5C08D

1e6 tcr in complex with hla-a0e carrying rqwgpdpaav
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
189
structure length
189
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 26
structure length 189
sequence length 189
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08D02
4NN7C 3W0WD 2XKUA 1NLBL 4Z95L 3RGVB 3SJVE 3HZVB 2XN9A 3HAEB 4DGYL 1RZFH 2J6EL 1NPUA 4U1HB 3HPJB 1OP3H 3RY5A 4BH8A 1A7PL 3W81A 5I2IB 3QEUB 2MKWA 1RU9L 5C6TH 1BIIB 1M05B 3NH7H 1KLFA 1CDYA 3DO7A 1Z9OA 3MUGB 4D0BB 3CDCA 4YBHA 1E4WH 5FV1L 5HI5D 3DUSA 1MI5B 2FL5A 3IDJB 3QUXC 4IS6B 4E0RB 4O5LH 3X17A 5I8EB 1Q0YL 4EI5A 2B1AH 2UWEE 4H25B 3QQ3A 2DTML 4HAFA 5F9JA 3VWKB 3MRNB 5ITFA 4PJIF 1A1NA 5JQ6L 3NIFE 4Y16C 4R7DB 1MAML 3GMOB 4LLYA 2ZOKA 4OLYH 4RGNE 1IGIL 3HI5H 2J6EH 4ODXB 4PJXB 1MRFL 3QXTA 3RPIA 5LKNA 4MLIA 1CG9B 5I6XB 4MSWB 4K3HA 4AZ8A 5IBUG 5ENWB 2Y06L 3QIUD 4YHLH 2FX8H 5JW4M 1A6AB 4GW4B 4QY8B 1DFBL 3SY0B 1TIUA 5KSAA 2Y5TB 3S5LG 4NDMB 2BC4B 4NKIH 2ZPKL 1YNKH 4P9ML 5KW9L 2NPLX 4H20L 2R2HB 3QFDB 2I5YH 1QSEE 2R0KL 5DQJA 5IOPA 4HWZB 1BBJB 2EYRA 2XWJA 4WI8A 1OARH 3AS2A 2YUZA 1X5IA 3DX8B 2FX8L 3AREB 1JZ7A 2EDDA 3EYQC 3O11A 3ULVE 5I6XC 3WFBH 3ARYA 3IDMB 1DUZA 2OS7A 4YHLL 2JJSA 4Z0BH 1HSBA 3GB7B 4Y4KD 5CILH 5EBLA 4F3FA 2F53B 4PRDB 1DLHB 1FFPA 1T80A 2VZ1A 3FT4B 5CBAB 3CU1A 3MBEA 1RHFA 2ARJQ 2HVJB 5EOCJ 3RU8L 2VERN 3C09C 5I17B 5C0CE 5CEZD 4UNUA 4HGMA 1YNTA 2I9TB 4MWFA 1CT8B 3VXRA 2GSGA 1BD2B 2DQCL 1NANI 1D9KA 4EEEA 4K2UL 2ZCKH 3O3UN 4P4KC 5EFIB 5C0NC 3W82A 3QPXL 4G8EB 3TBTB 1H8SA 4DZBB 3UO1L 1UKQA 2CRMA 1U95A 1QRNA 5JIPA 1QBLL 4LRNL 4TVPH 2O5ZL 5F7LB 1LE5B 1FORL 4GMTH 4KQ4L 2V7HA 4FXKB 3RL1A 2RQ8A 3QIWD 2ZG2A 1A7NH 4KQ4H 4CKVX 1MFNA 2F5BL 4XTRC 1IC5H 4CVUA 2EZ0C 1OSPH 4YX2L 3CDYA 2ZSWA 4OZHA 1YQVH 4U7MA 4NN5C 3T0ED 3Q6FB 1T2QL 4KI5E 5F6IC 5KANG 5BRZE 3GM0A 2I07A 2VQUA 3B2UD 4HH8A 5DUPH 5F8QC 2PO6D 3IXAB 1MOEA 1P7KB 2R4RH 2M26A 4QRPD 1ZHKB 1I7TA 2J5LB 3O4LD 3FOLB 4QRSB 4Q9RH 2AI0L 2GTZB 