5C04A

Crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
153
Chain Sequence
SMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFHPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peroxiredoxin MT2298
publication title The active site architecture in peroxiredoxins: a case study on Mycobacterium tuberculosis AhpE.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 54
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5c04A00
5G1LA 3ERGA 2VCXA 3APSA 1PN9A 5G1KA 1JLVA 1YF0A 4POKA 4EXJA 4FYCA 1IYHA 3AY8A 4GSSA 1THXA 1MDIA 6GSWA 1XCCA 1TKDB 2HRNA 1FHEA 1AQXA 1VF1A 1HQOA 4GSNA 2P5RA 2VL3A 1XW6A 3IK7A 1EP7A 1J9BA 3KM6A 5EL8A 2B5XA 1K0DA 3W6GA 3DGQA 2DIZA 2PU9C 5DALB 4TR1B 1ZGNA 4KW6A 2LJAA 4WXTA 5KN1A 4K0GA 4F82A 2CA8A 2LQQA 4WR5A 5D73A 4NV5A 2C0EA 2YV9A 1FVJA 4OCEA 4XCSA 2GS3A 4MH3A 2R37A 3ZIJA 4YQMA 1DE2A 2MMNA 1MEKA 3IR4A 4WETA 1T7PB 3WGEA 2B5YA 4HQSA 1YDKA 1AIUA 5DQYA 2P0GA 4LL1B 1OE8A 3APQA 6GSSA 1TDIA 3U5RE 3TDGA 1PKWA 2DSAA 4MJCA 1Y6EA 2ON5A 1SK1A 1AW9A 1H4OA 3HXSA 2LKUA 2FUG2 2HNLA 1XOAA 1WPIA 2MYGA 3DVWA 1FVKA 5G2ZA 4ZILA 1A23A 3HZ4A 5DJMA 2YWNA 5GAPD 4KSOA 1GSEA 1T4YA 3IAS2 4ZBDA 2H6YA 4XS6A 3LXTA 3A5WA 5HFKA 2H71A 1ZYQB 1OE7A 4NV2A 5IO2A 2OE3A 4OFTA 4OO5A 1A8YA 1EWXA 1W89A 2VLTA 3TB2A 5CAXA 1EGOA 4KA0A 2H75A 4HDEA 1JZRA 3ZL5A 3KMOA 1R7HA 2N5FA 1ZCPA 2YJ7A 4F03A 5HFGA 2KHPA 2LNTA 3KCMA 1T4ZA 2LRCA 3H79A 5EPFA 2FCHA 2C0DA 3TKQA 3TJFA 2IMIA 1JHBA 4GTUA 1SYRA 1TRUA 3GSTA 2DJKA 1TU8A 3F3RA 5FWGA 3C1SA 4MJEA 1PSQA 5CYYA 4BA7A 2GSRA 1HNBA 1MD3A 3L9SA 4EE0A 4RUVA 5DALA 5IPHA 4I8BA 2GLRA 4H86A 1WE0A 3F4TA 2DJ3A 1UC7A 3M8NA 5G31A 2YCDA 3E0UA 5D9VA 4KE3A 3J7Yk 1BYEA 4BVXA 1GSDA 5HFIA 3A2XA 3DIEA 1DSBA 3FZ9A 1K0OA 3HA9A 3UEMA 1HNCA 5ECLB 1F6MC 2I4AA 5H5SA 3V1WA 3ISOA 2H66A 17GSA 4FYUA 4BL7A 6GSVA 1SU9A 4PUFC 2F3MA 2FA8A 3HVVA 2X8CA 2D2ZA 3GL3A 4AGSA 4WEYA 2LS5A 1GULA 3RPPA 2GVPA 1Q98A 4ZIJA 1HD2A 5LCZA 3GN3A 5B6NA 1SENA 1M2BA 3ERFA 3TKSC 1WP0A 3ZLPA 2C80A 2B1KA 4K1FA 2ALBA 1G6YA 2X64A 3GX8A 2B6MA 2ES7A 2H6ZA 1MDJA 2LSTA 2R6KA 5COHA 5G30A 1PRXA 1TK5B 3ZFLA 4V2LA 2YJHA 1GSFA 2Z9SA 1M9BA 4XRDA 4ZB6A 1E6BA 1N8JA 1GRXA 5B6MA 4DSSA 2VM1A 3EYTA 4LLRA 1OC9B 4MPFA 4ECJA 2MZCA 4LL4B 5HQPA 2AV4A 2NTOA 4HI7A 5B8BA 4EC0A 2HZEA 5CRDA 1PX7A 2GSTA 3L9UA 1BJXA 3HD5A 5ABRA 4I5QA 5ECKB 1QK8A 2M46A 3BD2A 3EMPA 1ZZYA 4YH2A 4AJ7A 1U6TA 1PL1A 5GAND 3VFIA 2BTOT 2KOKA 2YV7A 2CX4A 4OO4A 1J0FA 7GSSA 1SKSB 5JWQB 4X0XA 2JZTA 4NMUA 3EMXA 3RHBA 1VRSD 5F06A 1BAYA 1KTEA 4TKYA 4F0BA 3CSJA 3QPMA 5DCHA 1HYUA 5FT3A 2RUFA 1V58A 4BWSA 3IA1A 1HNAA 1JZOA 1DE1A 1KBNA 5ECOB 2WS2A 3DRNA 2GGTA 4ML6A 3IE3A 4MF7A 3ZRDA 9GSSA 3EWLA 3F3QA 5KN3A 1Z9HA 3BCIA 4L0UA 5EY6A 4HZ4A 1OAZA 1VF4A 3MNGA 1EEJA 2J23A 3LG6A 4BPYA 2DJJA 1SL0B 1WWJA 2H8LA 2X8HA 4POMA 2R5GA 2I1UA 2C3QA 4JBBA 4RI7A 4X1UA 3F4SA 4HJMA 5JCUA 4AJ8A 2AB6A 1THOA 2K18A 2GZZA 1MDKA 3M9JA 2B5EA 3ZVJA 2AUVA 1V40A 2AAWA 3FZAA 1K3YA 4HOJA 4EUYA 1Q4JA 2PMTA 14GSA 3GA4A 3GRXA 2LJKA 3LYKA 3GNJA 2VAFA 1K3LA 2X8GA 3ERWA 4N0ZA 4FIWA 2V6KA 1QFNA 4ACSA 5IPGA 4F2IA 3KP9A 4O92A 3WGDA 3O3TA 1PGTA 3GMFA 2YOIA 2G2QA 2K8VA 2DIYA 2I81A 1U87A 4MDCA 3UBKA 2YWOA 4OFMA 22GSA 1BEDA 1G6WA 1TXXA 1T1VA 2LUSA 2FHEA 8GSSA 1NHOA 1SD9A 1B4QA 1OC9A 3O6TA 2VL9A 1FB6A 1JZWA 2MMZA 4YAPA 1TK0B 4IN0A 2IMFA 1YF1A 2H19A 1H75A 3VWVA 4RQXA 2K9FA 5IMDA 1F3AA 3LXZA 3IK9A 4J56E 1T3BA 3KMNA 2C4JA 1Z3EA 2P31A 4N30A 2WJUA 2X99A 4PXOA 3UL3A 1VF3A 4XS4B 2K8SA 4O7HA 3FW2A 2BMXA 5DAKA 4GSTA 3TKRA 4L8EA 1RQMA 1URMA 2FA4A 4L5LA 4QL7A 4OCFA 3JCML 2O89A 5JWRB 1OC8A 4AJ6A 5ELGA 3GSSA 13GSA 2DMMA 1G0TA 5ECMB 1BQ7A 4HQZA 3DMLA 4I6XA 4PQIA 4RI6A 2R4VA 3LFLA 3TOTA 4FH8A 2WZ9A 3HKRA 1FG4A 2IFQA 4ML1A 4YAVA 2KP1A 3A3TA 4PNFA 2H74A 4N10A 3G9BA 4PX1A 2RIIA 2MBTA 16GSA 1TOFA 2H1AA 1NHYA 2M80A 5J4UA 3K8NA 1M2DA 1V98A 2DJ0A 4DSRA 4AF2A 1YEXA 4OD7A 4N11A 1TI3A 4ZL9A 1K0BA 3LGCA 1ILOA 1E2YA 2XPEA 2HRFA 4WKWA 1FO5A 3KH7A 2FWHA 5D9XA 3ZMKA 2M72A 1USBA 3GKKA 3I43A 1GSSA 2HSHA 4GQCA 3P90A 18GSA 2V6OA 3CMIA 5B8AA 1B9YC 4WF4A 5J5NA 2F9SA 2PVQA 2QKEA 1I5GA 3F6DA 1OC3A 3GIXA 2CAIA 2QGVA 5A4VA 4PQ1A 1FOVA 1B8XA 1TW9A 4E8EA 1U88A 1EEMA 5GZZB 2KP2A 1GLPA 3WT2A 4K7IA 3G7JA 2L59A 4TR4A 4PNGA 5CRHA 2HT9A 4IP1A 3TJGA 1XW5A 5IM9A 2RM5A 4IKHA 4K9ZA 3HZ8A 3D21A 3KJYA 2JU5A 5ECHB 3GYKA 4TOPA 2DJ1A 3GTUA 1T8EB 1DUGA 2IMKA 2C8UA 4IGJA 2FLSA 1ERTA 3BBYA 2HE3A 4ZBBA 4ID0A 1F9MA 1U3AA 1TI1A 4EO3A 3W8JA 2OJLA 4DSSB 2O8VB 2VL2C 2XC2A 2A2SA 4XS4A 4TR0A 3TKSE 2DLXA 1ST9A 3DXBA 3E9JB 5IMCA 3KD0A 2HXKA 3CXGA 5D93A 3P8WA 3KGKA 1FB0A 3D4MA 4CHSA 3QMXA 4V2NA 2C0GA 3KTBA 2HZEB 3QAWA 5G5EA 4TXOA 3RBTA 2YP6A 4KCAA 4K7OA 4K0NA 1AC1A 2E0QA 5FHIA 1ZL9A 1A0FA 4KB3A 5JWOB 2L5OA 19GSA 3HJPA 1XOBA 3GL5A 3OR5A 2VO4A 5AGYA 1O81A 2R2JA 5HR0A 3ZVJD 5IMAA 2VCTA 5DDLA 4IJ3A 4MF6A 2HZFA 2VCQA 3FY7A 5L71A 3BJ5A 3HJMA 5E4WA 5A5KA 2LTKA 3TUEA 1SKRB 3Q18A 1O85A 2F51A 2V32A 3QR6A 2OADA 3RDWA 3GKXA 3Q6OA 2H0HA 4XHMA 4FYBA 5C04A 5D8IA 4IP6A 4POBA 1GNWA 3GUSA 2HLSA 2IIYA 4DSQA 2GQKA 4IQAA 3KH9A 4EVMA 1ERVA 5ECNB 2OBIA 1R5PA 5ECQB 3BOAA 1AQVA 1GUMA 2H6XA 3CTFA 4DVCA 4KDUA 2REMA 1M2AA 3WT1A 2CAQA 2YZUA 4TN8A 5DQSA 1WMJA 3QCPA 4PGTA 3KP8A 4OMVA 3F6FA 5F05A 2FD3A 1WRYA 4K8MA 2PBJA 4TW5A 4KGIA 1AAZA 3VPQA 2DBCA 4D73A 1PL2A 1X5CA 1GP1A 3G7IA 4MP4A 2E2GA 3EC3A 4ECCA 3EURA 1U3IA 2I3YA 3M3MA 4ZL7A 4WR4A 4CW9A 3MAKA 4KUNA 3ZZXA 1XIYA 1ZYEA 2CZ2A 4GWRA 4HS1A 20GSA 5ENUA 2TRCP 4F0CA 1B4PA 2E2MA 5AIXA 2BJXA 4WBRD 1WIKA 1F2EA 1RW1A 4O5RA 1GTBA 1FW1A 1XVWA 3DWVA 4HJ2A 1O6JA 5IMVA 2AHEA 3CSHA 3ZREA 4HUAA 3KXOA 1Z7PA 6GSXA 2H73A 3CYNA 2R3XA 4V1Ap 3N5OA 2LRNA 2YPMA 3D0ZA 5DCGA 4NHZA 2VD1A 1QXHA 1XWAA 4J2FA 5AISA 5EVOA 3VI5A 4G9HA 3LEFA 1EV9A 3EINA 4G10A 2JACA 2L5LA 3BCKA 3MSZA 4K6XA 1O8XA 4MPGA 4NAXA 3F8UA 3IRAA 3F9UA 5DAKB 4YQUA 2ZUPA 1V57A 1YZXA 1O8WA 3VWXA 4GXZA 1C72A 1G7OA 1Z7RA 5HR3A 6GSTA 11GSA 4MABA 3D4TA 1XWKA 5DBQA 5LD0A 2GT6A 1YKAA 2WULA 3CSIA 4J57E 4KNDA 2XBIA 3EU4A 1PMTA 2ZNMA 1K0AA 1K0NA 2A2RA 3CBUA 3G7YA 4WF5A 2C0FA 2PPTA 2C1YA 4MK3A 1XFLA 5J9BA 2MMOA 3VK9A 4JEDA 1PQNA 3PINA 1NSWA 1PKZA 3TKPA 2LJRA 1XZOA 4IVFA 2IFQB 1GTAA 3W8SA 4EF0A 1TK8B 4FO5A 3CRTA 5J41A 3H93A 5CRWA 2PVOC 1R5AA 2GSQA 2IPAA 3LJRA 2IMEA 1QMVA 3UOMA 1GH2A 3HYPA 4NWYA 1Z5YE 3GKMA 1XPVA 3P2AA 1XBSA 1EOHA 4K2DA 4NPBA 2F8AA 1K3OA 1OKTA 5G5FA 4L5OA 3O76A 3GFKA 5B7CA 1AUCA 4KH7A 3GURA 2XHFA 1UN2A 3ZIVA 2L57A 4ZB8A 2VCVA 4ECBA 2A4VA 4MJAA 3TOUA 4KCEA 3ZYWA 1SYXA 1X0RA 3VWUA 4V2MA 2CVBA 4DEJA 2VUPA 4LMVA 2LQOA 1ML6A 4LA1A 3FYGA 1AXDA 4KSMA 3FR6A 2CVKA 1I9DA 1CQHA 2GDRA 2HYXA 2FY6A 2H1GA 2WFCA 2PWJA 2V2GA 4GRFA 6GSUA 3R2QA 3FR9A 4GCIA 3D22A 1SD8A 4JE1A 3H8QA 2V1MA 1GSUA 3GTUB 1A2MA 2CX3A 1JZDA 2GTUA 3DYRA 4HZ2A 1PA3A 3ME8A 4XS1A 3SWLA 2KUCA 2YWIA 2GZYA 2WDUA 3GH9A 4RQRA 3FEUA 2YN1A 2GT5A 2B1LA 2OKAA 10GSA 2IJYA 3PR8A 3S9FA 3US3A 4TXOB 6GSYA 3I9V2 3IV4A 2VM2A 1X9MB 3TJJA 2O7KA 4MZCA 1EP8A 1V9WA 3TGZA 3QOUA 2O85A 4G19A 3APOA 3IPZA 4GQFA 1JFUA 2GQLA 5F8BA 4JR6A 3IBHA 1KNGA 1J08A 4WBJA 3C7MA 2VL2A 2GSSA 3L9VA 2VIMA 3PGTA 1BG5A 3TJKA 1WJKA 1AQWA 4KAEA 2C3NA 3HVXA 2L4QA 1VF2A 3LWAA 2KLXA 3VPTA 3GKNA 1VGLA 1SJ6A 1X9SB 3F63A 4OWYA 3C1RA 3KEBA 3KTLA 4TR3A 3ZTLA 1A8LA 3UVHA 1SK2A 2WGRA 1GLQA 1QUWA 1X5EA 3LYPA 5KEJA 3LSZA 2AJQB 1XWCA 2GZPA 4K7NA 3ZITA 2VCWA 5A4WA 4EKZA 3GHAA 2DC5A 1Z6NA 1A24A 1V2AA 3QDNA 5CREA 1TP9A 3D6IA 3NIVA 4EDYA 2CV4A 2O87A 4KDXA 4MF5A 4NHWA 2N5AA 5HR2A 5J3RA 3HDCA 3WGXA 4GF0A 3A2VA 4ZBAA 4GLTA 3QAGA 5ECPB 4ZB9A 2HSYA 3J7Yb 1ABAA 1YJ6A 3IHQA 2FWEA 2C3TA 2IWTA 5GSTA 1B9XC 2VCZA 4TXVA 4MZWA 3EU3A 3C73A 3E3EA 2LRTA 2N5BA 1TRSA 4PQHA 2H0GA 4HEA2 2NDOA 2XPDA 4D73B 5ECSA 3ZFBA 1IYIA 4PUAA 2JZSA 4E8HA 4QL9A 4XTSA 1SK0A 3RHCA 1R26A 3LORA 2LEGA 5IOXA 2FWGA 3HVSA 1OYJA 3NOFA 1XW9A 1M7TA 3VWWA 4I97A 3NZNA 1G7EA 3EVIA 3TKSA 2FGXA 3QD9A 2JSZA 4X43A 2VLVA 3HJOA 1LBKA 5F0GA 3UARA 2LNSA 2K6VA 1TU7A 4ILFA 4KX4A 1S3DA 1T00A 2H1BA 2WRTA 2NVLA 4Z7XA 4TRXA 4IQ1A 1PD21 1TTZA 4MMMA 5F07A 4JR4A 4LMWA 1K0MA 2EIOA 2H72A 5H5QA 5AN1A 2RUEA 3U6VA 1RK4A 5KN0A 3DEXA 3L0HA 3MDKA 1LJRA 1GWCA 3ME7A 4Q5QA 2L6DA 3UAPA 2B7KA 3HCZA 3IDVA 3P7XA 3FZ5A 1NW2A 4JRRA 4MA9A 1SKWB 4IW9A 2LV3A 2AYTA 1CQGA 2PGTA 4KDYA 4IJIA 4BVYA 3FR3A 5D96A 2G0FA 3IAM2 3L78A 2QSIA 2VLUA 4TR1A 2EIRA 3GH6A 2YWMA 3TJBA 2WB9A 1SJIA 3L4NA 2HFDA 4P3YB 2OE0A 5ECIB 3HHVA 4Q5RA 5C00A 1XWBA 3DKSA 3WD6A 1KEBA 1Z6MA 4CDOA 1FAAA 2YZHA 1WOUA 2NPBA 4NXIA 5ECRB 5IMFA 3FKFA 2OE1A 2ZCTA 5IIZA 2XBQA 4G2EA 5IO0A 2PUKC 4OFNA 3A2WA 2H01A 1EGRA 2MMAA 2JSYA 1YY7A 1GTIA 1LU4A 2DJ2A 3MWHA 4TVEA 1R4WA 2OACA 1JLWA 1X5DA 4F9ZA 3TRPA 3UMAA 2FNOA 1GUHA 3H1NA 2CQ9A 5INYA 5A4UA 1BX9A 4MCUA 5HR1A 1M9AA 1SJZA 1S3CA 4HU9A 2WCIA 3CTGA 2NBSA 3QFBC 4EL1A 3C71A 1ERWA 1O73A 4V1Ag 3D5JA 2RM6A 3GX0A 5ID2B 2RLIA 4MZBA 1QGVA 5KN2A 2FWFA 3QAVA 5H5RA 1GUKA 3GV1A 2IMDA 2OA7A 3CRUA 3FHKA 5CRGA 3M0FA 2PERA 3UIWA 1MTCA 3UBLA 4MH2A 1M0UA 3TCOA 5IOWA 5D9WA 1TRVA 4ULXA 4ECIA 1W4VA 3F4RA 3VURA 2J9HA 2EC4A 2QC7A 4L0WA 3DD3A 1Y25A 5GSSA 2OBKA 4MLYA 2L6CA 3VLNA 1GSQA 2TRXA 1A2LA 4Q5NA 4XRAA 2VOCA 4ZL8A 5JCWA 1YEPA 5IMZA 1OVNA 4IELA 1UA5A 2IN3A 3IOSA 2P5QA 1OKDA 2F8FA 1GNEA 3VI7A 5E59A 4YQVA 1S3AA 4XIHA 1N2AA 5CNWA 3I6AA 5JCGA 4I2TA 3DVXA 1A0RP 2MBSA 2YNXA 5LNKe 1K0CA 4QQ7A 2CT6A 1ACVA 2GQMA 4MJBA 2L4CA 3SBCA 1F37A 1XWGA 4IHUA 2YANA 4IBPA 1ZOFA 1TRWA 1ERUA 1XVQA 4BWQA 3TRQA 3Q19A 2DMLA 3KIJA 2B3SA 1F3BA 2IL3A 3C8EA 2H70A 3TRXA 1GL8A 3IC4A 2H1DA 4IS0A 2H0IA 2B7JA 5J9CA 1TJDA 1X9WB 3M1GA 2TIRA 3I69A 3ED3A 3PH9A 1DBYA 1MD4A 2HI7A 3LQ7A 3EE2A 1GTUA 3HY2A 5IQYA 1SL2B 2H30A 2JL4A 3RPNA 4O32A 2H76A 5AIVA 1PX6A 4HU7A 1SL1B 1O7UA 3H4KA 4Q5FA 2JADA 3UJ1A 5CP1A 3RAZA 2EIQA 12GSA 1UVZA 1YQ1A 5ID2A 3IXRA 1NM3A 3FRCA 4N0VA 3ZMLA 3F0IA 5ELAA 4I2UA 2ON7A 2CVDA 3FK8A 2V41A 3N9JA 1XXUA 1ZMAA 4ZXGA 4EDZA 3WYWA 2VD0A 3FZ4A 3KZQA 1EV4A 5CO3A 3M9KA 2CZ3A 2PN8A 1M99A 1QQ2A 2I9HA 3Q74A 1ON4A 5DJLA 4POLA 1GSYA 2E7PA 2JZRA 1A2JA 4ISDA 1EZKA 5D9TA 3UVTA 3QFAC 4JZQA 1EOGA 4PURA 1YKCA 4JU5A 5DVBA 1B48A
