5BZWB

Crystal structure of pcdn-27b, an antibody from the pcdn family of hiv-1 antibodies
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
230
structure length
230
Chain Sequence
QVQLQQWGAGLLKPSETLSLTCAVYNESLSAFSWSWIRQFPGQGLEWIGEIDHTTSSNYNPSLKRRINISIDTSKKQFSLKLYSVTAADTAVYYCARGGRKVYHAYWSGYVNNCFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2B3 HIV Antibody light chain
publication title Early Antibody Lineage Diversification and Independent Limb Maturation Lead to Broad HIV-1 Neutralization Targeting the Env High-Mannose Patch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2015-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bzwB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bzwB01
1GPOH 2BVTA 5C0RH 1SYSB 1AGDA 4QGTA 5MEOA 4XTRD 4XPAH 4IMKC 1TVHA 3T0DA 1DVFD 2IQ9H 1DL7H 4HPYH 1NC4B 1JNNL 3BYTA 3SDCB 1NCWH 4DCQA 1B6UA 4F3FA 1S7SB 3EJZD 3QNZA 4PJHB 4HGWB 4P59H 4J2XA 4GW1B 3S36L 1G7LB 4PJIB 2VYRE 5SX4I 5DF0A 5ACZB 5DYOB 2HRPL 1CQKA 5C08E 2XKUA 3IKCB 4HQQL 1IGFL 1YY8A 1DBJH 2VLKB 3S7GA 4DTGL 1JGDB 2YRLA 4AMKL 1T22A 3U0TA 4K8RC 1VB9A 2BHUA 3GHEL 3U46B 3VH8A 1S9VB 2IBZY 3MRQB 3RDTA 1ZLWK 4PJCA 3ORJA 1AQKL 1M6OB 3Q3GB 3UAJC 3U9UA 2KUTA 3TBYA 4LNRB 1G9EA 1GSMA 2VLRA 2RFXA 4P23D 5EWIL 1TIUA 1I9EA 1EFQA 3W39A 3QCTH 4U0RB 2VN7A 1BQHG 1P53A 2V9QA 2BXZA 3TESA 1FL6A 5JIPA 2PN5A 2HH0H 2R0LL 5D7JD 2H3NB 2X5PA 4NYLB 4CMMB 2O5ZH 2D4FA 3GMLB 4GRMB 1JMXA 4XNYH 5I1CH 1A7RL 2HN7A 1S9YB 2IBBA 1S5HA 4ENEC 3VGFA 3RP1A 3LKSA 5E8OB 3ARBC 3O3BA 1R24B 5E99L 3OXSB 4ODWA 3F58L 4XVJL 4WHTB 3B8YA 5F7MC 4TTGA 2DLIA 2W59A 5ELIA 4KDTA 1ZWIA 3NCBB 5MHSE 1MEXL 3P4MB 1QRNB 2Z35B 2CKBH 2SEBB 1CFTA 3IDNB 3MNZA 1OCWH 2J7LA 1W72A 1F6LL 1NJ9B 1JWMB 5HVFB 3C9NB 1GGCH 4K23H 1GGIL 2OL3L 2YD1A 1FC1A 1XGUA 1WJ3A 5FKAA 3D25B 4Z95H 4UV4H 4UNTA 1CGYA 3SE4A 4U6XB 3MRLB 3DMMD 3GO1L 2YN3A 4L5FH 5FYJD 3UTPE 1OLLA 2XXMB 5J11C 1A6PA 4NC1E 3BO8A 2Y36H 1CXKA 3DXAD 4G7YH 5DJAA 2AQ1A 2W60B 3NFPB 5C0NC 4PG2C 3PP3K 4OFYA 1UM5H 2FEEL 2IANE 4KK5C 4YXKH 5KZCD 3MRMA 1YC8A 1BQSA 2HT3C 4KHXL 3SKMA 2J8UE 2BSTB 5DVKA 3VH8G 2F74A 3NVQA 4LVHC 1MCSA 5T3ZD 3D6GA 3WS6C 3L6FA 1TETH 4YDJB 4XC1L 4ZOEA 1T0PB 1FNAA 3BH9B 3QULA 5ITFA 3G5YB 1NGYB 2JK5B 3WJJA 1RIHL 3NIGF 4JRWA 2MQCA 2AXFA 2B0SL 4Z7UF 1FYTD 2DOCA 35C8L 2V6HA 1IFHH 4KWUA 5D7LE 2AEQH 5DT1L 2C1PA 2R0ZL 4NQDD 3HUJF 4NUGL 1T1WB 4JG1L 4S11A 4MJ5A 3ZLQC 1JIBA 4RISL 2OJZL 1SJHB 4ZS7H 2GKIA 3P0VH 4U1IB 1X7QA 2VJXA 4X5XB 2ESVA 4YGVA 1SVZA 1JZ2A 3IFOB 4XCFH 5J57B 1ITBB 2XRAH 3K74B 4F33B 3V4VH 3C5SB 5IESH 1I8LC 1UKQA 3KAAA 2AK1H 4U05A 2BVOA 2P1YA 5DJCA 4YJZL 4PJ5D 4IBLT 3ULVD 5EZLA 4DAGH 3FFDA 2ENYA 3MV7D 4PLKC 1F11B 2IPUG 1JPTH 2H6PA 3ES6B 1E4WL 1G6RH 2FEEI 2ADIB 1H3PH 1BWWA 5KVDL 5EOQH 1RAMA 1X5IA 3KLAA 3K8MA 2B2XH 2HJKB 4DW2L 1DSFL 2VXTH 2HTLC 3LN4B 4M62H 4AH2A 4AQOA 1FFNB 1FZOB 5TE7L 5F89B 3JUZA 1AO7E 4ZPTB 5I0ZA 2AJSL 3CXDH 3V0AC 5DGQA 3WNKA 4JANA 1YZZA 1A7NL 3GIZL 3WUZA 1IGTA 4C58B 2DD8L 3ZKMC 1I1AD 4POZC 1AXIB 4KJWD 4JPIB 4LLQB 5D71H 3OKLB 2VAJA 5IWLA 4HUXA 3A6CH 4I4WA 2EDYA 2F5AH 1RZFL 3O9WB 2NYYC 5D8JL 4NN7B 5C07B 2BVEA 5BQ7B 4AY0A 1U93B 1P4IL 2P48B 2BSSA 3IAGC 2P5WD 1FNEA 2FSEB 3N0PB 2RHEA 5JMRA 3RAJH 4GFTB 3PDOB 4XRCB 3M1BB 1WK0A 4PRPB 4ETQA 25C8L 4PUBL 1WEJH 2EH8L 5JA8B 2NY7H 3QDJD 2IGFL 1PSKH 3HMXA 5AYQA 4DZ8B 3FT2A 4ELMF 3LH2L 2AV1B 4Z7WA 3TBVA 3NGBB 1UCBH 2ICES 5F96H 4X6FB 3CH8A 1AHWC 1A6AA 4ZNEA 4TULL 1UQSB 4R7NB 3SY0B 4JZNB 3DVGA 4MHHI 2ICWB 2YD5A 4R4BA 4RAVB 4HK3N 5K9JH 1LO2L 2R1YB 4NQUA 4Q9CA 2V5RA 2IAMC 4GKZB 4PJ7F 3VFMA 4NZTL 4ZUTB 3QWRD 3MGOA 4JQXA 3TNNB 4NRXB 4YX2L 5FUCE 1B0GA 5EZIH 3GMRA 1RVFL 2UWEF 1OB1A 2DWEB 3VE0A 2LTQC 5GRWA 3AS3A 3RWJA 1BAFL 3MV9A 4KKBD 3V6FA 3TLRA 4APQC 2NY3C 4Z0XB 4TRPL 5CJQL 4N0FB 2EDBA 2R4SL 3P0GB 3SDXA 2IPKB 4RAUA 5IMKA 2AP2A 1T1XA 2XWBA 5BRZD 5JNYB 5F7WC 4CADA 3MR9A 3L3JB 3C5ZB 1MJ8L 3FL7A 3MLUH 5J1TC 4JN2A 4KK6C 3GBMH 5C0BB 1P4BL 3RNQA 3GJFB 1BM3H 1V7NH 3RZWA 4FQXD 4OFVA 5L0QB 1L6ZA 1T2JA 1ZHNB 5FYKL 1QSZA 4JM4H 3S4SB 5I30H 1CWVA 1N7ML 3U7WH 1CF8L 3RKPA 5BV7H 2A0LC 3HLAB 5BXFA 1CE1L 5FB8B 2FL5B 3SDAC 2ITDA 4BELD 2QADD 2R2BA 4IRSC 3MCLH 4L4VE 1OAQL 1AQDA 3H3BC 3O2DL 1AFVL 5IVZB 1TJIH 5ICXB 1E28B 2NY4C 3MLTB 3KPSD 4X4MA 3MODL 3L3HB 1U3HD 4TUOB 3V0VA 3JWDC 4XP4L 5JDJA 2ICCA 1H5BB 4NGHH 1A14L 3BUYB 3MYZA 4XC3H 1YMMA 3LEXA 4KGLA 4ZXBA 4JFFB 4R8WL 4YWGH 2V9TA 3B3IB 1N2RB 1N5AB 1QFUL 5E8EA 3GRWA 4WJ5B 1J18A 2FZ3A 2DQUH 3KR3L 1W0VB 2NW3A 4YE4L 1KPVA 3PGDB 2DBLL 4D9QE 1BVLA 3EFFA 1RMFH 1KTLA 1DQQA 3VCLB 2GJZB 2UVFA 4G8GD 3GSNL 3QUMH 4JQIH 2P24B 4J8RA 4Y4FA 4UT9L 2OTPA 3IDUA 5FA4B 3NIGE 4UDUB 3B5GA 1H3VA 4Z7UE 1EGJA 4KKAC 4HIXH 4GO6B 3OWEA 3GK8H 4OZGF 2DRUA 3HR5A 5JTWA 1HEZA 1WWAX 1ZVYA 4AEEA 3HUJE 1UB6A 2A74A 2E3VA 4NJ9H 4P3DA 1KJ2B 3QQ9D 1JRHH 4KTDL 3HZKA 1I9RL 2KH2B 3QG6A 3QHZH 4KJQD 3BRGC 4UV7L 4OLYL 3KHOA 5JOFB 3I6GB 2YPVH 5FYLH 4WFGD 1SBSL 2X7LB 4EZMA 4D94A 3NZ8B 2J5LB 3RGHA 1EX0A 3DETD 1RZGA 1KB5L 2Y5TA 4ZAKA 5H2BB 1LQSR 3W81A 5GS2H 3BKJH 3VD5A 5C08B 1MVFA 2B39A 2L4OA 4H5SB 3RVXC 2DDQL 4OM0L 5J6GB 5GGTL 