1E27A 3HZVA 2F9BT 3OG4B 4M7JH 4PGDB 5HYJD 3I85A 4ZUTA 1WITA 1E4KA 4WVRA 2HN7A 2Y72A 3QXAB 5GRVL 1W72B 1I8LA 2C3VA 5IWLC 3MRPA 2N7BA 1IL1B 4X4ZA 3QHZL 4NT6B 4HDIA 3MUGA 4D0BA 2F54B 1D3CA 1CFTB 3QJHB 5JPNA 5JLZB 3FO1A 4Y4FA 4IOFD 1N3NB 5EIIA 2EDTA 1RIVH 5KS9F 3C6LD 3ZDYE 1MRDH 5FGCE 4NHUA 4GRWH 4ENED 1AY1L 3C2SA 3QQ3B 5F9JB 1G9EA 1J1OL 1TLKA 2V7NB 1I8KA 1INDL 2Z31D 5DHYB 25C8L 1CQKA 3IFLL 4QTIL 1MCWW 5KOVC 3LZFH 1YEKH 4XC3L 4PY7A 3QHZH 3O3EA 3JZ7A 1UWXK 3V4PL 3EYFB 4Q2ZA 1DQDH 2VH5H 4BFBD 3GMMA 4ZAKC 5TDPA 1P9MA 2EIBA 1MI5D 2XN9D 2P45B 3TJHD 4LF3A 3QHFH 4NIKB 5CWSA 5DWUH 5EZOL 3QDMA 2X05A 2Z8SA 4XNQA 4PJIA 5E99H 4CADB 1CFQA 5GQBA 1EIBA 5C0BA 5IEHB 2V9QA 2IH1A 2ICEA 4MVBD 4GFTB 3WYRA 1OP5H 1AI1L 1OAQH 4OQTA 4WHCA 3S3JA 5HD8C 4MB3A 3CFKB 2XYCA 3O11B 1QLRB 4HSQA 1U8OB 3TBYA 3FOMA 5FYKE 4O2CA 1UCTA 3MJ9A 5HTSA 1S7UA 3BGFC 3Q5OA 3LPGA 3O6KH 1RZGB 3S35L 5I18L 5DJ6B 1UCBL 1N7MH 3RX5A 2DICA 2AABH 2MQCA 3MA9H 2VE6A 4UV7H 3WN5C 1S9XA 4RZCB 3GBLA 4LCIH 1YEEH 1Q9WA 1DLFL 2HWZH 4N0UE 3C6LA 4G8FB 4JFXA 3LN4B 4P9HH 3DXAD 3FCTB 4RGMC 4KXZH 3T2PA 4CDHA 3B9VA 5IMOB 4XP6H 2NY2D 2EDXA 4MJ5B 1I9RL 1BM3H 5GISH 3BPNC 4ELME 3CVHL 1NAML 1BX2A 3FONA 4R0LA 4MMZC 4R26L 1U95B 3QH3B 4AENB 2CDFA 4M1GL 3BKMH 1MJ8L 2HMIC 4FXGB 5L7XH 4P4KD 2Z8WC 1YJDL 3MLYH 3I6GA 4MA7H 3O4LB 2RBLA 3EHBD 3ZE1E 4Z7UE 4HX1A 4MXWH 4XNUL 4XGZB 3WUWA 1BIIA 4P0DA 1M05A 3CCHB 2F54D 4PJ7E 1QLEL 3K74B 4NQDE 5BS0E 5F9WB 3UPRA 1BOGA 1VEOA 2OP4L 5FECB 2O61B 1XGQB 3WJJA 1CL7L 3MLYL 4MA7L 4NJAH 4ZXBD 4OB5L 1UA6H 1YDPB 1UC6A 3RWGB 3DMMB 2RJMA 4Z78B 8FABA 4JFFA 3EYQD 3LN5A 5D72L 1CL7H 4JFHE 3AY4C 1KB5B 1LO0H 4PRIE 1AGBB 1Q38A 3EOTL 4OCYL 4P2QD 4OGYL 2CKBA 4PGDA 4ZUTB 3MSPA 4HCRA 2EIDA 1T1YA 4WU5A 2X4OB 5IMMB 5FYJD 5IB5B 3QI9A 1MLCA 1A64A 3M1BB 5T5FH 5C0BE 4O9HL 4A6YL 5D96B 1HINL 4M3JA 5CP3H 5IT2L 3RVVD 2R2HA 3DETC 5DUMH 1RUAL 2OJZH 2EE2A 2H6PA 3F7PC 4J2XA 3ARXA 5EU6B 1YNLH 3N0PB 2W1NA 4Y16D 3CX2A 3OPZH 4P2YA 3SGKC 3JWDL 4MAYD 