5C00A

Mdba protein, a thiol-disulfide oxidoreductase from corynebacterium diphtheriae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
202
structure length
202
Chain Sequence
KAHQANKYADYDKESVSFTGSVTDSAIVLKAVNAKKDAKKIDFYEDFSCPHCAELGEVTDGPMTKAIENGDIVVNLRILNFLDRDGDDGNSTKAGAAALAVAQSGDWETYWNYRALLMKEQKNIYGKWGDNDFADVAKSLGASDEVTQKIREGGAKEDFRKFAEANSKKLEKDGGSVSSPRVFIDGKEVKNGIETWVEQATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MdbA protein
publication title A thiol-disulfide oxidoreductase of the Gram-positive pathogen Corynebacterium diphtheriae is essential for viability, pilus assembly, toxin production and virulence.
pubmed doi rcsb
source organism Corynebacterium diphtheriae (strain atcc 700971 / nctc 13129 / biotype gravis)
molecule tags Oxidoreductase
total genus 72
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5c00A00
3UEMA 3UMAA 2BTOT 3FW2A 4BPYA 1Z7PA 1SL2B 3ZFLA 4G2EA 4KCEA 1TI3A 1GL8A 3M9JA 1ERVA 3P8WA 3LORA 4WBJA 4WETA 1X9MB 1XWKA 1WOUA 2K8SA 1ZL9A 3CTFA 5B7CA 1AQXA 3ISOA 1BJXA 2VCQA 1EOHA 1PKZA 2WULA 2B1KA 2X8CA 1MTCA 1TDIA 4FIWA 2VCXA 1EV4A 3GTUA 2GSQA 4KDYA 5CREA 2V2GA 3K8NA 4Q5FA 1J9BA 1A24A 4AJ8A 5AIXA 4LMWA 3F9UA 2RUEA 4K0GA 5CO3A 4KH7A 1NW2A 2F8FA 2EIQA 1VRSD 4PURA 2XBQA 4KSOA 3QAGA 6GSSA 2V32A 9GSSA 1HQOA 1A0RP 2HLSA 5CNWA 2PVQA 3CYNA 3BD2A 1M7TA 2C3NA 3BOAA 2F9SA 3FRCA 3UARA 2PN8A 1TTZA 2YANA 5G5FA 2E7PA 3FYGA 4MJEA 2AJQB 3KH7A 4K7NA 2QSIA 3J7Yk 4FH8A 3GKNA 4K1FA 5J4UA 3E9JB 5GSSA 5ECIB 2C3QA 3IV4A 4GLTA 2H30A 4NPBA 4K9ZA 4YAVA 3VFIA 1FG4A 4ILFA 4DSRA 3GTUB 17GSA 2LQQA 4KB3A 1NSWA 1FHEA 3FEUA 3TKSE 5B6NA 3IC4A 5ECKB 2O85A 5KN2A 1MD4A 5AISA 2DC5A 2FA8A 5G5EA 1GLQA 6GSYA 2ES7A 2CX3A 2V6KA 2LNTA 5FWGA 2X64A 4PQHA 2VD1A 3UOMA 1V57A 1OKDA 3C7MA 3R2QA 2CZ3A 1Y6EA 4EVMA 2HNLA 2IMIA 3FY7A 3KM6A 5ECSA 2JSZA 2WGRA 3IK9A 4ZXGA 3DYRA 1PL2A 5AGYA 4TR1A 5CRHA 3FHKA 2K8VA 1C72A 4KNDA 2CAIA 2B7JA 1VF4A 4XIHA 5JCGA 4NV2A 4K6XA 3UVHA 5G31A 2LS5A 1ON4A 2H6YA 1RW1A 3ERWA 3IPZA 6GSUA 2HZEA 2JACA 2E0QA 4MZCA 3LG6A 2L6DA 4HQSA 3A2XA 1VGLA 2H6XA 2IMFA 3QCPA 3CTGA 1SL0B 3BCIA 2B6MA 2OE3A 5LCZA 3RPPA 2REMA 1A2LA 3C73A 3ZL5A 1WPIA 2E2MA 2ON5A 4I97A 1U88A 1OKTA 1CQHA 2VLTA 3UBLA 11GSA 3IE3A 2MBSA 4WR5A 2EC4A 1PA3A 3U6VA 3KXOA 3H79A 4PQ1A 4X1UA 3IAS2 1EP7A 4KDXA 4ZL8A 1O7UA 1TRUA 1TXXA 1O8XA 2LJRA 1PL1A 4ULXA 1E6BA 3D5JA 3PH9A 2DIZA 4PUAA 3CBUA 4TXVA 4TR1B 3KD0A 2H70A 3VWUA 1H75A 4MLYA 1HNAA 2C0DA 2VL9A 2YP6A 3HHVA 3ZVJD 4LL1B 2HZEB 3I6AA 4HOJA 4MH3A 2L6CA 4KDUA 3F8UA 2H19A 2DLXA 1YF1A 2F3MA 4TKYA 3D4MA 3P2AA 2FHEA 3HZ8A 2AV4A 5ENUA 1GTIA 1M2BA 2RM6A 4DSSA 1S3CA 2MMNA 2WCIA 3VI5A 3CSJA 4JU5A 3MAKA 5ECMB 1GULA 4TXOB 3FR3A 4TVEA 5ECPB 3KIJA 2A4VA 3GH6A 1X5CA 2VL2C 1XFLA 2LJAA 2YOIA 3WYWA 5ID2A 3F0IA 2DMMA 4EF0A 5D9TA 1SD8A 4BVYA 2VM2A 4BL7A 1T8EB 1MEKA 1EP8A 1EEMA 3TKQA 4HJ2A 1GRXA 5ABRA 2C3TA 1AQVA 1WP0A 2JZTA 2R6KA 4ECIA 4K8MA 1ERTA 1F3AA 1OC3A 4IP6A 1W89A 3RHBA 1DE1A 5B8BA 1PX7A 3EMPA 1T00A 1WWJA 2IFQB 1O73A 2K9FA 1RK4A 4DSSB 1XIYA 2B5XA 2GSSA 3DIEA 3L0HA 1WIKA 4IKHA 5IQYA 5D9XA 1TP9A 3I43A 5G2ZA 3BJ5A 3IR4A 2GZYA 4Z7XA 5AIVA 4MZBA 3UIWA 2H8LA 4IVFA 2GT6A 4PXOA 1SJ6A 2LQOA 5ID2B 4QL7A 1X9WB 2BMXA 4TW5A 4EE0A 2ZCTA 3E3EA 1XPVA 1Z5YE 4MK3A 3GNJA 1M9BA 2H73A 4XCSA 1USBA 5G1LA 4PX1A 4HU9A 4MMMA 2QC7A 2P0GA 1PSQA 1AQWA 2GQMA 5DVBA 1V98A 3Q74A 2VL3A 3LXTA 2F51A 2JU5A 3M8NA 4PQIA 2YWMA 4N0VA 3TGZA 2XBIA 3VURA 3IXRA 1QGVA 4LA1A 1KTEA 1V2AA 3GFKA 5JWOB 3IOSA 3KCMA 1K3YA 1J08A 4RI7A 5A4VA 3WT1A 2PMTA 3Q19A 4BVXA 4XHMA 4Q5RA 1U6TA 3EVIA 4KAEA 4XRDA 2FY6A 4NV5A 5E4WA 4V2NA 4N0ZA 5IPHA 3CRTA 2DJJA 2H0GA 2MYGA 3FZAA 1EWXA 1XXUA 1ILOA 3VWXA 2RIIA 1PGTA 3RBTA 1XWCA 2YZUA 4GSTA 1WRYA 1ZYEA 1FOVA 1SJIA 3W8SA 3VWWA 3G7IA 5CRDA 4JR4A 4JRRA 1GSFA 1QXHA 3LEFA 3DEXA 3KZQA 1WMJA 4BWQA 1XVQA 3QFAC 4O5RA 1EOGA 3WGXA 1BYEA 6GSTA 1G7EA 2LNSA 4MJAA 3H1NA 1ZGNA 2H76A 4KE3A 1Z3EA 1IYHA 3TJBA 3N5OA 1BQ7A 3TOTA 4MF6A 5HR2A 3FZ9A 2PVOC 3UBKA 2BJXA 3DRNA 5ECOB 4MPFA 1UA5A 2WRTA 2ZUPA 4YQUA 3HVXA 1EGOA 2TRXA 1GSYA 4IS0A 1AAZA 4TR4A 2C8UA 4JZQA 2CZ2A 4QL9A 2IMKA 2PUKC 1K0BA 4IQAA 2H74A 1GNWA 1PKWA 2DJ2A 2L59A 5CP1A 3Q18A 1R4WA 1YF0A 1Z7RA 3EINA 1MD3A 2P5QA 2KP1A 3O6TA 2VO4A 1V9WA 1KEBA 3J7Yb 1K0OA 1XBSA 1G6YA 3D4TA 1JZDA 1LJRA 4ZB9A 1HNCA 3LSZA 5IMFA 3RAZA 4ZL7A 3EU4A 3TJGA 2WZ9A 3FR6A 1GH2A 2X99A 3M9KA 2HE3A 3GSTA 1ACVA 4H86A 4L5OA 5HFGA 2NDOA 4MJCA 5AN1A 3APSA 2LJKA 5CRWA 5FT3A 1FO5A 3G7JA 1B9XC 3ZRDA 2L4QA 4RI6A 2B5YA 1B8XA 2IMEA 1M0UA 4NAXA 2H01A 5F07A 3IAM2 4IELA 4V1Ap 2L4CA 1XW9A 3APOA 2DJ0A 3G9BA 2K18A 4EDZA 4F0CA 3UJ1A 18GSA 2VOCA 1N2AA 3GUSA 4WXTA 5DJLA 2WB9A 1YJ6A 2NPBA 4K0NA 2JZSA 1YEPA 2HZFA 5B8AA 2IPAA 4MH2A 4ML6A 3GL3A 2XPDA 3GN3A 1SYXA 5J41A 5JCWA 4MPGA 3Q6OA 4O32A 2DBCA 2HSYA 1SKWB 1OC8A 3MWHA 4HUAA 1HD2A 1FB6A 3FR9A 1B48A 2GSTA 2FLSA 4MF7A 5IMZA 1G6WA 2KUCA 3F63A 4OO4A 2R2JA 2XPEA 1ST9A 2PGTA 2YN1A 2H66A 2ALBA 1A0FA 4EL1A 3CRUA 4KUNA 1PD21 2OACA 2N5BA 4K7IA 5JWRB 1A23A 4LMVA 2I81A 4PUFC 1GTBA 3PGTA 1EZKA 5DDLA 3LYKA 2J23A 2C1YA 2E2GA 3BBYA 4LLRA 2VCTA 4J56E 5J5NA 4F03A 2GQKA 5IMCA 5J9BA 1K0MA 3CMIA 1I5GA 4JEDA 3GH9A 1QQ2A 4EC0A 4LL4B 5KEJA 3TKSC 5D73A 4TXOA 4OFMA 2GSRA 2B3SA 1GNEA 1A8YA 4N10A 5HQPA 1XVWA 3F6FA 3HYPA 5HR3A 2LKUA 4L8EA 1JHBA 3M1GA 5GSTA 3VK9A 4HDEA 2N5FA 5EL8A 2IWTA 1TK0B 4FYCA 2PBJA 5L71A 1T4ZA 4PGTA 2DMLA 3TDGA 2C0EA 2H1AA 2WDUA 3F3RA 4G10A 2MMAA 3GURA 2HSHA 4OWYA 5B6MA 3O76A 1YZXA 2I9HA 4TOPA 2CA8A 5D9VA 2IFQA 5HFIA 1THXA 3EURA 1RQMA 2OADA 2PERA 5G1KA 3RPNA 5IOWA 2CX4A 3F4RA 1TRSA 3D0ZA 20GSA 3IHQA 2VCZA 4JE1A 4ZBAA 4DSQA 3HKRA 2OA7A 3V1WA 5F8BA 2FWHA 3ZYWA 3TOUA 5D93A 5IO2A 4EUYA 1ZOFA 2PWJA 2XC2A 3D6IA 3GHAA 1O8WA 2TIRA 3ME8A 5F0GA 3KMOA 4GTUA 4MABA 1U87A 4ZB8A 4ECBA 2HRFA 2YV9A 2GZPA 4GF0A 3QMXA 5DALB 2IN3A 2R5GA 2WFCA 4AJ6A 1MDIA 4YAPA 10GSA 2HRNA 1FAAA 3WD6A 2EIRA 6GSXA 1FVKA 1TU8A 1R5PA 3TKSA 3TJFA 2A2SA 3KEBA 1DSBA 2EIOA 5A5KA 1G0TA 4TN8A 1SK1A 1JZRA 3I69A 4V2MA 3A2VA 3ZITA 1AW9A 4MA9A 1A2MA 1YY7A 1YDKA 3IK7A 2DJ3A 4HQZA 5LD0A 1GP1A 4IQ1A 2IL3A 4WR4A 2FA4A 1Z6NA 4NHWA 5DQYA 2YV7A 5DQSA 4L0UA 2YZHA 5C00A 1KNGA 1QMVA 22GSA 2YNXA 2C80A 3LJRA 4IP1A 4G19A 5JWQB 1AUCA 2GT5A 2R37A 1Q98A 3ZZXA 1MDJA 1Z9HA 8GSSA 5GAND 1XZOA 1R26A 3IDVA 2YPMA 3SBCA 16GSA 4WF5A 3C8EA 1FB0A 1SENA 1T4YA 4TR0A 4AF2A 2H72A 3EE2A 1AIUA 4POBA 13GSA 4OFNA 5KN0A 1LU4A 4BWSA 3KTLA 1PX6A 3QAVA 3ED3A 3NIVA 3ZIVA 2YWNA 3L4NA 3TB2A 2LEGA 5H5SA 2CV4A 2DJ1A 1CQGA 3F3QA 1JZWA 3GKKA 5HR0A 2JSYA 2F8AA 4IW9A 3DKSA 3GIXA 4GSSA 1V58A 1OC9A 1K0AA 4MZWA 4O7HA 2YJ7A 2GLRA 2ON7A 3HDCA 3HA9A 5C04A 2PU9C 4YQMA 3RDWA 3ZIJA 5HR1A 2FWEA 2GTUA 3CSIA 5DCHA 3EMXA 2KHPA 4XTSA 2RM5A 4E8EA 5KN3A 2J9HA 1OE8A 2DJKA 1F37A 3GX0A 1TK8B 3TJKA 1SYRA 2RLIA 1FW1A 1Q4JA 1ERWA 1VF3A 2H75A 1TK5B 4XS1A 1XWGA 1ZMAA 3GRXA 3TUEA 3UVTA 1SKRB 1QUWA 1HYUA 3ZTLA 5CRGA 1BAYA 5D96A 4ECCA 1T7PB 2LTKA 1KBNA 4NXIA 2LRNA 2YWOA 3H4KA 1YQ1A 3QDNA 1OYJA 2YCDA 4DVCA 1BEDA 1F2EA 4MP4A 2GS3A 1H4OA 1OC9B 2NTOA 4F82A 1U3AA 1R5AA 1E2YA 1O6JA 2CAQA 3HJPA 4D73A 2C4JA 4WEYA 4JBBA 3GKXA 4YH2A 1V40A 2FD3A 2LV3A 1NM3A 2C0FA 3F4SA 5J3RA 1LBKA 5F06A 3TCOA 4FYUA 3MNGA 3C1RA 2RUFA 1M2AA 1TRWA 1X5EA 4GQCA 3ZVJA 2R4VA 5EVOA 3VPTA 5ECRB 5ECHB 3HVVA 1B9YC 4IHUA 1GWCA 4HU7A 2R3XA 1XW5A 3L9SA 4N11A 3IBHA 2D2ZA 3HVSA 3NZNA 3JCML 2O8VB 2VM1A 2HXKA 3DD3A 2LRTA 1GSQA 5CYYA 3TRPA 2LSTA 3A3TA 2AYTA 4HZ4A 4FO5A 1R7HA 4ZBDA 1DE2A 1A8LA 2VLUA 3ZREA 3UAPA 2P31A 4EO3A 3FZ5A 3D22A 2CT6A 4KX4A 3AY8A 4OD7A 1M99A 3C71A 4GXZA 4HZ2A 4QQ7A 3ERFA 4ZBBA 4MDCA 2GDRA 5ECLB 3W8JA 2K6VA 2LRCA 3EWLA 4D73B 2IIYA 4POKA 4F2IA 3GKMA 3TKRA 5DAKA 4ZL9A 2H71A 3EC3A 2YJHA 3IRAA 3GX8A 4EXJA 2L5LA 4OCEA 1GUHA 1AXDA 2DIYA 1T1VA 3ZMKA 1B4PA 2V1MA 3DMLA 4O92A 1SL1B 3N9JA 1FVJA 3EU3A 3OR5A 5INYA 5G30A 6GSVA 2M46A 3PR8A 1WJKA 1SK0A 3ERGA 1PN9A 3DXBA 1OAZA 2GZZA 1K3OA 5E59A 3FZ4A 2MMZA 3APQA 4Q5QA 12GSA 4IBPA 4I2UA 4V2LA 4CDOA 3A5WA 4XS4A 1X5DA 1Y25A 2M80A 3P7XA 4L0WA 2OKAA 2OE1A 4RQXA 4HJMA 3FK8A 4GRFA 2FWGA 1HNBA 1NHOA 2DSAA 5EPFA 3DWVA 3KMNA 19GSA 4KW6A 3VI7A 3GYKA 1UVZA 1XW6A 2H1DA 3L9VA 1EGRA 5DAKB 5D9WA 1TOFA 4OCFA 1VF1A 4IJIA 1GSEA 1SKSB 3M0FA 1XWAA 4WBRD 4GWRA 1S3AA 3LFLA 2AB6A 1SD9A 2L5OA 3H93A 4IGJA 3CXGA 3P90A 3WT2A 3QR6A 1K0CA 2A2RA 5A4WA 2VLVA 1NHYA 3ME7A 4AJ7A 1U3IA 1ML6A 3U5RE 4IJ3A 5HFKA 7GSSA 2JZRA 5H5RA 4KSMA 2AUVA 2X8GA 2FWFA 1YKCA 4XS4B 3GL5A 2B5EA 2NVLA 2H0IA 2CVBA 3VWVA 5ELGA 1GTUA 3KTBA 1TRVA 4EKZA 2GVPA 2OBIA 4OMVA 2WS2A 4MF5A 1K0DA 4ISDA 5F05A 3D21A 1SJZA 2H6ZA 2VIMA 1TI1A 4GSNA 1GUMA 2IJYA 5H5QA 4OO5A 4J2FA 2OE0A 2VCWA 2WJUA 4ZIJA 1ZZYA 4GQFA 3I9V2 1M9AA 2CQ9A 1GUKA 3ZLPA 3UL3A 3HJOA 1B4QA 1XOAA 2FUG2 2MMOA 3HJMA 1XOBA 4KGIA 2CVKA 4KA0A 3VPQA 1F9MA 2H1BA 4X43A 2VCVA 1O85A 5DALA 3DVXA 4BA7A 1ABAA 3VLNA 5IMVA 4N30A 3DVWA 3RHCA 2OBKA 2V41A 4X0XA 2AAWA 1MDKA 2Z9SA 3FKFA 3HCZA 4J57E 3W6GA 2YWIA 4F0BA 3LXZA 1I9DA 3NOFA 3TRQA 5GAPD 2KLXA 3SWLA 2O87A 4MCUA 2I1UA 2KOKA 3O3TA 5JCUA 1W4VA 2FGXA 2HFDA 2KP2A 2JL4A 1TKDB 5J9CA 1WE0A 2HT9A 3M3MA 3MDKA 3LQ7A 4AGSA 4L5LA 1THOA 5IOXA 3WGDA 4FYBA 3QAWA 1ZYQB 4OFTA 1BG5A 1PQNA 1PMTA 1QFNA 3DGQA 4PNFA 6GSWA 5LNKe 2L57A 2N5AA 2X8HA 4GCIA 3S9FA 1XWBA 2GQLA 1VF2A 3HY2A 4P3YB 4WF4A 5IMAA 2GGTA 2O7KA 3GA4A 2QKEA 1G7OA 4PNGA 2O89A 4POLA 4V1Ag 2VAFA 5IM9A 3ZMLA 4ID0A 4KCAA 1GSDA 4ZB6A 2JADA 4I6XA 5KN1A 4POMA 1OE7A 1UN2A 3TJJA 1XCCA 1EEJA 3QD9A 2IMDA 1BX9A 4IN0A 5ELAA 2ZNMA 1JZOA 5DJMA 3HZ4A 3KJYA 2QGVA 1GSUA 1T3BA 3EYTA 2VD0A 1EV9A 1TJDA 2M72A 1PRXA 5DBQA 1JLVA 3KP8A 2NBSA 2HI7A 1N8JA 5FHIA 3TRXA 1YKAA 1OVNA 4HI7A 3WGEA 3GV1A 1X0RA 1SK2A 2TRCP 4TRXA 2LUSA 5EY6A 1SU9A 3A2WA 1X9SB 4ML1A 5A4UA 4NHZA 2G2QA 2AHEA 3KH9A 4HEA2 1A2JA 2FCHA 3F6DA 1TW9A 1QK8A 2PPTA 2H1GA 2MBTA 5ECQB 4K7OA 4XRAA 4NMUA 3ZFBA 3LWAA 5GZZB 3H8QA 2HYXA 4DEJA 3QFBC 4K2DA 1K0NA 4ECJA 1ERUA 2P5RA 1J0FA 4YQVA 1JLWA 1JFUA 4RUVA 1M2DA 1UC7A 4XS6A 5IO0A 3GMFA 4E8HA 4CHSA 2VL2A 5IIZA 3HXSA 1O81A 4CW9A 1GLPA 5IMDA 3MSZA 1GTAA 2C0GA 5COHA 4WKWA 1IYIA 1AC1A 4F9ZA 1S3DA 5CAXA 2V6OA 14GSA 2I3YA 3E0UA 1K3LA 3LYPA 4MJBA 3L9UA 1GSSA 5IPGA 1ZCPA 4HS1A 2XHFA 4I5QA 1DUGA 3LGCA 5D8IA 4G9HA 4ACSA 2FNOA 3C1SA 3TKPA 3PINA 4Q5NA 4I8BA 2G0FA 4NWYA 1F6MC 3CSHA 1URMA 3QOUA 3BCKA 3HD5A 4TR3A 4RQRA 5DCGA 2MZCA 5ECNB 1F3BA 3L78A 1DBYA 3G7YA 3KP9A 3F4TA 3KGKA 2H0HA 3IA1A 1Z6MA 4EDYA 2B7KA 2OJLA 4ZILA 4I2TA 2B1LA 3US3A 1TU7A 1YEXA 2I4AA 2VUPA 2CVDA 3GSSA 4JR6A 3QPMA