chains in the Genus database with same CATH superfamily
5G1LA 3ERGA 2VCXA 3APSA 1PN9A 5G1KA 2R0CA 1JLVA 1YF0A 4POKA 4EXJA 4FYCA 1IYHA 3CQFA 3AY8A 4GSSA 1THXA 1MDIA 6GSWA 1XCCA 1TKDB 2HRNA 1FHEA 1AQXA 1VF1A 1HQOA 4GSNA 2P5RA 2VL3A 1XW6A 3IK7A 1EP7A 1J9BA 3KM6A 5EL8A 2B5XA 1K0DA 3W6GA 4BVYB 4YKGA 3DGQA 2DIZA 2PU9C 5DALB 4TR1B 1ZGNA 4KW6A 2LJAA 4WXTA 5KN1A 4K0GA 4F82A 2CA8A 2LQQA 4WR5A 5D73A 4NV5A 2C0EA 2YV9A 1FVJA 4OCEA 4XCSA 2GS3A 4MH3A 2R37A 3ZIJA 4YQMA 1DE2A 2MMNA 1MEKA 3IR4A 3A5IA 4WETA 1T7PB 3WGEA 2B5YA 4HQSA 1YDKA 1AIUA 5DQYA 5BMUA 2P0GA 4LL1B 1OE8A 3APQA 6GSSA 1TDIA 3U5RE 3TDGA 1PKWA 2DSAA 4MJCA 1Y6EA 2ON5A 1SK1A 1AW9A 1H4OA 3HXSA 2LKUA 2FUG2 2HNLA 1XOAA 1WPIA 2MYGA 3DVWA 1FVKA 5G2ZA 4ZILA 1A23A 3HZ4A 5DJMA 2YWNA 5GAPD 4KSOA 1GSEA 1T4YA 3IAS2 4ZBDA 2H6YA 4XS6A 3LXTA 3A5WA 5HFKA 2H71A 1ZYQB 1OE7A 4NV2A 5IO2A 2OE3A 4OFTA 4OO5A 1A8YA 1EWXA 1W89A 2VLTA 3TB2A 5CAXA 1EGOA 4KA0A 2H75A 4HDEA 1JZRA 3ZL5A 3KMOA 1R7HA 2N5FA 1ZCPA 2YJ7A 4F03A 5HFGA 2KHPA 2LNTA 3KCMA 1T4ZA 2LRCA 2UZ8A 3H79A 5EPFA 2FCHA 2C0DA 3TKQA 3TJFA 2IMIA 1JHBA 4GTUA 1SYRA 1TRUA 3GSTA 2DJKA 1TU8A 3F3RA 5FWGA 3C1SA 4MJEA 1PSQA 5CYYA 4BA7A 2GSRA 1HNBA 1MD3A 3L9SA 4EE0A 4RUVA 5DALA 5IPHA 4I8BA 4X4JA 2GLRA 4H86A 1WE0A 3F4TA 2DJ3A 1UC7A 3M8NA 5G31A 2YCDA 3E0UA 5D9VA 4KE3A 3J7Yk 1BYEA 4BVXA 1GSDA 5HFIA 3A2XA 3DIEA 1DSBA 3FZ9A 1K0OA 3HA9A 3UEMA 1HNCA 5ECLB 1F6MC 2I4AA 5H5SA 3V1WA 3ISOA 2H66A 17GSA 4FYUA 4BL7A 6GSVA 1SU9A 4PUFC 2F3MA 2FA8A 3HVVA 2X8CA 2D2ZA 3GL3A 2R0PA 4O5QA 4AGSA 4WEYA 2LS5A 1GULA 3RPPA 2GVPA 1Q98A 4ZIJA 1HD2A 5LCZA 3GN3A 5B6NA 1SENA 1M2BA 3ERFA 3TKSC 1WP0A 3ZLPA 2C80A 2B1KA 4K1FA 2ALBA 1G6YA 2X64A 3GX8A 2B6MA 2QA1A 2ES7A 2H6ZA 1MDJA 2LSTA 2R6KA 5COHA 1FOHA 5G30A 1PRXA 1TK5B 3ZFLA 4V2LA 2YJHA 1GSFA 2Z9SA 1M9BA 4XRDA 4ZB6A 1E6BA 1N8JA 1GRXA 5B6MA 4DSSA 2VM1A 3EYTA 4LLRA 1OC9B 4MPFA 4ECJA 2MZCA 4LL4B 5HQPA 2AV4A 2NTOA 4HI7A 5B8BA 4EC0A 2HZEA 5CRDA 1PX7A 2GSTA 3L9UA 1BJXA 3HD5A 5ABRA 1XG8A 4I5QA 5ECKB 1QK8A 2M46A 3BD2A 3EMPA 1ZZYA 4YH2A 4AJ7A 1U6TA 1PL1A 5GAND 3VFIA 2BTOT 2KOKA 2YV7A 2CX4A 4OO4A 1J0FA 7GSSA 1SKSB 5JWQB 4X0XA 2JZTA 4NMUA 3EMXA 3RHBA 1VRSD 5F06A 1BAYA 1KTEA 4TKYA 4F0BA 3CSJA 3QPMA 5DCHA 1HYUA 5FT3A 2RUFA 1V58A 4BWSA 3IA1A 1HNAA 1JZOA 1DE1A 1KBNA 5ECOB 2WS2A 3DRNA 2GGTA 4ML6A 3IE3A 4MF7A 3ZRDA 9GSSA 3EWLA 3F3QA 5KN3A 1Z9HA 3BCIA 4L0UA 5EY6A 4HZ4A 1OAZA 4CY8A 1VF4A 3MNGA 1EEJA 2J23A 3LG6A 4BPYA 2DJJA 1SL0B 1WWJA 2H8LA 2X8HA 4POMA 2R5GA 2I1UA 2C3QA 4JBBA 4RI7A 4X1UA 3F4SA 4HJMA 5JCUA 4AJ8A 2AB6A 1THOA 2K18A 2GZZA 1MDKA 3M9JA 2B5EA 3ZVJA 2AUVA 1V40A 2AAWA 3FZAA 1K3YA 4HOJA 4EUYA 1Q4JA 2PMTA 14GSA 3GA4A 3GRXA 2LJKA 3LYKA 3GNJA 2VAFA 4A5PA 1K3LA 2X8GA 3ERWA 4N0ZA 4FIWA 2V6KA 1QFNA 4ACSA 4G0KA 5IPGA 4F2IA 3KP9A 4O92A 3WGDA 3O3TA 1PGTA 3GMFA 2YOIA 2G2QA 2K8VA 2DIYA 2I81A 1U87A 4MDCA 3UBKA 2YWOA 4OFMA 22GSA 1BEDA 1G6WA 1TXXA 1T1VA 2LUSA 2FHEA 8GSSA 1NHOA 1SD9A 1B4QA 1OC9A 3O6TA 2VL9A 1FB6A 1JZWA 2MMZA 4YAPA 1TK0B 4IN0A 2IMFA 1YF1A 2H19A 1H75A 4MNNA 4CY6A 3VWVA 4RQXA 2K9FA 5IMDA 1F3AA 3LXZA 3IK9A 4J56E 1T3BA 3KMNA 2C4JA 1Z3EA 2P31A 4N30A 2WJUA 2X99A 4PXOA 3UL3A 1VF3A 4XS4B 2K8SA 4O7HA 3FW2A 2BMXA 5DAKA 4GSTA 3TKRA 4O5UA 4L8EA 1RQMA 1URMA 2FA4A 4L5LA 4QL7A 4OCFA 3JCML 2O89A 3IHGA 5JWRB 1OC8A 4AJ6A 5ELGA 3GSSA 13GSA 2DMMA 1G0TA 5ECMB 1BQ7A 4HQZA 2HSMA 3DMLA 4I6XA 4PQIA 4RI6A 2R4VA 3LFLA 3TOTA 4FH8A 2WZ9A 3HKRA 1FG4A 2IFQA 4ML1A 4YAVA 2KP1A 3A3TA 4PNFA 2H74A 4N10A 3G9BA 4PX1A 2RIIA 3R3EA 2MBTA 16GSA 1TOFA 2H1AA 1NHYA 2M80A 5J4UA 3K8NA 1M2DA 1V98A 4BVXB 2DJ0A 4DSRA 4AF2A 1YEXA 4OD7A 4N11A 1TI3A 4ZL9A 1K0BA 3LGCA 1ILOA 1E2YA 2XPEA 2HRFA 4WKWA 1FO5A 3KH7A 2FWHA 5D9XA 3ZMKA 2M72A 1USBA 4BL7B 3GKKA 3I43A 1GSSA 2HSHA 4GQCA 3P90A 5KOXA 18GSA 2V6OA 3CMIA 5B8AA 1B9YC 4WF4A 5J5NA 2F9SA 2PVQA 2QKEA 1I5GA 3F6DA 1OC3A 3GIXA 2CAIA 2QGVA 5A4VA 4PQ1A 1M3IA 1FOVA 4Z2UA 1B8XA 1TW9A 4E8EA 1U88A 1EEMA 3IC8A 5GZZB 2KP2A 1GLPA 3WT2A 4K7IA 3G7JA 2L59A 4TR4A 4PNGA 5CRHA 2HT9A 4IP1A 3TJGA 1XW5A 5IM9A 2RM5A 4IKHA 3MYDA 4K9ZA 3HZ8A 3D21A 3KJYA 2JU5A 5ECHB 3GYKA 4HSCX 4TOPA 2DJ1A 3GTUA 1T8EB 1DUGA 2IMKA 2C8UA 4IGJA 2FLSA 1ERTA 3BBYA 2HE3A 4ZBBA 4ID0A 1F9MA 1U3AA 1TI1A 4EO3A 3W8JA 2OJLA 4DSSB 2O8VB 2VL2C 2XC2A 2A2SA 4XS4A 4TR0A 3TKSE 2DLXA 1ST9A 3DXBA 3E9JB 5IMCA 3KD0A 2HXKA 3CXGA 5D93A 3P8WA 3KGKA 1FB0A 3D4MA 4CHSA 3QMXA 4V2NA 2C0GA 3KTBA 2X49A 2HZEB 3QAWA 5G5EA 4TXOA 3RBTA 2YP6A 4KCAA 4K7OA 4K0NA 1AC1A 2E0QA 5FHIA 1ZL9A 1A0FA 4KB3A 5JWOB 2L5OA 19GSA 3HJPA 1XOBA 3GL5A 3OR5A 2VO4A 5AGYA 1O81A 2R2JA 5HR0A 3ZVJD 5IMAA 2VCTA 5DDLA 4IJ3A 4MF6A 2HZFA 2VCQA 3FY7A 1PN0A 5L71A 3BJ5A 3HJMA 5E4WA 5A5KA 2LTKA 3FMWA 3TUEA 1SKRB 3Q18A 1O85A 2F51A 2V32A 3QR6A 2OADA 3RDWA 3GKXA 3Q6OA 2H0HA 4XHMA 4FYBA 5C04A 5D8IA 4IP6A 4POBA 1GNWA 3GUSA 2HLSA 2IIYA 4DSQA 2GQKA 4IQAA 3KH9A 4EVMA 1ERVA 5ECNB 2OBIA 1R5PA 5ECQB 3BOAA 1AQVA 1GUMA 2H6XA 3CTFA 4DVCA 4KDUA 2REMA 5BRTA 1M2AA 3WT1A 4EIQA 2CAQA 2YZUA 4TN8A 4KF9A 5DQSA 1WMJA 2A2PA 3QCPA 4PGTA 3KP8A 4OMVA 3F6FA 5F05A 2FD3A 1WRYA 4K8MA 2PBJA 4TW5A 4KGIA 1AAZA 3VPQA 2DBCA 4D73A 1PL2A 1X5CA 1GP1A 3G7IA 4MP4A 2E2GA 3EC3A 4ECCA 3EURA 4Z2TA 1U3IA 2I3YA 3M3MA 4ZL7A 4WR4A 4CW9A 3MAKA 4KUNA 3ZZXA 1XIYA 1ZYEA 2CZ2A 3LW9A 4GWRA 4HS1A 20GSA 5ENUA 2TRCP 4F0CA 1B4PA 2E2MA 5AIXA 2BJXA 4WBRD 1WIKA 1F2EA 1RW1A 4O5RA 1GTBA 1FW1A 1XVWA 3DWVA 4HJ2A 1O6JA 4USSA 5IMVA 4G0IA 2AHEA 3CSHA 3ZREA 4HUAA 3KXOA 1Z7PA 6GSXA 2H73A 3CYNA 2R3XA 4V1Ap 3N5OA 2LRNA 4EIPA 2YPMA 3D0ZA 5DCGA 4NHZA 2VD1A 1QXHA 1XWAA 4J2FA 5AISA 5EVOA 3VI5A 4G9HA 3LEFA 1EV9A 3EINA 4G10A 2JACA 2L5LA 3BCKA 3MSZA 4K6XA 1O8XA 4MPGA 4NAXA 3F8UA 3IRAA 3F9UA 5DAKB 4YQUA 2ZUPA 1V57A 1YZXA 1O8WA 3VWXA 4GXZA 1C72A 1G7OA 1Z7RA 5HR3A 6GSTA 11GSA 4MABA 3D4TA 1XWKA 5DBQA 5LD0A 2GT6A 1YKAA 2WULA 3CSIA 4J57E 4KNDA 2XBIA 3EU4A 1PMTA 2ZNMA 1K0AA 1K0NA 2A2RA 3CBUA 3G7YA 4WF5A 2C0FA 2PPTA 2C1YA 4MK3A 1XFLA 5J9BA 2MMOA 3VK9A 4JEDA 1PQNA 3PINA 1NSWA 1PKZA 3TKPA 2LJRA 1XZOA 4IVFA 2IFQB 1GTAA 3W8SA 4EF0A 1TK8B 4FO5A 3CRTA 5J41A 3H93A 5CRWA 2PVOC 1R5AA 2GSQA 2IPAA 3LJRA 2IMEA 1QMVA 3UOMA 1GH2A 3HYPA 4NWYA 1Z5YE 3GKMA 4K2XA 1XPVA 3P2AA 1XBSA 1EOHA 4K2DA 4NPBA 2F8AA 1K3OA 1OKTA 5G5FA 4L5OA 3O76A 3GFKA 5B7CA 1AUCA 4KH7A 3GURA 2XHFA 1UN2A 3ZIVA 2L57A 4ZB8A 2VCVA 4ECBA 2A4VA 4MJAA 3TOUA 4KCEA 3ZYWA 1SYXA 1X0RA 1M3JA 3VWUA 4V2MA 2CVBA 4DEJA 2VUPA 4LMVA 2LQOA 1ML6A 4LA1A 3FYGA 1AXDA 4KSMA 3FR6A 2CVKA 1I9DA 1CQHA 2GDRA 2HYXA 1ZYPA 2FY6A 2H1GA 2WFCA 2PWJA 2V2GA 4GRFA 6GSUA 3R2QA 3FR9A 4GCIA 3D22A 1SD8A 4JE1A 3H8QA 2V1MA 1GSUA 3GTUB 1A2MA 2CX3A 1JZDA 2GTUA 3DYRA 4HZ2A 1PA3A 3ME8A 4XS1A 3SWLA 2KUCA 2YWIA 2GZYA 2WDUA 3GH9A 4FQUA 4RQRA 3FEUA 2YN1A 2GT5A 2B1LA 2OKAA 10GSA 2IJYA 3PR8A 3S9FA 3US3A 4TXOB 6GSYA 3I9V2 3IV4A 1S3RA 2VM2A 1X9MB 3TJJA 2O7KA 4MZCA 1EP8A 1V9WA 3TGZA 3QOUA 4YKFA 2O85A 4G19A 3APOA 3IPZA 4K5SA 4GQFA 1JFUA 2GQLA 5F8BA 4JR6A 3IBHA 1KNGA 1J08A 4WBJA 3C7MA 2VL2A 2GSSA 3L9VA 2VIMA 3PGTA 1BG5A 3TJKA 1WJKA 1AQWA 2HRAA 4KAEA 2C3NA 3HVXA 2L4QA 1VF2A 3LWAA 2KLXA 5KOWA 3VPTA 3GKNA 1VGLA 1SJ6A 1X9SB 3F63A 4OWYA 3C1RA 3KEBA 3KTLA 4TR3A 3ZTLA 1A8LA 3UVHA 1SK2A 2WGRA 1GLQA 1QUWA 1X5EA 3LYPA 5KEJA 3LSZA 2AJQB 1XWCA 2GZPA 4K7NA 3ZITA 2VCWA 5A4WA 4EKZA 3GHAA 2DC5A 1Z6NA 1A24A 1V2AA 3QDNA 5CREA 1TP9A 3D6IA 3NIVA 4EDYA 2CV4A 2O87A 4KDXA 4MF5A 4NHWA 2N5AA 5HR2A 5J3RA 3HDCA 3WGXA 4GF0A 3A2VA 4ZBAA 4GLTA 3QAGA 5ECPB 4ZB9A 2QA2A 2HSYA 3J7Yb 1ABAA 1YJ6A 3IHQA 2FWEA 2C3TA 2IWTA 5GSTA 4BIKA 1B9XC 2VCZA 4TXVA 4MZWA 3EU3A 3C73A 3E3EA 2HRKA 2LRTA 2N5BA 1TRSA 4PQHA 2H0GA 4HEA2 2NDOA 2XPDA 4D73B 5ECSA 3ZFBA 1IYIA 4PUAA 2JZSA 4E8HA 2DKHA 4QL9A 4XTSA 1SK0A 3RHCA 1R26A 3LORA 2LEGA 5IOXA 2FWGA 3HVSA 1OYJA 3NOFA 1XW9A 1M7TA 3VWWA 4I97A 3NZNA 1G7EA 3EVIA 3TKSA 2FGXA 3QD9A 4Z2RA 2JSZA 4X43A 2VLVA 3HJOA 1LBKA 5F0GA 3UARA 2LNSA 2K6VA 1TU7A 4ILFA 4KX4A 1S3DA 1T00A 2H1BA 2WRTA 2NVLA 4Z7XA 4TRXA 4IQ1A 1PD21 1TTZA 4MMMA 5F07A 4JR4A 4LMWA 1K0MA 2EIOA 2H72A 5H5QA 5AN1A 2RUEA 3U6VA 1RK4A 5KN0A 3DEXA 3L0HA 3MDKA 1LJRA 3PPUA 1GWCA 3ME7A 4Q5QA 2L6DA 3UAPA 2B7KA 3HCZA 3IDVA 3P7XA 3FZ5A 1NW2A 4JRRA 4MA9A 1SKWB 4IW9A 2LV3A 2AYTA 1CQGA 2PGTA 4KDYA 4IJIA 4BVYA 3FR3A 5D96A 2G0FA 3IAM2 3L78A 2QSIA 2VLUA 2X4AA 4TR1A 2EIRA 3GH6A 2YWMA 3TJBA 2WB9A 1SJIA 3L4NA 2HFDA 4P3YB 2OE0A 5ECIB 3HHVA 4Q5RA 5C00A 1XWBA 3DKSA 3WD6A 1KEBA 1Z6MA 4CDOA 1FAAA 2YZHA 1WOUA 2NPBA 4NXIA 5ECRB 5IMFA 3FKFA 2OE1A 2ZCTA 5IIZA 2XBQA 4G2EA 5IO0A 2PUKC 4OFNA 3A2WA 2H01A 1EGRA 2MMAA 2JSYA 1YY7A 1GTIA 1LU4A 2DJ2A 3MWHA 4TVEA 1R4WA 2OACA 1JLWA 1X5DA 4F9ZA 3TRPA 3UMAA 2FNOA 1GUHA 3H1NA 2CQ9A 5INYA 5A4UA 