5CLTA 3QQ4B 1FSKB 3FQRB 1GPOL 2WP3T 3IJHA 5DHXB 5MERB 4LLVB 1DLHA 4TUKL 2NNAB 4LCCB 2CXGA 3C8KA 5KSAD 1YJDH 2LU4A 5JIKA 4M4RA 3BZFB 2QQNL 1KELH 3VWKB 2R1XA 4YHYB 2BNQA 1F4WH 4PJXF 5CCKH 5KVMC 3Q6FB 5F70A 1KV3A 3MJ9L 5E2WH 1GCFA 1QBAA 4Y16A 4Y5YA 4P57A 1FNLA 1UB5A 4JFEA 3FO0H 5DR5H 3PL6B 3KJ4B 4Q6IC 3V5HB 4WHDA 1RJZB 3QA3B 2MHAA 4F7CA 2QTEA 5DJ0A 1G7IA 5HD8D 4JHBA 4IRJB 1XMWA 5IR1B 1UM6H 1H3TA 5GJSH 2E7MA 1TPXC 2L7JA 4NWUH 4KK9D 1JGLH 5TE6L 2ATKA 4MJIA 1UVQB 1Q0YH 3VFRA 4DQOH 5LGHL 1IL1B 3UBXI 4PJDF 4L3AA 5C92A 4DFHA 3B9VA 2I9LA 1F4YL 5AWNH 1S7QA 1SYVB 2WWKT 5E94A 4WHYH 4HAGA 5C0GB 4OZIA 1YNKL 5F93C 1IAIM 4FG6C 2Q7YA 4ELME 3BQUC 4MD5B 3RGVC 1T83C 3MROA 4Y5VC 3NCEB 1KIPA 3V5DB 3GKZA 3LV3B 3EYUH 3T65B 1A2YA 2ED9A 2K7PA 1UYWH 4OF3A 4G8EB 4JGMA 2HKFL 4X4XB 3F7RA 4JPVH 4W6XB 4YPGA 4OV5A 1NBVH 3J8F7 2WW8A 3WUWA 1N3NB 3BPLC 5F3BB 1H8SA 2E7BA 4N90E 2DL9A 2P43B 4Q9QH 4R2GD 4HIIA 2RGSA 4PJ7E 5CEYA 2CDEB 1DQJB 1Q9WA 5BMFH 2EZ0C 1DE4A 3RVUD 4S1RL 4V2CB 1S7XA 2IPTL 2UWEE 5FO8A 5I1KL 2J8UB 3BPCB 3ECBB 5D1QD 1DDHB 4LSPH 4UT7H 1GGCL 1DQLH 4OJFH 5JW4N 4IOIB 2XTJC 1EERB 3G6AB 3OQ3B 3VRLF 4I5BA 1A0QL 4AIZA 5DURB 2DB8A 1IVLA 4IJ3B 1ZGLP 5D7LB 4QOKE 1UG9A 2AI0H 5DFVD 2HG5A 3TH3T 4RGOL 4PG9A 4NN5C 2VB5A 4HXBH 3RVVC 1L7IL 1AKJD 5AUMA 3GM8A 1AD9A 2QBWA 3AXLA 4CBPA 2EECA 2UVEA 3HTLX 4ZUVB 4CVUA 3SE8H 2GTZB 5FHBH 1EMTL 4Z8FH 3DOSA 3TWCH 1WZ1H 2WIIB 4L8BA 3L3OA 3UROR 2X05A 1P4LA 3LPWA 4HKJA 1IGMH 4UTAH 1JYWA 1VA9A 5B3JF 1SJXA 4G80A 4OF8A 1OARH 3GMNA 1OAYH 2XA8H 3OGCA 3KPNB 4LKCA 5MP6L 4HEME 1D6VH 4Z9KB 3EDJA 1SJEA 2DTSA 3FFCE 2DQDH 1CGUA 2N4IA 4I3GA 3ZDXF 3S97C 1MFCH 4FXLA 4YDIL 3WLWD 1MF2L 3BKCL 1AO7B 3WUWG 2XQBL 3O8XD 4JFPA 1X6LA 3DYMA 1Z9LA 1SY6H 5L2JB 3R0MA 1XGPB 2YPLD 3LRHA 3SDDD 4XH2B 3FO9B 1RZJC 4LKXB 5LBSL 4N0UA 2WBJC 3D85D 1AIFA 3X13B 3TEUA 3G9AB 1G6RL 1S7TB 1KB9K 4U1GB 3GBNH 1KCRH 5T1MB 2X4RA 5ANMA 4FQ2L 5IK3B 3ESVF 4ZUWA 1MCOL 3IFPA 4GBXA 5J1SC 4LPWA 1A1OB 4P23A 3TO4B 1OD7A 1WWCA 3QI9C 5HI5D 5A3ID 2EYSB 4FABH 3BAEH 1IM9B 3FB7A 5D7JA 4O2EB 4NDMB 1P1ZA 2UV3A 3QQNA 1VGKB 3H7BA 4N0YH 4HX1A 4L29A 1OTUD 4A6YB 3NN8B 5I76A 4DFIA 1NC4D 1YN6B 3WL9A 1EO5A 1NDGB 4EQ2A 2EH7L 1NC2D 3SGDH 3D9AH 4EOWH 3QT2A 5GISL 4MD0B 3MBEC 3ARGB 5I1IH 1OAKH 5GSVB 5LQBH 2AJXH 1OAXL 1EK3A 1DCLA 4KK8D 4TPRL 1D9KC 1I9IH 1BPVA 1ZT7A 1JHTA 2DQEL 5LXGL 1FJ1B 2FO4A 3L7FB 5B22A 3BH8B 1IC4H 2ZNXA 3RWFB 4ZG1A 4PJXE 1YQVL 2GFBB 5C9JB 1AC6A 5I1HH 2CIKA 1T20A 3L5JA 1WBZA 4R90H 1HHJB 2QJDA 4PYHA 2EYRA 4DVRH 5AYUL 1ZGLA 4H0IA 3KYMB 4L9LA 3GB7B 1TENA 1A21A 2WZPD 4F37K 4Z77B 4JO1L 3CSGA 4ONFH 1I8MA 5F96L 3MA9L 2BVPB 3I75A 3L5IA 3DMMA 4G8FA 2V2XB 2EKJA 1E6JH 2QQKL 1K3IA 4XVTH 2YPKA 3CLFH 3JV6A 1X5AA 5K59F 3NA9H 4W70A 5DMIH 3HC3L 3BZ4B 4MJ6A 5CIPB 4PJ9C 3NFSH 2C4FU 3PF2A 3JWNC 4FFVD 4PIRF 1L9NA 5D7SH 3H9HB 1F6FB 1FVEB 3PABB 1NGXA 3EDEA 5ID0A 4WO4C 4KUZL 4RMTA 2PNDA 3TO2A 1XCQA 1HINL 4C54A 1W8NA 4JFYA 1S7WA 1AR1C 3RIAF 5JLZB 1GHFL 3VFSB 5LJYH 3LHPH 1J10A 3BIAX 3ULUC 1DZBA 4PRDB 2VAAA 1LNUA 1KGCE 4WWKD 4PTUB 3B9KC 1MJJB 5F9DC 2R0KL 4NO0A 4KKLD 2YN5A 4L4VB 4LPYA 1UJ3C 3VGAB 5J06A 1ZVSA 3NCJL 5DMKA 4OT1L 5C0JA 2QV2A 1ZTXH 4Z18A 1DANU 1FYTA 3PQYE 4KZEL 4LIQE 1RUMH 1BLNA 4HFWA 2VZOA 3DURB 1RURH 4NQDA 1AI1L 4E0RB 4LDEB 2BFVL 1KT2B 5KANI 1CGSH 1MHCA 4U1SA 5ISZE 4NKIL 5DHVH 1AGCA 1BQUA 2DM2A 1WGOA 2PR4H 1LE5B 4H88H 1I7ZB 3OJMB 5GHWL 1JHLL 2AXJA 1MH5A 4NM8H 3EYSH 2A77H 3QRGL 1R3KA 4PJ5A 1ADQH 2APVA 8FABA 5GIRA 5FDWA 3MV7A 2XZAL 1OGTA 3T2PA 4AENA 4ONOA 3X14A 2NMSA 5ITBH 4LVNB 4Y19D 5CP3A 4JRYA 3AM8C 4HG4J 1C5DA 2WQRA 1MIEH 3VRLE 4YXLH 4JQVA 5IMMA 5EFIB 2YS4A 4Z7UB 1WIPA 3W2DL 1DP0A 4AL8H 4BFBD 1U8JA 4RWHA 4XZUB 4XC3L 1F2QA 3HE7D 4BKLB 4LLUA 3HUJB 2X44D 3KNBA 5T3XL 3BXNA 3WFDH 4LLMA 3JV5A 5IB3B 1N6QH 5GGSA 4K8RL 1KB9J 4TVPH 2I9TB 1FO0B 1NFIA 1KPRB 5F1IA 1ZHKA 2DLGA 2QQLH 3CFBA 5DVMA 4YXHH 2YA1A 3MLYH 3RY6A 1P7QB 4YHZH 4D0DA 3RDTC 3QPQC 3MRFA 5HHME 3O4LE 5C0AE 5DJDB 5D7KD 1XF2A 4IHOB 2GY7B 5T1LB 1MFAH 1BBDH 1K8IB 5B3JE 3HE6C 2LAGB 2P5WA 3MLRH 3N85H 4DGYL 4J12A 1AGEB 4PS4H 3GK8L 1W2KT 5IB2A 4NO2A 2LTQB 3N50A 4FZ8H 3LQMA 2GYSA 4RFEA 5B38A 3ZDXE 5MEPB 5HYQA 2OXGA 3PUCA 4APQB 2NY3B 2HT4D 3KYNA 4I8DA 1TMCB 3U79A 3WBDA 4LLYB 4RSVA 1FNHA 3QUYB 3O6KH 2H2PC 3DVIA 3LPGA 2CDGB 1RIVL 1XCTB 3DX7B 5EU3B 3KLDA 1U8IB 2P44B 2OLDA 2IH1A 4OZ4A 2DI8A 3S35H 2XY2A 4HIEA 2Z31B 3S6CA 2JJUA 3IU3A 2ZCLH 3WIFB 1CXHA 3Q6GL 2KZ1B 2ZOLB 3EYFA 4G8IA 3EGSA 3QWRA 1QRKA 1Q9KA 3GKWH 3U4EA 1MWAB 3FAXA 3D0LB 1Q9LB 2EDRA 2DJUA 1YJDL 1CIDA 3WD5L 3OKDB 5EH1A 5EN2A 4BQCA 1QSFE 5JR1H 3MXVH 2G5BA 3CXHJ 1DN2A 5C07D 3DV6B 2VWEC 2XG4A 4UB0H 1OLZA 4FQQB 4N68A 1QG3A 3QDHA 2NY4B 4XI5D 2EC9T 3CVHB 4YHLL 5F7NC 3FO0L 1A5FH 3VFPB 2XN9E 3STZB 1WITA 4BUGA 3D3VD 1BIIA 1N0XH 4ELMB 3IXTB 2ITCB 3BPOB 5J6HB 3WFCL 5L2KA 3WLBB 1P84K 4JFDE 3V6OE 2GAZA 4PRPD 4DKEL 1UJTA 3ISWA 4BH7A 3CIQA 1C8PA 3ARZA 3G6DH 3DX9B 5FKPA 4O2CB 5D96B 3HCVB 4X0KB 3HS0B 4P2RD 4QHLA 4GG8B 1PZUB 1KLUA 1FL5B 3B83A 1DEDA 2W0LA 1BVKA 1Q0YL 4NKMB 1VFBB 5B4MD 4M43L 4PJ7B 4UIKL 4JHWH 3KPPB 4UUJB 1NBYB 2X4OA 2YKLH 4S0TD 