chains in the Genus database with same CATH superfamily
3UEMA 3UMAA 1S3RA 2BTOT 3FW2A 4BPYA 1Z7PA 1SL2B 3ZFLA 4G2EA 4KCEA 1TI3A 1GL8A 3M9JA 1ERVA 3P8WA 3LORA 4WBJA 4WETA 1X9MB 5KOXA 1XWKA 1WOUA 2K8SA 1ZL9A 3CTFA 5B7CA 1AQXA 3ISOA 1BJXA 2VCQA 1EOHA 1PKZA 2WULA 2B1KA 2X8CA 1MTCA 1TDIA 4FIWA 2VCXA 1EV4A 3GTUA 2GSQA 4KDYA 5CREA 2V2GA 3K8NA 4Q5FA 1J9BA 1A24A 4AJ8A 5AIXA 4LMWA 2X49A 3F9UA 2RUEA 4K0GA 5CO3A 4YKGA 4KH7A 1NW2A 2F8FA 2EIQA 5BRTA 1VRSD 4PURA 3A5IA 2XBQA 4KSOA 3QAGA 6GSSA 2V32A 9GSSA 1HQOA 1A0RP 2HLSA 5CNWA 2PVQA 3CYNA 3BD2A 1M7TA 2C3NA 3BOAA 2F9SA 3FRCA 3UARA 2PN8A 1TTZA 2YANA 5G5FA 2E7PA 3FYGA 4MJEA 2AJQB 3KH7A 4K7NA 2QSIA 3J7Yk 4FH8A 3GKNA 4K1FA 2HRAA 5J4UA 4Z2TA 3E9JB 5GSSA 5ECIB 2C3QA 3IV4A 4GLTA 2H30A 4NPBA 4K9ZA 4YAVA 3VFIA 1FG4A 4ILFA 4DSRA 3GTUB 17GSA 2LQQA 4KB3A 1NSWA 1FHEA 3FEUA 3TKSE 5B6NA 4G0KA 3IC4A 5ECKB 2O85A 5KN2A 1MD4A 5AISA 2DC5A 2FA8A 5G5EA 1GLQA 6GSYA 4EIQA 2ES7A 2CX3A 2V6KA 2LNTA 5FWGA 2X64A 4PQHA 2VD1A 3UOMA 1V57A 1OKDA 3C7MA 3R2QA 2CZ3A 1Y6EA 4EVMA 2HNLA 2IMIA 3FY7A 3KM6A 5ECSA 2JSZA 2WGRA 3IK9A 4ZXGA 3DYRA 1PL2A 5AGYA 4TR1A 5CRHA 3FHKA 2K8VA 1C72A 4KNDA 2CAIA 2B7JA 1VF4A 4XIHA 5JCGA 4NV2A 4K6XA 4CY6A 3UVHA 5G31A 2LS5A 1ON4A 2H6YA 1RW1A 3ERWA 3IPZA 6GSUA 2HZEA 2JACA 2E0QA 4MZCA 3LG6A 2L6DA 4HQSA 3A2XA 1VGLA 4MNNA 2H6XA 2IMFA 3QCPA 3CTGA 1SL0B 3BCIA 2B6MA 2OE3A 5LCZA 3RPPA 2REMA 1A2LA 3C73A 3ZL5A 1WPIA 2E2MA 2ON5A 4I97A 1U88A 1OKTA 1CQHA 2VLTA 3UBLA 11GSA 3IE3A 2MBSA 4WR5A 2EC4A 1PA3A 3U6VA 3KXOA 3H79A 4PQ1A 4X1UA 3IAS2 1EP7A 4KDXA 4ZL8A 1O7UA 1TRUA 1TXXA 1O8XA 2LJRA 1PL1A 4ULXA 1E6BA 3D5JA 3PH9A 2DIZA 4PUAA 3CBUA 4TXVA 4TR1B 3KD0A 2H70A 3VWUA 1H75A 4MLYA 1HNAA 2C0DA 2VL9A 2YP6A 3HHVA 3ZVJD 4LL1B 2HZEB 3I6AA 4HOJA 1PFOA 4MH3A 2L6CA 4KDUA 3F8UA 4X4JA 2H19A 2DLXA 1YF1A 2F3MA 4TKYA 3D4MA 3P2AA 2FHEA 3HZ8A 2AV4A 5ENUA 1GTIA 1M2BA 2RM6A 4DSSA 1S3CA 2MMNA 2WCIA 3VI5A 3CSJA 4JU5A 3MAKA 5ECMB 1GULA 4TXOB 4CY8A 3HVNA 3FR3A 4TVEA 5ECPB 3KIJA 2A4VA 3GH6A 1X5CA 2VL2C 1XFLA 2LJAA 2YOIA 3WYWA 5ID2A 3F0IA 2DMMA 5BMUA 4EF0A 5D9TA 1SD8A 4BVYA 2VM2A 4BL7A 1T8EB 1MEKA 1EP8A 1EEMA 3TKQA 4HJ2A 1PN0A 1GRXA 3IHGA 5ABRA 2C3TA 1AQVA 1WP0A 2JZTA 2R6KA 4ECIA 4K8MA 1ERTA 1F3AA 1OC3A 4IP6A 1W89A 3RHBA 1DE1A 5B8BA 1PX7A 3EMPA 1T00A 1WWJA 2IFQB 3PPUA 1O73A 2K9FA 3MYDA 1RK4A 4DSSB 1XIYA 2B5XA 2GSSA 3DIEA 3L0HA 1WIKA 4IKHA 5IQYA 5D9XA 1TP9A 3I43A 4K5SA 5G2ZA 3BJ5A 3IR4A 2GZYA 4Z7XA 5AIVA 4MZBA 3UIWA 2H8LA 4IVFA 2GT6A 4PXOA 1SJ6A 2LQOA 5ID2B 4QL7A 1X9WB 2BMXA 4TW5A 4EE0A 2ZCTA 3E3EA 1XPVA 1Z5YE 4MK3A 3GNJA 1M9BA 4BVYB 2H73A 4XCSA 4BL7B 1USBA 5G1LA 4PX1A 4HU9A 4MMMA 2QC7A 2P0GA 1PSQA 1AQWA 2GQMA 5DVBA 1V98A 3Q74A 4A5PA 2VL3A 3LXTA 2F51A 2JU5A 3M8NA 4PQIA 2YWMA 4N0VA 3TGZA 2XBIA 3VURA 3IXRA 1QGVA 4LA1A 5KOWA 1KTEA 1V2AA 3GFKA 5JWOB 3IOSA 3KCMA 1K3YA 1J08A 4RI7A 5A4VA 3WT1A 2PMTA 3Q19A 4BVXA 4XHMA 4Q5RA 1U6TA 2DKHA 3EVIA 1M3IA 4YKFA 4KAEA 4XRDA 2FY6A 4NV5A 5E4WA 4V2NA 4N0ZA 5IPHA 3CRTA 2DJJA 2H0GA 2MYGA 3FZAA 1EWXA 1XXUA 1ILOA 3VWXA 2RIIA 1PGTA 3RBTA 1XWCA 2YZUA 4GSTA 1WRYA 1ZYEA 1FOVA 1SJIA 3W8SA 3VWWA 3G7IA 5CRDA 4JR4A 4JRRA 1GSFA 1QXHA 3LEFA 3DEXA 3KZQA 1WMJA 4BWQA 1XVQA 3QFAC 4O5RA 1EOGA 3WGXA 1BYEA 6GSTA 1G7EA 2LNSA 4MJAA 3H1NA 1ZGNA 2H76A 4KE3A 1Z3EA 1IYHA 1M3JA 3TJBA 3N5OA 4BVXB 1BQ7A 3TOTA 4MF6A 5HR2A 3FZ9A 2PVOC 3UBKA 2BJXA 3DRNA 5ECOB 4MPFA 1UA5A 2WRTA 2ZUPA 4YQUA 3HVXA 1EGOA 2TRXA 1GSYA 4IS0A 1AAZA 4TR4A 2C8UA 4JZQA 3R3EA 2CZ2A 4QL9A 2IMKA 2PUKC 1K0BA 4IQAA 2H74A 1GNWA 1PKWA 2DJ2A 2L59A 5CP1A 3Q18A 1R4WA 1YF0A 1Z7RA 2R0CA 3EINA 1MD3A 2P5QA 2KP1A 3O6TA 2VO4A 1V9WA 1KEBA 3J7Yb 1K0OA 1XBSA 1G6YA 3D4TA 1JZDA 1LJRA 4ZB9A 1HNCA 3LSZA 5IMFA 3RAZA 4ZL7A 3EU4A 3TJGA 2WZ9A 3FR6A 1GH2A 2X99A 3M9KA 2HE3A 3GSTA 1ACVA 4H86A 4L5OA 5HFGA 4G0IA 2NDOA 4MJCA 5AN1A 3APSA 2LJKA 5CRWA 5FT3A 1FO5A 3G7JA 1B9XC 3ZRDA 2L4QA 4RI6A 2B5YA 1B8XA 2IMEA 1M0UA 4NAXA 2H01A 5F07A 3IAM2 4IELA 4V1Ap 2L4CA 1XW9A 3APOA 2DJ0A 3G9BA 2K18A 4EDZA 4F0CA 3UJ1A 18GSA 2VOCA 1N2AA 3GUSA 4WXTA 5DJLA 2WB9A 1YJ6A 2NPBA 4K0NA 2JZSA 1YEPA 2HZFA 5B8AA 2IPAA 4MH2A 4ML6A 3GL3A 4O5UA 2XPDA 3GN3A 1SYXA 5J41A 5JCWA 4MPGA 4O32A 3Q6OA 2DBCA 2HSYA 1SKWB 1OC8A 3MWHA 4HUAA 1HD2A 1FB6A 3FR9A 1B48A 2GSTA 2FLSA 4MF7A 5IMZA 1G6WA 2KUCA 3F63A 4OO4A 2R2JA 2XPEA 1ST9A 2PGTA 4Z2RA 2YN1A 2H66A 2ALBA 1A0FA 4EL1A 3CRUA 4KUNA 1PD21 2OACA 2N5BA 4K7IA 5JWRB 1A23A 4LMVA 2I81A 4PUFC 1GTBA 3PGTA 1EZKA 5DDLA 3LYKA 2J23A 2C1YA 2E2GA 3BBYA 4LLRA 2VCTA 4J56E 5J5NA 4F03A 2GQKA 5IMCA 5J9BA 1K0MA 3CMIA 1I5GA 4JEDA 3GH9A 1QQ2A 4EC0A 4LL4B 5KEJA 3TKSC 5D73A 4TXOA 4OFMA 2GSRA 2B3SA 1GNEA 1A8YA 4N10A 5HQPA 1XVWA 3F6FA 3HYPA 5HR3A 2LKUA 4L8EA 1JHBA 3M1GA 5GSTA 1ZYPA 3VK9A 4HDEA 2N5FA 5EL8A 2IWTA 1TK0B 4FYCA 4HSCX 2PBJA 5L71A 1T4ZA 4PGTA 2DMLA 3TDGA 2C0EA 2H1AA 2WDUA 3F3RA 4G10A 2MMAA 3GURA 2HSHA 4OWYA 5B6MA 3O76A 2X4AA 1YZXA 2I9HA 4TOPA 4PTSA 2CA8A 5D9VA 2IFQA 5HFIA 1THXA 3EURA 2UZ8A 1RQMA 2OADA 2PERA 5G1KA 4USSA 3RPNA 5IOWA 2CX4A 4K2XA 2HSMA 3F4RA 1TRSA 3D0ZA 20GSA 3IHQA 2VCZA 4JE1A 4ZBAA 4DSQA 4ICYA 3HKRA 2OA7A 3V1WA 5F8BA 2FWHA 3ZYWA 3TOUA 5D93A 5IO2A 4EUYA 3EPTA 1ZOFA 2PWJA 2XC2A 3D6IA 3GHAA 1O8WA 2TIRA 3IC8A 3ME8A 5F0GA 3KMOA 4GTUA 4MABA 1U87A 4ZB8A 4ECBA 2HRFA 2YV9A 2GZPA 4GF0A 2QA2A 3QMXA 5DALB 2IN3A 2R5GA 2WFCA 4AJ6A 1MDIA 4YAPA 10GSA 2HRNA 1FAAA 3WD6A 2EIRA 6GSXA 1FVKA 1TU8A 1R5PA 3TKSA 3TJFA 2A2SA 3KEBA 1DSBA 2EIOA 5A5KA 1G0TA 4TN8A 1SK1A 1JZRA 3I69A 4V2MA 3A2VA 3ZITA 1AW9A 4MA9A 1A2MA 1YY7A 1YDKA 3IK7A 2DJ3A 4HQZA 5LD0A 1GP1A 4IQ1A 2IL3A 4WR4A 2FA4A 1Z6NA 4NHWA 5DQYA 2YV7A 5DQSA 4L0UA 2YZHA 5C00A 1KNGA 1QMVA 22GSA 2YNXA 2C80A 3LJRA 4IP1A 4G19A 5JWQB 1AUCA 2GT5A 2R37A 1Q98A 3ZZXA 1MDJA 1Z9HA 8GSSA 5GAND 1XZOA 1R26A 3IDVA 2YPMA 4EIPA 3SBCA 16GSA 4WF5A 3C8EA 1FB0A 1SENA 1T4YA 4TR0A 2QA1A 4AF2A 2H72A 3EE2A 1AIUA 4POBA 13GSA 4OFNA 2A4HA 5KN0A 1LU4A 4BWSA 3KTLA 1PX6A 3QAVA 3ED3A 3NIVA 3ZIVA 2YWNA 3L4NA 3TB2A 2LEGA 5H5SA 2CV4A 2DJ1A 1CQGA 3F3QA 1JZWA 3GKKA 5HR0A 2JSYA 2F8AA 4IW9A 3DKSA 3GIXA 4GSSA 1V58A 1OC9A 1K0AA 4MZWA 4O7HA 2YJ7A 2GLRA 2ON7A 3HDCA 2R0PA 3HA9A 5C04A 2PU9C 4YQMA 3RDWA 3ZIJA 5HR1A 2FWEA 2GTUA 3CSIA 5DCHA 3EMXA 2KHPA 4XTSA 2RM5A 4E8EA 5KN3A 2J9HA 1OE8A 2DJKA 1F37A 3GX0A 1TK8B 3TJKA 1SYRA 2RLIA 1FW1A 1Q4JA 1ERWA 1VF3A 2H75A 1TK5B 4XS1A 1XWGA 1ZMAA 3GRXA 3TUEA 3UVTA 1SKRB 1QUWA 1HYUA 3ZTLA 5CRGA 1XG8A 1BAYA 5D96A 4ECCA 1T7PB 2LTKA 1KBNA 4NXIA 2LRNA 2YWOA 3H4KA 1YQ1A 3QDNA 1OYJA 2YCDA 4DVCA 1BEDA 1F2EA 4MP4A 2GS3A 3CQFA 4FQUA 1H4OA 1OC9B 2NTOA 4F82A 1U3AA 1R5AA 1E2YA 1O6JA 2CAQA 3HJPA 4D73A 2C4JA 4WEYA 4JBBA 3GKXA 4YH2A 1V40A 2FD3A 2LV3A 1NM3A 2C0FA 3F4SA 5J3RA 1LBKA 5F06A 3TCOA 4FYUA 3MNGA 3C1RA 2RUFA 1M2AA 1TRWA 1X5EA 4GQCA 3ZVJA 2R4VA 5EVOA 3VPTA 5ECRB 5ECHB 3HVVA 1B9YC 4IHUA 1GWCA 4HU7A 2R3XA 1XW5A 3L9SA 4N11A 3IBHA 2D2ZA 3HVSA 3NZNA 3JCML 2O8VB 2VM1A 2HXKA 3DD3A 2LRTA 1GSQA 5CYYA 3TRPA 4O5QA 2LSTA 3A3TA 2AYTA 4HZ4A 4FO5A 1R7HA 4ZBDA 1DE2A 1A8LA 2VLUA 3ZREA 3UAPA 2P31A 4EO3A 3FZ5A 3D22A 2CT6A 4KX4A 3AY8A 4OD7A 3FMWA 1M99A 3C71A 4GXZA 4HZ2A 4QQ7A 3ERFA 4ZBBA 4MDCA 2GDRA 5ECLB 3W8JA 2K6VA 2LRCA 3EWLA 4D73B 2IIYA 4POKA 4F2IA 3GKMA 3TKRA 5DAKA 4ZL9A 2H71A 3EC3A 2YJHA 4K5RA 3IRAA 3GX8A 4EXJA 2L5LA 4OCEA 1GUHA 1AXDA 2DIYA 1T1VA 3ZMKA 1B4PA 2V1MA 3DMLA 4O92A 1SL1B 3N9JA 1FVJA 3EU3A 3OR5A 5INYA 5G30A 6GSVA 2M46A 3PR8A 1WJKA 3LW9A 1SK0A 3ERGA 1PN9A 3DXBA 1OAZA 2GZZA 1K3OA 5E59A 3FZ4A 2MMZA 3APQA 2A2PA 4Q5QA 12GSA 4IBPA 4I2UA 4V2LA 4CDOA 3A5WA 4XS4A 1X5DA 1Y25A 2M80A 3P7XA 4L0WA 2OKAA 2OE1A 4RQXA 4HJMA 3FK8A 4GRFA 2FWGA 1HNBA 1NHOA 2DSAA 5EPFA 3DWVA 3KMNA 19GSA 4KW6A 3VI7A 3GYKA 1UVZA 1XW6A 2H1DA 3L9VA 1EGRA 5DAKB 5D9WA 1TOFA 4OCFA 1VF1A 4IJIA 1GSEA 1SKSB 3M0FA 1XWAA 4WBRD 4GWRA 1S3AA 4KF9A 3LFLA 2AB6A 1SD9A 2L5OA 3H93A 4IGJA 3CXGA 3P90A 3WT2A 3QR6A 1K0CA 2A2RA 2DKIA 5A4WA 2VLVA 1NHYA 3ME7A 4AJ7A 1U3IA 1ML6A 3U5RE 4IJ3A 5HFKA 7GSSA 2JZRA 5H5RA 4KSMA 2AUVA 2X8GA 2FWFA 1YKCA 4XS4B 3GL5A 2B5EA 2NVLA 2H0IA 2CVBA 3VWVA 5ELGA 1GTUA 3KTBA 1TRVA 4EKZA 2GVPA 2OBIA 4OMVA 2WS2A 4MF5A 1K0DA 4ISDA 5F05A 3D21A 1SJZA 2H6ZA 2VIMA 1TI1A 4GSNA 1GUMA 2IJYA 5H5QA 4OO5A 4J2FA 2OE0A 2VCWA 2WJUA 4ZIJA 1ZZYA 4GQFA 3I9V2 1M9AA 2CQ9A 1GUKA 3ZLPA 3UL3A 3HJOA 1B4QA 1XOAA 2FUG2 2MMOA 3HJMA 1XOBA 4KGIA 2CVKA 