1BX9A 4MCUA 4ICYA 1M9AA 5HR1A 1SJZA 1S3CA 4HU9A 2WCIA 3CTGA 2NBSA 3QFBC 4EL1A 4PTSA 3C71A 1ERWA 1O73A 4V1Ag 3D5JA 2RM6A 3GX0A 5ID2B 2RLIA 4MZBA 1QGVA 5KN2A 2FWFA 3QAVA 5H5RA 1GUKA 3GV1A 2IMDA 2OA7A 3CRUA 3FHKA 5CRGA 3M0FA 2PERA 3UIWA 1MTCA 3UBLA 4MH2A 1M0UA 3EPTA 3TCOA 5IOWA 5D9WA 1TRVA 4ULXA 4ECIA 1W4VA 3F4RA 2R0GA 3VURA 2J9HA 2EC4A 2QC7A 4L0WA 3DD3A 1Y25A 5GSSA 2OBKA 4MLYA 2L6CA 3VLNA 1GSQA 2TRXA 1A2LA 4Q5NA 4XRAA 2VOCA 4ZL8A 5JCWA 1YEPA 5IMZA 1OVNA 4IELA 1UA5A 3HVNA 4K5RA 2IN3A 3IOSA 2P5QA 1OKDA 2F8FA 1GNEA 3VI7A 5E59A 4YQVA 1S3AA 4XIHA 1N2AA 5CNWA 4G0LA 3I6AA 5JCGA 4I2TA 2DKIA 3DVXA 1A0RP 2MBSA 2YNXA 5LNKe 1K0CA 4QQ7A 2CT6A 1ACVA 2GQMA 4MJBA 2L4CA 3SBCA 1F37A 1XWGA 4IHUA 2YANA 4IBPA 1ZOFA 1TRWA 1ERUA 1XVQA 4BWQA 3TRQA 3Q19A 2DMLA 3KIJA 2B3SA 1F3BA 2IL3A 3C8EA 2A4HA 2H70A 3TRXA 1GL8A 3IC4A 2H1DA 4IS0A 2H0IA 2B7JA 5J9CA 1TJDA 1X9WB 3M1GA 2TIRA 3I69A 3ED3A 3PH9A 1DBYA 1MD4A 2HI7A 3LQ7A 3EE2A 1GTUA 1ZYNA 1PFOA 3HY2A 5IQYA 1SL2B 2H30A 2JL4A 3RPNA 4O32A 2H76A 5AIVA 1PX6A 4HU7A 1SL1B 1O7UA 3H4KA 4Q5FA 2JADA 3UJ1A 5CP1A 3RAZA 2EIQA 12GSA 1UVZA 1YQ1A 5ID2A 3IXRA 1NM3A 3FRCA 4N0VA 3ZMLA 3F0IA 5ELAA 4I2UA 2ON7A 2CVDA 3FK8A 2V41A 3N9JA 1XXUA 1ZMAA 4ZXGA 4EDZA 3WYWA 2VD0A 3FZ4A 3KZQA 1EV4A 5CO3A 3M9KA 2CZ3A 2PN8A 1M99A 1QQ2A 2I9HA 3Q74A 1ON4A 5DJLA 4POLA 1GSYA 2E7PA 2JZRA 1A2JA 4ISDA 1EZKA 5D9TA 3MIXA 3UVTA 3QFAC 4JZQA 1EOGA 4PURA 1YKCA 4JU5A 5DVBA 1B48A
chains in the Genus database with same CATH topology
5G1LA 3ERGA 2VCXA 3APSA 1PN9A 5G1KA 2R0CA 1JLVA 1YF0A 4POKA 4EXJA 4FYCA 1IYHA 3AY8A 4GSSA 1THXA 1MDIA 6GSWA 1XCCA 1TKDB 2HRNA 1FHEA 1AQXA 1VF1A 1HQOA 4GSNA 2P5RA 2VL3A 1XW6A 3IK7A 1EP7A 1J9BA 3KM6A 5EL8A 2B5XA 1K0DA 3W6GA 4BVYB 4YKGA 3DGQA 2DIZA 2PU9C 5DALB 4TR1B 1ZGNA 4KW6A 2LJAA 4WXTA 5KN1A 4K0GA 4F82A 2CA8A 2LQQA 4WR5A 5D73A 4NV5A 2C0EA 2YV9A 1FVJA 4OCEA 4XCSA 2GS3A 4MH3A 2R37A 3ZIJA 4YQMA 1DE2A 2MMNA 1MEKA 3IR4A 3A5IA 4WETA 1T7PB 3WGEA 2B5YA 4HQSA 1YDKA 1AIUA 5DQYA 5BMUA 2P0GA 4LL1B 1OE8A 3APQA 6GSSA 1TDIA 3U5RE 3TDGA 1PKWA 2DSAA 4MJCA 1Y6EA 2ON5A 1SK1A 1AW9A 1H4OA 3HXSA 2LKUA 2FUG2 2HNLA 1XOAA 1WPIA 2MYGA 3DVWA 1FVKA 5G2ZA 4ZILA 1A23A 3HZ4A 5DJMA 2YWNA 5GAPD 4KSOA 1GSEA 1T4YA 3IAS2 4ZBDA 2H6YA 4XS6A 3LXTA 3A5WA 5HFKA 2H71A 1ZYQB 1OE7A 4NV2A 5IO2A 2OE3A 4OFTA 4OO5A 1A8YA 1EWXA 1W89A 2VLTA 3TB2A 5CAXA 1EGOA 4KA0A 2H75A 4HDEA 1JZRA 3ZL5A 3KMOA 1R7HA 2N5FA 1ZCPA 2YJ7A 4F03A 5HFGA 2KHPA 2LNTA 3KCMA 1T4ZA 2LRCA 2UZ8A 3H79A 5EPFA 2FCHA 2C0DA 3TKQA 3TJFA 2IMIA 1JHBA 4GTUA 1SYRA 1TRUA 3GSTA 2DJKA 1TU8A 3F3RA 5FWGA 3C1SA 4MJEA 1PSQA 5CYYA 4BA7A 2GSRA 1HNBA 1MD3A 3L9SA 4EE0A 4RUVA 5DALA 5IPHA 4I8BA 4X4JA 2GLRA 4H86A 1WE0A 3F4TA 2DJ3A 1UC7A 3M8NA 5G31A 2YCDA 3E0UA 5D9VA 4KE3A 3J7Yk 1BYEA 4BVXA 1GSDA 5HFIA 3A2XA 3DIEA 1DSBA 3FZ9A 1K0OA 3HA9A 3UEMA 1HNCA 5ECLB 1F6MC 2I4AA 5H5SA 3V1WA 3ISOA 2H66A 17GSA 4FYUA 4BL7A 6GSVA 1SU9A 4PUFC 2F3MA 2FA8A 3HVVA 2X8CA 2D2ZA 3GL3A 2R0PA 4O5QA 4AGSA 4WEYA 2LS5A 1GULA 3RPPA 2GVPA 1Q98A 4ZIJA 1HD2A 5LCZA 3GN3A 5B6NA 1SENA 1M2BA 3ERFA 3TKSC 1WP0A 3ZLPA 2C80A 2B1KA 4K1FA 2ALBA 1G6YA 2X64A 3GX8A 2B6MA 2QA1A 2ES7A 2H6ZA 1MDJA 2LSTA 2R6KA 5COHA 1FOHA 5G30A 1PRXA 1TK5B 3ZFLA 4V2LA 2YJHA 1GSFA 2Z9SA 1M9BA 4XRDA 4ZB6A 1E6BA 1N8JA 1GRXA 5B6MA 4DSSA 2VM1A 3EYTA 4LLRA 1OC9B 4MPFA 4ECJA 2MZCA 4LL4B 5HQPA 2AV4A 2NTOA 4HI7A 5B8BA 4EC0A 2HZEA 5CRDA 1PX7A 2GSTA 3L9UA 1BJXA 3HD5A 5ABRA 4I5QA 5ECKB 1QK8A 2M46A 3BD2A 3EMPA 1ZZYA 4YH2A 4AJ7A 1U6TA 1PL1A 5GAND 3VFIA 2BTOT 2KOKA 2YV7A 2CX4A 4OO4A 1J0FA 7GSSA 1SKSB 5JWQB 4X0XA 2JZTA 4NMUA 3EMXA 3RHBA 1VRSD 5F06A 1BAYA 1KTEA 4TKYA 4F0BA 3CSJA 3QPMA 5DCHA 1HYUA 5FT3A 2RUFA 1V58A 4BWSA 3IA1A 1HNAA 1JZOA 1DE1A 1KBNA 5ECOB 2WS2A 3DRNA 2GGTA 4ML6A 3IE3A 4MF7A 3ZRDA 9GSSA 3EWLA 3F3QA 5KN3A 1Z9HA 3BCIA 4L0UA 5EY6A 4HZ4A 1OAZA 4CY8A 1VF4A 3MNGA 1EEJA 2J23A 3LG6A 4BPYA 2DJJA 1SL0B 1WWJA 2H8LA 2X8HA 4POMA 2R5GA 2I1UA 2C3QA 4JBBA 4RI7A 4X1UA 3F4SA 4HJMA 5JCUA 4AJ8A 2AB6A 1THOA 2K18A 2GZZA 1MDKA 3M9JA 2B5EA 3ZVJA 2AUVA 1V40A 2AAWA 3FZAA 1K3YA 4HOJA 4EUYA 1Q4JA 2PMTA 14GSA 3GA4A 3GRXA 2LJKA 3LYKA 3GNJA 2VAFA 4A5PA 1K3LA 2X8GA 3ERWA 4N0ZA 4FIWA 2V6KA 1QFNA 4ACSA 4G0KA 5IPGA 4F2IA 3KP9A 4O92A 3WGDA 3O3TA 1PGTA 3GMFA 2YOIA 2G2QA 2K8VA 2DIYA 2I81A 1U87A 4MDCA 3UBKA 2YWOA 4OFMA 22GSA 1BEDA 1G6WA 1TXXA 1T1VA 2LUSA 2FHEA 8GSSA 1NHOA 1SD9A 1B4QA 1OC9A 3O6TA 2VL9A 1FB6A 1JZWA 2MMZA 4YAPA 1TK0B 4IN0A 2IMFA 1YF1A 2H19A 1H75A 4MNNA 4CY6A 3VWVA 4RQXA 2K9FA 5IMDA 1F3AA 3LXZA 3IK9A 4J56E 1T3BA 3KMNA 2C4JA 1Z3EA 2P31A 4N30A 2WJUA 2X99A 4PXOA 3UL3A 1VF3A 4XS4B 2K8SA 4O7HA 3FW2A 2BMXA 5DAKA 4GSTA 3TKRA 4O5UA 4L8EA 1RQMA 1URMA 2FA4A 4L5LA 4QL7A 4OCFA 3JCML 2O89A 3IHGA 5JWRB 1OC8A 4AJ6A 5ELGA 3GSSA 13GSA 2DMMA 1G0TA 5ECMB 1BQ7A 4HQZA 2HSMA 3DMLA 4I6XA 4PQIA 4RI6A 2R4VA 3LFLA 3TOTA 4FH8A 2WZ9A 3HKRA 1FG4A 2IFQA 4ML1A 4YAVA 2KP1A 3A3TA 4PNFA 2H74A 4N10A 3G9BA 4PX1A 2RIIA 3R3EA 2MBTA 16GSA 1TOFA 2H1AA 1NHYA 2M80A 5J4UA 3K8NA 1M2DA 1V98A 4BVXB 2DJ0A 4DSRA 4AF2A 1YEXA 4OD7A 4N11A 1TI3A 4ZL9A 1K0BA 3LGCA 1ILOA 1E2YA 2XPEA 2HRFA 4WKWA 1FO5A 3KH7A 2FWHA 5D9XA 3ZMKA 2M72A 1USBA 4BL7B 3GKKA 3I43A 1GSSA 2HSHA 4GQCA 3P90A 5KOXA 18GSA 2V6OA 3CMIA 5B8AA 1B9YC 4WF4A 5J5NA 2F9SA 2PVQA 2QKEA 1I5GA 3F6DA 1OC3A 3GIXA 2CAIA 2QGVA 5A4VA 4PQ1A 1FOVA 4Z2UA 1B8XA 1TW9A 4E8EA 1U88A 1EEMA 3IC8A 5GZZB 2KP2A 1GLPA 3WT2A 4K7IA 3G7JA 2L59A 4TR4A 4PNGA 5CRHA 2HT9A 4IP1A 3TJGA 1XW5A 5IM9A 2RM5A 4IKHA 3MYDA 4K9ZA 3HZ8A 3D21A 3KJYA 2JU5A 5ECHB 3GYKA 4TOPA 2DJ1A 3GTUA 1T8EB 1DUGA 2IMKA 2C8UA 4IGJA 2FLSA 1ERTA 3BBYA 2HE3A 4ZBBA 4ID0A 1F9MA 1U3AA 1TI1A 4EO3A 3W8JA 2OJLA 4DSSB 2O8VB 2VL2C 2XC2A 2A2SA 4XS4A 4TR0A 3TKSE 2DLXA 1ST9A 3DXBA 3E9JB 5IMCA 3KD0A 2HXKA 3CXGA 5D93A 3P8WA 3KGKA 1FB0A 3D4MA 4CHSA 3QMXA 4V2NA 2C0GA 3KTBA 2X49A 2HZEB 3QAWA 5G5EA 4TXOA 3RBTA 2YP6A 4KCAA 4K7OA 4K0NA 1AC1A 2E0QA 5FHIA 1ZL9A 1A0FA 4KB3A 5JWOB 2L5OA 19GSA 3HJPA 1XOBA 3GL5A 3OR5A 2VO4A 5AGYA 1O81A 2R2JA 5HR0A 3ZVJD 5IMAA 2VCTA 5DDLA 4IJ3A 4MF6A 2HZFA 2VCQA 3FY7A 1PN0A 5L71A 3BJ5A 3HJMA 5E4WA 5A5KA 2LTKA 3FMWA 3TUEA 1SKRB 3Q18A 1O85A 2F51A 2V32A 3QR6A 2OADA 3RDWA 3GKXA 3Q6OA 2H0HA 4XHMA 4FYBA 5C04A 5D8IA 4IP6A 4POBA 1GNWA 3GUSA 2HLSA 2IIYA 4DSQA 2GQKA 4IQAA 3KH9A 4EVMA 1ERVA 5ECNB 2OBIA 1R5PA 5ECQB 3BOAA 1AQVA 1GUMA 2H6XA 3CTFA 4DVCA 4KDUA 2REMA 5BRTA 1M2AA 3WT1A 4EIQA 2CAQA 2YZUA 4TN8A 4KF9A 5DQSA 1WMJA 2A2PA 3QCPA 4PGTA 3KP8A 4OMVA 3F6FA 5F05A 2FD3A 1WRYA 4K8MA 2PBJA 4TW5A 4KGIA 1AAZA 3VPQA 2DBCA 4D73A 1PL2A 1X5CA 1GP1A 3G7IA 4MP4A 2E2GA 3EC3A 4ECCA 3EURA 4Z2TA 1U3IA 2I3YA 3M3MA 4ZL7A 4WR4A 4CW9A 3MAKA 4KUNA 3ZZXA 1XIYA 1ZYEA 2CZ2A 3LW9A 4GWRA 4HS1A 20GSA 5ENUA 2TRCP 4F0CA 1B4PA 2E2MA 5AIXA 2BJXA 4WBRD 1WIKA 1F2EA 1RW1A 4O5RA 1GTBA 1FW1A 1XVWA 3DWVA 4HJ2A 1O6JA 4USSA 5IMVA 4G0IA 2AHEA 3CSHA 3ZREA 4HUAA 3KXOA 1Z7PA 6GSXA 2H73A 3CYNA 2R3XA 4V1Ap 3N5OA 2LRNA 4EIPA 2YPMA 3D0ZA 5DCGA 4NHZA 2VD1A 1QXHA 1XWAA 4J2FA 5AISA 5EVOA 3VI5A 4G9HA 3LEFA 1EV9A 3EINA 4G10A 2JACA 2L5LA 3BCKA 3MSZA 4K6XA 1O8XA 4MPGA 4NAXA 3F8UA 3IRAA 3F9UA 5DAKB 4YQUA 2ZUPA 1V57A 1YZXA 1O8WA 3VWXA 4GXZA 1C72A 1G7OA 1Z7RA 5HR3A 6GSTA 11GSA 4MABA 3D4TA 1XWKA 5DBQA 5LD0A 2GT6A 1YKAA 2WULA 3CSIA 4J57E 4KNDA 2XBIA 3EU4A 1PMTA 2ZNMA 1K0AA 1K0NA 2A2RA 3CBUA 3G7YA 4WF5A 2C0FA 2PPTA 2C1YA 4MK3A 1XFLA 5J9BA 2MMOA 3VK9A 4JEDA 1PQNA 3PINA 1NSWA 1PKZA 3TKPA 2LJRA 1XZOA 4IVFA 2IFQB 1GTAA 3W8SA 4EF0A 1TK8B 4FO5A 3CRTA 5J41A 3H93A 5CRWA 2PVOC 1R5AA 2GSQA 2IPAA 3LJRA 2IMEA 1QMVA 3UOMA 1GH2A 3HYPA 4NWYA 1Z5YE 3GKMA 4K2XA 1XPVA 3P2AA 1XBSA 1EOHA 4K2DA 4NPBA 2F8AA 1K3OA 1OKTA 5G5FA 4L5OA 3O76A 3GFKA 5B7CA 1AUCA 4KH7A 3GURA 2XHFA 1UN2A 3ZIVA 2L57A 4ZB8A 2VCVA 4ECBA 2A4VA 4MJAA 3TOUA 4KCEA 3ZYWA 1SYXA 1X0RA 3VWUA 4V2MA 2CVBA 4DEJA 2VUPA 4LMVA 2LQOA 1ML6A 4LA1A 3FYGA 1AXDA 4KSMA 3FR6A 2CVKA 1I9DA 1CQHA 2GDRA 2HYXA 1ZYPA 2FY6A 2H1GA 2WFCA 2PWJA 2V2GA 4GRFA 6GSUA 3R2QA 3FR9A 4GCIA 3D22A 1SD8A 4JE1A 3H8QA 2V1MA 1GSUA 3GTUB 1A2MA 2CX3A 1JZDA 2GTUA 3DYRA 4HZ2A 1PA3A 3ME8A 4XS1A 3SWLA 2KUCA 2YWIA 2GZYA 2WDUA 3GH9A 4FQUA 4RQRA 3FEUA 2YN1A 2GT5A 2B1LA 2OKAA 10GSA 2IJYA 3PR8A 3S9FA 3US3A 4TXOB 6GSYA 3I9V2 3IV4A 2VM2A 1X9MB 3TJJA 2O7KA 4MZCA 1EP8A 1V9WA 3TGZA 3QOUA 4YKFA 2O85A 4G19A 3APOA 3IPZA 4K5SA 4GQFA 1JFUA 2GQLA 5F8BA 4JR6A 3IBHA 1KNGA 1J08A 4WBJA 3C7MA 2VL2A 2GSSA 3L9VA 2VIMA 3PGTA 1BG5A 3TJKA 1WJKA 1AQWA 2HRAA 4KAEA 2C3NA 3HVXA 2L4QA 1VF2A 3LWAA 2KLXA 5KOWA 3VPTA 3GKNA 1VGLA 1SJ6A 1X9SB 3F63A 4OWYA 3C1RA 3KEBA 3KTLA 4TR3A 3ZTLA 1A8LA 3UVHA 1SK2A 2WGRA 1GLQA 1QUWA 1X5EA 3LYPA 5KEJA 3LSZA 2AJQB 1XWCA 2GZPA 4K7NA 3ZITA 2VCWA 5A4WA 4EKZA 3GHAA 2DC5A 1Z6NA 1A24A 1V2AA 3QDNA 5CREA 1TP9A 3D6IA 3NIVA 4EDYA 2CV4A 2O87A 4KDXA 4MF5A 4NHWA 2N5AA 5HR2A 5J3RA 3HDCA 3WGXA 4GF0A 3A2VA 4ZBAA 4GLTA 3QAGA 5ECPB 4ZB9A 2QA2A 2HSYA 3J7Yb 1ABAA 1YJ6A 3IHQA 2FWEA 2C3TA 2IWTA 5GSTA 1B9XC 2VCZA 4TXVA 4MZWA 3EU3A 3C73A 3E3EA 2HRKA 2LRTA 2N5BA 1TRSA 4PQHA 2H0GA 4HEA2 2NDOA 2XPDA 4D73B 5ECSA 3ZFBA 1IYIA 4PUAA 2JZSA 4E8HA 2DKHA 4QL9A 4XTSA 1SK0A 3RHCA 1R26A 3LORA 2LEGA 5IOXA 2FWGA 3HVSA 1OYJA 3NOFA 1XW9A 1M7TA 3VWWA 4I97A 3NZNA 1G7EA 3EVIA 3TKSA 2FGXA 3QD9A 4Z2RA 2JSZA 4X43A 2VLVA 3HJOA 1LBKA 5F0GA 3UARA 2LNSA 2K6VA 1TU7A 4ILFA 4KX4A 1S3DA 1T00A 2H1BA 2WRTA 2NVLA 4Z7XA 4TRXA 4IQ1A 1PD21 