2R8SL 2BY1A 5D1XC 3ALPA 5AEAA 4Q6YA 2UWEB 2ZP0T 3G08A 3SGEH 1PD6A 4HMEA 3LSOB 3RL1B 5EO0B 5IM7A 2EC8A 4YHNA 5B38G 3M8OL 1RZIA 1I1FA 1NBZB 3QUZA 4XMPH 1KJ3H 4LHUA 1OP3K 3QEQD 1MRDL 1F90H 3P4NB 1DEEB 5JO5B 1CDBA 5CKAA 2VUOA 3SKOA 5ACLA 5I1JH 4EI5B 1K85A 1CBVL 1QBMH 4FQHA 5ADOL 4BQ9A 5IROA 5DD3L 2FJHA 1E27B 3OF6A 5HGAA 3OAUH 1RK0A 2ZUXA 5K59E 5IT2H 2C4XA 4QOKB 2DS4A 2K1MA 4JRXD 1QR1B 2E7CA 3FO1A 1CFQA 1DUZB 3D2UA 4X5LA 3STLB 2C7UB 3BWAB 3C5ZD 5BS0E 1T89A 4XPBH 4EUPB 2JELL 2IJ0C 4QRPD 4FA8A 1KACB 7CGTA 1DN0A 4U6YA 2YZ8A 4LSRH 4DN3H 2ZUQB 5GZOD 3QPXL 2V17L 1KN2L 2ZG1A 3L5WB 2UYLA 2VLJE 1JGUH 3MNWA 4H1LA 1NLDH 1WFTA 5AD0B 1U6AH 3IF1B 4GKNA 4MXWL 1QO3A 2L7UA 2YMXL 4M6ML 3S35X 3RRQA 3DWTA 2Y06L 4PY7A 3IU4H 4PREA 4R0LA 3X3GL 3DO7B 3FFCB 3RZCD 3RWIA 2ZSVA 5KS9F 3GSVA 5IG7B 1PGRB 5C0DA 4Q6IB 2HMIC 5IWLC 3CFDA 3A6OA 5CFHA 4FHBD 1HXYB 3GDBA 2EDWA 4WI9A 4MQ7B 4NO5A 5IMLB 5IHLB 1MCBA 4LEXL 2I26N 4OF0A 3O3EB 5KVGH 1TPXB 1T0MB 2XKNA 3DUSA 5E2TH 5FO7A 3BEWB 2EXWD 3V8CA 2BVQB 1OWWA 3VXSE 1XGYL 1IGML 2OI9C 1OM3L 2OMBA 5LCVH 1OT1A 1OARL 4NQEE 2DTMH 2AABL 1OAYL 2XA8L 4LHUG 2Q8BL 2Q8AL 4L8DA 3FOLA 2AJZA 4A2LA 1JYVA 1U8NA 4OZGB 4X83A 1WFUA 1T4KA 2H45A 4MAYC 3O4OB 3GSRB 1RUAL 4XXCA 4PJ8B 2WBKA 4HS6A 1KLGB 3TN0B 5K9KB 3DX8B 1JWSB 2PYEA 5CD5C 2BVUA 4U1LB 1DBBL 1N8ZA 3O41A 1UA6L 4Y5VB 4EDXA 3T1WA 3BP5A 3TYGH 2OJEA 5F88A 2DQGH 1IGYA 2R56H 3TBWB 4P46D 1PG7W 3TT3L 4AM0B 1H0DA 2X4TA 2IBGA 1U8OB 2A9MH 4KQ3L 3BZEA 3LD8B 4NQTA 1D5ZA 1ERNA 2Z91A 1VKXA 5HPMB 1JF6A 4S10A 4ZD3H 3HC4L 1FVDB 1JE6A 3TPKA 3JWOL 4OV6F 2VDML 4V1DD 4I1NB 1MHHA 4H1LG 2J4WL 1S5IH 3IJYB 3MFFA 3RQ3A 2O61A 2ZJSL 3ZDYF 4NZRH 4X7TA 4Z5RB 3QCUH 5SWZD 2OTWB 1I3RB 3HC0A 2M2DA 3RHWF 4PJXB 1MSPA 2FYYB 4WTZA 4XNZC 5EU4B 4N9GB 3U0WH 2YXFA 5TE4H 3MJ8A 3UTZA 2RAMA 2AJUH 2NXYD 3FRUA 1JFQL 3LKNB 4QXGL 4RQQA 3CFJB 1IZJA 1ZLUK 2OR7A 4HUWA 3P30L 3MXWL 1HKFA 3D9AL 1OTTD 4ZYKB 3DVFA 3ARDD 4G6KH 4ODTL 5GS0H 4LSDA 1NAMA 5CBAB 1MCHA 3BD5A 5C6TH 4M6OH 5I17B 4ZSOE 4OCRH 3HAEA 4WRLA 1T7ZA 1ODAA 4G6AD 3MRBB 2X4QB 4P99A 2MOVA 1QUNA 3GMMB 3O2VH 4NIKB 2ADFL 3JWDL 1KXQE 2WUCH 4IIQC 5D1QA 43CAB 4M6NL 3FMGH 3DPBA 3I6KA 4KVCH 5K9OA 1YEIH 5EC1A 2FWOB 1T80A 3GBLA 3NABH 4ZXBC 3VMOA 2Q87A 1MLBB 1JZ3A 1W0WB 3HG1D 1BBJA 3PQYB 4XGZA 4HKBB 1Q1JL 5TPWH 1MIML 4X5WB 2CDFB 4XVTL 5DC0A 3GI8H 3ULSA 3OHXA 1A6WL 5DMIL 3RNKA 2PXYC 4Z7VF 4S1SH 5TQ0H 3UMTA 5ISZB 1D7FA 3RU8H 5CWSA 1IJ9A 5DK3A 4X7FC 4Y4FC 3UTTE 4QF1B 2Q86B 1K8DA 4M00A 4O00A 2H32B 1BFTA 5DK2A 1IEHA 5I8CA 4U6HB 2X4NA 1KCUL 5JW3H 4BQ8A 1ZT4A 4JY6B 3GMPB 1HNFA 2VXUL 3FQTB 3OB0K 3MO1B 3T8XA 3BKMH 1OSZA 2EDFA 4NCDA 3WXWL 2F19H 1JGEB 5JPNA 4WTZG 2X4PA 3K8KA 3BOVA 4RBPK 1U42A 2BERA 3MV8E 3C08H 1NKRA 1BFVH 1ZV5A 3QIUA 2G60H 3PWPD 4ZUSB 4E42B 1HILB 1ORSB 5DVOA 5IJKA 4ZAKC 2X1WL 3E8UH 5D6DC 3GSQA 4JFQA 4M5YH 1MFBH 2PR4L 4X80L 4CU7A 4WEUD 4CUCA 2KPNA 3O8XA 4ZFGH 3DV4B 5T1KA 1CZ8H 1S7UB 5DURD 1BD2A 4O51B 1RHFA 1W72H 3ESUF 5SWSE 3WIIH 3X11A 1CD8A 3FQXA 3GI9L 1IC5H 5DA0B 5I8KL 1K4DB 2B1AL 4UDTA 3FOMA 4JPKL 3HAEG 2YPLA 3FQUB 4HLZH 2W0FB 2V5YA 3D85A 3K4AA 4FQJL 4M03A 3MRNB 5HHMB 3O4LB 5C0AB 1D9KB 4HKZB 2VDPH 1AGBA 2A1WH 5T3XD 4QWWC 2EDHA 1X4ZA 3MV01 1QLEH 1L4IA 2VTFA 2EKSA 4K8RD 4KTYA 1T03L 4HWBL 5FYLE 4KH2A 3LKOB 2VL5B 4QTHB 1FAIL 1FRGL 1GC1H 1SYSA 4ODVL 1N6UA 3UAJD 4QO1A 2ADJB 3GMOB 2GT9B 3B2VL 4KXZH 5EBLB 1NC4A 3SDCA 5B8CB 4YXHL 1S7SA 1BIHA 3MLYL 5IBTL 4PJHA 4HGWA 4O02L 3DRTB 1PLGL 3QNYB 4GW1A 1G7LA 4N1HB 5KBNC 5ACZA 3CJJA 5DYOA 4J1UB 2EE2A 3IKCA 4WO4B 2VLKA 1BBDL 1J8HE 1AE6H 3R8QA 4ENED 2R69H 1WQVT 3T4YB 3ARBD 1MRFH 3LMJL 4JM2C 2DL2A 3R0NA 3NIDE 4HZLA 4P3WA 1MQKH 2LFGA 5EUOF 1QSFB 1BQHB 3EO0B 2GHWB 3U46A 3HNVL 1S9VA 1X3DA 1UJ3B 3MRQA 2GJ6E 2RCSL 4JKKA 3Q3GA 3UC0H 3MRKB 4OCSL 4LNRA 3IYLW 5HYSG 4Q9RL 2XN9B 1TQCB 5HHPB 1WT5A 3FRPG 4GOSA 4LVOB 1NCDH 2WBWB 4OCYL 3FB5B 4JFZL 4JFDB 5H37G 4OZHF 4YHML 1VEPA 4ZFZB 2H3NA 4DEPB 4OCLC 4NYLA 4CMMA 4UU9B 3TIEB 1FGNL 3PWLA 3GMLA 1NMAH 3D69B 2CKBB 2ZCLL 4YHPB 3PP3H 1J5OL 1S9YA 1P5VA 4PRIE 1UEMA 1MNUH 3ZDYE 5E8OA 3VXOB 5I75B 1ZE3C 5A16B 1R24A 2MCG1 3VW3H 1Z9MA 4AG4L 4WHTA 4H8WH 5C0ND 2DN7A 4OTXH 5D1ZB 4KK5D 4XXDB 3TJEL 4WWKA 5L6YL 3P4MA 2Q1EA 2G2RB 1QRNA 2HT3D 2Z35A 4C56D 2SEBA 2CXKA 1JZ8A 3IDNA 4MAUL 4M8QB 3RWHB 3U9PL 3QIWB 4KMQA 1HDMA 4LRIC 3MRRB 1YQ2A 4NJAH 1NJ9A 1JWMA 4K3JH 1VEOA 2BY3A 3C9NA 2BVYA 2ZUVA 5FAAA 3RUGE 1YNTB 4TOYL 4WFEE 3D25A 4WV1B 4PRHB 2ZCKH 4YHIB 4U6XA 1KBGH 4UZGA 3MRLA 1Q9OB 5BS0B 2FBJL 5C0IB 5HHOD 2W60A 4BQBA 1INEH 2FX8H 2VDOH 1PX3A 1OL0A 1ZKAA 4BSJA 2VLJB 3NTCH 1F5WA 4OLWL 2QR0B 4LBEB 4XCEB 5KG9B 3TT1H 5BCAA 4R4FH 2J6EL 3OAYH 4HC1A 4PLKD 4YDJA 4QXUH 4EJ1C 3IKKA 2MMXA 3BH9A 3G5YA 3CSYB 1NGYA 2J2ZA 2JK5A 4L4VD 4BZ1L 1RZJL 1J0KA 3HRZB 4Z7VE 3WKML 1YEHL 2B8OT 4UTBL 1C5BH 1CDCA 4YEFA 2W9DH 1UGNA 2AEIT 1A6UH 3QH3B 1AGFB 4B53A 2HTLD 1JZ7A 5IBUB 4X9HA 1T1WA 1WV7T 4L3CB 4PRBB 1RQ5A 1WAAF 4P5TB 1KENH 4LSRL 3OAZH 1KN4L 4U1IA 1IAIL 4X5XA 3T2NH 4GBXC 2BSED 3IFOA 1G1YA 4F33A 1JNHB 2Y6SC 3C5SA 5JQ6L 2ORBH 1KXVC 1NLDL 4TSAL 2QSCH 4X6BB 3ZKMD 3VXSB 4POZD 1IGCL 1AXTH 4KMTL 