4KA0A 3VPQA 1F9MA 2H1BA 4X43A 2VCVA 1O85A 5DALA 3DVXA 4BA7A 1ABAA 3VLNA 5IMVA 4N30A 3DVWA 3RHCA 2OBKA 2V41A 4X0XA 2AAWA 1MDKA 2Z9SA 3FKFA 3HCZA 1FOHA 4J57E 3W6GA 2YWIA 4F0BA 3LXZA 1I9DA 3NOFA 3TRQA 5GAPD 2KLXA 3SWLA 2O87A 4MCUA 2I1UA 2KOKA 3O3TA 5JCUA 1W4VA 2FGXA 2HFDA 2KP2A 2JL4A 1TKDB 5J9CA 1WE0A 2HT9A 3M3MA 3MDKA 3LQ7A 4AGSA 4L5LA 1THOA 5IOXA 3WGDA 4FYBA 3QAWA 1ZYQB 4OFTA 1BG5A 1PQNA 1PMTA 1QFNA 3DGQA 4PNFA 6GSWA 5LNKe 2L57A 2N5AA 2X8HA 4GCIA 3S9FA 1XWBA 2GQLA 1VF2A 3HY2A 4P3YB 4WF4A 5IMAA 2GGTA 2O7KA 3GA4A 2QKEA 2R0GA 1G7OA 4PNGA 2O89A 4POLA 4V1Ag 2VAFA 5IM9A 3ZMLA 4ID0A 4KCAA 1GSDA 4ZB6A 2JADA 4I6XA 5KN1A 4POMA 4G0LA 1OE7A 1UN2A 3TJJA 1XCCA 1EEJA 3QD9A 2IMDA 1BX9A 4IN0A 5ELAA 2ZNMA 1JZOA 5DJMA 3HZ4A 3KJYA 2QGVA 1GSUA 1T3BA 3EYTA 1ZYNA 2VD0A 1EV9A 1TJDA 2M72A 1PRXA 5DBQA 1JLVA 3KP8A 2NBSA 2HI7A 1N8JA 5FHIA 3TRXA 1YKAA 1OVNA 4HI7A 3WGEA 3GV1A 1X0RA 1SK2A 2TRCP 4TRXA 2LUSA 5EY6A 1SU9A 3A2WA 1X9SB 4ML1A 5A4UA 4NHZA 2G2QA 2AHEA 3KH9A 4HEA2 1A2JA 2FCHA 3F6DA 1TW9A 1QK8A 2PPTA 2H1GA 2HRKA 2MBTA 5ECQB 4K7OA 4XRAA 4NMUA 3ZFBA 3LWAA 5GZZB 3H8QA 2HYXA 4DEJA 3QFBC 4K2DA 1K0NA 4BIKA 4ECJA 1ERUA 2P5RA 1J0FA 4YQVA 1JLWA 1JFUA 4RUVA 1M2DA 1UC7A 4XS6A 5IO0A 3GMFA 4E8HA 4CHSA 2VL2A 5IIZA 3HXSA 1O81A 4CW9A 1GLPA 5IMDA 3MSZA 1GTAA 2C0GA 5COHA 4WKWA 1IYIA 1AC1A 4F9ZA 1S3DA 5CAXA 2V6OA 14GSA 2I3YA 3E0UA 3MIXA 1K3LA 3LYPA 4MJBA 3L9UA 1GSSA 5IPGA 1ZCPA 4HS1A 2XHFA 4I5QA 1DUGA 3LGCA 5D8IA 4G9HA 4ACSA 2FNOA 3C1SA 3TKPA 3PINA 4Q5NA 4I8BA 2G0FA 4Z2UA 4NWYA 1F6MC 3CSHA 1URMA 3QOUA 3BCKA 3HD5A 4TR3A 4RQRA 5DCGA 2MZCA 5ECNB 1F3BA 3L78A 1DBYA 3G7YA 3KP9A 3F4TA 3KGKA 2H0HA 3IA1A 1Z6MA 4EDYA 2B7KA 2OJLA 4ZILA 4I2TA 2B1LA 3US3A 1TU7A 1YEXA 2I4AA 2VUPA 2CVDA 3GSSA 4JR6A 3QPMA
chains in the Genus database with same CATH topology
3UEMA 3UMAA 2BTOT 3FW2A 4BPYA 1Z7PA 1SL2B 3ZFLA 4G2EA 4KCEA 1TI3A 1GL8A 3M9JA 1ERVA 3P8WA 3LORA 4WBJA 4WETA 1X9MB 5KOXA 1XWKA 1WOUA 2K8SA 1ZL9A 3CTFA 5B7CA 1AQXA 3ISOA 1BJXA 2VCQA 1EOHA 1PKZA 2WULA 2B1KA 2X8CA 1MTCA 1TDIA 4FIWA 2VCXA 1EV4A 3GTUA 2GSQA 4KDYA 5CREA 2V2GA 3K8NA 4Q5FA 1J9BA 1A24A 4AJ8A 5AIXA 4LMWA 2X49A 3F9UA 2RUEA 4K0GA 5CO3A 4YKGA 4KH7A 1NW2A 2F8FA 2EIQA 5BRTA 1VRSD 4PURA 3A5IA 2XBQA 4KSOA 3QAGA 6GSSA 2V32A 9GSSA 1HQOA 1A0RP 2HLSA 5CNWA 2PVQA 3CYNA 3BD2A 1M7TA 2C3NA 3BOAA 2F9SA 3FRCA 3UARA 2PN8A 1TTZA 2YANA 5G5FA 2E7PA 3FYGA 4MJEA 2AJQB 3KH7A 4K7NA 2QSIA 3J7Yk 4FH8A 3GKNA 4K1FA 2HRAA 5J4UA 4Z2TA 3E9JB 5GSSA 5ECIB 2C3QA 3IV4A 4GLTA 2H30A 4NPBA 4K9ZA 4YAVA 3VFIA 1FG4A 4ILFA 4DSRA 3GTUB 17GSA 2LQQA 4KB3A 1NSWA 1FHEA 3FEUA 3TKSE 5B6NA 4G0KA 3IC4A 5ECKB 2O85A 5KN2A 1MD4A 5AISA 2DC5A 2FA8A 5G5EA 1GLQA 6GSYA 4EIQA 2ES7A 2CX3A 2V6KA 2LNTA 5FWGA 2X64A 4PQHA 2VD1A 3UOMA 1V57A 1OKDA 3C7MA 3R2QA 2CZ3A 1Y6EA 4EVMA 2HNLA 2IMIA 3FY7A 3KM6A 5ECSA 2JSZA 2WGRA 3IK9A 4ZXGA 3DYRA 1PL2A 5AGYA 4TR1A 5CRHA 3FHKA 2K8VA 1C72A 4KNDA 2CAIA 2B7JA 1VF4A 4XIHA 5JCGA 4NV2A 4K6XA 4CY6A 3UVHA 5G31A 2LS5A 1ON4A 2H6YA 1RW1A 3ERWA 3IPZA 6GSUA 2HZEA 2JACA 2E0QA 4MZCA 3LG6A 2L6DA 4HQSA 3A2XA 1VGLA 4MNNA 2H6XA 2IMFA 3QCPA 3CTGA 1SL0B 3BCIA 2B6MA 2OE3A 5LCZA 3RPPA 2REMA 1A2LA 3C73A 3ZL5A 1WPIA 2E2MA 2ON5A 4I97A 1U88A 1OKTA 1CQHA 2VLTA 3UBLA 11GSA 3IE3A 2MBSA 4WR5A 2EC4A 1PA3A 3U6VA 3KXOA 3H79A 4PQ1A 4X1UA 3IAS2 1EP7A 4KDXA 4ZL8A 1O7UA 1TRUA 1TXXA 1O8XA 2LJRA 1PL1A 4ULXA 1E6BA 3D5JA 3PH9A 2DIZA 4PUAA 3CBUA 4TXVA 4TR1B 3KD0A 2H70A 3VWUA 1H75A 4MLYA 1HNAA 2C0DA 2VL9A 2YP6A 3HHVA 3ZVJD 4LL1B 2HZEB 3I6AA 4HOJA 4MH3A 2L6CA 4KDUA 3F8UA 4X4JA 2H19A 2DLXA 1YF1A 2F3MA 4TKYA 3D4MA 3P2AA 2FHEA 3HZ8A 2AV4A 5ENUA 1GTIA 1M2BA 2RM6A 4DSSA 1S3CA 2MMNA 2WCIA 3VI5A 3CSJA 4JU5A 3MAKA 5ECMB 1GULA 4TXOB 4CY8A 3FR3A 4TVEA 5ECPB 3KIJA 2A4VA 3GH6A 1X5CA 2VL2C 1XFLA 2LJAA 2YOIA 3WYWA 5ID2A 3F0IA 2DMMA 5BMUA 4EF0A 5D9TA 1SD8A 4BVYA 2VM2A 4BL7A 1T8EB 1MEKA 1EP8A 1EEMA 3TKQA 4HJ2A 1PN0A 1GRXA 3IHGA 5ABRA 2C3TA 1AQVA 1WP0A 2JZTA 2R6KA 4ECIA 4K8MA 1ERTA 1F3AA 1OC3A 4IP6A 1W89A 3RHBA 1DE1A 5B8BA 1PX7A 3EMPA 1T00A 1WWJA 2IFQB 3PPUA 1O73A 2K9FA 3MYDA 1RK4A 4DSSB 1XIYA 2B5XA 2GSSA 3DIEA 3L0HA 1WIKA 4IKHA 5IQYA 5D9XA 1TP9A 3I43A 4K5SA 5G2ZA 3BJ5A 3IR4A 2GZYA 4Z7XA 5AIVA 4MZBA 3UIWA 2H8LA 4IVFA 2GT6A 4PXOA 1SJ6A 2LQOA 5ID2B 4QL7A 1X9WB 2BMXA 4TW5A 4EE0A 2ZCTA 3E3EA 1XPVA 1Z5YE 4MK3A 3GNJA 1M9BA 4BVYB 2H73A 4XCSA 4BL7B 1USBA 5G1LA 4PX1A 4HU9A 4MMMA 2QC7A 2P0GA 1PSQA 1AQWA 2GQMA 5DVBA 1V98A 3Q74A 4A5PA 2VL3A 3LXTA 2F51A 2JU5A 3M8NA 4PQIA 2YWMA 4N0VA 3TGZA 2XBIA 3VURA 3IXRA 1QGVA 4LA1A 5KOWA 1KTEA 1V2AA 3GFKA 5JWOB 3IOSA 3KCMA 1K3YA 1J08A 4RI7A 5A4VA 3WT1A 2PMTA 3Q19A 4BVXA 4XHMA 4Q5RA 1U6TA 2DKHA 3EVIA 4YKFA 4KAEA 4XRDA 2FY6A 4NV5A 5E4WA 4V2NA 4N0ZA 5IPHA 3CRTA 2DJJA 2H0GA 2MYGA 3FZAA 1EWXA 1XXUA 1ILOA 3VWXA 2RIIA 1PGTA 3RBTA 1XWCA 2YZUA 4GSTA 1WRYA 1ZYEA 1FOVA 1SJIA 3W8SA 3VWWA 3G7IA 5CRDA 4JR4A 4JRRA 1GSFA 1QXHA 3LEFA 3DEXA 3KZQA 1WMJA 4BWQA 1XVQA 3QFAC 4O5RA 1EOGA 3WGXA 1BYEA 6GSTA 1G7EA 2LNSA 4MJAA 3H1NA 1ZGNA 2H76A 4KE3A 1Z3EA 1IYHA 3TJBA 3N5OA 4BVXB 1BQ7A 3TOTA 4MF6A 5HR2A 3FZ9A 2PVOC 3UBKA 2BJXA 3DRNA 5ECOB 4MPFA 1UA5A 2WRTA 2ZUPA 4YQUA 3HVXA 1EGOA 2TRXA 1GSYA 4IS0A 1AAZA 4TR4A 2C8UA 4JZQA 3R3EA 2CZ2A 4QL9A 2IMKA 2PUKC 1K0BA 4IQAA 2H74A 1GNWA 1PKWA 2DJ2A 2L59A 5CP1A 3Q18A 1R4WA 1YF0A 1Z7RA 2R0CA 3EINA 1MD3A 2P5QA 2KP1A 3O6TA 2VO4A 1V9WA 1KEBA 3J7Yb 1K0OA 1XBSA 1G6YA 3D4TA 1JZDA 1LJRA 4ZB9A 1HNCA 3LSZA 5IMFA 3RAZA 4ZL7A 3EU4A 3TJGA 2WZ9A 3FR6A 1GH2A 2X99A 3M9KA 2HE3A 3GSTA 1ACVA 4H86A 4L5OA 5HFGA 4G0IA 2NDOA 4MJCA 5AN1A 3APSA 2LJKA 5CRWA 5FT3A 1FO5A 3G7JA 1B9XC 3ZRDA 2L4QA 4RI6A 2B5YA 1B8XA 2IMEA 1M0UA 4NAXA 2H01A 5F07A 3IAM2 4IELA 4V1Ap 2L4CA 1XW9A 3APOA 2DJ0A 3G9BA 2K18A 4EDZA 4F0CA 3UJ1A 18GSA 2VOCA 1N2AA 3GUSA 4WXTA 5DJLA 2WB9A 1YJ6A 2NPBA 4K0NA 2JZSA 1YEPA 2HZFA 5B8AA 2IPAA 4MH2A 4ML6A 3GL3A 4O5UA 2XPDA 3GN3A 1SYXA 5J41A 5JCWA 4MPGA 4O32A 3Q6OA 2DBCA 2HSYA 1SKWB 1OC8A 3MWHA 4HUAA 1HD2A 1FB6A 3FR9A 1B48A 2GSTA 2FLSA 4MF7A 5IMZA 1G6WA 2KUCA 3F63A 4OO4A 2R2JA 2XPEA 1ST9A 2PGTA 4Z2RA 2YN1A 2H66A 2ALBA 1A0FA 4EL1A 3CRUA 4KUNA 1PD21 2OACA 2N5BA 4K7IA 5JWRB 1A23A 4LMVA 2I81A 4PUFC 1GTBA 3PGTA 1EZKA 5DDLA 3LYKA 2J23A 2C1YA 2E2GA 3BBYA 4LLRA 2VCTA 4J56E 5J5NA 4F03A 2GQKA 5IMCA 5J9BA 1K0MA 3CMIA 1I5GA 4JEDA 3GH9A 1QQ2A 4EC0A 4LL4B 5KEJA 3TKSC 5D73A 4TXOA 4OFMA 2GSRA 2B3SA 1GNEA 1A8YA 4N10A 5HQPA 1XVWA 3F6FA 3HYPA 5HR3A 2LKUA 4L8EA 1JHBA 3M1GA 5GSTA 1ZYPA 3VK9A 4HDEA 2N5FA 5EL8A 2IWTA 1TK0B 4FYCA 2PBJA 5L71A 1T4ZA 4PGTA 2DMLA 3TDGA 2C0EA 2H1AA 2WDUA 3F3RA 4G10A 2MMAA 3GURA 2HSHA 4OWYA 5B6MA 3O76A 2X4AA 1YZXA 2I9HA 4TOPA 4PTSA 2CA8A 5D9VA 2IFQA 5HFIA 1THXA 3EURA 2UZ8A 1RQMA 2OADA 2PERA 5G1KA 4USSA 3RPNA 5IOWA 2CX4A 4K2XA 2HSMA 3F4RA 1TRSA 3D0ZA 20GSA 3IHQA 2VCZA 4JE1A 4ZBAA 4DSQA 4ICYA 3HKRA 2OA7A 3V1WA 5F8BA 2FWHA 3ZYWA 3TOUA 5D93A 5IO2A 4EUYA 3EPTA 1ZOFA 2PWJA 2XC2A 3D6IA 3GHAA 1O8WA 2TIRA 3IC8A 3ME8A 5F0GA 3KMOA 4GTUA 4MABA 1U87A 4ZB8A 4ECBA 2HRFA 2YV9A 2GZPA 4GF0A 2QA2A 3QMXA 5DALB 2IN3A 2R5GA 2WFCA 4AJ6A 1MDIA 4YAPA 10GSA 2HRNA 1FAAA 3WD6A 2EIRA 6GSXA 1FVKA 1TU8A 1R5PA 3TKSA 3TJFA 2A2SA 3KEBA 1DSBA 2EIOA 5A5KA 1G0TA 4TN8A 1SK1A 1JZRA 3I69A 4V2MA 3A2VA 3ZITA 1AW9A 4MA9A 1A2MA 1YY7A 1YDKA 3IK7A 2DJ3A 4HQZA 5LD0A 1GP1A 4IQ1A 2IL3A 4WR4A 2FA4A 1Z6NA 4NHWA 5DQYA 2YV7A 5DQSA 4L0UA 2YZHA 5C00A 1KNGA 1QMVA 22GSA 2YNXA 2C80A 3LJRA 4IP1A 4G19A 5JWQB 1AUCA 2GT5A 2R37A 1Q98A 3ZZXA 1MDJA 1Z9HA 8GSSA 5GAND 1XZOA 1R26A 3IDVA 2YPMA 4EIPA 3SBCA 16GSA 4WF5A 3C8EA 1FB0A 1SENA 1T4YA 4TR0A 2QA1A 4AF2A 2H72A 3EE2A 1AIUA 4POBA 13GSA 4OFNA 2A4HA 5KN0A 1LU4A 4BWSA 3KTLA 1PX6A 3QAVA 3ED3A 3NIVA 3ZIVA 2YWNA 3L4NA 3TB2A 2LEGA 5H5SA 2CV4A 2DJ1A 1CQGA 3F3QA 1JZWA 3GKKA 5HR0A 2JSYA 2F8AA 4IW9A 3DKSA 3GIXA 4GSSA 1V58A 1OC9A 1K0AA 4MZWA 4O7HA 2YJ7A 2GLRA 2ON7A 3HDCA 2R0PA 3HA9A 5C04A 2PU9C 4YQMA 3RDWA 3ZIJA 5HR1A 2FWEA 2GTUA 3CSIA 5DCHA 3EMXA 2KHPA 4XTSA 2RM5A 4E8EA 5KN3A 2J9HA 1OE8A 2DJKA 1F37A 3GX0A 1TK8B 3TJKA 1SYRA 2RLIA 1FW1A 1Q4JA 1ERWA 1VF3A 2H75A 1TK5B 4XS1A 1XWGA 1ZMAA 3GRXA 3TUEA 3UVTA 1SKRB 1QUWA 1HYUA 3ZTLA 5CRGA 1BAYA 5D96A 4ECCA 1T7PB 2LTKA 1KBNA 4NXIA 2LRNA 2YWOA 3H4KA 1YQ1A 3QDNA 1OYJA 2YCDA 4DVCA 1BEDA 1F2EA 4MP4A 2GS3A 4FQUA 1H4OA 1OC9B 2NTOA 4F82A 1U3AA 1R5AA 1E2YA 1O6JA 2CAQA 3HJPA 4D73A 2C4JA 4WEYA 4JBBA 3GKXA 4YH2A 1V40A 2FD3A 2LV3A 1NM3A 2C0FA 3F4SA 5J3RA 1LBKA 5F06A 3TCOA 4FYUA 3MNGA 3C1RA 2RUFA 1M2AA 1TRWA 1X5EA 4GQCA 3ZVJA 2R4VA 5EVOA 3VPTA 5ECRB 5ECHB 3HVVA 1B9YC 4IHUA 1GWCA 4HU7A 2R3XA 1XW5A 3L9SA 4N11A 3IBHA 2D2ZA 3HVSA 3NZNA 3JCML 2O8VB 2VM1A 2HXKA 3DD3A 2LRTA 1GSQA 5CYYA 3TRPA 4O5QA 2LSTA 3A3TA 2AYTA 4HZ4A 4FO5A 1R7HA 4ZBDA 1DE2A 1A8LA 2VLUA 3ZREA 3UAPA 2P31A 4EO3A 3FZ5A 3D22A 2CT6A 4KX4A 3AY8A 4OD7A 3FMWA 1M99A 3C71A 4GXZA 4HZ2A 4QQ7A 3ERFA 4ZBBA 4MDCA 2GDRA 5ECLB 3W8JA 2K6VA 2LRCA 3EWLA 4D73B 2IIYA 4POKA 4F2IA 3GKMA 3TKRA 5DAKA 4ZL9A 2H71A 3EC3A 2YJHA 4K5RA 3IRAA 3GX8A 4EXJA 2L5LA 4OCEA 1GUHA 1AXDA 2DIYA 1T1VA 3ZMKA 1B4PA 2V1MA 3DMLA 4O92A 1SL1B 3N9JA 1FVJA 3EU3A 3OR5A 5INYA 5G30A 6GSVA 2M46A 3PR8A 1WJKA 3LW9A 1SK0A 3ERGA 1PN9A 3DXBA 1OAZA 2GZZA 1K3OA 5E59A 3FZ4A 2MMZA 3APQA 2A2PA 4Q5QA 12GSA 4IBPA 4I2UA 4V2LA 4CDOA 3A5WA 4XS4A 1X5DA 1Y25A 2M80A 3P7XA 4L0WA 2OKAA 2OE1A 4RQXA 4HJMA 3FK8A 4GRFA 2FWGA 1HNBA 1NHOA 2DSAA 5EPFA 3DWVA 3KMNA 19GSA 4KW6A 3VI7A 3GYKA 1UVZA 1XW6A 