4KVNH 1AO7A 2BVQA 4B7IA 1MJUL 1YYLH 1WIPA 2EE3A 4JQIH 4WW2A 4DVBB 3RNQB 4DAGH 1NGXA 4N8PA 4F15B 4X6DA 3B5TA 2VR9A 4QRPA 4FQ1L 2Z91A 4PGZA 3OAUL 5I0DA 4G3YL 1P5VA 1LDPH 2GY5A 5ETUB 1AR2A 4N5UA 4GUPA 4I3RH 5DD0H 1RZ8A 4ONFH 2E9BA 4UT9L 2ICEB 3P4NB 2JIXD 5ICYB 1LO4H 4LPVA 2GCYA 3BWAA 1ZLVK 5KSBB 4KRPB 4KFZC 3T0AA 1MJ7L 4G9DA 1Q9LA 3D3VB 3PGDA 5IB3B 5T1MB 3JVGC 4Z7WE 3RY6C 3ZDZF 2WWKT 1D6VL 3TN0A 2VLJE 3N9GL 4FG6D 3MRKB 3MUJA 1XGUB 3G04B 1U8MB 1DEEA 1ZS8A 4OLUL 3VE0A 1MCOL 3RDTD 4CBPA 2H26B 3F7QA 3MRCA 4UOW0 5IKCA 1EO8H 4GRMA 1V7NL 4R8WL 1EEZB 5C0RL 4MLSA 4MNQD 3C8DA 3VRJB 3S34H 2JB6A 4WUUD 1MVUB 1PLGL 5GRZA 5ILTH 4RWYH 4H1LG 2VQ1A 3UC0L 1N64L 4LCWB 3IRPX 1JRHI 4MQXD 1PG7H 3MV8E 1DTUA 3QUKA 4TSBH 4FQJL 4YHNB 1ZLWK 1AQKH 3QFJE 3MO1A 1OL0A 4URTB 4E0RA 2HJKA 3OGCA 3IKCB 3U2SB 3FOLA 1OGAA 3VJ6B 4J3UA 1QRNE 5EC2B 2MHAA 3B6SB 2X1QA 3VCLB 3ZZ1A 1OPGH 1UM6H 4M7KL 4I5BA 1FNFA 1LO5B 5DDHA 1IL1A 3AU1B 5LWYL 3HNTL 5H2BB 3RWIB 2NNAB 4KI1A 4MJIB 2F54A 1LO3H 1HYSC 1LP9F 4LCCC 2XZCH 1F45A 4QY8A 4OCNC 3TO2B 1IGIH 1I8MA 3KYKL 5E9DB 4U1MB 1MY7A 1P7QA 2X2YA 4NZJA 3RWGA 2ZCHH 3DMMA 3LS4L 2VXTL 3GMLB 4ODWB 3GHEH 1H3WM 3SO3B 5IHZB 3BRFA 4Q0XL 3MACL 4HKBB 3SCMD 5IOPB 5D5MB 3QISA 2AJUL 3CZFB 1IKNA 2JF1A 3MGTA 2H2PD 4MXQD 1SJVA 3EJZD 2LTQC 2QADB 3KPSD 4PY7B 3FT2B 1LEGA 5GRUH 3O3EB 1JHTB 3T0EE 2C26A 1DUZB 3M17A 3WKNA 1NMBH 1R3IL 3FAWA 5CJXC 1ZLUK 1G9MC 3CD4A 5IF0B 4YQXH 1QLFB 5I1IL 4LLQA 3GSNL 3SE8H 1BWWA 2VC2L 1C7SA 4JQVC 1OAUL 4F33A 3IAPA 4YWGH 5GRUL 1ACYL 4XPBL 1CT8A 1EZVY 3TZVD 1UB6A 1HXYB 4KRMB 1K85A 3QXVA 4M7ZB 4U31A 2QADC 5CEXB 3FOMB 4JVUA 3ZSTA 4U6TA 4Z5RB 2IFGA 5CHNB 3BH9B 4XVJL 5T1LD 3L6FB 4M1CD 1IQWL 1BF8A 4RX4A 1NDMA 4X6FB 3HI1A 2P43B 1T5WA 4DKFH 2VDQL 2YPLD 5L2KD 4K3JH 4HMDA 4HUXB 1CGTA 1NCUA 3SDAC 1BFOB 3BX7C 3HN3A 5EO9A 3L5JA 5E70A 1BREA 1ZANL 5HJ3A 1A7QL 4QRRE 1GOFA 2DQTL 1EHAA 1T1WB 2IPTH 3HI5L 3JTSA 1I8IA 1EV2E 2I27N 1J0HA 2A83A 2EKSB 1ITBB 4HEPG 3K1DA 3PIQA 4HUWB 