3OTTA 4R26L 4NQEB 4MNGE 3ES6A 2NYYD 4KDWA 4G7VH 3V2AR 5ESQB 1RPQA 1XGTB 2HFTA 5FUOH 4QGYA 5HI4C 2ADIA 5EORL 1CK0L 2HWZH 5LGKA 3LN5B 4N9OB 5HYFA 2HA1A 2HJKA 2VIRB 1FFNA 1FZOA 3JSSA 3ZE1F 5F89A 3KWWB 4N8CH 3WO4C 4HJ0C 2PO6B 3U7YL 3BKYL 4XX1E 1F42A 1X5LA 4ZPTA 3LVEA 3OXRA 4OFPA 2XPGB 1HYSC 4QKXB 4HWUA 5JIIA 2QSVA 1R5IA 4NCC2 4R96B 5MENB 3AC0A 3MJ9A 4R7DB 5GQBA 3VXQB 1P7QD 4JFXA 4LLQA 4JPIA 1OSPL 3OKLA 4L9LC 5D1XB 2IQAB 5JW5B 4MD4B 1J1XL 2PCPB 5F21B 2Q76B 3O9WA 3GRWH 1EVUA 2IAMD 3LKPB 5C07A 4EBQH 1IAII 3D48R 5BZWB 1L7TH 2AXGB 4QT5A 3W0WE 5BQ7A 1U93A 4XBPA 4DVBB 4YQXL 2FSEA 3TJHC 4P5KB 3D3VA 3PDOA 5JDSB 4XRCA 2DQGL 2XZQH 3M1BA 3SQOL 1FGVL 4PRPA 1BF8A 4X6DA 4E41E 4OQ1A 5HJ3B 2NY3D 1S9WB 3W82A 1NCAL 3GNMH 4CJ0A 4DZ8A 4P2RA 2AV1A 5I6XB 3P73A 3WFBL 3ULUL 4JLRA 4X6FA 5ALCL 5IVXF 4MJ2A 1HHGA 4KK6D 1UQSA 2VDNL 4NKDB 4HBQA 4R7NA 4JZNA 4ZSOB 3SY0A 1CU4H 5EIIB 2ICWA 3C2SA 4NZRL 4RAVA 4XNXH 2R1YA 5EUOE 3VGHA 4GKZA 3MLSH 3V6ZB 1TVBB 3ME0A 2A0LD 4ZUTA 3BPNC 5IQ7L 3RIAK 3RWDB 5EU6D 4NRXA 1F2XK 1H8NA 3SDAD 3VGBA 1MAJA 2DWEA 3P9LB 4IRSD 2ZUUA 4OLUL 3EUUA 1H3WM 1N6VA 3DSNA 3QDGD 3ZT7A 4Z0XA 2NY4D 4N0FA 4AYFA 1QP1A 1MCKA 2IPKA 3CLEL 5BV7B 3I50L 3CSPA 3L3JA 3C5ZA 4OCRL 3WNPA 1D3CA 3VXME 3L7EB 3UTTB 1HHHB 3GJFA 4J7RA 2EE3A 5EB9A 2EDKA 3RVTC 2JJVA 4JQVC 3P9WB 1ZHNA 3S4SA 3BZDA 4MXVF 1I9JH 1QZ1A 2XWTB 5K93A 5J4MA 1KEGL 3HLAA 1XF4B 4F58L 5FB8A 2FL5A 2P5EB 3FN0L 5I8OH 3BDYH 4K9EH 4DN4H 5FCUH 2AJVH 4DZBB 1S8DB 2XNAB 3MV8B 5E4EB 2YSSA 4MA3B 5IVZA 2IMNA 2KBGA 3V52L 5ICXA 9CGTA 3GI8L 3MLTA 4OKVB 5DD6B 1ES0B 5DMGC 1IBGH 2HLAB 2NQCA 5I2IB 4OM1H 3L3HA 4KKAD 5TQ0L 4TUOA 5JORB 3EO9L 2W92A 3BSZH 3DYOA 1OAZL 1H5BA 3BHBB 1JL8A 3BUYA 4ZTOL 3E2HB 4JFFA 3MFGB 3B3IA 1N2RA 2IF7A 3TFKC 4F7PB 3WDIA 1N5AA 3UXFA 4WJ5A 3ZL4L 1W0VA 3I2CL 2R39A 4PB9L 1I3VA 3PGDA 4WDIB 3ZYIA 3QQ3B 1OVZA 5HGDB 3RVXD 2OYPA 3RX7A 3VCLA 2GJZA 3VMPA 5IOPB 1CCZA 4RGND 1FQ9C 4HXAH 3O6LL 4XCCH 4K3GA 5FA4A 4UDUA 4TVPE 2H1PH 3PGCB 4NNPH 1JHKL 2PTTA 8CGTA 3U6RB 4PJBF 1N5YH 4IMLB 2XI9A 2UZYB 5KS9B 5I66B 5DD0L 1W72L 2ZWLT 3QUXC 4QRRE 3WIIL 2BHZA 4P46A 3I9GH 1KJ2A 3H7LA 1GOGA 1WAAE 4YAQB 2F58L 1M1SA 4ZOCA 1NGQH 2NLJB 2ED8A 3I6GA 1ZK9A 3BGAA 3IFNL 4H0GA 2X7LA 3QZWB 4G3YH 4FP8H 2R2HB 3VXTB 3S4SG 5H2BA 3ZKQD 4V1DA 5F97E 4F7EB 3UYRL 1JMZA 5C08A 3C87A 1K4CB 4DUWA 4YUEL 4XCYB 4H5SA 1J8HB 3P11H 5J6GA 3QQ4A 1FBIH 3FQRA 4IIQB 3K1KC 1YEEL 2BOBB 5MERA 3IS0X 3SDYH 4LLVA 5CGYC 4LCCA 5IHUL 4EXKA 1S7RB 3BJ91 4OLXH 4X7SL 5EZOH 1B4JL 3BZFA 5GGQH 2GJ6B 3VWKA 1CR9H 3O45B 5H8DA 4D9RD 3Q6FA 3ZE1E 1AJ7H 1KIUA 4S1QH 1Z3GL 1T7XA 1XR9B 1RUPL 4XB8A 4FG6D 3U30B 3VXNA 2PXYB 1VFMA 3PL6A 3BQUD 3MZTA 3RGVD 2C3VB 3V5HA 1GIGL 1RJZA 1XF3B 3QA3A 4JY4B 1N4XL 3K3QA 1CGTA 2VR5A 4AT6B 4WFHD 3LN9A 4IRJA 2HJFB 1CDHA 5IR1A 2F54E 4NHCH 3QUZC 4PRIB 5HSFA 4UBDC 4J3OC 1QSED 4RMRA 5JXAH 4JAMB 1H3GA 3W11C 1UVQA 5A2JH 3FN3A 3D87B 3FQNB 2EZ0D 1IL1A 1R3LB 1HWHB 4PGCB 1SYVA 2IFFL 4HPOH 5C0GA 1PY9A 1JUFB 1FIGH 4Z76B 2APWA 3BI9X 4NWTH 3EDKA 3EO1B 5IFHL 5E9DD 3DO3A 3NCCB 4Y4KB 3KYKL 1T89C 2H9GB 2XTJD 5J13C 1EHLH 4QRTB 4MD5A 4PV9B 3RUGB 4NQVB 3U48A 4NP4H 4N1EA 3RJDA 4I18B 3V5DA 3LV3A 3IDGA 4JJ5B 3T65A 5IVXE 3MRJB 4OKDA 4KXZI 4G8EA 3SPVB 4X4XA 3F7QA 3QB7C 2FCBA 1B2WL 1Z9OA 3HZYA 5HDQL 2VZSA 3VW3L 1N3NA 5F3BA 3C60C 5C0CD 4F9PA 4M1DH 3WFHB 4MMZC 4OTXL 5ALBH 3RVVD 5ADPH 4XP9H 4U1NB 1QFPA 1DQJA 4NRYB 1X5FA 5J12B 2DQTH 3HI6H 3VFOB 3MRHB 2MCPL 3VFNA 4R0LC 1G7JB 1MREL 3QFJE 5DI8B 3GSUB 1D6EB 2J8UA 3WKNA 3BPCA 2NR6C 3ECBA 1M7IB 5IIEB 2Z8WC 4K3JL 4HLJA 4LCUB 4IOIA 1ONQB 3G6AA 4DKFL 3QHFH 5L7XH 1JGVH 4U3XA 4MA7L 1C1EL 2AEPL 4IMKA 4Z7VB 1UKTA 2FR4B 2VRAA 3H0TB 3PQYD 4M6AA 4CVZB 4P2QE 2FX7L 1F4XH 5E8DH 5D7LA 4QEGA 2EIDA 2VR9A 5TFSH 1HI6B 3EHBC 1FFRA 5KW9L 2JTDA 1A7PH 5GGRB 4LCWD 3PHQB 4MXVE 3HMXL 4N1CA 4JO3H 4YFLI 1A64A 2R29L 3VWJC 1SEBB 2VDOL 5D72L 4F7TB 3I3DA 2C5DC 2I60L 1CLOL 4ZUVA 5FYJH 4GG6F 5F7HA 3W5NA 1CLZH 2GTZA 2WBJD 3N1PC 2W38A 3VGEA 2WIIA 3PV7A 3DGGB 3KPRD 1VPOH 4MNGB 1LE9B 2R15A 1D5MB 1BEYH 3BIKB 5T3ZH 1Q72L 3KPNA 4U2YA 2HAZA 3QI9D 4OGYH 4U1HB 5I1AB 3EOTH 1CN4A 3QDMD 1A7BA 3ARSA 4JO2H 1X44A 2HT2C 5B3NA 5SV3A 1CFNA 3OKYA 1AO7A 1K3ZA 1FN4B 1CE6B 3ZTJH 1X5KA 2A73B 5L2JA 2HKHH 1HHKB 1XGPA 4GSDL 4XH2A 3FO9A 2VXVL 4LKXA 3MBED 3RL2B 4XCNB 1LO3H 5DQDH 4XMLH 3X13A 1MCEA 3QISA 3IFLL 3QHTC 5C0AD 1S7TA 1TTUA 1C08B 3P0YL 1D9KD 1KCVL 3ROLB 1BGXH 5T1MA 5F7YC 4YGAB 5IK3A 3W0WB 4WI2A 5IGXL 3CC5A 1HQRB 3LDBB 3ULVH 3TVMB 4IOSD 3QJHB 5DWUH 3I02B 2NY0B 4ORGB 4MDIA 3G5ZB 3AUVA 2EYSA 1IM9A 5CP3H 4O2EA 4NDMA 2DICA 1MRCL 2ZZUT 4R4NC 4E41B 3U1SH 1QACA 1VGKA 1ZXQA 3VXRD 2WUBH 4A6YA 2DLFH 3NN8A 1MPAL 3RI5K 1M7DB 1KFAL 4GAJH 4K3HA 1YN6A 1XIWC 5JHDD 4KU1A 1NDGA 4WUUE 4WUKL 4X9IA 5E6IB 2A38A 2RBLA 4RFNC 4RWYL 4MD0A 1SJVA 4DOHE 3ARGA 5FHAH 5GSVA 4PJ9D 2C1OB 1RY7B 1GC1C 4TUJB 4EBQL 2A9NH 1Z2KA 5EUOB 4WO4D 4TNVK 5HVGB 3QIBB 2CD0A 3C2AL 5IW6B 5DS8B 4LASH 1FJ1A 1N59B 4MA8L 3H9SD 3L7FA 4FQIL 3UPCA 1Q38A 2Q3ZA 1AR1D 3BH8A 3IS1X 3RWFA 3MNVB 2GFBA 4XP1H 5C9JA 3VG9B 1E6OH 3ULUD 5AZ2L 1HHJA 4KVNH 3B9KD 1NFDF 4JHZA 4HEPG 3PDGA 