2H1DA 3L9VA 1EGRA 5DAKB 5D9WA 1TOFA 4OCFA 1VF1A 4IJIA 1GSEA 1SKSB 3M0FA 1XWAA 4WBRD 4GWRA 1S3AA 4KF9A 3LFLA 2AB6A 1SD9A 2L5OA 3H93A 4IGJA 3CXGA 3P90A 3WT2A 3QR6A 1K0CA 2A2RA 2DKIA 5A4WA 2VLVA 1NHYA 3ME7A 4AJ7A 1U3IA 1ML6A 3U5RE 4IJ3A 5HFKA 7GSSA 2JZRA 5H5RA 4KSMA 2AUVA 2X8GA 2FWFA 1YKCA 4XS4B 3GL5A 2B5EA 2NVLA 2H0IA 2CVBA 3VWVA 5ELGA 1GTUA 3KTBA 1TRVA 4EKZA 2GVPA 2OBIA 4OMVA 2WS2A 4MF5A 1K0DA 4ISDA 5F05A 3D21A 1SJZA 2H6ZA 2VIMA 1TI1A 4GSNA 1GUMA 2IJYA 5H5QA 4OO5A 4J2FA 2OE0A 2VCWA 2WJUA 4ZIJA 1ZZYA 4GQFA 3I9V2 1M9AA 2CQ9A 1GUKA 3ZLPA 3UL3A 3HJOA 1B4QA 1XOAA 2FUG2 2MMOA 3HJMA 1XOBA 4KGIA 2CVKA 4KA0A 3VPQA 1F9MA 2H1BA 4X43A 2VCVA 1O85A 5DALA 3DVXA 4BA7A 1ABAA 3VLNA 5IMVA 4N30A 3DVWA 3RHCA 2OBKA 2V41A 4X0XA 2AAWA 1MDKA 2Z9SA 3FKFA 3HCZA 1FOHA 4J57E 3W6GA 2YWIA 4F0BA 3LXZA 1I9DA 3NOFA 3TRQA 5GAPD 2KLXA 3SWLA 2O87A 4MCUA 2I1UA 2KOKA 3O3TA 5JCUA 1W4VA 2FGXA 2HFDA 2KP2A 2JL4A 1TKDB 5J9CA 1WE0A 2HT9A 3M3MA 3MDKA 3LQ7A 4AGSA 4L5LA 1THOA 5IOXA 3WGDA 4FYBA 3QAWA 1ZYQB 4OFTA 1BG5A 1PQNA 1PMTA 1QFNA 3DGQA 4PNFA 6GSWA 5LNKe 2L57A 2N5AA 2X8HA 4GCIA 3S9FA 1XWBA 2GQLA 1VF2A 3HY2A 4P3YB 4WF4A 5IMAA 2GGTA 2O7KA 3GA4A 2QKEA 2R0GA 1G7OA 4PNGA 2O89A 4POLA 4V1Ag 2VAFA 5IM9A 3ZMLA 4ID0A 4KCAA 1GSDA 4ZB6A 2JADA 4I6XA 5KN1A 4POMA 4G0LA 1OE7A 1UN2A 3TJJA 1XCCA 1EEJA 3QD9A 2IMDA 1BX9A 4IN0A 5ELAA 2ZNMA 1JZOA 5DJMA 3HZ4A 3KJYA 2QGVA 1GSUA 1T3BA 3EYTA 1ZYNA 2VD0A 1EV9A 1TJDA 2M72A 1PRXA 5DBQA 1JLVA 3KP8A 2NBSA 2HI7A 1N8JA 5FHIA 3TRXA 1YKAA 1OVNA 4HI7A 3WGEA 3GV1A 1X0RA 1SK2A 2TRCP 4TRXA 2LUSA 5EY6A 1SU9A 3A2WA 1X9SB 4ML1A 5A4UA 4NHZA 2G2QA 2AHEA 3KH9A 4HEA2 1A2JA 2FCHA 3F6DA 1TW9A 1QK8A 2PPTA 2H1GA 2HRKA 2MBTA 5ECQB 4K7OA 4XRAA 4NMUA 3ZFBA 3LWAA 5GZZB 3H8QA 2HYXA 4DEJA 3QFBC 4K2DA 1K0NA 4ECJA 1ERUA 2P5RA 1J0FA 4YQVA 1JLWA 1JFUA 4RUVA 1M2DA 1UC7A 4XS6A 5IO0A 3GMFA 4E8HA 4CHSA 2VL2A 5IIZA 3HXSA 1O81A 4CW9A 1GLPA 5IMDA 3MSZA 1GTAA 2C0GA 5COHA 4WKWA 1IYIA 1AC1A 4F9ZA 1S3DA 5CAXA 2V6OA 14GSA 2I3YA 3E0UA 3MIXA 1K3LA 3LYPA 4MJBA 3L9UA 1GSSA 5IPGA 1ZCPA 4HS1A 2XHFA 4I5QA 1DUGA 3LGCA 5D8IA 4G9HA 4ACSA 2FNOA 3C1SA 3TKPA 3PINA 4Q5NA 4I8BA 2G0FA 4Z2UA 4NWYA 1F6MC 3CSHA 1URMA 3QOUA 3BCKA 3HD5A 4TR3A 4RQRA 5DCGA 2MZCA 5ECNB 1F3BA 3L78A 1DBYA 3G7YA 3KP9A 3F4TA 3KGKA 2H0HA 3IA1A 1Z6MA 4EDYA 2B7KA 2OJLA 4ZILA 4I2TA 2B1LA 3US3A 1TU7A 1YEXA 2I4AA 2VUPA 2CVDA 3GSSA 4JR6A 3QPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEM A;  3UMA A;  2BTO T;  3FW2 A;  4BPY A;  1Z7P A;  1SL2 B;  3ZFL A;  4G2E A;  4KCE A;  1TI3 A;  1GL8 A;  3M9J A;  1ERV A;  3P8W A;  3LOR A;  4WBJ A;  4WET A;  1X9M B;  1XWK A;  1WOU A;  2K8S A;  1ZL9 A;  3CTF A;  5B7C A;  1AQX A;  3ISO A;  1BJX A;  2VCQ A;  1EOH A;  1PKZ A;  2WUL A;  2B1K A;  2X8C A;  1MTC A;  1TDI A;  4FIW A;  2VCX A;  1EV4 A;  3GTU A;  2GSQ A;  4KDY A;  5CRE A;  2V2G A;  3K8N A;  4Q5F A;  1J9B A;  1A24 A;  4AJ8 A;  5AIX A;  4LMW A;  3F9U A;  2RUE A;  4K0G A;  5CO3 A;  4KH7 A;  1NW2 A;  2F8F A;  2EIQ A;  1VRS D;  4PUR A;  2XBQ A;  4KSO A;  3QAG A;  6GSS A;  2V32 A;  9GSS A;  1HQO A;  1A0R P;  2HLS A;  5CNW A;  2PVQ A;  3CYN A;  3BD2 A;  1M7T A;  2C3N A;  3BOA A;  2F9S A;  3FRC A;  3UAR A;  2PN8 A;  1TTZ A;  2YAN A;  5G5F A;  2E7P A;  3FYG A;  4MJE A;  2AJQ B;  3KH7 A;  4K7N A;  2QSI A;  3J7Y k;  4FH8 A;  3GKN A;  4K1F A;  5J4U A;  3E9J B;  5GSS A;  5ECI B;  2C3Q A;  3IV4 A;  4GLT A;  2H30 A;  4NPB A;  4K9Z A;  4YAV A;  3VFI A;  1FG4 A;  4ILF A;  4DSR A;  3GTU B;  17GS A;  2LQQ A;  4KB3 A;  1NSW A;  1FHE A;  3FEU A;  3TKS E;  5B6N A;  3IC4 A;  5ECK B;  2O85 A;  5KN2 A;  1MD4 A;  5AIS A;  2DC5 A;  2FA8 A;  5G5E A;  1GLQ A;  6GSY A;  2ES7 A;  2CX3 A;  2V6K A;  2LNT A;  5FWG A;  2X64 A;  4PQH A;  2VD1 A;  3UOM A;  1V57 A;  1OKD A;  3C7M A;  3R2Q A;  2CZ3 A;  1Y6E A;  4EVM A;  2HNL A;  2IMI A;  3FY7 A;  3KM6 A;  5ECS A;  2JSZ A;  2WGR A;  3IK9 A;  4ZXG A;  3DYR A;  1PL2 A;  5AGY A;  4TR1 A;  5CRH A;  3FHK A;  2K8V A;  1C72 A;  4KND A;  2CAI A;  2B7J A;  1VF4 A;  4XIH A;  5JCG A;  4NV2 A;  4K6X A;  3UVH A;  5G31 A;  2LS5 A;  1ON4 A;  2H6Y A;  1RW1 A;  3ERW A;  3IPZ A;  6GSU A;  2HZE A;  2JAC A;  2E0Q A;  4MZC A;  3LG6 A;  2L6D A;  4HQS A;  3A2X A;  1VGL A;  2H6X A;  2IMF A;  3QCP A;  3CTG A;  1SL0 B;  3BCI A;  2B6M A;  2OE3 A;  5LCZ A;  3RPP A;  2REM A;  1A2L A;  3C73 A;  3ZL5 A;  1WPI A;  2E2M A;  2ON5 A;  4I97 A;  1U88 A;  1OKT A;  1CQH A;  2VLT A;  3UBL A;  11GS A;  3IE3 A;  2MBS A;  4WR5 A;  2EC4 A;  1PA3 A;  3U6V A;  3KXO A;  3H79 A;  4PQ1 A;  4X1U A;  3IAS 2;  1EP7 A;  4KDX A;  4ZL8 A;  1O7U A;  1TRU A;  1TXX A;  1O8X A;  2LJR A;  1PL1 A;  4ULX A;  1E6B A;  3D5J A;  3PH9 A;  2DIZ A;  4PUA A;  3CBU A;  4TXV A;  4TR1 B;  3KD0 A;  2H70 A;  3VWU A;  1H75 A;  4MLY A;  1HNA A;  2C0D A;  2VL9 A;  2YP6 A;  3HHV A;  3ZVJ D;  4LL1 B;  2HZE B;  3I6A A;  4HOJ A;  4MH3 A;  2L6C A;  4KDU A;  3F8U A;  2H19 A;  2DLX A;  1YF1 A;  2F3M A;  4TKY A;  3D4M A;  3P2A A;  2FHE A;  3HZ8 A;  2AV4 A;  5ENU A;  1GTI A;  1M2B A;  2RM6 A;  4DSS A;  1S3C A;  2MMN A;  2WCI A;  3VI5 A;  3CSJ A;  4JU5 A;  3MAK A;  5ECM B;  1GUL A;  4TXO B;  3FR3 A;  4TVE A;  5ECP B;  3KIJ A;  2A4V A;  3GH6 A;  1X5C A;  2VL2 C;  1XFL A;  2LJA A;  2YOI A;  3WYW A;  5ID2 A;  3F0I A;  2DMM A;  4EF0 A;  5D9T A;  1SD8 A;  4BVY A;  2VM2 A;  4BL7 A;  1T8E B;  1MEK A;  1EP8 A;  1EEM A;  3TKQ A;  4HJ2 A;  1GRX A;  5ABR A;  2C3T A;  1AQV A;  1WP0 A;  2JZT A;  2R6K A;  4ECI A;  4K8M A;  1ERT A;  1F3A A;  1OC3 A;  4IP6 A;  1W89 A;  3RHB A;  1DE1 A;  5B8B A;  1PX7 A;  3EMP A;  1T00 A;  1WWJ A;  2IFQ B;  1O73 A;  2K9F A;  1RK4 A;  4DSS B;  1XIY A;  2B5X A;  2GSS A;  3DIE A;  3L0H A;  1WIK A;  4IKH A;  5IQY A;  5D9X A;  1TP9 A;  3I43 A;  5G2Z A;  3BJ5 A;  3IR4 A;  2GZY A;  4Z7X A;  5AIV A;  4MZB A;  3UIW A;  2H8L A;  4IVF A;  2GT6 A;  4PXO A;  1SJ6 A;  2LQO A;  5ID2 B;  4QL7 A;  1X9W B;  2BMX A;  4TW5 A;  4EE0 A;  2ZCT A;  3E3E A;  1XPV A;  1Z5Y E;  4MK3 A;  3GNJ A;  1M9B A;  2H73 A;  4XCS A;  1USB A;  5G1L A;  4PX1 A;  4HU9 A;  4MMM A;  2QC7 A;  2P0G A;  1PSQ A;  1AQW A;  2GQM A;  5DVB A;  1V98 A;  3Q74 A;  2VL3 A;  3LXT A;  2F51 A;  2JU5 A;  3M8N A;  4PQI A;  2YWM A;  4N0V A;  3TGZ A;  2XBI A;  3VUR A;  3IXR A;  1QGV A;  4LA1 A;  1KTE A;  1V2A A;  3GFK A;  5JWO B;  3IOS A;  3KCM A;  1K3Y A;  1J08 A;  4RI7 A;  5A4V A;  3WT1 A;  2PMT A;  3Q19 A;  4BVX A;  4XHM A;  4Q5R A;  1U6T A;  3EVI A;  4KAE A;  4XRD A;  2FY6 A;  4NV5 A;  5E4W A;  4V2N A;  4N0Z A;  5IPH A;  3CRT A;  2DJJ A;  2H0G A;  2MYG A;  3FZA A;  1EWX A;  1XXU A;  1ILO A;  3VWX A;  2RII A;  1PGT A;  3RBT A;  1XWC A;  2YZU A;  4GST A;  1WRY A;  1ZYE A;  1FOV A;  1SJI A;  3W8S A;  3VWW A;  3G7I A;  5CRD A;  4JR4 A;  4JRR A;  1GSF A;  1QXH A;  3LEF A;  3DEX A;  3KZQ A;  1WMJ A;  4BWQ A;  1XVQ A;  3QFA C;  4O5R A;  1EOG A;  3WGX A;  1BYE A;  6GST A;  1G7E A;  2LNS A;  4MJA A;  3H1N A;  1ZGN A;  2H76 A;  4KE3 A;  1Z3E A;  1IYH A;  3TJB A;  3N5O A;  1BQ7 A;  3TOT A;  4MF6 A;  5HR2 A;  3FZ9 A;  2PVO C;  3UBK A;  2BJX A;  3DRN A;  5ECO B;  4MPF A;  1UA5 A;  2WRT A;  2ZUP A;  4YQU A;  3HVX A;  1EGO A;  2TRX A;  1GSY A;  4IS0 A;  1AAZ A;  4TR4 A;  2C8U A;  4JZQ A;  2CZ2 A;  4QL9 A;  2IMK A;  2PUK C;  1K0B A;  4IQA A;  2H74 A;  1GNW A;  1PKW A;  2DJ2 A;  2L59 A;  5CP1 A;  3Q18 A;  1R4W A;  1YF0 A;  1Z7R A;  3EIN A;  1MD3 A;  2P5Q A;  2KP1 A;  3O6T A;  2VO4 A;  1V9W A;  1KEB A;  3J7Y b;  1K0O A;  1XBS A;  1G6Y A;  3D4T A;  1JZD A;  1LJR A;  4ZB9 A;  1HNC A;  3LSZ A;  5IMF A;  3RAZ A;  4ZL7 A;  3EU4 A;  3TJG A;  2WZ9 A;  3FR6 A;  1GH2 A;  2X99 A;  3M9K A;  2HE3 A;  3GST A;  1ACV A;  4H86 A;  4L5O A;  5HFG A;  2NDO A;  4MJC A;  5AN1 A;  3APS A;  2LJK A;  5CRW A;  5FT3 A;  1FO5 A;  3G7J A;  1B9X C;  3ZRD A;  2L4Q A;  4RI6 A;  2B5Y A;  1B8X A;  2IME A;  1M0U A;  4NAX A;  2H01 A;  5F07 A;  3IAM 2;  4IEL A;  4V1A p;  2L4C A;  1XW9 A;  3APO A;  2DJ0 A;  3G9B A;  2K18 A;  4EDZ A;  4F0C A;  3UJ1 A;  18GS A;  2VOC A;  1N2A A;  3GUS A;  4WXT A;  5DJL A;  2WB9 A;  1YJ6 A;  2NPB A;  4K0N A;  2JZS A;  1YEP A;  2HZF A;  5B8A A;  2IPA A;  4MH2 A;  4ML6 A;  3GL3 A;  2XPD A;  3GN3 A;  1SYX A;  5J41 A;  5JCW A;  4MPG A;  3Q6O A;  4O32 A;  2DBC A;  2HSY A;  1SKW B;  1OC8 A;  3MWH A;  4HUA A;  1HD2 A;  1FB6 A;  3FR9 A;  1B48 A;  2GST A;  2FLS A;  4MF7 A;  5IMZ A;  1G6W A;  2KUC A;  3F63 A;  4OO4 A;  2R2J A;  2XPE A;  1ST9 A;  2PGT A;  2YN1 A;  2H66 A;  2ALB A;  1A0F A;  4EL1 A;  3CRU A;  4KUN A;  1PD2 1;  2OAC A;  2N5B A;  4K7I A;  5JWR B;  1A23 A;  4LMV A;  2I81 A;  4PUF C;  1GTB A;  3PGT A;  1EZK A;  5DDL A;  3LYK A;  2J23 A;  2C1Y A;  2E2G A;  3BBY A;  4LLR A;  2VCT A;  4J56 E;  5J5N A;  4F03 A;  2GQK A;  5IMC A;  5J9B A;  1K0M A;  3CMI A;  1I5G A;  4JED A;  3GH9 A;  1QQ2 A;  4EC0 A;  4LL4 B;  5KEJ A;  3TKS C;  5D73 A;  4TXO A;  4OFM A;  2GSR A;  2B3S A;  1GNE A;  1A8Y A;  4N10 A;  5HQP A;  1XVW A;  3F6F A;  3HYP A;  5HR3 A;  2LKU A;  4L8E A;  1JHB A;  3M1G A;  5GST A;  3VK9 A;  4HDE A;  2N5F A;  5EL8 A;  2IWT A;  1TK0 B;  4FYC A;  2PBJ A;  5L71 A;  1T4Z A;  4PGT A;  2DML A;  3TDG A;  2C0E A;  2H1A A;  2WDU A;  3F3R A;  4G10 A;  2MMA A;  3GUR A;  2HSH A;  4OWY A;  5B6M A;  3O76 A;  1YZX A;  2I9H A;  4TOP A;  2CA8 A;  5D9V A;  2IFQ A;  5HFI A;  1THX A;  