4R3SA 4PBWD 1MRCL 1I3RA 3HC4L 4WCYH 4PTTA 5T1LB 2VUYA 4K94C 1ZHKA 4L29B 1KIQA 4RDQF 5CCKH 3LH2H 3FTGB 4P4KB 2G5RA 5GJTL 1M6OB 1NGWA 1J8KA 2BP3A 3U4BL 3ZTJG 4RMSA 3GUTB 1VENA 4HFUL 4L3ED 4WI3A 2HN7B 3QXAA 5FCUL 5KSAC 4Y0GA 5LXGH 2FJGA 1UQSB 5IR1B 3ARDB 5D6DC 3FQWB 4WO4D 4QEGA 1S7WB 2F5BH 4WTZG 1NGZA 5TPWH 1A22B 1A4KA 4M62H 1G0DA 1D9KD 4N0UA 4PS4L 5CEZH 4MCZB 1CTNA 2WAHA 3VXNA 1YZZA 5EIIB 2ZUVA 2DQHH 5TE7L 4H0IA 4KTYA 4M62L 1AGBA 3U46A 2LFGA 1KJ2L 1KN2H 1OGAB 3UYRL 3VJ6A 1EJOH 4Y19D 5ISZD 4Z7OE 4NQEE 1AJ7H 1ULVA 5EC2A 5CCKL 4NRZB 4M43H 3LKPB 3L3DA 1RIVL 1G9NC 5L2JA 1NC2D 3AB0B 3SN6N 2H3NB 4PJEB 1F4AA 3S3PA 3Q6GL 3TYFB 2CDEA 4LSSL 5H2BA 3RWIA 3FKUS 5IIEA 1UXWB 4MQTB 2VDLL 3QNXA 4L9LB 2NY7H 4GRLB 3SE4A 3UTPE 1Q9OA 3D0LB 3BUYB 3GI9L 4ZG1A 3X12B 1Q1JL 1BD2D 3KWWB 3LS5L 3CXDH 3GMLA 4ODWA 4XC3H 4LHUA 3GJFB 4WI4A 4LCWD 4YHML 4GAGH 3EZ8A 1AO7E 1CK0H 2IH1B 1HE7A 2OK0H 5F3HA 5SWZE 3TF7C 5C08D 5KSVB 3BW9A 2FECL 2VDLH 5E03A 1UEYA 3MGTB 3MZTA 4WW2C 4WY7L 1JNJA 1INQA 3QZWA 1XZ0B 3L3JA 3Q6GH 4O58L 4U3HA 43CAB 3DURB 4M1CC 4FTVA 2Y5EA 2F8VA 2DAVA 3K2MC 1T2QH 4C83B 2EKJA 3VD7A 5CUSL 4R2GB 4YHPB 4G43A 5E2UH 2E8ZA 3ZE0E 3MJ9L 3S36H 2XTJD 3BP4B 5GGRY 4P2OD 5JHLH 2VLKE 1Q9WB 4WWKA 5JDJA 1FBIL 3WIIL 4R97B 4IOFC 4JRXA 1EX0A 2UZYB 5JHLL 1MWAL 1FNSH 1HXYA 4L8DA 4B50A 4M5YH 5IB3A 5JIKA 1CDIA 3SOBL 3U6RB 1WC7B 1DN0B 4Z5RA 2GW5A 2K7QA 4LIQE 4KK8D 4XCEB 2DL2A 3MYJA 3TVMB 1BQSA 4X6DF 1KOAA 3U7YH 4AENA 2ZG3A 4LVNB 1CF8H 5T3XE 1NFDA 1ZHLB 3N1PC 3EJYC 4JKWA 1TJGL 1I8LC 1EFQA 2R2CA 2CK0L 5EBWA 1OLZA 3RPKA 1A6ZB 1YMHA 1JWUA 1NFIA 4LK4A 5IVXB 1FJ1B 4CDGC 1N7ML 3F58L 3MA9L 4LCWA 4RQQB 1QOKA 3O0RH 3U30B 3RKDC 4NKQB 4Y7MA 3U7YL 1FE8H 2YBRA 4LEOA 2E9JA 2QQKL 1NBZA 1X5HA 3P30L 4FFYH 1XGQA 1HYSD 3WO3B 5F93C 5D70H 5BS0D 1Q72L 1Y18A 4U6VL 4JFZL 5TDNA 1JRHH 1ZTXH 1I7UA 5I75C 4Q9CA 4AM0A 5C0CB 2X09A 3SKNA 1EK3A 1BECA 1TJGH 4RGMB 4XPAL 4QO1A 3BRDA 3AU1A 4PJBB 5D9SA 2P5WD 2ZUWA 5E2WL 3TH2T 3DSFH 3MNWB 4MJIA 