1TTZA 4MMMA 5F07A 4JR4A 4LMWA 1K0MA 2EIOA 2H72A 5H5QA 5AN1A 2RUEA 3U6VA 1RK4A 5KN0A 3DEXA 3L0HA 3MDKA 1LJRA 3PPUA 1GWCA 3ME7A 4Q5QA 2L6DA 3UAPA 2B7KA 3HCZA 3IDVA 3P7XA 3FZ5A 1NW2A 4JRRA 4MA9A 1SKWB 4IW9A 2LV3A 2AYTA 1CQGA 2PGTA 4KDYA 4IJIA 4BVYA 3FR3A 5D96A 2G0FA 3IAM2 3L78A 2QSIA 2VLUA 2X4AA 4TR1A 2EIRA 3GH6A 2YWMA 3TJBA 2WB9A 1SJIA 3L4NA 2HFDA 4P3YB 2OE0A 5ECIB 3HHVA 4Q5RA 5C00A 1XWBA 3DKSA 3WD6A 1KEBA 1Z6MA 4CDOA 1FAAA 2YZHA 1WOUA 2NPBA 4NXIA 5ECRB 5IMFA 3FKFA 2OE1A 2ZCTA 5IIZA 2XBQA 4G2EA 5IO0A 2PUKC 4OFNA 3A2WA 2H01A 1EGRA 2MMAA 2JSYA 1YY7A 1GTIA 1LU4A 2DJ2A 3MWHA 4TVEA 1R4WA 2OACA 1JLWA 1X5DA 4F9ZA 3TRPA 3UMAA 2FNOA 1GUHA 3H1NA 2CQ9A 5INYA 5A4UA 1BX9A 4MCUA 4ICYA 1M9AA 5HR1A 1SJZA 1S3CA 4HU9A 2WCIA 3CTGA 2NBSA 3QFBC 4EL1A 4PTSA 3C71A 1ERWA 1O73A 4V1Ag 3D5JA 2RM6A 3GX0A 5ID2B 2RLIA 4MZBA 1QGVA 5KN2A 2FWFA 3QAVA 5H5RA 1GUKA 3GV1A 2IMDA 2OA7A 3CRUA 3FHKA 5CRGA 3M0FA 2PERA 3UIWA 1MTCA 3UBLA 4MH2A 1M0UA 3EPTA 3TCOA 5IOWA 5D9WA 1TRVA 4ULXA 4ECIA 1W4VA 3F4RA 2R0GA 3VURA 2J9HA 2EC4A 2QC7A 4L0WA 3DD3A 1Y25A 5GSSA 2OBKA 4MLYA 2L6CA 3VLNA 1GSQA 2TRXA 1A2LA 4Q5NA 4XRAA 2VOCA 4ZL8A 5JCWA 1YEPA 5IMZA 1OVNA 4IELA 1UA5A 4K5RA 2IN3A 3IOSA 2P5QA 1OKDA 2F8FA 1GNEA 3VI7A 5E59A 4YQVA 1S3AA 4XIHA 1N2AA 5CNWA 4G0LA 3I6AA 5JCGA 4I2TA 2DKIA 3DVXA 1A0RP 2MBSA 2YNXA 5LNKe 1K0CA 4QQ7A 2CT6A 1ACVA 2GQMA 4MJBA 2L4CA 3SBCA 1F37A 1XWGA 4IHUA 2YANA 4IBPA 1ZOFA 1TRWA 1ERUA 1XVQA 4BWQA 3TRQA 3Q19A 2DMLA 3KIJA 2B3SA 1F3BA 2IL3A 3C8EA 2A4HA 2H70A 3TRXA 1GL8A 3IC4A 2H1DA 4IS0A 2H0IA 2B7JA 5J9CA 1TJDA 1X9WB 3M1GA 2TIRA 3I69A 3ED3A 3PH9A 1DBYA 1MD4A 2HI7A 3LQ7A 3EE2A 1GTUA 1ZYNA 3HY2A 5IQYA 1SL2B 2H30A 2JL4A 3RPNA 4O32A 2H76A 5AIVA 1PX6A 4HU7A 1SL1B 1O7UA 3H4KA 4Q5FA 2JADA 3UJ1A 5CP1A 3RAZA 2EIQA 12GSA 1UVZA 1YQ1A 5ID2A 3IXRA 1NM3A 3FRCA 4N0VA 3ZMLA 3F0IA 5ELAA 4I2UA 2ON7A 2CVDA 3FK8A 2V41A 3N9JA 1XXUA 1ZMAA 4ZXGA 4EDZA 3WYWA 2VD0A 3FZ4A 3KZQA 1EV4A 5CO3A 3M9KA 2CZ3A 2PN8A 1M99A 1QQ2A 2I9HA 3Q74A 1ON4A 5DJLA 4POLA 1GSYA 2E7PA 2JZRA 1A2JA 4ISDA 1EZKA 5D9TA 3MIXA 3UVTA 3QFAC 4JZQA 1EOGA 4PURA 1YKCA 4JU5A 5DVBA 1B48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G1L A;  3ERG A;  2VCX A;  3APS A;  1PN9 A;  5G1K A;  1JLV A;  1YF0 A;  4POK A;  4EXJ A;  4FYC A;  1IYH A;  3AY8 A;  4GSS A;  1THX A;  1MDI A;  6GSW A;  1XCC A;  1TKD B;  2HRN A;  1FHE A;  1AQX A;  1VF1 A;  1HQO A;  4GSN A;  2P5R A;  2VL3 A;  1XW6 A;  3IK7 A;  1EP7 A;  1J9B A;  3KM6 A;  5EL8 A;  2B5X A;  1K0D A;  3W6G A;  3DGQ A;  2DIZ A;  2PU9 C;  5DAL B;  4TR1 B;  1ZGN A;  4KW6 A;  2LJA A;  4WXT A;  5KN1 A;  4K0G A;  4F82 A;  2CA8 A;  2LQQ A;  4WR5 A;  5D73 A;  4NV5 A;  2C0E A;  2YV9 A;  1FVJ A;  4OCE A;  4XCS A;  2GS3 A;  4MH3 A;  2R37 A;  3ZIJ A;  4YQM A;  1DE2 A;  2MMN A;  1MEK A;  3IR4 A;  4WET A;  1T7P B;  3WGE A;  2B5Y A;  4HQS A;  1YDK A;  1AIU A;  5DQY A;  2P0G A;  4LL1 B;  1OE8 A;  3APQ A;  6GSS A;  1TDI A;  3U5R E;  3TDG A;  1PKW A;  2DSA A;  4MJC A;  1Y6E A;  2ON5 A;  1SK1 A;  1AW9 A;  1H4O A;  3HXS A;  2LKU A;  2FUG 2;  2HNL A;  1XOA A;  1WPI A;  2MYG A;  3DVW A;  1FVK A;  5G2Z A;  4ZIL A;  1A23 A;  3HZ4 A;  5DJM A;  2YWN A;  5GAP D;  4KSO A;  1GSE A;  1T4Y A;  3IAS 2;  4ZBD A;  2H6Y A;  4XS6 A;  3LXT A;  3A5W A;  5HFK A;  2H71 A;  1ZYQ B;  1OE7 A;  4NV2 A;  5IO2 A;  2OE3 A;  4OFT A;  4OO5 A;  1A8Y A;  1EWX A;  1W89 A;  2VLT A;  3TB2 A;  5CAX A;  1EGO A;  4KA0 A;  2H75 A;  4HDE A;  1JZR A;  3ZL5 A;  3KMO A;  1R7H A;  2N5F A;  1ZCP A;  2YJ7 A;  4F03 A;  5HFG A;  2KHP A;  2LNT A;  3KCM A;  1T4Z A;  2LRC A;  3H79 A;  5EPF A;  2FCH A;  2C0D A;  3TKQ A;  3TJF A;  2IMI A;  1JHB A;  4GTU A;  1SYR A;  1TRU A;  3GST A;  2DJK A;  1TU8 A;  3F3R A;  5FWG A;  3C1S A;  4MJE A;  1PSQ A;  5CYY A;  4BA7 A;  2GSR A;  1HNB A;  1MD3 A;  3L9S A;  4EE0 A;  4RUV A;  5DAL A;  5IPH A;  4I8B A;  2GLR A;  4H86 A;  1WE0 A;  3F4T A;  2DJ3 A;  1UC7 A;  3M8N A;  5G31 A;  2YCD A;  3E0U A;  5D9V A;  4KE3 A;  3J7Y k;  1BYE A;  4BVX A;  1GSD A;  5HFI A;  3A2X A;  3DIE A;  1DSB A;  3FZ9 A;  1K0O A;  3HA9 A;  3UEM A;  1HNC A;  5ECL B;  1F6M C;  2I4A A;  5H5S A;  3V1W A;  3ISO A;  2H66 A;  17GS A;  4FYU A;  4BL7 A;  6GSV A;  1SU9 A;  4PUF C;  2F3M A;  2FA8 A;  3HVV A;  2X8C A;  2D2Z A;  3GL3 A;  4AGS A;  4WEY A;  2LS5 A;  1GUL A;  3RPP A;  2GVP A;  1Q98 A;  4ZIJ A;  1HD2 A;  5LCZ A;  3GN3 A;  5B6N A;  1SEN A;  1M2B A;  3ERF A;  3TKS C;  1WP0 A;  3ZLP A;  2C80 A;  2B1K A;  4K1F A;  2ALB A;  1G6Y A;  2X64 A;  3GX8 A;  2B6M A;  2ES7 A;  2H6Z A;  1MDJ A;  2LST A;  2R6K A;  5COH A;  5G30 A;  1PRX A;  1TK5 B;  3ZFL A;  4V2L A;  2YJH A;  1GSF A;  2Z9S A;  1M9B A;  4XRD A;  4ZB6 A;  1E6B A;  1N8J A;  1GRX A;  5B6M A;  4DSS A;  2VM1 A;  3EYT A;  4LLR A;  1OC9 B;  4MPF A;  4ECJ A;  2MZC A;  4LL4 B;  5HQP A;  2AV4 A;  2NTO A;  4HI7 A;  5B8B A;  4EC0 A;  2HZE A;  5CRD A;  1PX7 A;  2GST A;  3L9U A;  1BJX A;  3HD5 A;  5ABR A;  4I5Q A;  5ECK B;  1QK8 A;  2M46 A;  3BD2 A;  3EMP A;  1ZZY A;  4YH2 A;  4AJ7 A;  1U6T A;  1PL1 A;  5GAN D;  3VFI A;  2BTO T;  2KOK A;  2YV7 A;  2CX4 A;  4OO4 A;  1J0F A;  7GSS A;  1SKS B;  5JWQ B;  4X0X A;  2JZT A;  4NMU A;  3EMX A;  3RHB A;  1VRS D;  5F06 A;  1BAY A;  1KTE A;  4TKY A;  4F0B A;  3CSJ A;  3QPM A;  5DCH A;  1HYU A;  5FT3 A;  2RUF A;  1V58 A;  4BWS A;  3IA1 A;  1HNA A;  1JZO A;  1DE1 A;  1KBN A;  5ECO B;  2WS2 A;  3DRN A;  2GGT A;  4ML6 A;  3IE3 A;  4MF7 A;  3ZRD A;  9GSS A;  3EWL A;  3F3Q A;  5KN3 A;  1Z9H A;  3BCI A;  4L0U A;  5EY6 A;  4HZ4 A;  1OAZ A;  1VF4 A;  3MNG A;  1EEJ A;  2J23 A;  3LG6 A;  4BPY A;  2DJJ A;  1SL0 B;  1WWJ A;  2H8L A;  2X8H A;  4POM A;  2R5G A;  2I1U A;  2C3Q A;  4JBB A;  4RI7 A;  4X1U A;  3F4S A;  4HJM A;  5JCU A;  4AJ8 A;  2AB6 A;  1THO A;  2K18 A;  2GZZ A;  1MDK A;  3M9J A;  2B5E A;  3ZVJ A;  2AUV A;  1V40 A;  2AAW A;  3FZA A;  1K3Y A;  4HOJ A;  4EUY A;  1Q4J A;  2PMT A;  14GS A;  3GA4 A;  3GRX A;  2LJK A;  3LYK A;  3GNJ A;  2VAF A;  1K3L A;  2X8G A;  3ERW A;  4N0Z A;  4FIW A;  2V6K A;  1QFN A;  4ACS A;  5IPG A;  4F2I A;  3KP9 A;  4O92 A;  3WGD A;  3O3T A;  1PGT A;  3GMF A;  2YOI A;  2G2Q A;  2K8V A;  2DIY A;  2I81 A;  1U87 A;  4MDC A;  3UBK A;  2YWO A;  4OFM A;  22GS A;  1BED A;  1G6W A;  1TXX A;  1T1V A;  2LUS A;  2FHE A;  8GSS A;  1NHO A;  1SD9 A;  1B4Q A;  1OC9 A;  3O6T A;  2VL9 A;  1FB6 A;  1JZW A;  2MMZ A;  4YAP A;  1TK0 B;  4IN0 A;  2IMF A;  1YF1 A;  2H19 A;  1H75 A;  3VWV A;  4RQX A;  2K9F A;  5IMD A;  1F3A A;  3LXZ A;  3IK9 A;  4J56 E;  1T3B A;  3KMN A;  2C4J A;  1Z3E A;  2P31 A;  4N30 A;  2WJU A;  2X99 A;  4PXO A;  3UL3 A;  1VF3 A;  4XS4 B;  2K8S A;  4O7H A;  3FW2 A;  2BMX A;  5DAK A;  4GST A;  3TKR A;  4L8E A;  1RQM A;  1URM A;  2FA4 A;  4L5L A;  4QL7 A;  4OCF A;  3JCM L;  2O89 A;  5JWR B;  1OC8 A;  4AJ6 A;  5ELG A;  3GSS A;  13GS A;  2DMM A;  1G0T A;  5ECM B;  1BQ7 A;  4HQZ A;  3DML A;  4I6X A;  4PQI A;  4RI6 A;  2R4V A;  3LFL A;  3TOT A;  4FH8 A;  2WZ9 A;  3HKR A;  1FG4 A;  2IFQ A;  4ML1 A;  4YAV A;  2KP1 A;  3A3T A;  4PNF A;  2H74 A;  4N10 A;  3G9B A;  4PX1 A;  2RII A;  2MBT A;  16GS A;  1TOF A;  2H1A A;  1NHY A;  2M80 A;  5J4U A;  3K8N A;  1M2D A;  1V98 A;  2DJ0 A;  4DSR A;  4AF2 A;  1YEX A;  4OD7 A;  4N11 A;  1TI3 A;  4ZL9 A;  1K0B A;  3LGC A;  1ILO A;  1E2Y A;  2XPE A;  2HRF A;  4WKW A;  1FO5 A;  3KH7 A;  2FWH A;  5D9X A;  3ZMK A;  2M72 A;  1USB A;  3GKK A;  3I43 A;  1GSS A;  2HSH A;  4GQC A;  3P90 A;  18GS A;  2V6O A;  3CMI A;  5B8A A;  1B9Y C;  4WF4 A;  5J5N A;  2F9S A;  2PVQ A;  2QKE A;  1I5G A;  3F6D A;  1OC3 A;  3GIX A;  2CAI A;  2QGV A;  5A4V A;  4PQ1 A;  1FOV A;  1B8X A;  1TW9 A;  4E8E A;  1U88 A;  1EEM A;  5GZZ B;  2KP2 A;  1GLP A;  3WT2 A;  4K7I A;  3G7J A;  2L59 A;  4TR4 A;  4PNG A;  5CRH A;  2HT9 A;  4IP1 A;  3TJG A;  1XW5 A;  5IM9 A;  2RM5 A;  4IKH A;  4K9Z A;  3HZ8 A;  3D21 A;  3KJY A;  2JU5 A;  5ECH B;  3GYK A;  4TOP A;  2DJ1 A;  3GTU A;  1T8E B;  1DUG A;  2IMK A;  2C8U A;  4IGJ A;  2FLS A;  1ERT A;  3BBY A;  2HE3 A;  4ZBB A;  4ID0 A;  1F9M A;  1U3A A;  1TI1 A;  4EO3 A;  3W8J A;  2OJL A;  4DSS B;  2O8V B;  2VL2 C;  2XC2 A;  2A2S A;  4XS4 A;  4TR0 A;  3TKS E;  2DLX A;  1ST9 A;  3DXB A;  3E9J B;  5IMC A;  3KD0 A;  2HXK A;  3CXG A;  5D93 A;  3P8W A;  3KGK A;  1FB0 A;  3D4M A;  4CHS A;  3QMX A;  4V2N A;  2C0G A;  3KTB A;  2HZE B;  3QAW A;  5G5E A;  4TXO A;  3RBT A;  2YP6 A;  4KCA A;  4K7O A;  4K0N A;  1AC1 A;  2E0Q A;  5FHI A;  1ZL9 A;  1A0F A;  4KB3 A;  5JWO B;  2L5O A;  19GS A;  3HJP A;  1XOB A;  3GL5 A;  3OR5 A;  2VO4 A;  5AGY A;  1O81 A;  2R2J A;  5HR0 A;  3ZVJ D;  5IMA A;  2VCT A;  5DDL A;  4IJ3 A;  4MF6 A;  2HZF A;  2VCQ A;  3FY7 A;  5L71 A;  3BJ5 A;  3HJM A;  5E4W A;  5A5K A;  2LTK A;  3TUE A;  1SKR B;  3Q18 A;  1O85 A;  2F51 A;  2V32 A;  3QR6 A;  2OAD A;  3RDW A;  3GKX A;  3Q6O A;  2H0H A;  4XHM A;  4FYB A;  5C04 A;  5D8I A;  4IP6 A;  4POB A;  1GNW A;  3GUS A;  2HLS A;  2IIY A;  4DSQ A;  2GQK A;  4IQA A;  3KH9 A;  4EVM A;  1ERV A;  5ECN B;  2OBI A;  1R5P A;  5ECQ B;  3BOA A;  1AQV A;  1GUM A;  2H6X A;  3CTF A;  4DVC A;  4KDU A;  2REM A;  1M2A A;  3WT1 A;  2CAQ A;  2YZU A;  4TN8 A;  5DQS A;  1WMJ A;  3QCP A;  4PGT A;  3KP8 A;  4OMV A;  3F6F A;  5F05 A;  2FD3 A;  1WRY A;  