3EUR A;  1RQM A;  2OAD A;  2PER A;  5G1K A;  3RPN A;  5IOW A;  2CX4 A;  3F4R A;  1TRS A;  3D0Z A;  20GS A;  3IHQ A;  2VCZ A;  4JE1 A;  4ZBA A;  4DSQ A;  3HKR A;  2OA7 A;  3V1W A;  5F8B A;  2FWH A;  3ZYW A;  3TOU A;  5D93 A;  5IO2 A;  4EUY A;  1ZOF A;  2PWJ A;  2XC2 A;  3D6I A;  3GHA A;  1O8W A;  2TIR A;  3ME8 A;  5F0G A;  3KMO A;  4GTU A;  4MAB A;  1U87 A;  4ZB8 A;  4ECB A;  2HRF A;  2YV9 A;  2GZP A;  4GF0 A;  3QMX A;  5DAL B;  2IN3 A;  2R5G A;  2WFC A;  4AJ6 A;  1MDI A;  4YAP A;  10GS A;  2HRN A;  1FAA A;  3WD6 A;  2EIR A;  6GSX A;  1FVK A;  1TU8 A;  1R5P A;  3TKS A;  3TJF A;  2A2S A;  3KEB A;  1DSB A;  2EIO A;  5A5K A;  1G0T A;  4TN8 A;  1SK1 A;  1JZR A;  3I69 A;  4V2M A;  3A2V A;  3ZIT A;  1AW9 A;  4MA9 A;  1A2M A;  1YY7 A;  1YDK A;  3IK7 A;  2DJ3 A;  4HQZ A;  5LD0 A;  1GP1 A;  4IQ1 A;  2IL3 A;  4WR4 A;  2FA4 A;  1Z6N A;  4NHW A;  5DQY A;  2YV7 A;  5DQS A;  4L0U A;  2YZH A;  5C00 A;  1KNG A;  1QMV A;  22GS A;  2YNX A;  2C80 A;  3LJR A;  4IP1 A;  4G19 A;  5JWQ B;  1AUC A;  2GT5 A;  2R37 A;  1Q98 A;  3ZZX A;  1MDJ A;  1Z9H A;  8GSS A;  5GAN D;  1XZO A;  1R26 A;  3IDV A;  2YPM A;  3SBC A;  16GS A;  4WF5 A;  3C8E A;  1FB0 A;  1SEN A;  1T4Y A;  4TR0 A;  4AF2 A;  2H72 A;  3EE2 A;  1AIU A;  4POB A;  13GS A;  4OFN A;  5KN0 A;  1LU4 A;  4BWS A;  3KTL A;  1PX6 A;  3QAV A;  3ED3 A;  3NIV A;  3ZIV A;  2YWN A;  3L4N A;  3TB2 A;  2LEG A;  5H5S A;  2CV4 A;  2DJ1 A;  1CQG A;  3F3Q A;  1JZW A;  3GKK A;  5HR0 A;  2JSY A;  2F8A A;  4IW9 A;  3DKS A;  3GIX A;  4GSS A;  1V58 A;  1OC9 A;  1K0A A;  4MZW A;  4O7H A;  2YJ7 A;  2GLR A;  2ON7 A;  3HDC A;  3HA9 A;  5C04 A;  2PU9 C;  4YQM A;  3RDW A;  3ZIJ A;  5HR1 A;  2FWE A;  2GTU A;  3CSI A;  5DCH A;  3EMX A;  2KHP A;  4XTS A;  2RM5 A;  4E8E A;  5KN3 A;  2J9H A;  1OE8 A;  2DJK A;  1F37 A;  3GX0 A;  1TK8 B;  3TJK A;  1SYR A;  2RLI A;  1FW1 A;  1Q4J A;  1ERW A;  1VF3 A;  2H75 A;  1TK5 B;  4XS1 A;  1XWG A;  1ZMA A;  3GRX A;  3TUE A;  3UVT A;  1SKR B;  1QUW A;  1HYU A;  3ZTL A;  5CRG A;  1BAY A;  5D96 A;  4ECC A;  1T7P B;  2LTK A;  1KBN A;  4NXI A;  2LRN A;  2YWO A;  3H4K A;  1YQ1 A;  3QDN A;  1OYJ A;  2YCD A;  4DVC A;  1BED A;  1F2E A;  4MP4 A;  2GS3 A;  1H4O A;  1OC9 B;  2NTO A;  4F82 A;  1U3A A;  1R5A A;  1E2Y A;  1O6J A;  2CAQ A;  3HJP A;  4D73 A;  2C4J A;  4WEY A;  4JBB A;  3GKX A;  4YH2 A;  1V40 A;  2FD3 A;  2LV3 A;  1NM3 A;  2C0F A;  3F4S A;  5J3R A;  1LBK A;  5F06 A;  3TCO A;  4FYU A;  3MNG A;  3C1R A;  2RUF A;  1M2A A;  1TRW A;  1X5E A;  4GQC A;  3ZVJ A;  2R4V A;  5EVO A;  3VPT A;  5ECR B;  5ECH B;  3HVV A;  1B9Y C;  4IHU A;  1GWC A;  4HU7 A;  2R3X A;  1XW5 A;  3L9S A;  4N11 A;  3IBH A;  2D2Z A;  3HVS A;  3NZN A;  3JCM L;  2O8V B;  2VM1 A;  2HXK A;  3DD3 A;  2LRT A;  1GSQ A;  5CYY A;  3TRP A;  2LST A;  3A3T A;  2AYT A;  4HZ4 A;  4FO5 A;  1R7H A;  4ZBD A;  1DE2 A;  1A8L A;  2VLU A;  3ZRE A;  3UAP A;  2P31 A;  4EO3 A;  3FZ5 A;  3D22 A;  2CT6 A;  4KX4 A;  3AY8 A;  4OD7 A;  1M99 A;  3C71 A;  4GXZ A;  4HZ2 A;  4QQ7 A;  3ERF A;  4ZBB A;  4MDC A;  2GDR A;  5ECL B;  3W8J A;  2K6V A;  2LRC A;  3EWL A;  4D73 B;  2IIY A;  4POK A;  4F2I A;  3GKM A;  3TKR A;  5DAK A;  4ZL9 A;  2H71 A;  3EC3 A;  2YJH A;  3IRA A;  3GX8 A;  4EXJ A;  2L5L A;  4OCE A;  1GUH A;  1AXD A;  2DIY A;  1T1V A;  3ZMK A;  1B4P A;  2V1M A;  3DML A;  4O92 A;  1SL1 B;  3N9J A;  1FVJ A;  3EU3 A;  3OR5 A;  5INY A;  5G30 A;  6GSV A;  2M46 A;  3PR8 A;  1WJK A;  1SK0 A;  3ERG A;  1PN9 A;  3DXB A;  1OAZ A;  2GZZ A;  1K3O A;  5E59 A;  3FZ4 A;  2MMZ A;  3APQ A;  4Q5Q A;  12GS A;  4IBP A;  4I2U A;  4V2L A;  4CDO A;  3A5W A;  4XS4 A;  1X5D A;  1Y25 A;  2M80 A;  3P7X A;  4L0W A;  2OKA A;  2OE1 A;  4RQX A;  4HJM A;  3FK8 A;  4GRF A;  2FWG A;  1HNB A;  1NHO A;  2DSA A;  5EPF A;  3DWV A;  3KMN A;  19GS A;  4KW6 A;  3VI7 A;  3GYK A;  1UVZ A;  1XW6 A;  2H1D A;  3L9V A;  1EGR A;  5DAK B;  5D9W A;  1TOF A;  4OCF A;  1VF1 A;  4IJI A;  1GSE A;  1SKS B;  3M0F A;  1XWA A;  4WBR D;  4GWR A;  1S3A A;  3LFL A;  2AB6 A;  1SD9 A;  2L5O A;  3H93 A;  4IGJ A;  3CXG A;  3P90 A;  3WT2 A;  3QR6 A;  1K0C A;  2A2R A;  5A4W A;  2VLV A;  1NHY A;  3ME7 A;  4AJ7 A;  1U3I A;  1ML6 A;  3U5R E;  4IJ3 A;  5HFK A;  7GSS A;  2JZR A;  5H5R A;  4KSM A;  2AUV A;  2X8G A;  2FWF A;  1YKC A;  4XS4 B;  3GL5 A;  2B5E A;  2NVL A;  2H0I A;  2CVB A;  3VWV A;  5ELG A;  1GTU A;  3KTB A;  1TRV A;  4EKZ A;  2GVP A;  2OBI A;  4OMV A;  2WS2 A;  4MF5 A;  1K0D A;  4ISD A;  5F05 A;  3D21 A;  1SJZ A;  2H6Z A;  2VIM A;  1TI1 A;  4GSN A;  1GUM A;  2IJY A;  5H5Q A;  4OO5 A;  4J2F A;  2OE0 A;  2VCW A;  2WJU A;  4ZIJ A;  1ZZY A;  4GQF A;  3I9V 2;  1M9A A;  2CQ9 A;  1GUK A;  3ZLP A;  3UL3 A;  3HJO A;  1B4Q A;  1XOA A;  2FUG 2;  2MMO A;  3HJM A;  1XOB A;  4KGI A;  2CVK A;  4KA0 A;  3VPQ A;  1F9M A;  2H1B A;  4X43 A;  2VCV A;  1O85 A;  5DAL A;  3DVX A;  4BA7 A;  1ABA A;  3VLN A;  5IMV A;  4N30 A;  3DVW A;  3RHC A;  2OBK A;  2V41 A;  4X0X A;  2AAW A;  1MDK A;  2Z9S A;  3FKF A;  3HCZ A;  4J57 E;  3W6G A;  2YWI A;  4F0B A;  3LXZ A;  1I9D A;  3NOF A;  3TRQ A;  5GAP D;  2KLX A;  3SWL A;  2O87 A;  4MCU A;  2I1U A;  2KOK A;  3O3T A;  5JCU A;  1W4V A;  2FGX A;  2HFD A;  2KP2 A;  2JL4 A;  1TKD B;  5J9C A;  1WE0 A;  2HT9 A;  3M3M A;  3MDK A;  3LQ7 A;  4AGS A;  4L5L A;  1THO A;  5IOX A;  3WGD A;  4FYB A;  3QAW A;  1ZYQ B;  4OFT A;  1BG5 A;  1PQN A;  1PMT A;  1QFN A;  3DGQ A;  4PNF A;  6GSW A;  5LNK e;  2L57 A;  2N5A A;  2X8H A;  4GCI A;  3S9F A;  1XWB A;  2GQL A;  1VF2 A;  3HY2 A;  4P3Y B;  4WF4 A;  5IMA A;  2GGT A;  2O7K A;  3GA4 A;  2QKE A;  1G7O A;  4PNG A;  2O89 A;  4POL A;  4V1A g;  2VAF A;  5IM9 A;  3ZML A;  4ID0 A;  4KCA A;  1GSD A;  4ZB6 A;  2JAD A;  4I6X A;  5KN1 A;  4POM A;  1OE7 A;  1UN2 A;  3TJJ A;  1XCC A;  1EEJ A;  3QD9 A;  2IMD A;  1BX9 A;  4IN0 A;  5ELA A;  2ZNM A;  1JZO A;  5DJM A;  3HZ4 A;  3KJY A;  2QGV A;  1GSU A;  1T3B A;  3EYT A;  2VD0 A;  1EV9 A;  1TJD A;  2M72 A;  1PRX A;  5DBQ A;  1JLV A;  3KP8 A;  2NBS A;  2HI7 A;  1N8J A;  5FHI A;  3TRX A;  1YKA A;  1OVN A;  4HI7 A;  3WGE A;  3GV1 A;  1X0R A;  1SK2 A;  2TRC P;  4TRX A;  2LUS A;  5EY6 A;  1SU9 A;  3A2W A;  1X9S B;  4ML1 A;  5A4U A;  4NHZ A;  2G2Q A;  2AHE A;  3KH9 A;  4HEA 2;  1A2J A;  2FCH A;  3F6D A;  1TW9 A;  1QK8 A;  2PPT A;  2H1G A;  2MBT A;  5ECQ B;  4K7O A;  4XRA A;  4NMU A;  3ZFB A;  3LWA A;  5GZZ B;  3H8Q A;  2HYX A;  4DEJ A;  3QFB C;  4K2D A;  1K0N A;  4ECJ A;  1ERU A;  2P5R A;  1J0F A;  4YQV A;  1JLW A;  1JFU A;  4RUV A;  1M2D A;  1UC7 A;  4XS6 A;  5IO0 A;  3GMF A;  4E8H A;  4CHS A;  2VL2 A;  5IIZ A;  3HXS A;  1O81 A;  4CW9 A;  1GLP A;  5IMD A;  3MSZ A;  1GTA A;  2C0G A;  5COH A;  4WKW A;  1IYI A;  1AC1 A;  4F9Z A;  1S3D A;  5CAX A;  2V6O A;  14GS A;  2I3Y A;  3E0U A;  1K3L A;  3LYP A;  4MJB A;  3L9U A;  1GSS A;  5IPG A;  1ZCP A;  4HS1 A;  2XHF A;  4I5Q A;  1DUG A;  3LGC A;  5D8I A;  4G9H A;  4ACS A;  2FNO A;  3C1S A;  3TKP A;  3PIN A;  4Q5N A;  4I8B A;  2G0F A;  4NWY A;  1F6M C;  3CSH A;  1URM A;  3QOU A;  3BCK A;  3HD5 A;  4TR3 A;  4RQR A;  5DCG A;  2MZC A;  5ECN B;  1F3B A;  3L78 A;  1DBY A;  3G7Y A;  3KP9 A;  3F4T A;  3KGK A;  2H0H A;  3IA1 A;  1Z6M A;  4EDY A;  2B7K A;  2OJL A;  4ZIL A;  4I2T A;  2B1L A;  3US3 A;  1TU7 A;  1YEX A;  2I4A A;  2VUP A;  2CVD A;  3GSS A;  4JR6 A;  3QPM A; 
#chains in the Genus database with same CATH topology
 3UEM A;  3UMA A;  1S3R A;  2BTO T;  3FW2 A;  4BPY A;  1Z7P A;  1SL2 B;  3ZFL A;  4G2E A;  4KCE A;  1TI3 A;  1GL8 A;  3M9J A;  1ERV A;  3P8W A;  3LOR A;  4WBJ A;  4WET A;  1X9M B;  5KOX A;  1XWK A;  1WOU A;  2K8S A;  1ZL9 A;  3CTF A;  5B7C A;  1AQX A;  3ISO A;  1BJX A;  2VCQ A;  1EOH A;  1PKZ A;  2WUL A;  2B1K A;  2X8C A;  1MTC A;  1TDI A;  4FIW A;  2VCX A;  1EV4 A;  3GTU A;  2GSQ A;  4KDY A;  5CRE A;  2V2G A;  3K8N A;  4Q5F A;  1J9B A;  1A24 A;  4AJ8 A;  5AIX A;  4LMW A;  2X49 A;  3F9U A;  2RUE A;  4K0G A;  5CO3 A;  4YKG A;  4KH7 A;  1NW2 A;  2F8F A;  2EIQ A;  5BRT A;  1VRS D;  4PUR A;  3A5I A;  2XBQ A;  4KSO A;  3QAG A;  6GSS A;  2V32 A;  9GSS A;  1HQO A;  1A0R P;  2HLS A;  5CNW A;  2PVQ A;  3CYN A;  3BD2 A;  1M7T A;  2C3N A;  3BOA A;  2F9S A;  3FRC A;  3UAR A;  2PN8 A;  1TTZ A;  2YAN A;  5G5F A;  2E7P A;  3FYG A;  4MJE A;  2AJQ B;  3KH7 A;  4K7N A;  2QSI A;  3J7Y k;  4FH8 A;  3GKN A;  4K1F A;  2HRA A;  5J4U A;  4Z2T A;  3E9J B;  5GSS A;  5ECI B;  2C3Q A;  3IV4 A;  4GLT A;  2H30 A;  4NPB A;  4K9Z A;  4YAV A;  3VFI A;  1FG4 A;  4ILF A;  4DSR A;  3GTU B;  17GS A;  2LQQ A;  4KB3 A;  1NSW A;  1FHE A;  3FEU A;  3TKS E;  5B6N A;  4G0K A;  3IC4 A;  5ECK B;  2O85 A;  5KN2 A;  1MD4 A;  5AIS A;  2DC5 A;  2FA8 A;  5G5E A;  1GLQ A;  6GSY A;  4EIQ A;  2ES7 A;  2CX3 A;  2V6K A;  2LNT A;  5FWG A;  2X64 A;  4PQH A;  2VD1 A;  3UOM A;  1V57 A;  1OKD A;  3C7M A;  3R2Q A;  2CZ3 A;  1Y6E A;  4EVM A;  2HNL A;  2IMI A;  3FY7 A;  3KM6 A;  5ECS A;  2JSZ A;  2WGR A;  3IK9 A;  4ZXG A;  3DYR A;  1PL2 A;  5AGY A;  4TR1 A;  5CRH A;  3FHK A;  2K8V A;  1C72 A;  4KND A;  2CAI A;  2B7J A;  1VF4 A;  4XIH A;  5JCG A;  4NV2 A;  4K6X A;  4CY6 A;  3UVH A;  5G31 A;  2LS5 A;  1ON4 A;  2H6Y A;  1RW1 A;  3ERW A;  3IPZ A;  6GSU A;  2HZE A;  2JAC A;  2E0Q A;  4MZC A;  3LG6 A;  2L6D A;  4HQS A;  3A2X A;  1VGL A;  4MNN