4OIBA 1K6QH 5GPRA 3GB7A 4OZHB 1IZKA 4Z77A 1EGJL 5M7QA 3LKRB 4NQCE 2BVPA 1FL3B 1J0IA 2V2XA 1J1PH 3SGKC 2GUOB 2UUDH 1IE5A 1MJ7H 1LGVA 1QVOB 3VXMB 3CVIL 3BZ4A 5CIPA 1NSNH 2VQTA 4AEIH 3SN6N 4LCIH 3MLSL 5C3TA 3H9HA 5DJ6B 3QIUC 1FVEA 3PABA 1CTOA 3VFUB 1I8LA 1F4HA 5IJKC 3EYOB 2DQIL 5JLZA 4JR9H 3VFSA 4PJGF 5KSUB 4PRDA 4PTUA 1P9MA 1MJJA 2MPAH 5DHVB 1ZT1B 3X17A 4L4VA 5D5MF 5HYJB 3L3DB 4ZS6C 1JI1A 1WZLA 3REVB 2DLTA 2NX5E 2MKWA 4HKXB 4J3TA 4OI8A 5DEZA 5C09E 3DURA 3SE3A 5CZVH 4E0RA 1CICC 5L88H 3WO4B 4PBWD 4H8WC 1RIUL 2UZIH 4KGJA 2JIXB 1LE5A 1I7ZA 3KPLB 3KDMB 4PRHD 5I18L 2O5YH 1I9JL 2J3SA 5HGHB 2R2CA 4NO3B 4LGRB 3UDWC 2JJTA 4LAQL 5BS0D 1F3DJ 4OQTH 2J8HA 3RDTD 1LO4H 3QPQD 2B5IB 5IFAL 4PB0H 3UJTH 4NCC1 1G0DA 1Z5LB 2A6IB 3SDCC 3HNTH 5E5UB 4D3CH 5DJYB 3HE6D 4G9DB 2JB5L 1GAFH 2CK2A 5T5FH 2O5XH 5EFIA 4Z7UA 5E5MB 4NNYB 3GJEB 2O93L 1T2QL 5L8KB 4ZUUB 4Y5XB 4XZUA 1GZPB 2EE6A 3SGJC 4BKLA 4OCNC 4QRRB 3HUJA 5LVEA 4FNLL 5IB3A 4H26B 4G9FB 5D4QA 3QDAA 2H2PD 4UOW1 2I9TA 3WSQH 2XZZA 1FO0A 1KPRA 1GGBH 2CKNA 4GG6E 4LAJH 1U41A 1RU9L 1P7QA 1FFPB 5CD3B 2KZWA 1UXWB 2VXQH 2B4CL 3EFDH 1TZGH 2FJGB 3WFZA 4XBGB 3MA7A 4HBCL 4MLSA 4MXQC 5DJDA 1NMBH 3K8LA 5KJRL 4IHOA 4U0RC 3BPNB 5T1LA 1YEJH 1WT5C 1K8IA 5CKGA 4NNPL 1L6XA 1S78C 4LSQH 5D70H 1N5YL 1MI5B 3TCXA 5SX4H 1AGEA 4JB9H 3HFMH 2VZ1A 1RZ7H 1BFOB 4KFZC 2N1KA 5MEPA 2P8MA 4APQA 1F3JB 1LDPH 4LLYA 5T33L 3QUYA 4QHNB 2BNRB 4XMKL 2CDGA 2A2QT 1XCTA 3DX7A 3PP4H 5EU3A 3CAFA 4OFYD 1U8IA 3PWVB 1QEWB 4HUUB 3P11L 2D9QB 2Z31A 5C2UB 2F54B 1CT8B 4GAYB 3WIFA 1JF1B 2PETA 2ZOLA 1CBVH 5MEND 1ZA6B 3DUUB 1MWAA 1R3IL 3D0LA 1Q9LA 5B39B 3MACL 3OKDA 5D1XD 1WFOA 5DJ2A 1J1OL 4OB5L 2EIZB 4CU6A 5L9DL 4HIHB 1IAOA 1J0HA 1CLYL 1JNNH 4FQQA 5HVHB 3UTSE 1TZIB 3CVHA 4Y4HC 3KHQA 2DQFB 3VFPA 3STZA 3FO2B 2F8VA 4ODXB 1O7VA 2XYCA 3S36H 5DFTA 4ELMA 1ZA3B 2ITCA 3IXTA 5J6HA 2ESVD 3WLBA 1VGEH 1K2DB 2HRPH 2MQ0A 5IVXB 4HQQH 1IGFH 4DTGH 3OZ9L 2V5TA 3DX9A 4O2CA 3HCVA 3SHSA 4X0KA 3HS0A 1UWGL 3UX9B 4M1GL 4GG8A 2GSIB 1FL5A 5K9QG 3F8UB 5D93B 4NKMA 1VFBA 5C71A 4PJ7A 3M17B 3AVEA 3KPPA 4UUJA 1NBYA 3GHEH 1U8QB 2N7BA 3QO0B 2BNUB 2FGWL 2FATL 1AQKH 1EPFA 3QFJB 43C9A 5ESAB 1EVTC 2UWEA 3KXFE 4NWTL 1RD6A 5EWIH 3LSOA 3RL1A 5EO0A 1EFXB 4RNRB 3X3FH 1NBZA 3ARUA 2R0LH 1DEEA 3P4NA 3QP3A 2FB4L 4ACPA 5JO5A 2D0GA 1TQBB 4J23A 3T0AA 3QUXB 4QNPF 1JPGA 2AGJL 3TYFA 4Z78B 5HYEA 4FQPA 2V2WB 1E27A 4QHMB 1A7RH 1AP2B 4Z7WE 4P2QB 5KVFL 3G5VA 4ZTPL 4QOKA 3VD3A 2ZSWB 4DK6A 1QR1A 4N5EC 2VABB 3HPJB 1DFBL 4X9FA 1J9CT 1FLTX 4M1DL 2HMID 1DUZA 1FVCB 4MVBC 3F58H 1OWRM 4XVJH 2C9AA 5HGGS 1NLBL 2B20A 2C7UA 3BWAA 2E6PA 3STLA 4EUPA 3HI6L 1MEXH 2D7PA 4BSVB 4PJGE 3DTXB 4JCLA 6FABL 3L5WA 3GMQB 2NPLX 5D5ME 1UC6A 4RAHA 5AD0A 3IF1A 4G5ZL 3TBTA 2P5ED 1GGIH 2OL3H 4IOFC 2YA2A 4RGMB 4K3DL 3SDXE 5E8DL 4MAYD 2H2SC 3GO1H 1CFSA 3DO7A 3FFCA 2PF6A 4L3EB 3ZTNL 3THML 1BOGB 5CD5D 5IG7A 3PWNB 4Q6IA 1GOFA 3UPRB 1FNFA 1HXYA 3OKMB 3O9WC 4HCRA 3LOWA 1WUNT 1H15B 1QNZL 4MQ7A 2P49B 5IMLA 2XACC 2BRRL 4KHXH 1KC5L 4BM7A 3O3EA 1T0MA 4Y0GA 2WAHA 3BEWA 4P5MB 1EO8L 1KIQA 4XC1H 3MV9D 1HK6A 4X8JB 5H35B 3S36X 1RIHH 2VLMD 3H3PH 4PP1C 3F12B 4PJBB 2B0SH 35C8H 4OZGA 3K7UA 1IGJB 4JG0L 3NGBC 3GSRA 3EOTL 4L4TE 1KLGA 5DT1H 3TN0A 2R0ZH 5K9KA 3DX8A 2YRPA 4NUGH 1QBBA 4ZOBA 4JG1H 5J13B 1JWSA 4I0PB 4GQ9L 4G42B 4IRZL 4U1LA 1YMME 4Y5VA 4RISH 2OJZH 4PTTB 5GS2D 4ZO7A 5TDNB 5C0FB 5FOBB 3TBWA 3MMEB 3RY4A 1NGWB 2VH5L 5F3HB 4AM0A 3IRPX 1T21B 4WU7B 4MS8C 4EUPG 5JQHC 1U8OA 4WUUB 4L4JA 3MUY1 2VR4A 2GITB 3MUZ1 3B2UC 5HPMA 1GGYA 2YWZA 4DOHB 5KVEL 1FVDA 2FH8A 3ZHKA 1E4WH 1H3XA 3IJYA 5JZ7C 4Y1AE 2VZTA 4ORZC 2GW5A 1UENA 5KVDH 4Z5RA 2OTWA 4LMQE 1I3RA 5DZLA 4ZFOB 3OKNB 4MHHG 4PV8A 2AV7B 4PJXA 4DW2H 3V9FA 2FYYA 1DSFH 5EU4A 4N9GA 3MBXL 5TE7H 5MEOB 4NPYB 5FO9B 1HH6B 3VXUE 4ZXBD 1A6VH 1S3KL 2GJ6D 2AJSH 3GSWB 4DCQB 4ODSL 1MCLA 3LKNA 3CFJA 1A7NH 4NQCB 3S88L 3GIZH 3QJFB 5IV2B 3ELAT 4ZYKA 3QEGL 2VZ3A 4K94C 2PXYD 2DD8H 1WWBX 1HIML 4C83B 5CBAA 4H20L 3VWJB 4BZYA 1YY8B 4PR5B 3OB0H 5I17A 4Y4FD 1RZFH 3IETB 5CBEB 1U8LB 3VD9A 5D8JH 2ARJB 1R0AL 4PJDA 4KI5C 3MRBA 1P4IH 2X4QA 3GHBL 1C5CL 2OP4L 3GMMA 1ND0B 4ZO9A 1L0YA 4XP1L 5D2LF 4CL7A 2VXSL 43CAA 4WEBL 1H5BC 4K71B 1QR4A 1CFBA 1TVDA 1D5XB 5FOJA 2FWOA 5BJTA 25C8H 3WHE1 4PUBH 4XTRC 1MLBA 3V6BR 2EH8H 1W0WA 3W39B 4B7IA 2J8OA 4ONHB 2IGFH 3PQYA 2NX5B 4HW6A 3LH2H 4HKBA 2XFXB 1J1PL 1RZ8B 3CFCL 3BE1L 5C09B 4UMGA 4ZAKD 4X5WA 2CDFA 1MJ7L 4TULH 2Z8VC 4HF5L 5ISZA 4JN1H 2NY2B 1CDGA 4GLRI 1LO2H 1P2CB 2XTLA 4QF1A 2Q86A 2H32A 4NZTH 1IQDB 2YD6A 4ODWB 1VACB 4YX2H 3HB3C 4X6EB 4JY6A 5EU7E 3GMPA 4ERSL 1RVFH 3FQTA 4CNIB 3MO1A 2BNQD 3QSKB 1BAFH 1JGEA 3LKQB 1MY5A 4LPVA 1RFDL 4QWWD 1QBLL 2Z0BA 4TRPH 5CJQH 2R4SH 5HHVL 3TV3L 4O2FB 3QXAB 4QNPE 2CLVB 2J5LC 4DKAA 4ZUSA 4E42A 1HILA 1ORSA 1B4RA 1PG7L 3WXVL 3STBA 1MJ8H 2G9HB 4FTVE 3QDMA 4IDJL 1LWRA 4KZDL 1P4BH 5JIHA 5HY9B 5I15H 4M7ZB 2O5YL 2R2EB 3DV4A 1S7UA 4I3SL 4O51A 3GIVB 4XPGL 2IADB 1QSVA 3R4DA 1XIWB 1N7MH 1CF8H 4MJID 5EC2B 1K4DA 4RFNB 4LCCC 4KRPC 4OZFH 2DM3A 2DLEA 4GG6B 2W0FA 1UT9A 4GT7A 3S98A 1X5XA 4WW2F 1TJHL 3MRNA 4NZUL 1FDLL 3O4LA 5C0AA 3T3PF 4D3CL 