4K8M A;  2PBJ A;  4TW5 A;  4KGI A;  1AAZ A;  3VPQ A;  2DBC A;  4D73 A;  1PL2 A;  1X5C A;  1GP1 A;  3G7I A;  4MP4 A;  2E2G A;  3EC3 A;  4ECC A;  3EUR A;  1U3I A;  2I3Y A;  3M3M A;  4ZL7 A;  4WR4 A;  4CW9 A;  3MAK A;  4KUN A;  3ZZX A;  1XIY A;  1ZYE A;  2CZ2 A;  4GWR A;  4HS1 A;  20GS A;  5ENU A;  2TRC P;  4F0C A;  1B4P A;  2E2M A;  5AIX A;  2BJX A;  4WBR D;  1WIK A;  1F2E A;  1RW1 A;  4O5R A;  1GTB A;  1FW1 A;  1XVW A;  3DWV A;  4HJ2 A;  1O6J A;  5IMV A;  2AHE A;  3CSH A;  3ZRE A;  4HUA A;  3KXO A;  1Z7P A;  6GSX A;  2H73 A;  3CYN A;  2R3X A;  4V1A p;  3N5O A;  2LRN A;  2YPM A;  3D0Z A;  5DCG A;  4NHZ A;  2VD1 A;  1QXH A;  1XWA A;  4J2F A;  5AIS A;  5EVO A;  3VI5 A;  4G9H A;  3LEF A;  1EV9 A;  3EIN A;  4G10 A;  2JAC A;  2L5L A;  3BCK A;  3MSZ A;  4K6X A;  1O8X A;  4MPG A;  4NAX A;  3F8U A;  3IRA A;  3F9U A;  5DAK B;  4YQU A;  2ZUP A;  1V57 A;  1YZX A;  1O8W A;  3VWX A;  4GXZ A;  1C72 A;  1G7O A;  1Z7R A;  5HR3 A;  6GST A;  11GS A;  4MAB A;  3D4T A;  1XWK A;  5DBQ A;  5LD0 A;  2GT6 A;  1YKA A;  2WUL A;  3CSI A;  4J57 E;  4KND A;  2XBI A;  3EU4 A;  1PMT A;  2ZNM A;  1K0A A;  1K0N A;  2A2R A;  3CBU A;  3G7Y A;  4WF5 A;  2C0F A;  2PPT A;  2C1Y A;  4MK3 A;  1XFL A;  5J9B A;  2MMO A;  3VK9 A;  4JED A;  1PQN A;  3PIN A;  1NSW A;  1PKZ A;  3TKP A;  2LJR A;  1XZO A;  4IVF A;  2IFQ B;  1GTA A;  3W8S A;  4EF0 A;  1TK8 B;  4FO5 A;  3CRT A;  5J41 A;  3H93 A;  5CRW A;  2PVO C;  1R5A A;  2GSQ A;  2IPA A;  3LJR A;  2IME A;  1QMV A;  3UOM A;  1GH2 A;  3HYP A;  4NWY A;  1Z5Y E;  3GKM A;  1XPV A;  3P2A A;  1XBS A;  1EOH A;  4K2D A;  4NPB A;  2F8A A;  1K3O A;  1OKT A;  5G5F A;  4L5O A;  3O76 A;  3GFK A;  5B7C A;  1AUC A;  4KH7 A;  3GUR A;  2XHF A;  1UN2 A;  3ZIV A;  2L57 A;  4ZB8 A;  2VCV A;  4ECB A;  2A4V A;  4MJA A;  3TOU A;  4KCE A;  3ZYW A;  1SYX A;  1X0R A;  3VWU A;  4V2M A;  2CVB A;  4DEJ A;  2VUP A;  4LMV A;  2LQO A;  1ML6 A;  4LA1 A;  3FYG A;  1AXD A;  4KSM A;  3FR6 A;  2CVK A;  1I9D A;  1CQH A;  2GDR A;  2HYX A;  2FY6 A;  2H1G A;  2WFC A;  2PWJ A;  2V2G A;  4GRF A;  6GSU A;  3R2Q A;  3FR9 A;  4GCI A;  3D22 A;  1SD8 A;  4JE1 A;  3H8Q A;  2V1M A;  1GSU A;  3GTU B;  1A2M A;  2CX3 A;  1JZD A;  2GTU A;  3DYR A;  4HZ2 A;  1PA3 A;  3ME8 A;  4XS1 A;  3SWL A;  2KUC A;  2YWI A;  2GZY A;  2WDU A;  3GH9 A;  4RQR A;  3FEU A;  2YN1 A;  2GT5 A;  2B1L A;  2OKA A;  10GS A;  2IJY A;  3PR8 A;  3S9F A;  3US3 A;  4TXO B;  6GSY A;  3I9V 2;  3IV4 A;  2VM2 A;  1X9M B;  3TJJ A;  2O7K A;  4MZC A;  1EP8 A;  1V9W A;  3TGZ A;  3QOU A;  2O85 A;  4G19 A;  3APO A;  3IPZ A;  4GQF A;  1JFU A;  2GQL A;  5F8B A;  4JR6 A;  3IBH A;  1KNG A;  1J08 A;  4WBJ A;  3C7M A;  2VL2 A;  2GSS A;  3L9V A;  2VIM A;  3PGT A;  1BG5 A;  3TJK A;  1WJK A;  1AQW A;  4KAE A;  2C3N A;  3HVX A;  2L4Q A;  1VF2 A;  3LWA A;  2KLX A;  3VPT A;  3GKN A;  1VGL A;  1SJ6 A;  1X9S B;  3F63 A;  4OWY A;  3C1R A;  3KEB A;  3KTL A;  4TR3 A;  3ZTL A;  1A8L A;  3UVH A;  1SK2 A;  2WGR A;  1GLQ A;  1QUW A;  1X5E A;  3LYP A;  5KEJ A;  3LSZ A;  2AJQ B;  1XWC A;  2GZP A;  4K7N A;  3ZIT A;  2VCW A;  5A4W A;  4EKZ A;  3GHA A;  2DC5 A;  1Z6N A;  1A24 A;  1V2A A;  3QDN A;  5CRE A;  1TP9 A;  3D6I A;  3NIV A;  4EDY A;  2CV4 A;  2O87 A;  4KDX A;  4MF5 A;  4NHW A;  2N5A A;  5HR2 A;  5J3R A;  3HDC A;  3WGX A;  4GF0 A;  3A2V A;  4ZBA A;  4GLT A;  3QAG A;  5ECP B;  4ZB9 A;  2HSY A;  3J7Y b;  1ABA A;  1YJ6 A;  3IHQ A;  2FWE A;  2C3T A;  2IWT A;  5GST A;  1B9X C;  2VCZ A;  4TXV A;  4MZW A;  3EU3 A;  3C73 A;  3E3E A;  2LRT A;  2N5B A;  1TRS A;  4PQH A;  2H0G A;  4HEA 2;  2NDO A;  2XPD A;  4D73 B;  5ECS A;  3ZFB A;  1IYI A;  4PUA A;  2JZS A;  4E8H A;  4QL9 A;  4XTS A;  1SK0 A;  3RHC A;  1R26 A;  3LOR A;  2LEG A;  5IOX A;  2FWG A;  3HVS A;  1OYJ A;  3NOF A;  1XW9 A;  1M7T A;  3VWW A;  4I97 A;  3NZN A;  1G7E A;  3EVI A;  3TKS A;  2FGX A;  3QD9 A;  2JSZ A;  4X43 A;  2VLV A;  3HJO A;  1LBK A;  5F0G A;  3UAR A;  2LNS A;  2K6V A;  1TU7 A;  4ILF A;  4KX4 A;  1S3D A;  1T00 A;  2H1B A;  2WRT A;  2NVL A;  4Z7X A;  4TRX A;  4IQ1 A;  1PD2 1;  1TTZ A;  4MMM A;  5F07 A;  4JR4 A;  4LMW A;  1K0M A;  2EIO A;  2H72 A;  5H5Q A;  5AN1 A;  2RUE A;  3U6V A;  1RK4 A;  5KN0 A;  3DEX A;  3L0H A;  3MDK A;  1LJR A;  1GWC A;  3ME7 A;  4Q5Q A;  2L6D A;  3UAP A;  2B7K A;  3HCZ A;  3IDV A;  3P7X A;  3FZ5 A;  1NW2 A;  4JRR A;  4MA9 A;  1SKW B;  4IW9 A;  2LV3 A;  2AYT A;  1CQG A;  2PGT A;  4KDY A;  4IJI A;  4BVY A;  3FR3 A;  5D96 A;  2G0F A;  3IAM 2;  3L78 A;  2QSI A;  2VLU A;  4TR1 A;  2EIR A;  3GH6 A;  2YWM A;  3TJB A;  2WB9 A;  1SJI A;  3L4N A;  2HFD A;  4P3Y B;  2OE0 A;  5ECI B;  3HHV A;  4Q5R A;  5C00 A;  1XWB A;  3DKS A;  3WD6 A;  1KEB A;  1Z6M A;  4CDO A;  1FAA A;  2YZH A;  1WOU A;  2NPB A;  4NXI A;  5ECR B;  5IMF A;  3FKF A;  2OE1 A;  2ZCT A;  5IIZ A;  2XBQ A;  4G2E A;  5IO0 A;  2PUK C;  4OFN A;  3A2W A;  2H01 A;  1EGR A;  2MMA A;  2JSY A;  1YY7 A;  1GTI A;  1LU4 A;  2DJ2 A;  3MWH A;  4TVE A;  1R4W A;  2OAC A;  1JLW A;  1X5D A;  4F9Z A;  3TRP A;  3UMA A;  2FNO A;  1GUH A;  3H1N A;  2CQ9 A;  5INY A;  5A4U A;  1BX9 A;  4MCU A;  5HR1 A;  1M9A A;  1SJZ A;  1S3C A;  4HU9 A;  2WCI A;  3CTG A;  2NBS A;  3QFB C;  4EL1 A;  3C71 A;  1ERW A;  1O73 A;  4V1A g;  3D5J A;  2RM6 A;  3GX0 A;  5ID2 B;  2RLI A;  4MZB A;  1QGV A;  5KN2 A;  2FWF A;  3QAV A;  5H5R A;  1GUK A;  3GV1 A;  2IMD A;  2OA7 A;  3CRU A;  3FHK A;  5CRG A;  3M0F A;  2PER A;  3UIW A;  1MTC A;  3UBL A;  4MH2 A;  1M0U A;  3TCO A;  5IOW A;  5D9W A;  1TRV A;  4ULX A;  4ECI A;  1W4V A;  3F4R A;  3VUR A;  2J9H A;  2EC4 A;  2QC7 A;  4L0W A;  3DD3 A;  1Y25 A;  5GSS A;  2OBK A;  4MLY A;  2L6C A;  3VLN A;  1GSQ A;  2TRX A;  1A2L A;  4Q5N A;  4XRA A;  2VOC A;  4ZL8 A;  5JCW A;  1YEP A;  5IMZ A;  1OVN A;  4IEL A;  1UA5 A;  2IN3 A;  3IOS A;  2P5Q A;  1OKD A;  2F8F A;  1GNE A;  3VI7 A;  5E59 A;  4YQV A;  1S3A A;  4XIH A;  1N2A A;  5CNW A;  3I6A A;  5JCG A;  4I2T A;  3DVX A;  1A0R P;  2MBS A;  2YNX A;  5LNK e;  1K0C A;  4QQ7 A;  2CT6 A;  1ACV A;  2GQM A;  4MJB A;  2L4C A;  3SBC A;  1F37 A;  1XWG A;  4IHU A;  2YAN A;  4IBP A;  1ZOF A;  1TRW A;  1ERU A;  1XVQ A;  4BWQ A;  3TRQ A;  3Q19 A;  2DML A;  3KIJ A;  2B3S A;  1F3B A;  2IL3 A;  3C8E A;  2H70 A;  3TRX A;  1GL8 A;  3IC4 A;  2H1D A;  4IS0 A;  2H0I A;  2B7J A;  5J9C A;  1TJD A;  1X9W B;  3M1G A;  2TIR A;  3I69 A;  3ED3 A;  3PH9 A;  1DBY A;  1MD4 A;  2HI7 A;  3LQ7 A;  3EE2 A;  1GTU A;  3HY2 A;  5IQY A;  1SL2 B;  2H30 A;  2JL4 A;  3RPN A;  4O32 A;  2H76 A;  5AIV A;  1PX6 A;  4HU7 A;  1SL1 B;  1O7U A;  3H4K A;  4Q5F A;  2JAD A;  3UJ1 A;  5CP1 A;  3RAZ A;  2EIQ A;  12GS A;  1UVZ A;  1YQ1 A;  5ID2 A;  3IXR A;  1NM3 A;  3FRC A;  4N0V A;  3ZML A;  3F0I A;  5ELA A;  4I2U A;  2ON7 A;  2CVD A;  3FK8 A;  2V41 A;  3N9J A;  1XXU A;  1ZMA A;  4ZXG A;  4EDZ A;  3WYW A;  2VD0 A;  3FZ4 A;  3KZQ A;  1EV4 A;  5CO3 A;  3M9K A;  2CZ3 A;  2PN8 A;  1M99 A;  1QQ2 A;  2I9H A;  3Q74 A;  1ON4 A;  5DJL A;  4POL A;  1GSY A;  2E7P A;  2JZR A;  1A2J A;  4ISD A;  1EZK A;  5D9T A;  3UVT A;  3QFA C;  4JZQ A;  1EOG A;  4PUR A;  1YKC A;  4JU5 A;  5DVB A;  1B48 A; 
#chains in the Genus database with same CATH topology
 5G1L A;  3ERG A;  2VCX A;  3APS A;  1PN9 A;  5G1K A;  2R0C A;  1JLV A;  1YF0 A;  4POK A;  4EXJ A;  4FYC A;  1IYH A;  3CQF A;  3AY8 A;  4GSS A;  1THX A;  1MDI A;  6GSW A;  1XCC A;  1TKD B;  2HRN A;  1FHE A;  1AQX A;  1VF1 A;  1HQO A;  4GSN A;  2P5R A;  2VL3 A;  1XW6 A;  3IK7 A;  1EP7 A;  1J9B A;  3KM6 A;  5EL8 A;  2B5X A;  1K0D A;  3W6G A;  4BVY B;  4YKG A;  3DGQ A;  2DIZ A;  2PU9 C;  5DAL B;  4TR1 B;  1ZGN A;  4KW6 A;  2LJA A;  4WXT A;  5KN1 A;  4K0G A;  4F82 A;  2CA8 A;  2LQQ A;  4WR5 A;  5D73 A;  4NV5 A;  2C0E A;  2YV9 A;  1FVJ A;  4OCE A;  4XCS A;  2GS3 A;  4MH3 A;  2R37 A;  3ZIJ A;  4YQM A;  1DE2 A;  2MMN A;  1MEK A;  3IR4 A;  3A5I A;  4WET A;  1T7P B;  3WGE A;  2B5Y A;  4HQS A;  1YDK A;  1AIU A;  5DQY A;  5BMU A;  2P0G A;  4LL1 B;  1OE8 A;  3APQ A;  6GSS A;  1TDI A;  3U5R E;  3TDG A;  1PKW A;  2DSA A;  4MJC A;  1Y6E A;  2ON5 A;  1SK1 A;  1AW9 A;  1H4O A;  3HXS A;  2LKU A;  2FUG 2;  2HNL A;  1XOA A;  1WPI A;  2MYG A;  3DVW A;  1FVK A;  5G2Z A;  4ZIL A;  1A23 A;  3HZ4 A;  5DJM A;  2YWN A;  5GAP D;  4KSO A;  1GSE A;  1T4Y A;  3IAS 2;  4ZBD A;  2H6Y A;  4XS6 A;  3LXT A;  3A5W A;  5HFK A;  2H71 A;  1ZYQ B;  1OE7 A;  4NV2 A;  5IO2 A;  2OE3 A;  4OFT A;  4OO5 A;  1A8Y A;  1EWX A;  1W89 A;  2VLT A;  3TB2 A;  5CAX A;  1EGO A;  4KA0 A;  2H75 A;  4HDE A;  1JZR A;  3ZL5 A;  3KMO A;  1R7H A;  2N5F A;  1ZCP A;  2YJ7 A;  4F03 A;  5HFG A;  2KHP A;  2LNT A;  3KCM A;  1T4Z A;  2LRC A;  2UZ8 A;  3H79 A;  5EPF A;  2FCH A;  2C0D A;  3TKQ A;  3TJF A;  2IMI A;  1JHB A;  4GTU A;  1SYR A;  1TRU A;  3GST A;  2DJK A;  1TU8 A;  3F3R A;  5FWG A;  3C1S A;  4MJE A;  1PSQ A;  5CYY A;  4BA7 A;  2GSR A;  1HNB A;  1MD3 A;  3L9S A;  4EE0 A;  4RUV A;  5DAL A;  5IPH A;  4I8B A;  4X4J A;  2GLR A;  4H86 A;  1WE0 A;  3F4T A;  2DJ3 A;  1UC7 A;  3M8N A;  5G31 A;  2YCD A;  3E0U A;  5D9V A;  4KE3 A;  3J7Y k;  1BYE A;  4BVX A;  1GSD A;  5HFI A;  3A2X A;  3DIE A;  1DSB A;  3FZ9 A;  1K0O A;  3HA9 A;  3UEM A;  1HNC A;  5ECL B;  1F6M C;  2I4A A;  5H5S A;  3V1W A;  3ISO