A;  2H6X A;  2IMF A;  3QCP A;  3CTG A;  1SL0 B;  3BCI A;  2B6M A;  2OE3 A;  5LCZ A;  3RPP A;  2REM A;  1A2L A;  3C73 A;  3ZL5 A;  1WPI A;  2E2M A;  2ON5 A;  4I97 A;  1U88 A;  1OKT A;  1CQH A;  2VLT A;  3UBL A;  11GS A;  3IE3 A;  2MBS A;  4WR5 A;  2EC4 A;  1PA3 A;  3U6V A;  3KXO A;  3H79 A;  4PQ1 A;  4X1U A;  3IAS 2;  1EP7 A;  4KDX A;  4ZL8 A;  1O7U A;  1TRU A;  1TXX A;  1O8X A;  2LJR A;  1PL1 A;  4ULX A;  1E6B A;  3D5J A;  3PH9 A;  2DIZ A;  4PUA A;  3CBU A;  4TXV A;  4TR1 B;  3KD0 A;  2H70 A;  3VWU A;  1H75 A;  4MLY A;  1HNA A;  2C0D A;  2VL9 A;  2YP6 A;  3HHV A;  3ZVJ D;  4LL1 B;  2HZE B;  3I6A A;  4HOJ A;  1PFO A;  4MH3 A;  2L6C A;  4KDU A;  3F8U A;  4X4J A;  2H19 A;  2DLX A;  1YF1 A;  2F3M A;  4TKY A;  3D4M A;  3P2A A;  2FHE A;  3HZ8 A;  2AV4 A;  5ENU A;  1GTI A;  1M2B A;  2RM6 A;  4DSS A;  1S3C A;  2MMN A;  2WCI A;  3VI5 A;  3CSJ A;  4JU5 A;  3MAK A;  5ECM B;  1GUL A;  4TXO B;  4CY8 A;  3HVN A;  3FR3 A;  4TVE A;  5ECP B;  3KIJ A;  2A4V A;  3GH6 A;  1X5C A;  2VL2 C;  1XFL A;  2LJA A;  2YOI A;  3WYW A;  5ID2 A;  3F0I A;  2DMM A;  5BMU A;  4EF0 A;  5D9T A;  1SD8 A;  4BVY A;  2VM2 A;  4BL7 A;  1T8E B;  1MEK A;  1EP8 A;  1EEM A;  3TKQ A;  4HJ2 A;  1PN0 A;  1GRX A;  3IHG A;  5ABR A;  2C3T A;  1AQV A;  1WP0 A;  2JZT A;  2R6K A;  4ECI A;  4K8M A;  1ERT A;  1F3A A;  1OC3 A;  4IP6 A;  1W89 A;  3RHB A;  1DE1 A;  5B8B A;  1PX7 A;  3EMP A;  1T00 A;  1WWJ A;  2IFQ B;  3PPU A;  1O73 A;  2K9F A;  3MYD A;  1RK4 A;  4DSS B;  1XIY A;  2B5X A;  2GSS A;  3DIE A;  3L0H A;  1WIK A;  4IKH A;  5IQY A;  5D9X A;  1TP9 A;  3I43 A;  4K5S A;  5G2Z A;  3BJ5 A;  3IR4 A;  2GZY A;  4Z7X A;  5AIV A;  4MZB A;  3UIW A;  2H8L A;  4IVF A;  2GT6 A;  4PXO A;  1SJ6 A;  2LQO A;  5ID2 B;  4QL7 A;  1X9W B;  2BMX A;  4TW5 A;  4EE0 A;  2ZCT A;  3E3E A;  1XPV A;  1Z5Y E;  4MK3 A;  3GNJ A;  1M9B A;  4BVY B;  2H73 A;  4XCS A;  4BL7 B;  1USB A;  5G1L A;  4PX1 A;  4HU9 A;  4MMM A;  2QC7 A;  2P0G A;  1PSQ A;  1AQW A;  2GQM A;  5DVB A;  1V98 A;  3Q74 A;  4A5P A;  2VL3 A;  3LXT A;  2F51 A;  2JU5 A;  3M8N A;  4PQI A;  2YWM A;  4N0V A;  3TGZ A;  2XBI A;  3VUR A;  3IXR A;  1QGV A;  4LA1 A;  5KOW A;  1KTE A;  1V2A A;  3GFK A;  5JWO B;  3IOS A;  3KCM A;  1K3Y A;  1J08 A;  4RI7 A;  5A4V A;  3WT1 A;  2PMT A;  3Q19 A;  4BVX A;  4XHM A;  4Q5R A;  1U6T A;  2DKH A;  3EVI A;  1M3I A;  4YKF A;  4KAE A;  4XRD A;  2FY6 A;  4NV5 A;  5E4W A;  4V2N A;  4N0Z A;  5IPH A;  3CRT A;  2DJJ A;  2H0G A;  2MYG A;  3FZA A;  1EWX A;  1XXU A;  1ILO A;  3VWX A;  2RII A;  1PGT A;  3RBT A;  1XWC A;  2YZU A;  4GST A;  1WRY A;  1ZYE A;  1FOV A;  1SJI A;  3W8S A;  3VWW A;  3G7I A;  5CRD A;  4JR4 A;  4JRR A;  1GSF A;  1QXH A;  3LEF A;  3DEX A;  3KZQ A;  1WMJ A;  4BWQ A;  1XVQ A;  3QFA C;  4O5R A;  1EOG A;  3WGX A;  1BYE A;  6GST A;  1G7E A;  2LNS A;  4MJA A;  3H1N A;  1ZGN A;  2H76 A;  4KE3 A;  1Z3E A;  1IYH A;  1M3J A;  3TJB A;  3N5O A;  4BVX B;  1BQ7 A;  3TOT A;  4MF6 A;  5HR2 A;  3FZ9 A;  2PVO C;  3UBK A;  2BJX A;  3DRN A;  5ECO B;  4MPF A;  1UA5 A;  2WRT A;  2ZUP A;  4YQU A;  3HVX A;  1EGO A;  2TRX A;  1GSY A;  4IS0 A;  1AAZ A;  4TR4 A;  2C8U A;  4JZQ A;  3R3E A;  2CZ2 A;  4QL9 A;  2IMK A;  2PUK C;  1K0B A;  4IQA A;  2H74 A;  1GNW A;  1PKW A;  2DJ2 A;  2L59 A;  5CP1 A;  3Q18 A;  1R4W A;  1YF0 A;  1Z7R A;  2R0C A;  3EIN A;  1MD3 A;  2P5Q A;  2KP1 A;  3O6T A;  2VO4 A;  1V9W A;  1KEB A;  3J7Y b;  1K0O A;  1XBS A;  1G6Y A;  3D4T A;  1JZD A;  1LJR A;  4ZB9 A;  1HNC A;  3LSZ A;  5IMF A;  3RAZ A;  4ZL7 A;  3EU4 A;  3TJG A;  2WZ9 A;  3FR6 A;  1GH2 A;  2X99 A;  3M9K A;  2HE3 A;  3GST A;  1ACV A;  4H86 A;  4L5O A;  5HFG A;  4G0I A;  2NDO A;  4MJC A;  5AN1 A;  3APS A;  2LJK A;  5CRW A;  5FT3 A;  1FO5 A;  3G7J A;  1B9X C;  3ZRD A;  2L4Q A;  4RI6 A;  2B5Y A;  1B8X A;  2IME A;  1M0U A;  4NAX A;  2H01 A;  5F07 A;  3IAM 2;  4IEL A;  4V1A p;  2L4C A;  1XW9 A;  3APO A;  2DJ0 A;  3G9B A;  2K18 A;  4EDZ A;  4F0C A;  3UJ1 A;  18GS A;  2VOC A;  1N2A A;  3GUS A;  4WXT A;  5DJL A;  2WB9 A;  1YJ6 A;  2NPB A;  4K0N A;  2JZS A;  1YEP A;  2HZF A;  5B8A A;  2IPA A;  4MH2 A;  4ML6 A;  3GL3 A;  4O5U A;  2XPD A;  3GN3 A;  1SYX A;  5J41 A;  5JCW A;  4MPG A;  4O32 A;  3Q6O A;  2DBC A;  2HSY A;  1SKW B;  1OC8 A;  3MWH A;  4HUA A;  1HD2 A;  1FB6 A;  3FR9 A;  1B48 A;  2GST A;  2FLS A;  4MF7 A;  5IMZ A;  1G6W A;  2KUC A;  3F63 A;  4OO4 A;  2R2J A;  2XPE A;  1ST9 A;  2PGT A;  4Z2R A;  2YN1 A;  2H66 A;  2ALB A;  1A0F A;  4EL1 A;  3CRU A;  4KUN A;  1PD2 1;  2OAC A;  2N5B A;  4K7I A;  5JWR B;  1A23 A;  4LMV A;  2I81 A;  4PUF C;  1GTB A;  3PGT A;  1EZK A;  5DDL A;  3LYK A;  2J23 A;  2C1Y A;  2E2G A;  3BBY A;  4LLR A;  2VCT A;  4J56 E;  5J5N A;  4F03 A;  2GQK A;  5IMC A;  5J9B A;  1K0M A;  3CMI A;  1I5G A;  4JED A;  3GH9 A;  1QQ2 A;  4EC0 A;  4LL4 B;  5KEJ A;  3TKS C;  5D73 A;  4TXO A;  4OFM A;  2GSR A;  2B3S A;  1GNE A;  1A8Y A;  4N10 A;  5HQP A;  1XVW A;  3F6F A;  3HYP A;  5HR3 A;  2LKU A;  4L8E A;  1JHB A;  3M1G A;  5GST A;  1ZYP A;  3VK9 A;  4HDE A;  2N5F A;  5EL8 A;  2IWT A;  1TK0 B;  4FYC A;  4HSC X;  2PBJ A;  5L71 A;  1T4Z A;  4PGT A;  2DML A;  3TDG A;  2C0E A;  2H1A A;  2WDU A;  3F3R A;  4G10 A;  2MMA A;  3GUR A;  2HSH A;  4OWY A;  5B6M A;  3O76 A;  2X4A A;  1YZX A;  2I9H A;  4TOP A;  4PTS A;  2CA8 A;  5D9V A;  2IFQ A;  5HFI A;  1THX A;  3EUR A;  2UZ8 A;  1RQM A;  2OAD A;  2PER A;  5G1K A;  4USS A;  3RPN A;  5IOW A;  2CX4 A;  4K2X A;  2HSM A;  3F4R A;  1TRS A;  3D0Z A;  20GS A;  3IHQ A;  2VCZ A;  4JE1 A;  4ZBA A;  4DSQ A;  4ICY A;  3HKR A;  2OA7 A;  3V1W A;  5F8B A;  2FWH A;  3ZYW A;  3TOU A;  5D93 A;  5IO2 A;  4EUY A;  3EPT A;  1ZOF A;  2PWJ A;  2XC2 A;  3D6I A;  3GHA A;  1O8W A;  2TIR A;  3IC8 A;  3ME8 A;  5F0G A;  3KMO A;  4GTU A;  4MAB A;  1U87 A;  4ZB8 A;  4ECB A;  2HRF A;  2YV9 A;  2GZP A;  4GF0 A;  2QA2 A;  3QMX A;  5DAL B;  2IN3 A;  2R5G A;  2WFC A;  4AJ6 A;  1MDI A;  4YAP A;  10GS A;  2HRN A;  1FAA A;  3WD6 A;  2EIR A;  6GSX A;  1FVK A;  1TU8 A;  1R5P A;  3TKS A;  3TJF A;  2A2S A;  3KEB A;  1DSB A;  2EIO A;  5A5K A;  1G0T A;  4TN8 A;  1SK1 A;  1JZR A;  3I69 A;  4V2M A;  3A2V A;  3ZIT A;  1AW9 A;  4MA9 A;  1A2M A;  1YY7 A;  1YDK A;  3IK7 A;  2DJ3 A;  4HQZ A;  5LD0 A;  1GP1 A;  4IQ1 A;  2IL3 A;  4WR4 A;  2FA4 A;  1Z6N A;  4NHW A;  5DQY A;  2YV7 A;  5DQS A;  4L0U A;  2YZH A;  5C00 A;  1KNG A;  1QMV A;  22GS A;  2YNX A;  2C80 A;  3LJR A;  4IP1 A;  4G19 A;  5JWQ B;  1AUC A;  2GT5 A;  2R37 A;  1Q98 A;  3ZZX A;  1MDJ A;  1Z9H A;  8GSS A;  5GAN D;  1XZO A;  1R26 A;  3IDV A;  2YPM A;  4EIP A;  3SBC A;  16GS A;  4WF5 A;  3C8E A;  1FB0 A;  1SEN A;  1T4Y A;  4TR0 A;  2QA1 A;  4AF2 A;  2H72 A;  3EE2 A;  1AIU A;  4POB A;  13GS A;  4OFN A;  2A4H A;  5KN0 A;  1LU4 A;  4BWS A;  3KTL A;  1PX6 A;  3QAV A;  3ED3 A;  3NIV A;  3ZIV A;  2YWN A;  3L4N A;  3TB2 A;  2LEG A;  5H5S A;  2CV4 A;  2DJ1 A;  1CQG A;  3F3Q A;  1JZW A;  3GKK A;  5HR0 A;  2JSY A;  2F8A A;  4IW9 A;  3DKS A;  3GIX A;  4GSS A;  1V58 A;  1OC9 A;  1K0A A;  4MZW A;  4O7H A;  2YJ7 A;  2GLR A;  2ON7 A;  3HDC A;  2R0P A;  3HA9 A;  5C04 A;  2PU9 C;  4YQM A;  3RDW A;  3ZIJ A;  5HR1 A;  2FWE A;  2GTU A;  3CSI A;  5DCH A;  3EMX A;  2KHP A;  4XTS A;  2RM5 A;  4E8E A;  5KN3 A;  2J9H A;  1OE8 A;  2DJK A;  1F37 A;  3GX0 A;  1TK8 B;  3TJK A;  1SYR A;  2RLI A;  1FW1 A;  1Q4J A;  1ERW A;  1VF3 A;  2H75 A;  1TK5 B;  4XS1 A;  1XWG A;  1ZMA A;  3GRX A;  3TUE A;  3UVT A;  1SKR B;  1QUW A;  1HYU A;  3ZTL A;  5CRG A;  1XG8 A;  1BAY A;  5D96 A;  4ECC A;  1T7P B;  2LTK A;  1KBN A;  4NXI A;  2LRN A;  2YWO A;  3H4K A;  1YQ1 A;  3QDN A;  1OYJ A;  2YCD A;  4DVC A;  1BED A;  1F2E A;  4MP4 A;  2GS3 A;  3CQF A;  4FQU A;  1H4O A;  1OC9 B;  2NTO A;  4F82 A;  1U3A A;  1R5A A;  1E2Y A;  1O6J A;  2CAQ A;  3HJP A;  4D73 A;  2C4J A;  4WEY A;  4JBB A;  3GKX A;  4YH2 A;  1V40 A;  2FD3 A;  2LV3 A;  1NM3 A;  2C0F A;  3F4S A;  5J3R A;  1LBK A;  5F06 A;  3TCO A;  4FYU A;  3MNG A;  3C1R A;  2RUF A;  1M2A A;  1TRW A;  1X5E A;  4GQC A;  3ZVJ A;  2R4V A;  5EVO A;  3VPT A;  5ECR B;  5ECH B;  3HVV A;  1B9Y C;  4IHU A;  1GWC A;  4HU7 A;  2R3X A;  1XW5 A;  3L9S A;  4N11 A;  3IBH A;  2D2Z A;  3HVS A;  3NZN A;  3JCM L;  2O8V B;  2VM1 A;  2HXK A;  3DD3 A;  2LRT A;  1GSQ A;  5CYY A;  3TRP A;  4O5Q A;  2LST A;  3A3T A;  2AYT A;  4HZ4 A;  4FO5 A;  1R7H A;  4ZBD A;  1DE2 A;  1A8L A;  2VLU A;  3ZRE A;  3UAP A;  2P31 A;  4EO3 A;  3FZ5 A;  3D22 A;  2CT6 A;  4KX4 A;  3AY8 A;  4OD7 A;  3FMW A;  1M99 A;  3C71 A;  4GXZ A;  4HZ2 A;  4QQ7 A;  3ERF A;  4ZBB A;  4MDC A;  2GDR A;  5ECL B;  3W8J A;  2K6V A;  2LRC A;  3EWL A;  4D73 B;  2IIY A;  4POK A;  4F2I A;  3GKM A;  3TKR A;  5DAK A;  4ZL9 A;  2H71 A;  3EC3 A;  2YJH A;  4K5R A;  3IRA A;  3GX8 A;  4EXJ A;  2L5L A;  4OCE A;  1GUH A;  1AXD A;  2DIY A;  1T1V A;  3ZMK A;  1B4P A;  2V1M A;  3DML A;  4O92 A;  1SL1 B;  3N9J A;  1FVJ A;  3EU3 A;  3OR5 A;  5INY A;  5G30 A;  6GSV A;  2M46 A;  3PR8 A;  1WJK A;  3LW9 A;  1SK0 A;  3ERG A;  1PN9 A;  3DXB A;  1OAZ A;  2GZZ A;  1K3O A;  5E59 A;  3FZ4 A;  2MMZ A;  3APQ A;  2A2P A;  4Q5Q A;  12GS A;  4IBP A;  4I2U A;  4V2L A;  4CDO A;  3A5W A;  4XS4 A;  1X5D A;  1Y25 A;  2M80 A;  3P7X A;  4L0W A;  2OKA A;  2OE1 A;  4RQX A;  4HJM A;  3FK8 A;  4GRF A;  2FWG