1S8DA 1XGTA 1X4ZA 4JANA 4N0UA 1CLOH 2DQDH 1AHWB 1RZ7H 2R8SL 3MZTA 2OP4H 5K33A 4EOWH 3MNZB 2C26A 5FIEA 3DUUB 4YJZL 3L7FA 3TP4A 1O7SA 3U4EB 4UOW1 3HZKA 4BK5A 1CN4A 4W68A 1EHLH 2NY7L 3VFSA 1JPTH 4QXTB 5INCB 4LPVA 2ZP0T 1S5HA 1F4HA 1JCKA 2AJYL 4PYGA 3PIQB 1JMXA 2ZJSH 4PRIA 4LMQE 2HVJA 3RDTA 1A3QA 1OD7A 3V0VB 2HTLD 5F7UA 4DFHA 5D5MF 2DRUA 4YDKL 1I8KA 3LEYH 4U3CA 4WW1A 2FNBA 1U8LA 4HK3N 4PJBA 3MBEA 4OBRA 2DJSA 5DD3H 5ESVB 3DYOA 2R1YB 3EDKA 1XZ0B 5AWNH 5JXED 2DQFB 4JY6A 2Q1EA 2QSQA 4Q0XL 3BIKA 4JKPL 3VJ6A 4BUHA 3U46B 5I8KH 3ZSTA 4LP4A 4DVRL 3RVWD 3GSWA 5DD0L 1OTTC 4LLWB 4WFHE 1LVEA 3C60D 3NGBC 4N0FB 3RWDA 2UZXB 1RV6X 3CLFL 5L2KD 3QSKB 3TWCL 2B0SH 2XV6B 5JNYA 4AQ1B 1T1WB 2Y06H 1CIUA 4OIAA 1I3GL 3HRZA 1GXEA 2EDTA 3SDCA 1FYHB 1RUMH 5FYJD 3RAJL 4FHBD 4YHMH 3D39D 1CQYA 4E0RB 3DUSB 5J6HB 1BJMA 4RZCB 2DQUH 5T1MB 3QCUL 3UJJH 4RBPK 3U4AA 1YMMA 3EKCA 3IU3B 4V1DB 2J5LB 3GGWB 4UIKH 4V1DE 4NQUA 4I8DA 5DQ9A 3CFKB 2P45B 5CJXC 3SDDA 5DVNA 3GRWH 5BW7C 2QQKL 3OAYH 3STZA 4IOIA 3VXRD 1JGLL 1XGPA 5DTFB 3WXWL 3VMPA 1DBAH 2R29L 5EIIB 4HS3A 4GG8B 5FYJH 4G9DA 3GIZH 1F6AA 3QWQB 4H5SB 4ZPVA 5IHLB 5EZIH 4JO4L 4KGJA 2GHWB 1Y6NR 2D9CA 3JV4A 4MQ7B 3P30H 1OGTA 3EDEA 4FMKA 4NGHH 1CDBA 3B2UC 4NWUL 4B5EA 1KSRA 1HCFX 2R2BA 2AJ3B 3UCRA 2XKNA 1U95A 5DHVA 3MLXL 4Z95L 4F37K 1C7SA 1GGUA 1IGYA 2H8PB 4YPJA 2EC8A 1GZQA 4IJ3B 4JY4A 3EOYG 3MLVH 4HJJL 4G6MH 4D3CH 4JDTH 4MB5A 1NBZA 4NO5A 4U49A 2HFFB 1F4WH 5D4QA 4KJPC 4L8DA 1LEIA 5DJZA 4CRPA 2IPKA 4JFHE 1RVFH 4O2CB 2Q76B 3RA7H 4EIZC 4QRSA 2EICA 3JTSB 2JCCA 2YKLH 1CZ8L 1ZEAL 4LPWA 4HC1H 4QRPA 3SKUD 1A7OL 1P6FA 1TTGA 3VXTB 1DL7L 1MPAH 5ITBH 5D2NC 4IIQA 5E00B 3RRQA 3O6FD 1OGAD 4MWFA 3VFGH 3O41B 2B1AL 1VEMA 1HXYA 3QDJB 3QDJE 1OTTD 2VQ1B 3B3IB 1YDPA 4G8GD 3ARZA 4PB9L 4TSCL 3OXRA 5C0BB 4LSUH 4A6YA 2ED8A 5C0BE 3VFMB 3V0AC 2XRAL 5T3ZL 1EDQA 1I3VA 3VG9B 3EYVA 2DS4A 4RFOL 1FO0L 2LU7A 1AGCB 1EO8L 3S88L 3B9DA 1B2WH 3VFNB 2AJXH 5ACLA 5HYJA 1AGFB 5JA8B 1YEEH 4XZUA 4OD3H 5BVPL 1MAML 2CK2A 4HEME 2FX8L 3PXJA 3EOBB 2F53A 4NDMA 4MAUL 3MGAA 4LFHG 2PF6A 3CPLA 1JI2A 3VRJB 5IB3B 2WBJC 1VFAB 4HIXL 2E27H 3V7AE 2FIKA 4I5BB 4N8PA 4D8PB 4Z7OE 1XF5B 1QRNB 1IGJA 5DZOA 1DVFC 3CNKA 1FCGA 5HHQA 1IAKB 3FMGL 4LF3B 3SBWA 1LEKA 3C5SA 3K3QA 3TZVC 1DQML