A;  2H66 A;  17GS A;  4FYU A;  4BL7 A;  6GSV A;  1SU9 A;  4PUF C;  2F3M A;  2FA8 A;  3HVV A;  2X8C A;  2D2Z A;  3GL3 A;  2R0P A;  4O5Q A;  4AGS A;  4WEY A;  2LS5 A;  1GUL A;  3RPP A;  2GVP A;  1Q98 A;  4ZIJ A;  1HD2 A;  5LCZ A;  3GN3 A;  5B6N A;  1SEN A;  1M2B A;  3ERF A;  3TKS C;  1WP0 A;  3ZLP A;  2C80 A;  2B1K A;  4K1F A;  2ALB A;  1G6Y A;  2X64 A;  3GX8 A;  2B6M A;  2QA1 A;  2ES7 A;  2H6Z A;  1MDJ A;  2LST A;  2R6K A;  5COH A;  1FOH A;  5G30 A;  1PRX A;  1TK5 B;  3ZFL A;  4V2L A;  2YJH A;  1GSF A;  2Z9S A;  1M9B A;  4XRD A;  4ZB6 A;  1E6B A;  1N8J A;  1GRX A;  5B6M A;  4DSS A;  2VM1 A;  3EYT A;  4LLR A;  1OC9 B;  4MPF A;  4ECJ A;  2MZC A;  4LL4 B;  5HQP A;  2AV4 A;  2NTO A;  4HI7 A;  5B8B A;  4EC0 A;  2HZE A;  5CRD A;  1PX7 A;  2GST A;  3L9U A;  1BJX A;  3HD5 A;  5ABR A;  1XG8 A;  4I5Q A;  5ECK B;  1QK8 A;  2M46 A;  3BD2 A;  3EMP A;  1ZZY A;  4YH2 A;  4AJ7 A;  1U6T A;  1PL1 A;  5GAN D;  3VFI A;  2BTO T;  2KOK A;  2YV7 A;  2CX4 A;  4OO4 A;  1J0F A;  7GSS A;  1SKS B;  5JWQ B;  4X0X A;  2JZT A;  4NMU A;  3EMX A;  3RHB A;  1VRS D;  5F06 A;  1BAY A;  1KTE A;  4TKY A;  4F0B A;  3CSJ A;  3QPM A;  5DCH A;  1HYU A;  5FT3 A;  2RUF A;  1V58 A;  4BWS A;  3IA1 A;  1HNA A;  1JZO A;  1DE1 A;  1KBN A;  5ECO B;  2WS2 A;  3DRN A;  2GGT A;  4ML6 A;  3IE3 A;  4MF7 A;  3ZRD A;  9GSS A;  3EWL A;  3F3Q A;  5KN3 A;  1Z9H A;  3BCI A;  4L0U A;  5EY6 A;  4HZ4 A;  1OAZ A;  4CY8 A;  1VF4 A;  3MNG A;  1EEJ A;  2J23 A;  3LG6 A;  4BPY A;  2DJJ A;  1SL0 B;  1WWJ A;  2H8L A;  2X8H A;  4POM A;  2R5G A;  2I1U A;  2C3Q A;  4JBB A;  4RI7 A;  4X1U A;  3F4S A;  4HJM A;  5JCU A;  4AJ8 A;  2AB6 A;  1THO A;  2K18 A;  2GZZ A;  1MDK A;  3M9J A;  2B5E A;  3ZVJ A;  2AUV A;  1V40 A;  2AAW A;  3FZA A;  1K3Y A;  4HOJ A;  4EUY A;  1Q4J A;  2PMT A;  14GS A;  3GA4 A;  3GRX A;  2LJK A;  3LYK A;  3GNJ A;  2VAF A;  4A5P A;  1K3L A;  2X8G A;  3ERW A;  4N0Z A;  4FIW A;  2V6K A;  1QFN A;  4ACS A;  4G0K A;  5IPG A;  4F2I A;  3KP9 A;  4O92 A;  3WGD A;  3O3T A;  1PGT A;  3GMF A;  2YOI A;  2G2Q A;  2K8V A;  2DIY A;  2I81 A;  1U87 A;  4MDC A;  3UBK A;  2YWO A;  4OFM A;  22GS A;  1BED A;  1G6W A;  1TXX A;  1T1V A;  2LUS A;  2FHE A;  8GSS A;  1NHO A;  1SD9 A;  1B4Q A;  1OC9 A;  3O6T A;  2VL9 A;  1FB6 A;  1JZW A;  2MMZ A;  4YAP A;  1TK0 B;  4IN0 A;  2IMF A;  1YF1 A;  2H19 A;  1H75 A;  4MNN A;  4CY6 A;  3VWV A;  4RQX A;  2K9F A;  5IMD A;  1F3A A;  3LXZ A;  3IK9 A;  4J56 E;  1T3B A;  3KMN A;  2C4J A;  1Z3E A;  2P31 A;  4N30 A;  2WJU A;  2X99 A;  4PXO A;  3UL3 A;  1VF3 A;  4XS4 B;  2K8S A;  4O7H A;  3FW2 A;  2BMX A;  5DAK A;  4GST A;  3TKR A;  4O5U A;  4L8E A;  1RQM A;  1URM A;  2FA4 A;  4L5L A;  4QL7 A;  4OCF A;  3JCM L;  2O89 A;  3IHG A;  5JWR B;  1OC8 A;  4AJ6 A;  5ELG A;  3GSS A;  13GS A;  2DMM A;  1G0T A;  5ECM B;  1BQ7 A;  4HQZ A;  2HSM A;  3DML A;  4I6X A;  4PQI A;  4RI6 A;  2R4V A;  3LFL A;  3TOT A;  4FH8 A;  2WZ9 A;  3HKR A;  1FG4 A;  2IFQ A;  4ML1 A;  4YAV A;  2KP1 A;  3A3T A;  4PNF A;  2H74 A;  4N10 A;  3G9B A;  4PX1 A;  2RII A;  3R3E A;  2MBT A;  16GS A;  1TOF A;  2H1A A;  1NHY A;  2M80 A;  5J4U A;  3K8N A;  1M2D A;  1V98 A;  4BVX B;  2DJ0 A;  4DSR A;  4AF2 A;  1YEX A;  4OD7 A;  4N11 A;  1TI3 A;  4ZL9 A;  1K0B A;  3LGC A;  1ILO A;  1E2Y A;  2XPE A;  2HRF A;  4WKW A;  1FO5 A;  3KH7 A;  2FWH A;  5D9X A;  3ZMK A;  2M72 A;  1USB A;  4BL7 B;  3GKK A;  3I43 A;  1GSS A;  2HSH A;  4GQC A;  3P90 A;  5KOX A;  18GS A;  2V6O A;  3CMI A;  5B8A A;  1B9Y C;  4WF4 A;  5J5N A;  2F9S A;  2PVQ A;  2QKE A;  1I5G A;  3F6D A;  1OC3 A;  3GIX A;  2CAI A;  2QGV A;  5A4V A;  4PQ1 A;  1M3I A;  1FOV A;  4Z2U A;  1B8X A;  1TW9 A;  4E8E A;  1U88 A;  1EEM A;  3IC8 A;  5GZZ B;  2KP2 A;  1GLP A;  3WT2 A;  4K7I A;  3G7J A;  2L59 A;  4TR4 A;  4PNG A;  5CRH A;  2HT9 A;  4IP1 A;  3TJG A;  1XW5 A;  5IM9 A;  2RM5 A;  4IKH A;  3MYD A;  4K9Z A;  3HZ8 A;  3D21 A;  3KJY A;  2JU5 A;  5ECH B;  3GYK A;  4HSC X;  4TOP A;  2DJ1 A;  3GTU A;  1T8E B;  1DUG A;  2IMK A;  2C8U A;  4IGJ A;  2FLS A;  1ERT A;  3BBY A;  2HE3 A;  4ZBB A;  4ID0 A;  1F9M A;  1U3A A;  1TI1 A;  4EO3 A;  3W8J A;  2OJL A;  4DSS B;  2O8V B;  2VL2 C;  2XC2 A;  2A2S A;  4XS4 A;  4TR0 A;  3TKS E;  2DLX A;  1ST9 A;  3DXB A;  3E9J B;  5IMC A;  3KD0 A;  2HXK A;  3CXG A;  5D93 A;  3P8W A;  3KGK A;  1FB0 A;  3D4M A;  4CHS A;  3QMX A;  4V2N A;  2C0G A;  3KTB A;  2X49 A;  2HZE B;  3QAW A;  5G5E A;  4TXO A;  3RBT A;  2YP6 A;  4KCA A;  4K7O A;  4K0N A;  1AC1 A;  2E0Q A;  5FHI A;  1ZL9 A;  1A0F A;  4KB3 A;  5JWO B;  2L5O A;  19GS A;  3HJP A;  1XOB A;  3GL5 A;  3OR5 A;  2VO4 A;  5AGY A;  1O81 A;  2R2J A;  5HR0 A;  3ZVJ D;  5IMA A;  2VCT A;  5DDL A;  4IJ3 A;  4MF6 A;  2HZF A;  2VCQ A;  3FY7 A;  1PN0 A;  5L71 A;  3BJ5 A;  3HJM A;  5E4W A;  5A5K A;  2LTK A;  3FMW A;  3TUE A;  1SKR B;  3Q18 A;  1O85 A;  2F51 A;  2V32 A;  3QR6 A;  2OAD A;  3RDW A;  3GKX A;  3Q6O A;  2H0H A;  4XHM A;  4FYB A;  5C04 A;  5D8I A;  4IP6 A;  4POB A;  1GNW A;  3GUS A;  2HLS A;  2IIY A;  4DSQ A;  2GQK A;  4IQA A;  3KH9 A;  4EVM A;  1ERV A;  5ECN B;  2OBI A;  1R5P A;  5ECQ B;  3BOA A;  1AQV A;  1GUM A;  2H6X A;  3CTF A;  4DVC A;  4KDU A;  2REM A;  5BRT A;  1M2A A;  3WT1 A;  4EIQ A;  2CAQ A;  2YZU A;  4TN8 A;  4KF9 A;  5DQS A;  1WMJ A;  2A2P A;  3QCP A;  4PGT A;  3KP8 A;  4OMV A;  3F6F A;  5F05 A;  2FD3 A;  1WRY A;  4K8M A;  2PBJ A;  4TW5 A;  4KGI A;  1AAZ A;  3VPQ A;  2DBC A;  4D73 A;  1PL2 A;  1X5C A;  1GP1 A;  3G7I A;  4MP4 A;  2E2G A;  3EC3 A;  4ECC A;  3EUR A;  4Z2T A;  1U3I A;  2I3Y A;  3M3M A;  4ZL7 A;  4WR4 A;  4CW9 A;  3MAK A;  4KUN A;  3ZZX A;  1XIY A;  1ZYE A;  2CZ2 A;  3LW9 A;  4GWR A;  4HS1 A;  20GS A;  5ENU A;  2TRC P;  4F0C A;  1B4P A;  2E2M A;  5AIX A;  2BJX A;  4WBR D;  1WIK A;  1F2E A;  1RW1 A;  4O5R A;  1GTB A;  1FW1 A;  1XVW A;  3DWV A;  4HJ2 A;  1O6J A;  4USS A;  5IMV A;  4G0I A;  2AHE A;  3CSH A;  3ZRE A;  4HUA A;  3KXO A;  1Z7P A;  6GSX A;  2H73 A;  3CYN A;  2R3X A;  4V1A p;  3N5O A;  2LRN A;  4EIP A;  2YPM A;  3D0Z A;  5DCG A;  4NHZ A;  2VD1 A;  1QXH A;  1XWA A;  4J2F A;  5AIS A;  5EVO A;  3VI5 A;  4G9H A;  3LEF A;  1EV9 A;  3EIN A;  4G10 A;  2JAC A;  2L5L A;  3BCK A;  3MSZ A;  4K6X A;  1O8X A;  4MPG A;  4NAX A;  3F8U A;  3IRA A;  3F9U A;  5DAK B;  4YQU A;  2ZUP A;  1V57 A;  1YZX A;  1O8W A;  3VWX A;  4GXZ A;  1C72 A;  1G7O A;  1Z7R A;  5HR3 A;  6GST A;  11GS A;  4MAB A;  3D4T A;  1XWK A;  5DBQ A;  5LD0 A;  2GT6 A;  1YKA A;  2WUL A;  3CSI A;  4J57 E;  4KND A;  2XBI A;  3EU4 A;  1PMT A;  2ZNM A;  1K0A A;  1K0N A;  2A2R A;  3CBU A;  3G7Y A;  4WF5 A;  2C0F A;  2PPT A;  2C1Y A;  4MK3 A;  1XFL A;  5J9B A;  2MMO A;  3VK9 A;  4JED A;  1PQN A;  3PIN A;  1NSW A;  1PKZ A;  3TKP A;  2LJR A;  1XZO A;  4IVF A;  2IFQ B;  1GTA A;  3W8S A;  4EF0 A;  1TK8 B;  4FO5 A;  3CRT A;  5J41 A;  3H93 A;  5CRW A;  2PVO C;  1R5A A;  2GSQ A;  2IPA A;  3LJR A;  2IME A;  1QMV A;  3UOM A;  1GH2 A;  3HYP A;  4NWY A;  1Z5Y E;  3GKM A;  4K2X A;  1XPV A;  3P2A A;  1XBS A;  1EOH A;  4K2D A;  4NPB A;  2F8A A;  1K3O A;  1OKT A;  5G5F A;  4L5O A;  3O76 A;  3GFK A;  5B7C A;  1AUC A;  4KH7 A;  3GUR A;  2XHF A;  1UN2 A;  3ZIV A;  2L57 A;  4ZB8 A;  2VCV A;  4ECB A;  2A4V A;  4MJA A;  3TOU A;  4KCE A;  3ZYW A;  1SYX A;  1X0R A;  1M3J A;  3VWU A;  4V2M A;  2CVB A;  4DEJ A;  2VUP A;  4LMV A;  2LQO A;  1ML6 A;  4LA1 A;  3FYG A;  1AXD A;  4KSM A;  3FR6 A;  2CVK A;  1I9D A;  1CQH A;  2GDR A;  2HYX A;  1ZYP A;  2FY6 A;  2H1G A;  2WFC A;  2PWJ A;  2V2G A;  4GRF A;  6GSU A;  3R2Q A;  3FR9 A;  4GCI A;  3D22 A;  1SD8 A;  4JE1 A;  3H8Q A;  2V1M A;  1GSU A;  3GTU B;  1A2M A;  2CX3 A;  1JZD A;  2GTU A;  3DYR A;  4HZ2 A;  1PA3 A;  3ME8 A;  4XS1 A;  3SWL A;  2KUC A;  2YWI A;  2GZY A;  2WDU A;  3GH9 A;  4FQU A;  4RQR A;  3FEU A;  2YN1 A;  2GT5 A;  2B1L A;  2OKA A;  10GS A;  2IJY A;  3PR8 A;  3S9F A;  3US3 A;  4TXO B;  6GSY A;  3I9V 2;  3IV4 A;  1S3R A;  2VM2 A;  1X9M B;  3TJJ A;  2O7K A;  4MZC A;  1EP8 A;  1V9W A;  3TGZ A;  3QOU A;  4YKF A;  2O85 A;  4G19 A;  3APO A;  3IPZ A;  4K5S A;  4GQF A;  1JFU A;  2GQL A;  5F8B A;  4JR6 A;  3IBH A;  1KNG A;  1J08 A;  4WBJ A;  3C7M A;  2VL2 A;  2GSS A;  3L9V A;  2VIM A;  3PGT A;  1BG5 A;  3TJK A;  1WJK A;  1AQW A;  2HRA A;  4KAE A;  2C3N A;  3HVX A;  2L4Q A;  1VF2 A;  3LWA A;  2KLX A;  5KOW A;  3VPT A;  3GKN A;  1VGL A;  1SJ6 A;  1X9S B;  3F63 A;  4OWY A;  3C1R A;  3KEB A;  3KTL A;  4TR3 A;  3ZTL A;  1A8L A;  3UVH A;  1SK2 A;  2WGR A;  1GLQ A;  1QUW A;  1X5E A;  3LYP A;  5KEJ A;  3LSZ A;  2AJQ B;  1XWC A;  2GZP A;  4K7N A;  3ZIT A;  2VCW A;  5A4W A;  4EKZ A;  3GHA A;  2DC5 A;  1Z6N A;  1A24 A;  1V2A A;  3QDN A;  5CRE A;  1TP9 A;  3D6I A;  3NIV A;  4EDY A;  2CV4 A;  2O87 A;  4KDX A;  4MF5 A;  4NHW A;  2N5A A;  5HR2 A;  5J3R A;  3HDC A;  3WGX A;  4GF0 A;  3A2V A;  4ZBA A;  4GLT A;  3QAG A;  5ECP B;  4ZB9 A;  2QA2 A;  2HSY A;  3J7Y b;  1ABA A;  1YJ6 A;  3IHQ A;  2FWE A;  2C3T A;  2IWT A;  5GST A;  4BIK A;  1B9X C;  2VCZ A;  4TXV A;  4MZW A;  3EU3 A;  3C73 A;  3E3E A;  2HRK A;  2LRT A;  2N5B A;  1TRS A;  4PQH A;  2H0G A;  4HEA 2;  2NDO A;  2XPD A;  4D73 B;  5ECS A;  3ZFB A;  1IYI A;  4PUA A;  2JZS A;  4E8H A;  2DKH A;  4QL9 A;  4XTS A;  