A;  1HNB A;  1NHO A;  2DSA A;  5EPF A;  3DWV A;  3KMN A;  19GS A;  4KW6 A;  3VI7 A;  3GYK A;  1UVZ A;  1XW6 A;  2H1D A;  3L9V A;  1EGR A;  5DAK B;  5D9W A;  1TOF A;  4OCF A;  1VF1 A;  4IJI A;  1GSE A;  1SKS B;  3M0F A;  1XWA A;  4WBR D;  4GWR A;  1S3A A;  4KF9 A;  3LFL A;  2AB6 A;  1SD9 A;  2L5O A;  3H93 A;  4IGJ A;  3CXG A;  3P90 A;  3WT2 A;  3QR6 A;  1K0C A;  2A2R A;  2DKI A;  5A4W A;  2VLV A;  1NHY A;  3ME7 A;  4AJ7 A;  1U3I A;  1ML6 A;  3U5R E;  4IJ3 A;  5HFK A;  7GSS A;  2JZR A;  5H5R A;  4KSM A;  2AUV A;  2X8G A;  2FWF A;  1YKC A;  4XS4 B;  3GL5 A;  2B5E A;  2NVL A;  2H0I A;  2CVB A;  3VWV A;  5ELG A;  1GTU A;  3KTB A;  1TRV A;  4EKZ A;  2GVP A;  2OBI A;  4OMV A;  2WS2 A;  4MF5 A;  1K0D A;  4ISD A;  5F05 A;  3D21 A;  1SJZ A;  2H6Z A;  2VIM A;  1TI1 A;  4GSN A;  1GUM A;  2IJY A;  5H5Q A;  4OO5 A;  4J2F A;  2OE0 A;  2VCW A;  2WJU A;  4ZIJ A;  1ZZY A;  4GQF A;  3I9V 2;  1M9A A;  2CQ9 A;  1GUK A;  3ZLP A;  3UL3 A;  3HJO A;  1B4Q A;  1XOA A;  2FUG 2;  2MMO A;  3HJM A;  1XOB A;  4KGI A;  2CVK A;  4KA0 A;  3VPQ A;  1F9M A;  2H1B A;  4X43 A;  2VCV A;  1O85 A;  5DAL A;  3DVX A;  4BA7 A;  1ABA A;  3VLN A;  5IMV A;  4N30 A;  3DVW A;  3RHC A;  2OBK A;  2V41 A;  4X0X A;  2AAW A;  1MDK A;  2Z9S A;  3FKF A;  3HCZ A;  1FOH A;  4J57 E;  3W6G A;  2YWI A;  4F0B A;  3LXZ A;  1I9D A;  3NOF A;  3TRQ A;  5GAP D;  2KLX A;  3SWL A;  2O87 A;  4MCU A;  2I1U A;  2KOK A;  3O3T A;  5JCU A;  1W4V A;  2FGX A;  2HFD A;  2KP2 A;  2JL4 A;  1TKD B;  5J9C A;  1WE0 A;  2HT9 A;  3M3M A;  3MDK A;  3LQ7 A;  4AGS A;  4L5L A;  1THO A;  5IOX A;  3WGD A;  4FYB A;  3QAW A;  1ZYQ B;  4OFT A;  1BG5 A;  1PQN A;  1PMT A;  1QFN A;  3DGQ A;  4PNF A;  6GSW A;  5LNK e;  2L57 A;  2N5A A;  2X8H A;  4GCI A;  3S9F A;  1XWB A;  2GQL A;  1VF2 A;  3HY2 A;  4P3Y B;  4WF4 A;  5IMA A;  2GGT A;  2O7K A;  3GA4 A;  2QKE A;  2R0G A;  1G7O A;  4PNG A;  2O89 A;  4POL A;  4V1A g;  2VAF A;  5IM9 A;  3ZML A;  4ID0 A;  4KCA A;  1GSD A;  4ZB6 A;  2JAD A;  4I6X A;  5KN1 A;  4POM A;  4G0L A;  1OE7 A;  1UN2 A;  3TJJ A;  1XCC A;  1EEJ A;  3QD9 A;  2IMD A;  1BX9 A;  4IN0 A;  5ELA A;  2ZNM A;  1JZO A;  5DJM A;  3HZ4 A;  3KJY A;  2QGV A;  1GSU A;  1T3B A;  3EYT A;  1ZYN A;  2VD0 A;  1EV9 A;  1TJD A;  2M72 A;  1PRX A;  5DBQ A;  1JLV A;  3KP8 A;  2NBS A;  2HI7 A;  1N8J A;  5FHI A;  3TRX A;  1YKA A;  1OVN A;  4HI7 A;  3WGE A;  3GV1 A;  1X0R A;  1SK2 A;  2TRC P;  4TRX A;  2LUS A;  5EY6 A;  1SU9 A;  3A2W A;  1X9S B;  4ML1 A;  5A4U A;  4NHZ A;  2G2Q A;  2AHE A;  3KH9 A;  4HEA 2;  1A2J A;  2FCH A;  3F6D A;  1TW9 A;  1QK8 A;  2PPT A;  2H1G A;  2HRK A;  2MBT A;  5ECQ B;  4K7O A;  4XRA A;  4NMU A;  3ZFB A;  3LWA A;  5GZZ B;  3H8Q A;  2HYX A;  4DEJ A;  3QFB C;  4K2D A;  1K0N A;  4BIK A;  4ECJ A;  1ERU A;  2P5R A;  1J0F A;  4YQV A;  1JLW A;  1JFU A;  4RUV A;  1M2D A;  1UC7 A;  4XS6 A;  5IO0 A;  3GMF A;  4E8H A;  4CHS A;  2VL2 A;  5IIZ A;  3HXS A;  1O81 A;  4CW9 A;  1GLP A;  5IMD A;  3MSZ A;  1GTA A;  2C0G A;  5COH A;  4WKW A;  1IYI A;  1AC1 A;  4F9Z A;  1S3D A;  5CAX A;  2V6O A;  14GS A;  2I3Y A;  3E0U A;  3MIX A;  1K3L A;  3LYP A;  4MJB A;  3L9U A;  1GSS A;  5IPG A;  1ZCP A;  4HS1 A;  2XHF A;  4I5Q A;  1DUG A;  3LGC A;  5D8I A;  4G9H A;  4ACS A;  2FNO A;  3C1S A;  3TKP A;  3PIN A;  4Q5N A;  4I8B A;  2G0F A;  4Z2U A;  4NWY A;  1F6M C;  3CSH A;  1URM A;  3QOU A;  3BCK A;  3HD5 A;  4TR3 A;  4RQR A;  5DCG A;  2MZC A;  5ECN B;  1F3B A;  3L78 A;  1DBY A;  3G7Y A;  3KP9 A;  3F4T A;  3KGK A;  2H0H A;  3IA1 A;  1Z6M A;  4EDY A;  2B7K A;  2OJL A;  4ZIL A;  4I2T A;  2B1L A;  3US3 A;  1TU7 A;  1YEX A;  2I4A A;  2VUP A;  2CVD A;  3GSS A;  4JR6 A;  3QPM A; 
#chains in the Genus database with same CATH homology
 3UEM A;  3UMA A;  2BTO T;  3FW2 A;  4BPY A;  1Z7P A;  1SL2 B;  3ZFL A;  4G2E A;  4KCE A;  1TI3 A;  1GL8 A;  3M9J A;  1ERV A;  3P8W A;  3LOR A;  4WBJ A;  4WET A;  1X9M B;  5KOX A;  1XWK A;  1WOU A;  2K8S A;  1ZL9 A;  3CTF A;  5B7C A;  1AQX A;  3ISO A;  1BJX A;  2VCQ A;  1EOH A;  1PKZ A;  2WUL A;  2B1K A;  2X8C A;  1MTC A;  1TDI A;  4FIW A;  2VCX A;  1EV4 A;  3GTU A;  2GSQ A;  4KDY A;  5CRE A;  2V2G A;  3K8N A;  4Q5F A;  1J9B A;  1A24 A;  4AJ8 A;  5AIX A;  4LMW A;  2X49 A;  3F9U A;  2RUE A;  4K0G A;  5CO3 A;  4YKG A;  4KH7 A;  1NW2 A;  2F8F A;  2EIQ A;  5BRT A;  1VRS D;  4PUR A;  3A5I A;  2XBQ A;  4KSO A;  3QAG A;  6GSS A;  2V32 A;  9GSS A;  1HQO A;  1A0R P;  2HLS A;  5CNW A;  2PVQ A;  3CYN A;  3BD2 A;  1M7T A;  2C3N A;  3BOA A;  2F9S A;  3FRC A;  3UAR A;  2PN8 A;  1TTZ A;  2YAN A;  5G5F A;  2E7P A;  3FYG A;  4MJE A;  2AJQ B;  3KH7 A;  4K7N A;  2QSI A;  3J7Y k;  4FH8 A;  3GKN A;  4K1F A;  2HRA A;  5J4U A;  4Z2T A;  3E9J B;  5GSS A;  5ECI B;  2C3Q A;  3IV4 A;  4GLT A;  2H30 A;  4NPB A;  4K9Z A;  4YAV A;  3VFI A;  1FG4 A;  4ILF A;  4DSR A;  3GTU B;  17GS A;  2LQQ A;  4KB3 A;  1NSW A;  1FHE A;  3FEU A;  3TKS E;  5B6N A;  4G0K A;  3IC4 A;  5ECK B;  2O85 A;  5KN2 A;  1MD4 A;  5AIS A;  2DC5 A;  2FA8 A;  5G5E A;  1GLQ A;  6GSY A;  4EIQ A;  2ES7 A;  2CX3 A;  2V6K A;  2LNT A;  5FWG A;  2X64 A;  4PQH A;  2VD1 A;  3UOM A;  1V57 A;  1OKD A;  3C7M A;  3R2Q A;  2CZ3 A;  1Y6E A;  4EVM A;  2HNL A;  2IMI A;  3FY7 A;  3KM6 A;  5ECS A;  2JSZ A;  2WGR A;  3IK9 A;  4ZXG A;  3DYR A;  1PL2 A;  5AGY A;  4TR1 A;  5CRH A;  3FHK A;  2K8V A;  1C72 A;  4KND A;  2CAI A;  2B7J A;  1VF4 A;  4XIH A;  5JCG A;  4NV2 A;  4K6X A;  4CY6 A;  3UVH A;  5G31 A;  2LS5 A;  1ON4 A;  2H6Y A;  1RW1 A;  3ERW A;  3IPZ A;  6GSU A;  2HZE A;  2JAC A;  2E0Q A;  4MZC A;  3LG6 A;  2L6D A;  4HQS A;  3A2X A;  1VGL A;  4MNN A;  2H6X A;  2IMF A;  3QCP A;  3CTG A;  1SL0 B;  3BCI A;  2B6M A;  2OE3 A;  5LCZ A;  3RPP A;  2REM A;  1A2L A;  3C73 A;  3ZL5 A;  1WPI A;  2E2M A;  2ON5 A;  4I97 A;  1U88 A;  1OKT A;  1CQH A;  2VLT A;  3UBL A;  11GS A;  3IE3 A;  2MBS A;  4WR5 A;  2EC4 A;  1PA3 A;  3U6V A;  3KXO A;  3H79 A;  4PQ1 A;  4X1U A;  3IAS 2;  1EP7 A;  4KDX A;  4ZL8 A;  1O7U A;  1TRU A;  1TXX A;  1O8X A;  2LJR A;  1PL1 A;  4ULX A;  1E6B A;  3D5J A;  3PH9 A;  2DIZ A;  4PUA A;  3CBU A;  4TXV A;  4TR1 B;  3KD0 A;  2H70 A;  3VWU A;  1H75 A;  4MLY A;  1HNA A;  2C0D A;  2VL9 A;  2YP6 A;  3HHV A;  3ZVJ D;  4LL1 B;  2HZE B;  3I6A A;  4HOJ A;  4MH3 A;  2L6C A;  4KDU A;  3F8U A;  4X4J A;  2H19 A;  2DLX A;  1YF1 A;  2F3M A;  4TKY A;  3D4M A;  3P2A A;  2FHE A;  3HZ8 A;  2AV4 A;  5ENU A;  1GTI A;  1M2B A;  2RM6 A;  4DSS A;  1S3C A;  2MMN A;  2WCI A;  3VI5 A;  3CSJ A;  4JU5 A;  3MAK A;  5ECM B;  1GUL A;  4TXO B;  4CY8 A;  3FR3 A;  4TVE A;  5ECP B;  3KIJ A;  2A4V A;  3GH6 A;  1X5C A;  2VL2 C;  1XFL A;  2LJA A;  2YOI A;  3WYW A;  5ID2 A;  3F0I A;  2DMM A;  5BMU A;  4EF0 A;  5D9T A;  1SD8 A;  4BVY A;  2VM2 A;  4BL7 A;  1T8E B;  1MEK A;  1EP8 A;  1EEM A;  3TKQ A;  4HJ2 A;  1PN0 A;  1GRX A;  3IHG A;  5ABR A;  2C3T A;  1AQV A;  1WP0 A;  2JZT A;  2R6K A;  4ECI A;  4K8M A;  1ERT A;  1F3A A;  1OC3 A;  4IP6 A;  1W89 A;  3RHB A;  1DE1 A;  5B8B A;  1PX7 A;  3EMP A;  1T00 A;  1WWJ A;  2IFQ B;  3PPU A;  1O73 A;  2K9F A;  3MYD A;  1RK4 A;  4DSS B;  1XIY A;  2B5X A;  2GSS A;  3DIE A;  3L0H A;  1WIK A;  4IKH A;  5IQY A;  5D9X A;  1TP9 A;  3I43 A;  4K5S A;  5G2Z A;  3BJ5 A;  3IR4 A;  2GZY A;  4Z7X A;  5AIV A;  4MZB A;  3UIW A;  2H8L A;  4IVF A;  2GT6 A;  4PXO A;  1SJ6 A;  2LQO A;  5ID2 B;  4QL7 A;  1X9W B;  2BMX A;  4TW5 A;  4EE0 A;  2ZCT A;  3E3E A;  1XPV A;  1Z5Y E;  4MK3 A;  3GNJ A;  1M9B A;  4BVY B;  2H73 A;  4XCS A;  4BL7 B;  1USB A;  5G1L A;  4PX1 A;  4HU9 A;  4MMM A;  2QC7 A;  2P0G A;  1PSQ A;  1AQW A;  2GQM A;  5DVB A;  1V98 A;  3Q74 A;  4A5P A;  2VL3 A;  3LXT A;  2F51 A;  2JU5 A;  3M8N A;  4PQI A;  2YWM A;  4N0V A;  3TGZ A;  2XBI A;  3VUR A;  3IXR A;  1QGV A;  4LA1 A;  5KOW A;  1KTE A;  1V2A A;  3GFK A;  5JWO B;  3IOS A;  3KCM A;  1K3Y A;  1J08 A;  4RI7 A;  5A4V A;  3WT1 A;  2PMT A;  3Q19 A;  4BVX A;  4XHM A;  4Q5R A;  1U6T A;  2DKH A;  3EVI A;  4YKF A;  4KAE A;  4XRD A;  2FY6 A;  4NV5 A;  5E4W A;  4V2N A;  4N0Z A;  5IPH A;  3CRT A;  2DJJ A;  2H0G A;  2MYG A;  3FZA A;  1EWX A;  1XXU A;  1ILO A;  3VWX A;  2RII A;  1PGT A;  3RBT A;  1XWC A;  2YZU A;  4GST A;  1WRY A;  1ZYE A;  1FOV A;  1SJI A;  3W8S A;  3VWW A;  3G7I A;  5CRD A;  4JR4 A;  4JRR A;  1GSF A;  1QXH A;  3LEF A;  3DEX A;  3KZQ A;  1WMJ A;  4BWQ A;  1XVQ A;  3QFA C;  4O5R A;  1EOG A;  3WGX A;  1BYE A;  6GST A;  1G7E A;  2LNS A;  4MJA A;  3H1N A;  1ZGN A;  2H76 A;  4KE3 A;  1Z3E A;  1IYH A;  3TJB A;  3N5O A;  4BVX B;  1BQ7 A;  3TOT A;  4MF6 A;  5HR2 A;  3FZ9 A;  2PVO C;  3UBK A;  2BJX A;  3DRN A;  5ECO B;  4MPF A;  1UA5 A;  2WRT A;  2ZUP A;  4YQU A;  3HVX A;  1EGO A;  2TRX A;  1GSY A;  4IS0 A;  1AAZ A;  4TR4 A;  2C8U A;  4JZQ A;  3R3E A;  2CZ2 A;  4QL9 A;  2IMK A;  2PUK C;  1K0B A;  4IQA A;  2H74 A;  1GNW A;  1PKW A;  2DJ2 A;  2L59 A;  5CP1 A;  3Q18 A;  1R4W A;  1YF0 A;  1Z7R A;  2R0C A;  3EIN A;  1MD3 A;  2P5Q A;  2KP1 A;  3O6T A;  2VO4 A;  1V9W A;  1KEB A;  3J7Y b;  1K0O A;  1XBS A;  1G6Y A;  3D4T A;  1JZD A;  1LJR A;  4ZB9 A;  1HNC A;  3LSZ A;  5IMF A;  3RAZ A;  4ZL7 A;  3EU4 A;  3TJG A;  2WZ9 A;  3FR6 A;  1GH2 A;  2X99 A;  3M9K A;  2HE3 A;  3GST A;  1ACV A;  4H86 A;  4L5O A;  5HFG A;  4G0I A;  2NDO A;  4MJC A;  5AN1 A;  3APS