3HNTL 4F37F 3ULVF 1OAQH 1D9KA 1JN6B 3O2DH 4HKZA 5ESVB 4EQ3A 1AFVH 4PGZA 1G9NC 1F13A 1UZ8B 1LO0L 4TSCL 4JM2D 1RHHB 3MODH 3KJ4C 5GGUB 4OIIL 2EDOA 3N1QC 2LABA 4XP4H 3LKOA 2VL5A 5TH2B 4QTHA 1A14H 4OBRA 3Q1SH 1B0WA 4IRJC 4PY8I 5IW3A 4R8WH 2ADJA 4DKDC 1SMOA 2CLRB 2GT9A 3GMOA 5H94B 1QFUH 5EBLA 3SO5A 3WSQL 1A1NB 3CMGA 3IDIB 5B8CA 3KR3H 4YE4H 1QQDB 3MRDB 1XAUA 2DBLH 3DRTA 3DSFL 4MSWB 1A3RL 3QNYA 1CXIA 2I27N 5KAQF 2CR6A 4J1UA 2CR3A 3GSNH 4WO4A 4UT9H 2IFGA 2BY2A 1G7QB 5F7EL 1G6VK 5IF0B 2JB6B 1XGRB 5HYSB 3MYJB 4I3RL 2E9IA 3IAPA 3ZE0F 1QSFA 1BQHA 1F6AB 2MJWA 3V4UL 3EO0A 3L1OL 1A4JB 2HLFC 3J7HA 1UJ3A 3KLAB 1WZKA 1PY4A 4KTDH 1I9RH 3UTSB 3MRKA 4I9WE 4UV7H 4OD1H 4OLYH 3UBXG 3IVKB 1BF2A 4GW5A 2XN9A 5CSZB 4F9PC 5HHPA 1SBSH 1CICB 2VERN 1CD1B 1KB5H 3FB5A 2J88L 4JFDA 3V6OA 3LS4H 4FFZL 5KN5B 2NY5L 4ZFZA 4J4PC 1G9MC 5CEZL 4LFHG 3F62A 4UU9A 3TIEA 4BFGA 5DVNA 5DQ9B 2DDQH 4OM0H 3D69A 2CKBA 4YHPA 5GGTH 1NANI 3OPZH 4N0UE 3VI4F 4WW2C 1NUFA 5GRUL 1J0YA 2Z8RA 3ULVC 4TUKH 3VXOA 5A16A 1U9KA 4L9DA 3P40A 4GRLB 2NZIA 1I3GL 1FNSL 1CS6A 2QQNH 4HAFA 5D1ZA 1J87A 1K9TA 4KAQL 4XXDA 1NGZB 3KXFB 1PKQE 2G2RA 3LEYL 4IJ3C 3AM8A 4M48H 3MJ9H 1NFDB 3RWHA 4M8QA 1R6VA 3QIWA 4PGBB 3PXJA 3P2TA 3MRRA 1IKNC 2R4RL 1VGEL 5BOPA 3BW9B 4LP5A 1OP5H 3MJ6A 4UT6L 3SEPA 2DWDB 2HJLB 1YNTA 3DX6B 2N56A 2E6JA 1WBYB 3K46A 4WV1A 4PRHA 5E8PB 4YHIA 1HHIB 4U6VL 3RVWC 1PBYA 5MI0C 2APTA 1Q9OA 5TE6H 4P3CL 4EN3C 2FO1A 32C2B 4M7KL 1JNLL 5LGHH 5BS0A 2HYMA 5C0IA 2H26B 2XZCL 2D7TH 1KPUB 5D2LE 1F4YH 4QCIB 3VG0L 3LQAC 3VFMB 4GBXD 4PJGB 2Y6SD 2WNGA 4G6JL 1YNKH 4P2OB 5LG1A 3X3FL 2VLJA 3HE6A 3UO1H 5D5MB 5FM5M 2QR0A 4Q2ZB 4P9HC 4LBEA 4XCEA 5KG9A 3MTRA 4GRWF 1ZLVK 3CSYA 5HYJD 1J88A 3N06B 5HI4D 2HKFH 2ZPKL 3HRZA 1J0JA 5FYJE 3MR9B 7FABH 4R9HA 2DIBA 3DXAE 3QH3A 1AGFA 4OFDA 3RPIB 4HWEL 4L3CA 3HI5H 3RWCB 4HJ0D 4PRBA 5DDHA 1LP9F 4Q97A 4WY7L 4U1GC 2DKSA 4P5TA 1MFEL 1E4XL 4S1RH 4HH9B 1GGTA 3EOBB 3WN5B 1HYSD 1RK1B 4X99B 1YECL 2IPTH 5CS7A 2UY7A 5I1KH 3WE6B 1NAML 3NH7L 5T3ZE 4JVUA 3TO4C 1JNHA 3T2OA 4X6BA 1GOHA 1XZ0B 2C4FT 5EBWB 3VXSA 4RMQA 1O0VA 5TDOB 1VCAA 4RIRB 3MLWL 1A0QH 4NQEA 4EXPX 4BFEA 4JDZB 1QTYT 2JE8A 5ESQA 2GEEA 1XGTA 4XP6H 4Y4HB 2AS5M 4LOUC 1OW0C 4L4TB 3LN5A 4DWHA 1TJGH 3V0VB 3TJHD 2V5SA 3ARGC 4RGOH 4Q58C 2WSKA 2VIRA 1YMMB 3E0GA 1L7IH 3OKKB 1DANT 4NOFA 3ZKSD 2PO6A 3EOAB 4JO4H 4OAWB 2VN4A 1PQZB 2XPGA 3T0VA 1QFOA 2EDTA 1CD9B 1MVUB 1P7KB 5FUCC 4G9FD 3IGAB 1EMTH 4PJ5E 3T3PE 3ULVE 1IC1A 2ZKHL 4R96A 3VFGL 2AK4E 2YRZA 5MENA 1HNGA 4GAGL 3MV7E 4GKOA 1EH9A 4R7DA 3ZHLA 5CHNB 3T0WA 3VXQA 4NO0D 2DBJA 2X89A 5FK9B 1DUYB 2HVKB 5D1XA 2IQAA 3H3PL 1RJLB 5JW5A 4MD4A 2ICEB 3IXAB 2WIMA 4Y1AB 1E4XI 5EUKB 2PCPA 2Q76A 5TF1L 1JK8B 3L5XL 3LKPA 5C1MB 5MP6H 5BZWA 3U4BL 1UXSB 2AXGA 1T5XB 4DVBA 2LVCA 1DBML 4KROC 1MI5D 4YDIH 4P5KA 5JDSA 5L8JB 3VXUB 1DBAL 1MF2H 3BKCH 4G6FD 2XQBH 3OR7B 3HZKB 5K33A 1JV5B 5HDLA 5IBUG 2C3XA 3FB8B 5HJ3A 5T1DL 1S9WA 3NZHL 3WDJA 4FMKA 3EZ8A 1RZGB 2BNRD 5LBSH 4OFKA 2DQJH 1P9MC 4NKDA 3VGAC 3KPOB 4JRYD 4ZSOA 5EIIA 2E6QA 4ODHL 4WW1B 3RVTD 3VA2C 4FQ2H 1MCOH 3ZE0E 3OAYK 2P5WE 2NCMA 3S8WA 3V6ZA 1TVBA 3BRFA 4MZ2A 3T3MF 3CPLB 3SE3C 3RWDA 4F9LC 1XF1A 4X7DC 3HZMB 2R1XB 1A6VL 1W0YT 1OF2B 1IAKB 3MUHL 3HR6A 5BW7C 1FYHB 4PPTA 4XWGH 1N64L 3CZJA 3QDJE 4Z7NF 2OMNA 2JJTC 5DMGD 5E2UL 2EH7H 3O6FB 3OAZK 2MHAB 4GW4A 2DJSA 1ED3B 5GISH 3W9EB 3M07A 3NFNB 3MLXL 1ZANL 3UYOD 5CJOL 1NQBA 3VI4E 1G7IB 1OAXH 4OD3L 4LVNC 4TPRH 3JXAA 3L7EA 1LK2B 3UTTA 4ZMAT 1HHHA 1UWEL 4W4OA 2FIRT 2P42B 2DQEH 4JKPL 4LSSL 5LXGH 3RTQB 3TFKD 5EBGA 3TBSB 4AJ0A 4M7JL 1YQVH 2DQCL 5KSAC 3BIBX 2XWTA 4U1JA 1XF4A 2ZUWA 3MRPB 2Y9RT 3TF7C 4IS6B 5C2BL 5AYUH 5EDXA 4OCWL 2P5EA 2C3GA 1Q0XL 1Y6NR 4U6TA 4JO1H 4DZBA 1S8DA 2XNAA 3MV8A 3DI3B 4MAYA 4MA3A 1KOAA 3MA9H 1A9EB 1EFXD 1F4AA 5BRZE 4OKVA 5DD6A 3PWUA 1ES0A 3F65A 2AJ3B 2HLAA 5I2IA 3ZKNC 2QQKH 3E3QE 4FTVB 4GXVL 5JORA 3TIDB 4JN1L 2CO6B 3HC3H 3QUXD 3BHBA 3EZJB 1NKOA 2VKXA 2PTVA 2M26A 3TZVC 4YH6A 5BZDB 3TH4T 1X4XA 4KUZH 3C6LB 1HINH 4F7PA 1T04B 3KLHC 4HV8B 1GHFH 2BJML 1EEYB 1A1MB 1Y0LB 4OI9A 3BP7B 1S7XB 1QFWM 4LPXA 4WDIA 3QQ3A 3MCKB 2R0KH 5HGDA 2M1KA 3NCJH 2IBZX 3HZVB 1HOCB 4OT1H 4P48A 1LDSA 4FXKB 4ODUB 3C6SB 4GRWE 3QUYC 4XBEL 4KZEH 1QLFB 3KPSE 2CMRL 2R1WB 5IOPA 4WI5A 5F1NB 1CG9B 5CGYD 5L2KD 1O5DT 1DQML 1AI1H 4UNVA 5EG6C 3PGCA 2BFVH 3INUL 3U6RA 4IMLA 5I15L 5KS9A 1KG0B 4NKIH 4MMXC 4WI6A 5I66A 4XHJC 2Z31C 2BMKB 2GCYB 1U3ZA 1V5JA 4NRZB 5CILL 2X6MA 2DYPB 5GHWH 2Z8SA 5KOMC 1LK3L 1JHLH 1LP9E 4YAQA 4X4YB 4F57L 4PG9B 5IB5B 4M93B 4L3ED 3LQZA 4O9HL 3QRGH 1FG2B 4B5EA 2NLJA 1XGQB 4EI6B 3QZWA 3AXLB 1Y6KR 5IB4B 1FC2D 3VXTA 2XZAH 3ZSTA 2YOCA 4G8GE 4F7EA 3OGOE 1K4CA 3QUZD 1J8HA 4LHUD 4UBDD 4ELKB 2VITB 4PYGA 3CK0L 4IIQA 5L8LB 1LEIB 2BOBA 3W2DH 4RX4A 2X9XA 3W11D 1T5WB 3BPOC 3CFKB 4JZJB 4G80B 3OF6D 3Q1SL 4S1DC 3SJVE 3VD4A 1S7RA 5C6WH 5T3XH 2NW2B 2EO1A 4MB5A 1DVFB 2GJ6A 3O45A 5D96C 2OS7A 2F15A 4HC1L 3RX5A 1JZ5A 4K8RH 3D2UD 2ENSA 3FT3B 4WFGE 1XR9A 2YZ1A 5C7XL 2B1HL 1SM3L 1FLRL 2E9BA 5DZNA 4TNWK 4PJFF 2PXYA 5DK0A 3UPAA 4MZ3A 2C3VA 1AY1L 4UI2A 4JY4A 4AK1A 4MCYB 4AT6A 1KJVB 3JZ7A 2HJFA 