1SK0 A;  3RHC A;  1R26 A;  3LOR A;  2LEG A;  5IOX A;  2FWG A;  3HVS A;  1OYJ A;  3NOF A;  1XW9 A;  1M7T A;  3VWW A;  4I97 A;  3NZN A;  1G7E A;  3EVI A;  3TKS A;  2FGX A;  3QD9 A;  4Z2R A;  2JSZ A;  4X43 A;  2VLV A;  3HJO A;  1LBK A;  5F0G A;  3UAR A;  2LNS A;  2K6V A;  1TU7 A;  4ILF A;  4KX4 A;  1S3D A;  1T00 A;  2H1B A;  2WRT A;  2NVL A;  4Z7X A;  4TRX A;  4IQ1 A;  1PD2 1;  1TTZ A;  4MMM A;  5F07 A;  4JR4 A;  4LMW A;  1K0M A;  2EIO A;  2H72 A;  5H5Q A;  5AN1 A;  2RUE A;  3U6V A;  1RK4 A;  5KN0 A;  3DEX A;  3L0H A;  3MDK A;  1LJR A;  3PPU A;  1GWC A;  3ME7 A;  4Q5Q A;  2L6D A;  3UAP A;  2B7K A;  3HCZ A;  3IDV A;  3P7X A;  3FZ5 A;  1NW2 A;  4JRR A;  4MA9 A;  1SKW B;  4IW9 A;  2LV3 A;  2AYT A;  1CQG A;  2PGT A;  4KDY A;  4IJI A;  4BVY A;  3FR3 A;  5D96 A;  2G0F A;  3IAM 2;  3L78 A;  2QSI A;  2VLU A;  2X4A A;  4TR1 A;  2EIR A;  3GH6 A;  2YWM A;  3TJB A;  2WB9 A;  1SJI A;  3L4N A;  2HFD A;  4P3Y B;  2OE0 A;  5ECI B;  3HHV A;  4Q5R A;  5C00 A;  1XWB A;  3DKS A;  3WD6 A;  1KEB A;  1Z6M A;  4CDO A;  1FAA A;  2YZH A;  1WOU A;  2NPB A;  4NXI A;  5ECR B;  5IMF A;  3FKF A;  2OE1 A;  2ZCT A;  5IIZ A;  2XBQ A;  4G2E A;  5IO0 A;  2PUK C;  4OFN A;  3A2W A;  2H01 A;  1EGR A;  2MMA A;  2JSY A;  1YY7 A;  1GTI A;  1LU4 A;  2DJ2 A;  3MWH A;  4TVE A;  1R4W A;  2OAC A;  1JLW A;  1X5D A;  4F9Z A;  3TRP A;  3UMA A;  2FNO A;  1GUH A;  3H1N A;  2CQ9 A;  5INY A;  5A4U A;  1BX9 A;  4MCU A;  4ICY A;  1M9A A;  5HR1 A;  1SJZ A;  1S3C A;  4HU9 A;  2WCI A;  3CTG A;  2NBS A;  3QFB C;  4EL1 A;  4PTS A;  3C71 A;  1ERW A;  1O73 A;  4V1A g;  3D5J A;  2RM6 A;  3GX0 A;  5ID2 B;  2RLI A;  4MZB A;  1QGV A;  5KN2 A;  2FWF A;  3QAV A;  5H5R A;  1GUK A;  3GV1 A;  2IMD A;  2OA7 A;  3CRU A;  3FHK A;  5CRG A;  3M0F A;  2PER A;  3UIW A;  1MTC A;  3UBL A;  4MH2 A;  1M0U A;  3EPT A;  3TCO A;  5IOW A;  5D9W A;  1TRV A;  4ULX A;  4ECI A;  1W4V A;  3F4R A;  2R0G A;  3VUR A;  2J9H A;  2EC4 A;  2QC7 A;  4L0W A;  3DD3 A;  1Y25 A;  5GSS A;  2OBK A;  4MLY A;  2L6C A;  3VLN A;  1GSQ A;  2TRX A;  1A2L A;  4Q5N A;  4XRA A;  2VOC A;  4ZL8 A;  5JCW A;  1YEP A;  5IMZ A;  1OVN A;  4IEL A;  1UA5 A;  3HVN A;  4K5R A;  2IN3 A;  3IOS A;  2P5Q A;  1OKD A;  2F8F A;  1GNE A;  3VI7 A;  5E59 A;  4YQV A;  1S3A A;  4XIH A;  1N2A A;  5CNW A;  4G0L A;  3I6A A;  5JCG A;  4I2T A;  2DKI A;  3DVX A;  1A0R P;  2MBS A;  2YNX A;  5LNK e;  1K0C A;  4QQ7 A;  2CT6 A;  1ACV A;  2GQM A;  4MJB A;  2L4C A;  3SBC A;  1F37 A;  1XWG A;  4IHU A;  2YAN A;  4IBP A;  1ZOF A;  1TRW A;  1ERU A;  1XVQ A;  4BWQ A;  3TRQ A;  3Q19 A;  2DML A;  3KIJ A;  2B3S A;  1F3B A;  2IL3 A;  3C8E A;  2A4H A;  2H70 A;  3TRX A;  1GL8 A;  3IC4 A;  2H1D A;  4IS0 A;  2H0I A;  2B7J A;  5J9C A;  1TJD A;  1X9W B;  3M1G A;  2TIR A;  3I69 A;  3ED3 A;  3PH9 A;  1DBY A;  1MD4 A;  2HI7 A;  3LQ7 A;  3EE2 A;  1GTU A;  1ZYN A;  1PFO A;  3HY2 A;  5IQY A;  1SL2 B;  2H30 A;  2JL4 A;  3RPN A;  4O32 A;  2H76 A;  5AIV A;  1PX6 A;  4HU7 A;  1SL1 B;  1O7U A;  3H4K A;  4Q5F A;  2JAD A;  3UJ1 A;  5CP1 A;  3RAZ A;  2EIQ A;  12GS A;  1UVZ A;  1YQ1 A;  5ID2 A;  3IXR A;  1NM3 A;  3FRC A;  4N0V A;  3ZML A;  3F0I A;  5ELA A;  4I2U A;  2ON7 A;  2CVD A;  3FK8 A;  2V41 A;  3N9J A;  1XXU A;  1ZMA A;  4ZXG A;  4EDZ A;  3WYW A;  2VD0 A;  3FZ4 A;  3KZQ A;  1EV4 A;  5CO3 A;  3M9K A;  2CZ3 A;  2PN8 A;  1M99 A;  1QQ2 A;  2I9H A;  3Q74 A;  1ON4 A;  5DJL A;  4POL A;  1GSY A;  2E7P A;  2JZR A;  1A2J A;  4ISD A;  1EZK A;  5D9T A;  3MIX A;  3UVT A;  3QFA C;  4JZQ A;  1EOG A;  4PUR A;  1YKC A;  4JU5 A;  5DVB A;  1B48 A; 
#chains in the Genus database with same CATH homology
 5G1L A;  3ERG A;  2VCX A;  3APS A;  1PN9 A;  5G1K A;  2R0C A;  1JLV A;  1YF0 A;  4POK A;  4EXJ A;  4FYC A;  1IYH A;  3AY8 A;  4GSS A;  1THX A;  1MDI A;  6GSW A;  1XCC A;  1TKD B;  2HRN A;  1FHE A;  1AQX A;  1VF1 A;  1HQO A;  4GSN A;  2P5R A;  2VL3 A;  1XW6 A;  3IK7 A;  1EP7 A;  1J9B A;  3KM6 A;  5EL8 A;  2B5X A;  1K0D A;  3W6G A;  4BVY B;  4YKG A;  3DGQ A;  2DIZ A;  2PU9 C;  5DAL B;  4TR1 B;  1ZGN A;  4KW6 A;  2LJA A;  4WXT A;  5KN1 A;  4K0G A;  4F82 A;  2CA8 A;  2LQQ A;  4WR5 A;  5D73 A;  4NV5 A;  2C0E A;  2YV9 A;  1FVJ A;  4OCE A;  4XCS A;  2GS3 A;  4MH3 A;  2R37 A;  3ZIJ A;  4YQM A;  1DE2 A;  2MMN A;  1MEK A;  3IR4 A;  3A5I A;  4WET A;  1T7P B;  3WGE A;  2B5Y A;  4HQS A;  1YDK A;  1AIU A;  5DQY A;  5BMU A;  2P0G A;  4LL1 B;  1OE8 A;  3APQ A;  6GSS A;  1TDI A;  3U5R E;  3TDG A;  1PKW A;  2DSA A;  4MJC A;  1Y6E A;  2ON5 A;  1SK1 A;  1AW9 A;  1H4O A;  3HXS A;  2LKU A;  2FUG 2;  2HNL A;  1XOA A;  1WPI A;  2MYG A;  3DVW A;  1FVK A;  5G2Z A;  4ZIL A;  1A23 A;  3HZ4 A;  5DJM A;  2YWN A;  5GAP D;  4KSO A;  1GSE A;  1T4Y A;  3IAS 2;  4ZBD A;  2H6Y A;  4XS6 A;  3LXT A;  3A5W A;  5HFK A;  2H71 A;  1ZYQ B;  1OE7 A;  4NV2 A;  5IO2 A;  2OE3 A;  4OFT A;  4OO5 A;  1A8Y A;  1EWX A;  1W89 A;  2VLT A;  3TB2 A;  5CAX A;  1EGO A;  4KA0 A;  2H75 A;  4HDE A;  1JZR A;  3ZL5 A;  3KMO A;  1R7H A;  2N5F A;  1ZCP A;  2YJ7 A;  4F03 A;  5HFG A;  2KHP A;  2LNT A;  3KCM A;  1T4Z A;  2LRC A;  2UZ8 A;  3H79 A;  5EPF A;  2FCH A;  2C0D A;  3TKQ A;  3TJF A;  2IMI A;  1JHB A;  4GTU A;  1SYR A;  1TRU A;  3GST A;  2DJK A;  1TU8 A;  3F3R A;  5FWG A;  3C1S A;  4MJE A;  1PSQ A;  5CYY A;  4BA7 A;  2GSR A;  1HNB A;  1MD3 A;  3L9S A;  4EE0 A;  4RUV A;  5DAL A;  5IPH A;  4I8B A;  4X4J A;  2GLR A;  4H86 A;  1WE0 A;  3F4T A;  2DJ3 A;  1UC7 A;  3M8N A;  5G31 A;  2YCD A;  3E0U A;  5D9V A;  4KE3 A;  3J7Y k;  1BYE A;  4BVX A;  1GSD A;  5HFI A;  3A2X A;  3DIE A;  1DSB A;  3FZ9 A;  1K0O A;  3HA9 A;  3UEM A;  1HNC A;  5ECL B;  1F6M C;  2I4A A;  5H5S A;  3V1W A;  3ISO A;  2H66 A;  17GS A;  4FYU A;  4BL7 A;  6GSV A;  1SU9 A;  4PUF C;  2F3M A;  2FA8 A;  3HVV A;  2X8C A;  2D2Z A;  3GL3 A;  2R0P A;  4O5Q A;  4AGS A;  4WEY A;  2LS5 A;  1GUL A;  3RPP A;  2GVP A;  1Q98 A;  4ZIJ A;  1HD2 A;  5LCZ A;  3GN3 A;  5B6N A;  1SEN A;  1M2B A;  3ERF A;  3TKS C;  1WP0 A;  3ZLP A;  2C80 A;  2B1K A;  4K1F A;  2ALB A;  1G6Y A;  2X64 A;  3GX8 A;  2B6M A;  2QA1 A;  2ES7 A;  2H6Z A;  1MDJ A;  2LST A;  2R6K A;  5COH A;  1FOH A;  5G30 A;  1PRX A;  1TK5 B;  3ZFL A;  4V2L A;  2YJH A;  1GSF A;  2Z9S A;  1M9B A;  4XRD A;  4ZB6 A;  1E6B A;  1N8J A;  1GRX A;  5B6M A;  4DSS A;  2VM1 A;  3EYT A;  4LLR A;  1OC9 B;  4MPF A;  4ECJ A;  2MZC A;  4LL4 B;  5HQP A;  2AV4 A;  2NTO A;  4HI7 A;  5B8B A;  4EC0 A;  2HZE A;  5CRD A;  1PX7 A;  2GST A;  3L9U A;  1BJX A;  3HD5 A;  5ABR A;  4I5Q A;  5ECK B;  1QK8 A;  2M46 A;  3BD2 A;  3EMP A;  1ZZY A;  4YH2 A;  4AJ7 A;  1U6T A;  1PL1 A;  5GAN D;  3VFI A;  2BTO T;  2KOK A;  2YV7 A;  2CX4 A;  4OO4 A;  1J0F A;  7GSS A;  1SKS B;  5JWQ B;  4X0X A;  2JZT A;  4NMU A;  3EMX A;  3RHB A;  1VRS D;  5F06 A;  1BAY A;  1KTE A;  4TKY A;  4F0B A;  3CSJ A;  3QPM A;  5DCH A;  1HYU A;  5FT3 A;  2RUF A;  1V58 A;  4BWS A;  3IA1 A;  1HNA A;  1JZO A;  1DE1 A;  1KBN A;  5ECO B;  2WS2 A;  3DRN A;  2GGT A;  4ML6 A;  3IE3 A;  4MF7 A;  3ZRD A;  9GSS A;  3EWL A;  3F3Q A;  5KN3 A;  1Z9H A;  3BCI A;  4L0U A;  5EY6 A;  4HZ4 A;  1OAZ A;  4CY8 A;  1VF4 A;  3MNG A;  1EEJ A;  2J23 A;  3LG6 A;  4BPY A;  2DJJ A;  1SL0 B;  1WWJ A;  2H8L A;  2X8H A;  4POM A;  2R5G A;  2I1U A;  2C3Q A;  4JBB A;  4RI7 A;  4X1U A;  3F4S A;  4HJM A;  5JCU A;  4AJ8 A;  2AB6 A;  1THO A;  2K18 A;  2GZZ A;  1MDK A;  3M9J A;  2B5E A;  3ZVJ A;  2AUV A;  1V40 A;  2AAW A;  3FZA A;  1K3Y A;  4HOJ A;  4EUY A;  1Q4J A;  2PMT A;  14GS A;  3GA4 A;  3GRX A;  2LJK A;  3LYK A;  3GNJ A;  2VAF A;  4A5P A;  1K3L A;  2X8G A;  3ERW A;  4N0Z A;  4FIW A;  2V6K A;  1QFN A;  4ACS A;  4G0K A;  5IPG A;  4F2I A;  3KP9 A;  4O92 A;  3WGD A;  3O3T A;  1PGT A;  3GMF A;  2YOI A;  2G2Q A;  2K8V A;  2DIY A;  2I81 A;  1U87 A;  4MDC A;  3UBK A;  2YWO A;  4OFM A;  22GS A;  1BED A;  1G6W A;  1TXX A;  1T1V A;  2LUS A;  2FHE A;  8GSS A;  1NHO A;  1SD9 A;  1B4Q A;  1OC9 A;  3O6T A;  2VL9 A;  1FB6 A;  1JZW A;  2MMZ A;  4YAP A;  1TK0 B;  4IN0 A;  2IMF A;  1YF1 A;  2H19 A;  1H75 A;  4MNN A;  4CY6 A;  3VWV A;  4RQX A;  2K9F A;  5IMD A;  1F3A A;  3LXZ A;  3IK9 A;  4J56 E;  1T3B A;  3KMN A;  2C4J A;  1Z3E A;  2P31 A;  4N30 A;  2WJU A;  2X99 A;  4PXO A;  3UL3 A;  1VF3 A;  4XS4 B;  2K8S A;  4O7H A;  3FW2 A;  2BMX A;  5DAK A;  4GST A;  3TKR A;  4O5U A;  4L8E A;  1RQM A;  1URM A;  2FA4 A;  4L5L A;  4QL7 A;  4OCF A;  3JCM L;  2O89 A;  3IHG A;  5JWR B;  1OC8 A;  4AJ6 A;  5ELG A;  3GSS A;  13GS A;  2DMM A;  1G0T A;  5ECM B;  1BQ7 A;  4HQZ A;  2HSM A;  3DML A;  4I6X A;  4PQI A;  4RI6 A;  2R4V A;  3LFL A;  3TOT A;  4FH8 A;  2WZ9 A;  3HKR A;  1FG4 A;  2IFQ A;  4ML1 A;  4YAV A;  2KP1 A;  3A3T A;  4PNF A;  2H74 A;  4N10 A;  3G9B A;  4PX1 A;  2RII A;  3R3E A;  2MBT A;  16GS A;  1TOF A;  2H1A A;  1NHY A;  2M80 A;  5J4U A;  3K8N A;  1M2D A;  1V98 A;  4BVX B;  2DJ0 A;  4DSR A;  4AF2 A;  1YEX A;  4OD7 A;  4N11 A;  1TI3 A;  4ZL9 A;  1K0B A;  3LGC A;  1ILO A;  1E2Y A;  2XPE A;  2HRF A;  4WKW A;  1FO5 A;  3KH7 A;  2FWH A;  5D9X A;  3ZMK A;  2M72 A;  1USB A;  4BL7 B;  3GKK A;  3I43 A;  1GSS A;  2HSH A;  4GQC A;  3P90 A;  5KOX A;  18GS A;  2V6O A;  3CMI A;  5B8A A;  1B9Y C;  4WF4 A;  5J5N A;  2F9S A;  2PVQ A;  2QKE A;  1I5G A;  