A;  2LJK A;  5CRW A;  5FT3 A;  1FO5 A;  3G7J A;  1B9X C;  3ZRD A;  2L4Q A;  4RI6 A;  2B5Y A;  1B8X A;  2IME A;  1M0U A;  4NAX A;  2H01 A;  5F07 A;  3IAM 2;  4IEL A;  4V1A p;  2L4C A;  1XW9 A;  3APO A;  2DJ0 A;  3G9B A;  2K18 A;  4EDZ A;  4F0C A;  3UJ1 A;  18GS A;  2VOC A;  1N2A A;  3GUS A;  4WXT A;  5DJL A;  2WB9 A;  1YJ6 A;  2NPB A;  4K0N A;  2JZS A;  1YEP A;  2HZF A;  5B8A A;  2IPA A;  4MH2 A;  4ML6 A;  3GL3 A;  4O5U A;  2XPD A;  3GN3 A;  1SYX A;  5J41 A;  5JCW A;  4MPG A;  4O32 A;  3Q6O A;  2DBC A;  2HSY A;  1SKW B;  1OC8 A;  3MWH A;  4HUA A;  1HD2 A;  1FB6 A;  3FR9 A;  1B48 A;  2GST A;  2FLS A;  4MF7 A;  5IMZ A;  1G6W A;  2KUC A;  3F63 A;  4OO4 A;  2R2J A;  2XPE A;  1ST9 A;  2PGT A;  4Z2R A;  2YN1 A;  2H66 A;  2ALB A;  1A0F A;  4EL1 A;  3CRU A;  4KUN A;  1PD2 1;  2OAC A;  2N5B A;  4K7I A;  5JWR B;  1A23 A;  4LMV A;  2I81 A;  4PUF C;  1GTB A;  3PGT A;  1EZK A;  5DDL A;  3LYK A;  2J23 A;  2C1Y A;  2E2G A;  3BBY A;  4LLR A;  2VCT A;  4J56 E;  5J5N A;  4F03 A;  2GQK A;  5IMC A;  5J9B A;  1K0M A;  3CMI A;  1I5G A;  4JED A;  3GH9 A;  1QQ2 A;  4EC0 A;  4LL4 B;  5KEJ A;  3TKS C;  5D73 A;  4TXO A;  4OFM A;  2GSR A;  2B3S A;  1GNE A;  1A8Y A;  4N10 A;  5HQP A;  1XVW A;  3F6F A;  3HYP A;  5HR3 A;  2LKU A;  4L8E A;  1JHB A;  3M1G A;  5GST A;  1ZYP A;  3VK9 A;  4HDE A;  2N5F A;  5EL8 A;  2IWT A;  1TK0 B;  4FYC A;  2PBJ A;  5L71 A;  1T4Z A;  4PGT A;  2DML A;  3TDG A;  2C0E A;  2H1A A;  2WDU A;  3F3R A;  4G10 A;  2MMA A;  3GUR A;  2HSH A;  4OWY A;  5B6M A;  3O76 A;  2X4A A;  1YZX A;  2I9H A;  4TOP A;  4PTS A;  2CA8 A;  5D9V A;  2IFQ A;  5HFI A;  1THX A;  3EUR A;  2UZ8 A;  1RQM A;  2OAD A;  2PER A;  5G1K A;  4USS A;  3RPN A;  5IOW A;  2CX4 A;  4K2X A;  2HSM A;  3F4R A;  1TRS A;  3D0Z A;  20GS A;  3IHQ A;  2VCZ A;  4JE1 A;  4ZBA A;  4DSQ A;  4ICY A;  3HKR A;  2OA7 A;  3V1W A;  5F8B A;  2FWH A;  3ZYW A;  3TOU A;  5D93 A;  5IO2 A;  4EUY A;  3EPT A;  1ZOF A;  2PWJ A;  2XC2 A;  3D6I A;  3GHA A;  1O8W A;  2TIR A;  3IC8 A;  3ME8 A;  5F0G A;  3KMO A;  4GTU A;  4MAB A;  1U87 A;  4ZB8 A;  4ECB A;  2HRF A;  2YV9 A;  2GZP A;  4GF0 A;  2QA2 A;  3QMX A;  5DAL B;  2IN3 A;  2R5G A;  2WFC A;  4AJ6 A;  1MDI A;  4YAP A;  10GS A;  2HRN A;  1FAA A;  3WD6 A;  2EIR A;  6GSX A;  1FVK A;  1TU8 A;  1R5P A;  3TKS A;  3TJF A;  2A2S A;  3KEB A;  1DSB A;  2EIO A;  5A5K A;  1G0T A;  4TN8 A;  1SK1 A;  1JZR A;  3I69 A;  4V2M A;  3A2V A;  3ZIT A;  1AW9 A;  4MA9 A;  1A2M A;  1YY7 A;  1YDK A;  3IK7 A;  2DJ3 A;  4HQZ A;  5LD0 A;  1GP1 A;  4IQ1 A;  2IL3 A;  4WR4 A;  2FA4 A;  1Z6N A;  4NHW A;  5DQY A;  2YV7 A;  5DQS A;  4L0U A;  2YZH A;  5C00 A;  1KNG A;  1QMV A;  22GS A;  2YNX A;  2C80 A;  3LJR A;  4IP1 A;  4G19 A;  5JWQ B;  1AUC A;  2GT5 A;  2R37 A;  1Q98 A;  3ZZX A;  1MDJ A;  1Z9H A;  8GSS A;  5GAN D;  1XZO A;  1R26 A;  3IDV A;  2YPM A;  4EIP A;  3SBC A;  16GS A;  4WF5 A;  3C8E A;  1FB0 A;  1SEN A;  1T4Y A;  4TR0 A;  2QA1 A;  4AF2 A;  2H72 A;  3EE2 A;  1AIU A;  4POB A;  13GS A;  4OFN A;  2A4H A;  5KN0 A;  1LU4 A;  4BWS A;  3KTL A;  1PX6 A;  3QAV A;  3ED3 A;  3NIV A;  3ZIV A;  2YWN A;  3L4N A;  3TB2 A;  2LEG A;  5H5S A;  2CV4 A;  2DJ1 A;  1CQG A;  3F3Q A;  1JZW A;  3GKK A;  5HR0 A;  2JSY A;  2F8A A;  4IW9 A;  3DKS A;  3GIX A;  4GSS A;  1V58 A;  1OC9 A;  1K0A A;  4MZW A;  4O7H A;  2YJ7 A;  2GLR A;  2ON7 A;  3HDC A;  2R0P A;  3HA9 A;  5C04 A;  2PU9 C;  4YQM A;  3RDW A;  3ZIJ A;  5HR1 A;  2FWE A;  2GTU A;  3CSI A;  5DCH A;  3EMX A;  2KHP A;  4XTS A;  2RM5 A;  4E8E A;  5KN3 A;  2J9H A;  1OE8 A;  2DJK A;  1F37 A;  3GX0 A;  1TK8 B;  3TJK A;  1SYR A;  2RLI A;  1FW1 A;  1Q4J A;  1ERW A;  1VF3 A;  2H75 A;  1TK5 B;  4XS1 A;  1XWG A;  1ZMA A;  3GRX A;  3TUE A;  3UVT A;  1SKR B;  1QUW A;  1HYU A;  3ZTL A;  5CRG A;  1BAY A;  5D96 A;  4ECC A;  1T7P B;  2LTK A;  1KBN A;  4NXI A;  2LRN A;  2YWO A;  3H4K A;  1YQ1 A;  3QDN A;  1OYJ A;  2YCD A;  4DVC A;  1BED A;  1F2E A;  4MP4 A;  2GS3 A;  4FQU A;  1H4O A;  1OC9 B;  2NTO A;  4F82 A;  1U3A A;  1R5A A;  1E2Y A;  1O6J A;  2CAQ A;  3HJP A;  4D73 A;  2C4J A;  4WEY A;  4JBB A;  3GKX A;  4YH2 A;  1V40 A;  2FD3 A;  2LV3 A;  1NM3 A;  2C0F A;  3F4S A;  5J3R A;  1LBK A;  5F06 A;  3TCO A;  4FYU A;  3MNG A;  3C1R A;  2RUF A;  1M2A A;  1TRW A;  1X5E A;  4GQC A;  3ZVJ A;  2R4V A;  5EVO A;  3VPT A;  5ECR B;  5ECH B;  3HVV A;  1B9Y C;  4IHU A;  1GWC A;  4HU7 A;  2R3X A;  1XW5 A;  3L9S A;  4N11 A;  3IBH A;  2D2Z A;  3HVS A;  3NZN A;  3JCM L;  2O8V B;  2VM1 A;  2HXK A;  3DD3 A;  2LRT A;  1GSQ A;  5CYY A;  3TRP A;  4O5Q A;  2LST A;  3A3T A;  2AYT A;  4HZ4 A;  4FO5 A;  1R7H A;  4ZBD A;  1DE2 A;  1A8L A;  2VLU A;  3ZRE A;  3UAP A;  2P31 A;  4EO3 A;  3FZ5 A;  3D22 A;  2CT6 A;  4KX4 A;  3AY8 A;  4OD7 A;  3FMW A;  1M99 A;  3C71 A;  4GXZ A;  4HZ2 A;  4QQ7 A;  3ERF A;  4ZBB A;  4MDC A;  2GDR A;  5ECL B;  3W8J A;  2K6V A;  2LRC A;  3EWL A;  4D73 B;  2IIY A;  4POK A;  4F2I A;  3GKM A;  3TKR A;  5DAK A;  4ZL9 A;  2H71 A;  3EC3 A;  2YJH A;  4K5R A;  3IRA A;  3GX8 A;  4EXJ A;  2L5L A;  4OCE A;  1GUH A;  1AXD A;  2DIY A;  1T1V A;  3ZMK A;  1B4P A;  2V1M A;  3DML A;  4O92 A;  1SL1 B;  3N9J A;  1FVJ A;  3EU3 A;  3OR5 A;  5INY A;  5G30 A;  6GSV A;  2M46 A;  3PR8 A;  1WJK A;  3LW9 A;  1SK0 A;  3ERG A;  1PN9 A;  3DXB A;  1OAZ A;  2GZZ A;  1K3O A;  5E59 A;  3FZ4 A;  2MMZ A;  3APQ A;  2A2P A;  4Q5Q A;  12GS A;  4IBP A;  4I2U A;  4V2L A;  4CDO A;  3A5W A;  4XS4 A;  1X5D A;  1Y25 A;  2M80 A;  3P7X A;  4L0W A;  2OKA A;  2OE1 A;  4RQX A;  4HJM A;  3FK8 A;  4GRF A;  2FWG A;  1HNB A;  1NHO A;  2DSA A;  5EPF A;  3DWV A;  3KMN A;  19GS A;  4KW6 A;  3VI7 A;  3GYK A;  1UVZ A;  1XW6 A;  2H1D A;  3L9V A;  1EGR A;  5DAK B;  5D9W A;  1TOF A;  4OCF A;  1VF1 A;  4IJI A;  1GSE A;  1SKS B;  3M0F A;  1XWA A;  4WBR D;  4GWR A;  1S3A A;  4KF9 A;  3LFL A;  2AB6 A;  1SD9 A;  2L5O A;  3H93 A;  4IGJ A;  3CXG A;  3P90 A;  3WT2 A;  3QR6 A;  1K0C A;  2A2R A;  2DKI A;  5A4W A;  2VLV A;  1NHY A;  3ME7 A;  4AJ7 A;  1U3I A;  1ML6 A;  3U5R E;  4IJ3 A;  5HFK A;  7GSS A;  2JZR A;  5H5R A;  4KSM A;  2AUV A;  2X8G A;  2FWF A;  1YKC A;  4XS4 B;  3GL5 A;  2B5E A;  2NVL A;  2H0I A;  2CVB A;  3VWV A;  5ELG A;  1GTU A;  3KTB A;  1TRV A;  4EKZ A;  2GVP A;  2OBI A;  4OMV A;  2WS2 A;  4MF5 A;  1K0D A;  4ISD A;  5F05 A;  3D21 A;  1SJZ A;  2H6Z A;  2VIM A;  1TI1 A;  4GSN A;  1GUM A;  2IJY A;  5H5Q A;  4OO5 A;  4J2F A;  2OE0 A;  2VCW A;  2WJU A;  4ZIJ A;  1ZZY A;  4GQF A;  3I9V 2;  1M9A A;  2CQ9 A;  1GUK A;  3ZLP A;  3UL3 A;  3HJO A;  1B4Q A;  1XOA A;  2FUG 2;  2MMO A;  3HJM A;  1XOB A;  4KGI A;  2CVK A;  4KA0 A;  3VPQ A;  1F9M A;  2H1B A;  4X43 A;  2VCV A;  1O85 A;  5DAL A;  3DVX A;  4BA7 A;  1ABA A;  3VLN A;  5IMV A;  4N30 A;  3DVW A;  3RHC A;  2OBK A;  2V41 A;  4X0X A;  2AAW A;  1MDK A;  2Z9S A;  3FKF A;  3HCZ A;  1FOH A;  4J57 E;  3W6G A;  2YWI A;  4F0B A;  3LXZ A;  1I9D A;  3NOF A;  3TRQ A;  5GAP D;  2KLX A;  3SWL A;  2O87 A;  4MCU A;  2I1U A;  2KOK A;  3O3T A;  5JCU A;  1W4V A;  2FGX A;  2HFD A;  2KP2 A;  2JL4 A;  1TKD B;  5J9C A;  1WE0 A;  2HT9 A;  3M3M A;  3MDK A;  3LQ7 A;  4AGS A;  4L5L A;  1THO A;  5IOX A;  3WGD A;  4FYB A;  3QAW A;  1ZYQ B;  4OFT A;  1BG5 A;  1PQN A;  1PMT A;  1QFN A;  3DGQ A;  4PNF A;  6GSW A;  5LNK e;  2L57 A;  2N5A A;  2X8H A;  4GCI A;  3S9F A;  1XWB A;  2GQL A;  1VF2 A;  3HY2 A;  4P3Y B;  4WF4 A;  5IMA A;  2GGT A;  2O7K A;  3GA4 A;  2QKE A;  2R0G A;  1G7O A;  4PNG A;  2O89 A;  4POL A;  4V1A g;  2VAF A;  5IM9 A;  3ZML A;  4ID0 A;  4KCA A;  1GSD A;  4ZB6 A;  2JAD A;  4I6X A;  5KN1 A;  4POM A;  4G0L A;  1OE7 A;  1UN2 A;  3TJJ A;  1XCC A;  1EEJ A;  3QD9 A;  2IMD A;  1BX9 A;  4IN0 A;  5ELA A;  2ZNM A;  1JZO A;  5DJM A;  3HZ4 A;  3KJY A;  2QGV A;  1GSU A;  1T3B A;  3EYT A;  1ZYN A;  2VD0 A;  1EV9 A;  1TJD A;  2M72 A;  1PRX A;  5DBQ A;  1JLV A;  3KP8 A;  2NBS A;  2HI7 A;  1N8J A;  5FHI A;  3TRX A;  1YKA A;  1OVN A;  4HI7 A;  3WGE A;  3GV1 A;  1X0R A;  1SK2 A;  2TRC P;  4TRX A;  2LUS A;  5EY6 A;  1SU9 A;  3A2W A;  1X9S B;  4ML1 A;  5A4U A;  4NHZ A;  2G2Q A;  2AHE A;  3KH9 A;  4HEA 2;  1A2J A;  2FCH A;  3F6D A;  1TW9 A;  1QK8 A;  2PPT A;  2H1G A;  2HRK A;  2MBT A;  5ECQ B;  4K7O A;  4XRA A;  4NMU A;  3ZFB A;  3LWA A;  5GZZ B;  3H8Q A;  2HYX A;  4DEJ A;  3QFB C;  4K2D A;  1K0N A;  4ECJ A;  1ERU A;  2P5R A;  1J0F A;  4YQV A;  1JLW A;  1JFU A;  4RUV A;  1M2D A;  1UC7 A;  4XS6 A;  5IO0 A;  3GMF A;  4E8H A;  4CHS A;  2VL2 A;  5IIZ A;  3HXS A;  1O81 A;  4CW9 A;  1GLP A;  5IMD A;  3MSZ A;  1GTA A;  2C0G A;  5COH A;  4WKW A;  1IYI A;  1AC1 A;  4F9Z A;  1S3D A;  5CAX A;  2V6O A;  14GS A;  2I3Y A;  3E0U A;  3MIX A;  1K3L A;  3LYP A;  4MJB A;  3L9U A;  1GSS A;  5IPG A;  1ZCP A;  4HS1 A;  2XHF A;  4I5Q A;  1DUG A;  3LGC A;  5D8I A;  4G9H A;  4ACS A;  2FNO A;  3C1S A;  3TKP A;  3PIN A;  4Q5N A;  4I8B A;  2G0F A;  4Z2U A;  4NWY A;  1F6M C;  3CSH A;  1URM A;  3QOU A;  3BCK A;  3HD5 A;  4TR3 A;  4RQR A;  5DCG A;  2MZC A;  5ECN B;  1F3B A;  3L78 A;  1DBY A;  3G7Y A;  3KP9 A;  3F4T A;  3KGK A;  2H0H A;  3IA1 A;  1Z6M A;  4EDY A;  2B7K A;  2OJL A;  4ZIL A;  4I2T A;  2B1L A;  3US3 A;  1TU7 A;  1YEX A;  2I4A A;  2VUP A;  2CVD A;  3GSS A;  4JR6 A;  3QPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...