2NY6C 4N0UB 4PRIA 3CUPA 3PGFL 5DD5L 4UILL 5EOCL 5IMOB 5IHZB 3C60D 4DGYH 3TGXA 4JAMA 4B7LA 1IGIL 4EI5C 5IHBA 1I1RA 4K07A 3FQNA 1T66C 3DROB 3F7VB 3IFPB 1FFQA 1R3LA 1PKQB 4P23B 4PGCA 1QKZL 4OD1L 5CEZD 2NR6D 4ODBD 4Z76A 3EO1A 1RIVH 4Y4KA 5D7JB 4QRQB 2VLLB 3LS4L 4MNHB 1DQDL 4HFUL 2H9GA 4NM4L 5D6DA 5DD1L 5J8OA 4QRTA 4PV9A 1EAPB 2ZUQC 1ZSDB 4NQVA 5E56A 3UEZA 1BREA 1I7RB 5D2NC 3OPZL 4GJTB 4I18A 1MCNA 3QZWG 4HSQA 4JJ5A 3MRJA 3IDJB 3SPVA 5FECB 1NBQA 3Q6GH 3EHBD 2YWYA 4KRPB 4XT1C 4TYUA 3WD5H 1BJ1J 4WFFD 3VWJD 3WFHA 4GMTL 5D2LB 5HPOA 4U1NA 3T3ME 4NRYA 1B90A 5CJ8A 4M48L 1EUUA 5E6YA 3VFOA 3MRHA 1HSAA 1G7JA 5DI8A 3GSUA 1D6EA 1VFAB 2CIKB 2PYED 4YHLH 1F3DH 5IIEA 1M7IA 5E7BA 5JUEL 2X1QA 5CZXC 3WFCH 4Z7NE 3LZFL 4HUMB 4LCUA 4DKEH 1ONQA 3K2UL 4HMCA 4NQXB 3I75B 3FTGB 3DHJA 4Z7VA 3B8SA 2FR4A 1PX4A 3H0TA 5INCA 4CVZA 2NZ9C 4JEGB 3CZFB 3DXAB 4OUUB 4M43H 2D7TL 4UIKH 4U2ZA 4FRWA 4WHYG 2HT2D 2R8SH 1IT9L 2EIBA 5GGRA 4PLJC 3PHQA 4EKXA 5KZCB 2I24N 4DJMA 4IDLA 1SEBA 5ID0B 3MC0A 3ROOB 4O4YL 4F7TA 4OGXL 2UZXB 3O4OC 4QLRA 3NCMA 1HXMB 4PJ8C 3UO1L 3TN0C 4LPTA 3QYCA 3M8OH 4YDKL 4QXTB 4AEHH 3AREC 4ALAL 4JM2A 3ABZA 1MRDH 3PIQB 5J0BA 3CFEB 3BGFC 3MLVH 5ADOH 4MQSB 4MNGA 5DD3H 1LE9A 5C0JB 2YD2A 4M9PA 1D5MA 2CGRL 3QWQB 3BIKA 3LD8C 1SY6A 1T7YA 7FABL 3T77B 3DARA 4U1HA 2VC2L 5I1AA 3HI5L 5E08L 1MHCB 2FX9L 2IANB 5KOVC 2JELH 2Z93B 4R4ND 4LSVL 4LRNL 2W9LA 3JVGA 5DRWB 3AAZB 3QPXH 2V17H 2G75B 1KN2H 3BEVB 1PFCA 1CE6A 4Q0XL 1XIWD 4WW2B 2A73A 5IQ9B 4HS8L 4RA3A 1KJMB 3EKCA 3REWB 1HHKA 1QYGL 2AK4B 1YEFL 5DEFB 8FABB 5GIRB 2WK2A 3RL2A 3JV4B 4XCNA 4H25B 4MXWH 4Y2OA 2RJMA 1H9VA 2D7MA 3PWJA 1OAUL 2GK2A 1C08A 2YMXH 4M6MH 4O5LL 4XP6L 3UTOA 2Y06H 2ARJQ 4YLQT 1TJGL 1A3LL 1CYGA 3W0WA 4K94L 2NXZC 3X3GH 3TM6A 2HFFB 2FECL 1HQRA 1F45A 3TVMA 4LRIA 3QJHA 2ICWI 3I02A 4ORGA 3A6BL 3G5ZA 4JO4L 5FFLA 1KIRB 4ONGL 4C59B 2P47B 1MHPH 3OKOB 3VU2A 2DMBA 4E41A 5D2NE 4LEXH 1V7ML 1FFOB 3PV6B 2C3HA 4LCYB 1M7DA 5MI0B 4FQLL 3S3JA 1J05B 1I1AB 4JE4B 4EN3B 5E6IA 1XGYH 3K1DA 1OM3H 1OGAE 1JWUB 2OX5A 2AABH 2HFGL 2C1OA 3QXDB 2Q8BH 2Q8AH 5AZEL 5GGVL 3QIUD 5EUOA 3MLZL 3UTQB 1GRWA 3QIBA 1RUAH 15C8L 2G5RA 5IW6A 5DS8A 1N59A 5IB2B 1INDL 1I8IB 4HG4K 3MNVA 1DBBH 4LGSB 1UA6H 3HKFA 5FA3B 5T1KD 4WTXA 3SQBA 2VISB 1BD2D 5E00B 1N0LA 2I5YL 5DO2C 3TT3H 3QDJB 4ZS6D 4X8XA 4PJFE 1IEBB 5E1AA 4OZHA 3UTSD 4C57C 4KQ3H 5DXWA 4X6DF 4XX1G 5F9AC 2JCCF 3LKRA 5DFWH 4E5XA 1FL3A 1YDPB 1HN1A 2FECI 2VDRL 3HC4H 1CICD 1RJCA 4GMSL 1KJ2L 2DQJL 4KPHL 3JWOH 2GUOA 2VDMH 4G6ML 3B5HA 1QVOA 2J4WH 3VXMA 2DQHH 4YFEA 2ZJSH 4G8IB 4JY5L 1ZLSL 1S9XB 5DJ6A 1TTGA 3VFUA 3RPKA 1RZKC 1FAKT 1ULVA 5EN2B 3SO3C 2VOTA 3ARWA 1PAMA 1CVRA 4X6CF 3FAWA 2X41A 4XWGL 3F6LA 5KSUA 2ERJB 3KXFD 5DHVA 1JFQH 1ZT1A 4QXGH 3SDCD 5HYJA 5AG8A 3L3DA 3FONB 1I4FB 3P30H 3MXWH 3REVA 5BRZB 4CVXB 1WCBB 4HKXA 3MJ7B 6CGTA 4ODTH 5LWYL 3MRIB 4YDLC 1ADQA 4O58L 5J9PB 1MCPL 3BGMB 2DIJA 4JPWL 3TP4A 5F6HI 3UZVB 4FQXB 2VLKD 1G9NL 2JIXA 2V2TB 5DUBA 1OQOA 3KPLA 2RQ8A 3KDMA 2BP3A 3ARYA 1CD0A 2W91A 4EDWL 3ARFC 2ADFH 3JWDH 4NO3A 5HGHA 5HHXL 4M6NH 3L9RB 4OSUL 4NC0B 3P4OB 1SMAA 3AS1A 5HGBB 2QADB 5F8QC 2OK0L 2L0DA 4P0DA 4WCYL 5BVJB 4MXQD 4GRWB 1Z5LA 3KPSB 2A6IA 3CCHB 3CXHK 1EHNA 1Q1JH 4N0CC 5B8CC 1U3HB 5FYKE 5DJYA 1MIMH 2JJWA 4G9DA 1S78D 2ED7A 4JZOB 1PZ5A 4KROB 1MELA 1A6WH 5E5MA 3T08A 4ZO6A 4NNYA 3GJEA 2FBOJ 4ZUUA 4Y5XA 3ALWA 1GZPA 5EO9B 3TA3C 1M71B 4WI8A 3BN3B 3AY4C 4QRRA 5IJVB 1YMHB 1LP9B 1WAAA 4GS7B 3W9DB 1KCUH 4H26A 4G9FA 5B4MC 4HMDA 2VXUH 5D7IF 1DR9A 4PGEB 2AERT 1QLRA 1QRND 1FFPA 4FFYL 3WXWH 5CD3A 4G8GB 1UXWA 4Y19E 4BSWB 5I1LB 2FJGA 5F9JB 4XBGA 5GXBB 1FCCA 1TQCC 2VDQL 4KQ4L 1JTPA 4WI3A 4LVOC 4MA1B 3QO1B 5DRXB 4DGIL 2YUWA 4X98B 3V6OC 1MI5A 4MB3A 4WENB 1F00I 4DEPC 3SJVB 4X80H 5DRNB 3I3EA 1BFOA 3QXUA 4PY7B 4XPHL 4G43B 3GI9H 3QFDB 2UUDK 1F3JA 4K7PL 5I8KH 1EUTA 4YBHA 2B1AH 3QRFM 4JPKH 5I75C 5I9QC 4HWZB 4QHNA 2BNRA 2OZ4A 2DKMA 5GRJH 3FCTB 5D1ZC 4FQJH 3PWVA 1R3HB 2YD9A 2CIIB 1VENA 2CPCA 1QEWA 3QEUB 5CLWA 4S0SD 5D7KE 4HUUA 5HDOA 3RWGB 3QIWC 2D0FA 4BK5A 3VGDA 1CFVL 1IEAB 3I6LD 1CT8A 3G9VA 4GAYA 1JF1A 5KSAB 3V0WL 4HWBH 1ZA6A 1T03H 5FV1L 4MB4A 1SEQL 1FAIH 1EEUA 5B39A 2F5BL 1MCDA 1FRGH 4JFHD 1FZKB 5J89A 4ODVH 5ABDE 4QRUB 4S2SB 4WV1C 2EIZA 3OB8A 5TJWK 4HIHA 2Y4SA 3B2VH 1YY9C 3BN9C 1NDMB 1TZIA 2FEDC 1N8ZB 1PEWA 3UJIL 4BJLA 2DQFA 4UIMB 2MTPA 5IBTH 4O02H 4TQEL 3FO2A 1G7MB 1PLGH 5JHLL 3KYAA 4ODXA 4BH8B 5SX5K 1AD0B 1ZA3A 4KJPC 2HRLA 3T0BA 2OR9L 1K2DA 5EULV 3TZVB 5IVXA 2X4SB 1VKXB 3VGGA 1ZEAL 1YYML 4GUPB 2YUZA 4P9HL 5F7FA 3U36B 3S34L 4N5ED 5HDBF 5IEKB 3WEXB 4P9ML 1HZHL 3EDFA 3LMJH 3PNWB 4MVBD 2GSIA 4PGDB 4I77L 5I19H 4AIXA 1JPFB 3L5HA 3L3GB 3M17A 4NNXB 4K7FB 3N9GL 1U8QA 1UACL 3JTTB 4M61B 3HNVH 3QO0A 4CDGC 5C07E 2BNUA 2RCSH 2QHRL 3QFJA 5ESAA 4L1DA 4OCSH 1BWMA 4Q9RH 4WGWB 4LSUL 4XAKD 3D3VE 1EFXA 2EO9A 3OJVC 4MWFA 4RNRA 2EXYC 4OCYH 1FNGB 4JFZH 4P5TC 4YHMH 4X6DE 2JCCE 4IOFD 2ZUSA 1EJOL 3MOBL 4HUWB 3QUXA 1FGNH 3WYRA 3B4NA 4Z78A 5DUPL 2H2SD 1LD9B 3HPLB 4P2RE 4QHMA 1AP2A 1J5OH 4P2QA 4OCXL 4OGZA 2ZSWA 2P46B 4R2GB 4ZPVA 2VABA 3HPJA 1MY7A 1FVCA 4FS0A 3D1MC 4POUB 4A6YL 