3F6D A;  1OC3 A;  3GIX A;  2CAI A;  2QGV A;  5A4V A;  4PQ1 A;  1FOV A;  4Z2U A;  1B8X A;  1TW9 A;  4E8E A;  1U88 A;  1EEM A;  3IC8 A;  5GZZ B;  2KP2 A;  1GLP A;  3WT2 A;  4K7I A;  3G7J A;  2L59 A;  4TR4 A;  4PNG A;  5CRH A;  2HT9 A;  4IP1 A;  3TJG A;  1XW5 A;  5IM9 A;  2RM5 A;  4IKH A;  3MYD A;  4K9Z A;  3HZ8 A;  3D21 A;  3KJY A;  2JU5 A;  5ECH B;  3GYK A;  4TOP A;  2DJ1 A;  3GTU A;  1T8E B;  1DUG A;  2IMK A;  2C8U A;  4IGJ A;  2FLS A;  1ERT A;  3BBY A;  2HE3 A;  4ZBB A;  4ID0 A;  1F9M A;  1U3A A;  1TI1 A;  4EO3 A;  3W8J A;  2OJL A;  4DSS B;  2O8V B;  2VL2 C;  2XC2 A;  2A2S A;  4XS4 A;  4TR0 A;  3TKS E;  2DLX A;  1ST9 A;  3DXB A;  3E9J B;  5IMC A;  3KD0 A;  2HXK A;  3CXG A;  5D93 A;  3P8W A;  3KGK A;  1FB0 A;  3D4M A;  4CHS A;  3QMX A;  4V2N A;  2C0G A;  3KTB A;  2X49 A;  2HZE B;  3QAW A;  5G5E A;  4TXO A;  3RBT A;  2YP6 A;  4KCA A;  4K7O A;  4K0N A;  1AC1 A;  2E0Q A;  5FHI A;  1ZL9 A;  1A0F A;  4KB3 A;  5JWO B;  2L5O A;  19GS A;  3HJP A;  1XOB A;  3GL5 A;  3OR5 A;  2VO4 A;  5AGY A;  1O81 A;  2R2J A;  5HR0 A;  3ZVJ D;  5IMA A;  2VCT A;  5DDL A;  4IJ3 A;  4MF6 A;  2HZF A;  2VCQ A;  3FY7 A;  1PN0 A;  5L71 A;  3BJ5 A;  3HJM A;  5E4W A;  5A5K A;  2LTK A;  3FMW A;  3TUE A;  1SKR B;  3Q18 A;  1O85 A;  2F51 A;  2V32 A;  3QR6 A;  2OAD A;  3RDW A;  3GKX A;  3Q6O A;  2H0H A;  4XHM A;  4FYB A;  5C04 A;  5D8I A;  4IP6 A;  4POB A;  1GNW A;  3GUS A;  2HLS A;  2IIY A;  4DSQ A;  2GQK A;  4IQA A;  3KH9 A;  4EVM A;  1ERV A;  5ECN B;  2OBI A;  1R5P A;  5ECQ B;  3BOA A;  1AQV A;  1GUM A;  2H6X A;  3CTF A;  4DVC A;  4KDU A;  2REM A;  5BRT A;  1M2A A;  3WT1 A;  4EIQ A;  2CAQ A;  2YZU A;  4TN8 A;  4KF9 A;  5DQS A;  1WMJ A;  2A2P A;  3QCP A;  4PGT A;  3KP8 A;  4OMV A;  3F6F A;  5F05 A;  2FD3 A;  1WRY A;  4K8M A;  2PBJ A;  4TW5 A;  4KGI A;  1AAZ A;  3VPQ A;  2DBC A;  4D73 A;  1PL2 A;  1X5C A;  1GP1 A;  3G7I A;  4MP4 A;  2E2G A;  3EC3 A;  4ECC A;  3EUR A;  4Z2T A;  1U3I A;  2I3Y A;  3M3M A;  4ZL7 A;  4WR4 A;  4CW9 A;  3MAK A;  4KUN A;  3ZZX A;  1XIY A;  1ZYE A;  2CZ2 A;  3LW9 A;  4GWR A;  4HS1 A;  20GS A;  5ENU A;  2TRC P;  4F0C A;  1B4P A;  2E2M A;  5AIX A;  2BJX A;  4WBR D;  1WIK A;  1F2E A;  1RW1 A;  4O5R A;  1GTB A;  1FW1 A;  1XVW A;  3DWV A;  4HJ2 A;  1O6J A;  4USS A;  5IMV A;  4G0I A;  2AHE A;  3CSH A;  3ZRE A;  4HUA A;  3KXO A;  1Z7P A;  6GSX A;  2H73 A;  3CYN A;  2R3X A;  4V1A p;  3N5O A;  2LRN A;  4EIP A;  2YPM A;  3D0Z A;  5DCG A;  4NHZ A;  2VD1 A;  1QXH A;  1XWA A;  4J2F A;  5AIS A;  5EVO A;  3VI5 A;  4G9H A;  3LEF A;  1EV9 A;  3EIN A;  4G10 A;  2JAC A;  2L5L A;  3BCK A;  3MSZ A;  4K6X A;  1O8X A;  4MPG A;  4NAX A;  3F8U A;  3IRA A;  3F9U A;  5DAK B;  4YQU A;  2ZUP A;  1V57 A;  1YZX A;  1O8W A;  3VWX A;  4GXZ A;  1C72 A;  1G7O A;  1Z7R A;  5HR3 A;  6GST A;  11GS A;  4MAB A;  3D4T A;  1XWK A;  5DBQ A;  5LD0 A;  2GT6 A;  1YKA A;  2WUL A;  3CSI A;  4J57 E;  4KND A;  2XBI A;  3EU4 A;  1PMT A;  2ZNM A;  1K0A A;  1K0N A;  2A2R A;  3CBU A;  3G7Y A;  4WF5 A;  2C0F A;  2PPT A;  2C1Y A;  4MK3 A;  1XFL A;  5J9B A;  2MMO A;  3VK9 A;  4JED A;  1PQN A;  3PIN A;  1NSW A;  1PKZ A;  3TKP A;  2LJR A;  1XZO A;  4IVF A;  2IFQ B;  1GTA A;  3W8S A;  4EF0 A;  1TK8 B;  4FO5 A;  3CRT A;  5J41 A;  3H93 A;  5CRW A;  2PVO C;  1R5A A;  2GSQ A;  2IPA A;  3LJR A;  2IME A;  1QMV A;  3UOM A;  1GH2 A;  3HYP A;  4NWY A;  1Z5Y E;  3GKM A;  4K2X A;  1XPV A;  3P2A A;  1XBS A;  1EOH A;  4K2D A;  4NPB A;  2F8A A;  1K3O A;  1OKT A;  5G5F A;  4L5O A;  3O76 A;  3GFK A;  5B7C A;  1AUC A;  4KH7 A;  3GUR A;  2XHF A;  1UN2 A;  3ZIV A;  2L57 A;  4ZB8 A;  2VCV A;  4ECB A;  2A4V A;  4MJA A;  3TOU A;  4KCE A;  3ZYW A;  1SYX A;  1X0R A;  3VWU A;  4V2M A;  2CVB A;  4DEJ A;  2VUP A;  4LMV A;  2LQO A;  1ML6 A;  4LA1 A;  3FYG A;  1AXD A;  4KSM A;  3FR6 A;  2CVK A;  1I9D A;  1CQH A;  2GDR A;  2HYX A;  1ZYP A;  2FY6 A;  2H1G A;  2WFC A;  2PWJ A;  2V2G A;  4GRF A;  6GSU A;  3R2Q A;  3FR9 A;  4GCI A;  3D22 A;  1SD8 A;  4JE1 A;  3H8Q A;  2V1M A;  1GSU A;  3GTU B;  1A2M A;  2CX3 A;  1JZD A;  2GTU A;  3DYR A;  4HZ2 A;  1PA3 A;  3ME8 A;  4XS1 A;  3SWL A;  2KUC A;  2YWI A;  2GZY A;  2WDU A;  3GH9 A;  4FQU A;  4RQR A;  3FEU A;  2YN1 A;  2GT5 A;  2B1L A;  2OKA A;  10GS A;  2IJY A;  3PR8 A;  3S9F A;  3US3 A;  4TXO B;  6GSY A;  3I9V 2;  3IV4 A;  2VM2 A;  1X9M B;  3TJJ A;  2O7K A;  4MZC A;  1EP8 A;  1V9W A;  3TGZ A;  3QOU A;  4YKF A;  2O85 A;  4G19 A;  3APO A;  3IPZ A;  4K5S A;  4GQF A;  1JFU A;  2GQL A;  5F8B A;  4JR6 A;  3IBH A;  1KNG A;  1J08 A;  4WBJ A;  3C7M A;  2VL2 A;  2GSS A;  3L9V A;  2VIM A;  3PGT A;  1BG5 A;  3TJK A;  1WJK A;  1AQW A;  2HRA A;  4KAE A;  2C3N A;  3HVX A;  2L4Q A;  1VF2 A;  3LWA A;  2KLX A;  5KOW A;  3VPT A;  3GKN A;  1VGL A;  1SJ6 A;  1X9S B;  3F63 A;  4OWY A;  3C1R A;  3KEB A;  3KTL A;  4TR3 A;  3ZTL A;  1A8L A;  3UVH A;  1SK2 A;  2WGR A;  1GLQ A;  1QUW A;  1X5E A;  3LYP A;  5KEJ A;  3LSZ A;  2AJQ B;  1XWC A;  2GZP A;  4K7N A;  3ZIT A;  2VCW A;  5A4W A;  4EKZ A;  3GHA A;  2DC5 A;  1Z6N A;  1A24 A;  1V2A A;  3QDN A;  5CRE A;  1TP9 A;  3D6I A;  3NIV A;  4EDY A;  2CV4 A;  2O87 A;  4KDX A;  4MF5 A;  4NHW A;  2N5A A;  5HR2 A;  5J3R A;  3HDC A;  3WGX A;  4GF0 A;  3A2V A;  4ZBA A;  4GLT A;  3QAG A;  5ECP B;  4ZB9 A;  2QA2 A;  2HSY A;  3J7Y b;  1ABA A;  1YJ6 A;  3IHQ A;  2FWE A;  2C3T A;  2IWT A;  5GST A;  1B9X C;  2VCZ A;  4TXV A;  4MZW A;  3EU3 A;  3C73 A;  3E3E A;  2HRK A;  2LRT A;  2N5B A;  1TRS A;  4PQH A;  2H0G A;  4HEA 2;  2NDO A;  2XPD A;  4D73 B;  5ECS A;  3ZFB A;  1IYI A;  4PUA A;  2JZS A;  4E8H A;  2DKH A;  4QL9 A;  4XTS A;  1SK0 A;  3RHC A;  1R26 A;  3LOR A;  2LEG A;  5IOX A;  2FWG A;  3HVS A;  1OYJ A;  3NOF A;  1XW9 A;  1M7T A;  3VWW A;  4I97 A;  3NZN A;  1G7E A;  3EVI A;  3TKS A;  2FGX A;  3QD9 A;  4Z2R A;  2JSZ A;  4X43 A;  2VLV A;  3HJO A;  1LBK A;  5F0G A;  3UAR A;  2LNS A;  2K6V A;  1TU7 A;  4ILF A;  4KX4 A;  1S3D A;  1T00 A;  2H1B A;  2WRT A;  2NVL A;  4Z7X A;  4TRX A;  4IQ1 A;  1PD2 1;  1TTZ A;  4MMM A;  5F07 A;  4JR4 A;  4LMW A;  1K0M A;  2EIO A;  2H72 A;  5H5Q A;  5AN1 A;  2RUE A;  3U6V A;  1RK4 A;  5KN0 A;  3DEX A;  3L0H A;  3MDK A;  1LJR A;  3PPU A;  1GWC A;  3ME7 A;  4Q5Q A;  2L6D A;  3UAP A;  2B7K A;  3HCZ A;  3IDV A;  3P7X A;  3FZ5 A;  1NW2 A;  4JRR A;  4MA9 A;  1SKW B;  4IW9 A;  2LV3 A;  2AYT A;  1CQG A;  2PGT A;  4KDY A;  4IJI A;  4BVY A;  3FR3 A;  5D96 A;  2G0F A;  3IAM 2;  3L78 A;  2QSI A;  2VLU A;  2X4A A;  4TR1 A;  2EIR A;  3GH6 A;  2YWM A;  3TJB A;  2WB9 A;  1SJI A;  3L4N A;  2HFD A;  4P3Y B;  2OE0 A;  5ECI B;  3HHV A;  4Q5R A;  5C00 A;  1XWB A;  3DKS A;  3WD6 A;  1KEB A;  1Z6M A;  4CDO A;  1FAA A;  2YZH A;  1WOU A;  2NPB A;  4NXI A;  5ECR B;  5IMF A;  3FKF A;  2OE1 A;  2ZCT A;  5IIZ A;  2XBQ A;  4G2E A;  5IO0 A;  2PUK C;  4OFN A;  3A2W A;  2H01 A;  1EGR A;  2MMA A;  2JSY A;  1YY7 A;  1GTI A;  1LU4 A;  2DJ2 A;  3MWH A;  4TVE A;  1R4W A;  2OAC A;  1JLW A;  1X5D A;  4F9Z A;  3TRP A;  3UMA A;  2FNO A;  1GUH A;  3H1N A;  2CQ9 A;  5INY A;  5A4U A;  1BX9 A;  4MCU A;  4ICY A;  1M9A A;  5HR1 A;  1SJZ A;  1S3C A;  4HU9 A;  2WCI A;  3CTG A;  2NBS A;  3QFB C;  4EL1 A;  4PTS A;  3C71 A;  1ERW A;  1O73 A;  4V1A g;  3D5J A;  2RM6 A;  3GX0 A;  5ID2 B;  2RLI A;  4MZB A;  1QGV A;  5KN2 A;  2FWF A;  3QAV A;  5H5R A;  1GUK A;  3GV1 A;  2IMD A;  2OA7 A;  3CRU A;  3FHK A;  5CRG A;  3M0F A;  2PER A;  3UIW A;  1MTC A;  3UBL A;  4MH2 A;  1M0U A;  3EPT A;  3TCO A;  5IOW A;  5D9W A;  1TRV A;  4ULX A;  4ECI A;  1W4V A;  3F4R A;  2R0G A;  3VUR A;  2J9H A;  2EC4 A;  2QC7 A;  4L0W A;  3DD3 A;  1Y25 A;  5GSS A;  2OBK A;  4MLY A;  2L6C A;  3VLN A;  1GSQ A;  2TRX A;  1A2L A;  4Q5N A;  4XRA A;  2VOC A;  4ZL8 A;  5JCW A;  1YEP A;  5IMZ A;  1OVN A;  4IEL A;  1UA5 A;  4K5R A;  2IN3 A;  3IOS A;  2P5Q A;  1OKD A;  2F8F A;  1GNE A;  3VI7 A;  5E59 A;  4YQV A;  1S3A A;  4XIH A;  1N2A A;  5CNW A;  4G0L A;  3I6A A;  5JCG A;  4I2T A;  2DKI A;  3DVX A;  1A0R P;  2MBS A;  2YNX A;  5LNK e;  1K0C A;  4QQ7 A;  2CT6 A;  1ACV A;  2GQM A;  4MJB A;  2L4C A;  3SBC A;  1F37 A;  1XWG A;  4IHU A;  2YAN A;  4IBP A;  1ZOF A;  1TRW A;  1ERU A;  1XVQ A;  4BWQ A;  3TRQ A;  3Q19 A;  2DML A;  3KIJ A;  2B3S A;  1F3B A;  2IL3 A;  3C8E A;  2A4H A;  2H70 A;  3TRX A;  1GL8 A;  3IC4 A;  2H1D A;  4IS0 A;  2H0I A;  2B7J A;  5J9C A;  1TJD A;  1X9W B;  3M1G A;  2TIR A;  3I69 A;  3ED3 A;  3PH9 A;  1DBY A;  1MD4 A;  2HI7 A;  3LQ7 A;  3EE2 A;  1GTU A;  1ZYN A;  3HY2 A;  5IQY A;  1SL2 B;  2H30 A;  2JL4 A;  3RPN A;  4O32 A;  2H76 A;  5AIV A;  1PX6 A;  4HU7 A;  1SL1 B;  1O7U A;  3H4K A;  4Q5F A;  2JAD A;  3UJ1 A;  5CP1 A;  3RAZ A;  2EIQ A;  12GS A;  1UVZ A;  1YQ1 A;  5ID2 A;  3IXR A;  1NM3 A;  3FRC A;  4N0V A;  3ZML A;  3F0I A;  5ELA A;  4I2U A;  2ON7 A;  2CVD A;  3FK8 A;  2V41 A;  3N9J A;  1XXU A;  1ZMA A;  4ZXG A;  4EDZ A;  3WYW A;  2VD0 A;  3FZ4 A;  3KZQ A;  1EV4 A;  5CO3 A;  3M9K A;  2CZ3 A;  2PN8 A;  1M99 A;  1QQ2 A;  2I9H A;  3Q74 A;  1ON4 A;  5DJL A;  4POL A;  1GSY A;  2E7P A;  2JZR A;  1A2J A;  4ISD A;  1EZK A;  5D9T A;  3MIX A;  3UVT A;  3QFA C;  4JZQ A;  1EOG A;  4PUR A;  1YKC A;  4JU5 A;  5DVB A;  1B48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...