4AG4H 2EEDA 5JOEA 1FV1B 1KNOB 2P8LB 4LU5L 2CK0L 3O9WD 4RDQF 2EYTB 3TJEH 1Y18B 2OL3B 3O6MH 4HK3J 3ET9F 5I74B 5L6YH 2EDQA 4YDVB 4X6CE 1PKOA 5B39G 4MAUH 4BSVA 2O26U 3U9PH 3DTXA 3GMQA 3QEQE 5EC1B 1MFDL 1NGPL 5DJXB 2PO6C 4KRNA 5C9KA 3EYQC 4PP1D 1YNLL 3T0EC 4TOYH 5CP7B 3BDBA 4JRXE 1A8JH 1XFPA 3SE9L 5BVPL 3FT4B 5F1SA 3MLPA 3ARDC 2EDJA 4YIQB 3U4AA 4L3EA 2IH3B 5DLML 1GL4B 1BOGA 2FBJH 2BY0A 3PWNA 1AKJB 1ACYL 1YEKL 3UPRA 4CDHA 4QRPE 3OKMA 2YK1L 3OR6B 1H15A 3SKJL 1T0NB 2NY6B 4MS8D 4OGAC 4AEHL 4OLWH 3B2UD 1UM4L 4HWNA 3E6FB 4P5MA 3GGWB 1V8HA 2J6EH 3MLVL 3WHXB 5JPNB 2OCFD 3GSOB 5E03A 3SCMC 4X8JA 3G5XB 3S37L 5H35A 2QL1A 2H32H 5JZ7D 4JHAL 1NMCB 3O3DA 4LPCA 2F53E 4BZ1H 1RZJH 3F12A 4PJBA 2WINB 3WKMH 1YEHH 4UTBH 5I6XC 1IGJA 2R0WL 2VUYA 3QG7L 4V2BA 3O11B 5IEHB 4EIGB 3KPQB 4I0PA 1LVEA 5C0BD 4G42A 4I48B 4YR6B 1KN4H 4PTTA 5TDNA 5D2NB 5C0FA 5D7IE 1IAIH 3BVNB 4UAOB 4PY8J 3MMEA 5FOBA 1NGWA 2DYPD 5J3HC 4DK3A 5F3HA 3SDDB 1T21A 1KEML 4WU7A 5JQ6H 4UINL 4WUUA 4TSAH 3BFOA 2OQJA 2GITA 4XNUL 3FB6B 3C60A 1IGCH 1OGAB 5GS1C 4KMTH 1FPTL 1V05A 2E8YA 4R26H 3F5WB 4NUJB 3WIHA 4U3HA 5FM8A 3MREB 5GRVL 4KI5D 5EORH 1CK0H 3JBG7 4FFWC 5BV7C 4ZFOA 3OKNA 4XPTL 2AV7A 2DMCA 3L95A 4PJEA 1JZ4A 1Z0NA 1YPZF 1MHPL 3DBXB 4NPYA 5FO9A 1HH6A 5KSBF 1HQ4B 2GK0B 3ALXA 3BKYH 3U7YH 1CXLA 4W4OC 4JFFD 1JPSL 5JOPE 3BP4B 4PJFB 3GSWA 4LDLB 1RULL 4MNQE 4K2UL 1HKLL 4I9WD 3P77B 1NC2B 1OP9A 4NQCA 2AQ2A 4LL9A 3QJFA 5IV2A 2AJYH 5CZKA 4PP2B 2J1KA 4Y2DC 4V1DE 4C83A 1OSPH 4HS3B 3WV0A 1R5WB 3VWJA 4PR5A 3NIDF 4HD9A 1J1XH 1F3RB 3IETA 1FO0L 5E4EC 1U8LA 3B43A 5CBEA 2ARJA 5SWZE 2IG2L 5F7DB 3DECA 4HZLB 3HB3D 3AREB 5A2LH 5LAXB 1ND0A 4YQXH 1VERA 4OD2B 5FXCH 1JCKA 3BGFB 3SQOH 4DGVH 1D5XA 2UY6A 1FGVH 5I1GL 3A0OA 1WSST 1D5IH 3T0EE 3JV0A 3E2HC 4TTDC 2WMPA 4IM8A 1NCAH 1VFOA 4ONHA 3VFWB 1NCCH 2NX5A 3LEVL 5D6CB 3WFBH 2XFXA 4FQCL 1T1YB 1RZ8A 3ULUH 5C09A 3EBAA 1U95B 5ALCH 3O0RL 5C08D 3PWLB 2F9BT 5HDBE 2VDNH 3RBSA 2DQHL 1I8KB 4XVSL 4L8SB 4HT1L 3KJ6L 5CSBA 1MUJB 3P9MB 3MJGX 3T09A 1RUKL 2YD4A 1P2CA 5GJTL 1VDGA 1IQDA 5IQ7H 2YD7A 1VACA 5DUMH 4KRPD 1Q8MA 4MX7B 5TQ2H 2R23B 4X6EA 2BDNL 4LLWA 4OF7A 3VWKD 1YYLL 4WWKB 4CNIA 4FXGB 1P69B 5IBLD 4OLUH 3HG1E 4M9OA 4D2NA 3LKQA 1MWAL 1ACZA 1NUGA 4RA0C 1HDMB 4WU5B 1YA5A 3RI5F 3ZHDA 2NXZB 3RUGF 4O2FA 1O7SA 3PL6D 3QXAA 2CLVA 3CLEH 4OZFB 1HCFX 5K9QI 3I50H 1YJDC 2G9HA 3QXWA 1D5BB 4IRJD 3CVHL 4QTIL 1Y6MR 1RJYB 5HY9A 4TNVF 2R2EA 4J3XA 2EDDA 3GIVA 2LAAA 2IADA 1XIWA 2BK8A 1T7WA 5EC2A 4LARL 2D7QA 1EIBA 2AXHA 1KEGH 1G7HB 4F58H 5MHSD 4GG6A 3BP6B 4NBXB 1ZS8B 1ORQB 3FN0H 4Y19B 4F2MA 4OBSA 4XP5L 1JN6A 5ESVA 4HJGB 4BFIB 2CJUL 1GYAA 1MFNA 3V52H 3PWPE 3L3KB 3DJ9A 3U30C 1UZ8A 1F8TL 1RHHA 5GGUA 2FH6A 3HE7B 3EO9H 3MGTA 5T5NG 5TH2A 5CEXB 1OAZH 2HLFD 5E1HB 4HK0B 1P7HL 2AVGA 1YN7B 4ZTOH 5EOTB 5J7CC 1QA9B 5CINL 3GSNB 3UTPD 2CLRA 5ETUB 5H94A 4LHJB 1I3UA 3AU1B 1A1NA 5IP4A 3IDIA 3ZL4H 2FLBT 3SGKA 1NL0H 1QQDA 3I2CH 2MNUA 4PB9H 3MRDA 2IAND 4MSWA 2BX5A 4J4PD 4J6RL 1U8KB 5T3XE 5I71B 5FUZH 3BD4A 1M05B 2V7HB 3I3BA 1T6WA 4Y4KC 1G7QA 3O6LH 3S3PA 5E4IA 2AK4D 3SO3B 3DIFB 2GI7A 5IF0A 2JB6A 1JHKH 1XGRA 2C3WA 3MYJA 5HYSA 3UBXB 1KB5B 1BQLL 4NSKB 1F6AA 3TH2T 3FRPA 4I18C 1A4JA 3A67H 5DD0H 1MCWM 1F58L 1NCTA 4YHKL 4HLZG 5D7LD 1Q94B 2X10A 3LCYA 4LQFL 3UTSA 2F58H 2OTUB 2ZOKB 3IVKA 1QFWL 5CSZA 1ZHLB 3IFNH 5GRJL 4YDLB 2ADGB 2W1NA 3PG2A 1CICA 1CD1A 3OXRB 4XWOC 1WTGT 5J12C 5KN5A 2XQYK 4CN6A 3OMZA 3UYRH 2A83B 1AXSA 4YUEH 2WM0A 4LPUA 1R5IB 4M5ZL 5DQ9A 2Q20A 3RVWD 4NBZB 3D0VB 4NZJA 3TCLA 3ARFB 4KMLB 3RIFK 1YEEH 4BZ2L 3UDWA 4HCRL 4D8PB 4EN3D 4JFXB 5DHYB 1ZMYA 4LNVA 3Q5TA 5CUSL 5IHUH 4GRLA 4X7SH 3NAAL 1B4JH 2Y07L 4QT5B 4Z0BL 1UH3A 3BYYA 4XBPB 1BX2B 1NGZA 2QKIB 3KXFA 1ZLVH 1YPZE 5KSBE 1Z3GH 1B0RB 4M8VA 1RUPH 1NFDA 3D3VB 4PGBA 3G6JF 2E27H 5FYKU 3O2WL 1G84A 4PJIA 1AO7D 4X6DB 5EA0L 1GIGH 2JCCB 5I1DB 1N4XH 1IKFL 3BW9A 1LEKB 3TA3B 3EOYG 3SGJA 1C16B 4NKQB 2DWDA 2HJLA 2VO5A 3DX6A 3PHSA 4P2RB 1WBYA 3P73B 1JGDA 5E8PA 1HHIA 1LO5B 1IC7L 4JLRB 5E2VL 2ARWA 5E8NB 3BT2H 5I19L 1HHGB 1KCSL 2PYFB 1MHEB 1QFWI 32C2A 3LB6C 4KHTL 5SV4A 2H26A 1TZHB 1KPUA 4NOBA 4QCIA 1FP5A 1M6OA 4C4KO 4C56E 4X6CB 2KQMA 2IFFH 3TO4D 4PJGA 4P2OA 5IFHH 3QEQB 5KTEL 3MCG1 5D5MA 4Q2ZA 2W9EL 1IM9D 3KYKH 2VSCA 3D18B 3U2SB 3JVGC 3JWOC 2NY1C 4GRMA 3SOBL 3PJSB 5IW1B 4JRXB 4LOUD 4Y8DC 1B2WH 5I9QB 4NBYB 3ARGD 5HDQH 3OXSA 5ICYB 2D2OA 2XICA 1Z9SA 5HHOE 3RPIA 2LU7A 4QRPB 3RWCA 3O6ML 4OUOA 3FHAA 4OLZL 2A6JB 4HH9A 2MCPH 3EOBA 3WN5A 1RK1A 2Q6WB 1MREH 4X99A 4M7LL 3AMLA 1GGUA 3WE6A 3LDBC 3L3IB 3TVMC 2XKSA 4PRNB 2NY0C 4POYA 2CLZB 1XZ0A 5EBWA 2YR3A 4PD4K 1U3YA 4F8TA 5TDOA 4DKFH 4RIRA 3RWEB 2YSSB 3EW3B 1A7QL 5E24E 1BZQK 1VEMA 1EO7A 2F53B 4MA7H 1C1EH 2AEPH 2VMFA 1YEGL 2Y7QB 4JDZA 3RZCB 5EBMB 3MOAL 2FX7H 4LEOB 5E6IC 4Y4HA 4L4TA 4KROD 1JTOA 1CL7L 1MLCB 5KW9H 1ZVHA 3H42L 1MOEA 3AB0C 3NFPA 3HMXH 4NN6B 2R29H 4LIQL 4XPFL 5D72H 3OKKA 5D7IB 4D9LL 3R1GL 4RCAA 3EOAA 4OAWA 2I60H 3QIBC 1CLOH 1PQZA 2BSTA 5F71A 4P4KC 4OCMC 5EU5B 1MVUA 3CMOL 3D39E 1U0QA 1P7KA 4I2XE 3IGAA 1UADC 4TN9A 1NAKL 5FF6B 5BO1L 3VG9C 3ZO0A 5CHNA 4N8VB 1FORH 5FK9A 1PYWB 2GTWB