5GS3A 4JRYB 1FZKA 3QULB 4NC1C 5D70L 2XG5A 5IB5A 4UMGA 4MXWL 1A2YA 2NXZC 2DKUA 3C8KA 1K3ZA 3LKNB 5EBMA 5F7UA 3UTOA 1KYOK 4ERSH 4PV9A 3MXWH 4RFNC 2DQFA 1DDHA 1NGZB 4GXVH 1PYWB 4KC3B 1EPFA 4XXDB 2Q76B 4NSKA 3VXQA 5I9QB 3FO2A 4G6JH 3TWCH 3BSZH 5D5MA 4XPHH 2BNQE 2D7NA 1A02N 1FFNA 5T5NF 1OGTB 2EDYA 1MHEA 2NZIA 3CPLB 3BSZL 4XVUC 5T3ZE 2YN3A 1F4WH 4OIBA 4UBDC 4GG8A 4QRRA 3BQUA 3QDHA 4ZYKB 3REWA 3RWFA 3VFWB 3MC0A 2CDEB 4JDVA 4PJ8C 4QXTA 1TNNA 3RWCB 3QG7H 4Z18A 4R26H 2AVGA 3X13B 1NCWH 1QA9A 2LU3A 5D6CA 5IGXH 2EC8A 1KIRA 3X12A 4FQ2H 4HLZH 2FGWH 4JO4H 4M03A 3T4YA 2NY2B 4S1SL 3SKUD 1MCCA 3NABH 5E5UB 5T3ZD 3TH4T 2BFVL 3K4ZA 3P4NA 2QQQA 1G6RH 1JV5A 1OAKH 5FEBA 1SJHA 2BY2A 2DMBA 3VWJA 2CUMA 1FCGA 4M7LL 3VG9C 3E3QC 3NFPA 3DVNA 3FZUC 2O93L 3VRIA 3GSOB 4LLVB 5BV7B 2B5IB 4HCRH 5GRXG 4X80L 4IEFB 5C71A 4P2RB 5C6WH 3TN0B 1BQHA 3JSSA 3QCUL 4JN2A 4IRSA 5SX4I 3SJVA 3ZYIA 3B8YA 3OF6A 2H2SC 3L7FB 1C16A 5GRJH 1BFOA 5J1SC 4EDXA 1J0ZA 1RURL 1I4FA 2P8PB 1LK2A 12E8L 1O7VA 3NABL 1MVUA 4ZS7L 5FOBA 2VR4A 2PYEB 5D2NE 4UDUB 1FZOB 3PIQB 2X40A 2AEQL 3SDXE 2RFXA 1J8HD 5FHAL 5ELIA 1DN0A 5T33H 3UTTD 2D03H 4G8GA 1N59A 4L8SC 5T5FL 1QHOA 1FPTH 4XNYL 3U4EB 1E0OB 1WF5A 4HV8B 1GGYA 2NLJA 5GS2H 4G8IB 4LQFL 5E0QA 3ELAT 3CFJA 4M8VA 3MV7E 2VDPL 1LO5A 2XQBH 3MOAH 1NFIB 1UQSA 4ODHL 3TC9A 1PJ9A 5ESAA 1OWRM 4YFDB 4ZXBC 1TZHB 4ZOEA 3PWPB 1A4KB 3ZDXF 5B22A 1MI5A 3PV7A 3BT2L 3GHBL 4ZO9A 3INUH 3O3DA 3TO2A 4E42B 1I8MB 1S8DA 3FQXB 4CAGA 1BIHA 4ODVH 4EI5B 3MYZA 3V52H 3SPVB 1A6UL 1H0DB 4OJFH 2R0LL 3ALPA 4Z7QE 1JGUL 4NRZA 3NGBC 4D2NA 4HKBA 2WUCH 5J8OA 4KKCD 4JGMA 1JHLL 4PJXA 1JI1A 4X6EB 4PJBA 5D9SB 3DTXB 1JFQH 3Q5YA 3UEZA 1D5MA 2R56L 4UU9A 1FIGL 4UV4L 4WENB 2QQNH 1IAOA 4P5KA 3M17B 4X0KA 3LV3B 2AEPL 3DBXA 1SBSL 3R8BB 1CQYA 3EOBA 5D93B 5EBGA 5TGBB 1PYWA 4UDTA 5KBNC 3O4LE 3E8UL 1MRFH 3RNKA 3GJFA 4ZPTA 4JE4B 4OLXL 4HIXL 4AEFA 1NMBL 2BVEA 3OV6A 2EYRB 3Q1SH 5GZOC 3DSNA 1FFNB 5IVOA 1MHEB 2ZCHL 1INQB 3AXLB 2OTWB 3TBWB 4HXBH 5CHNA 2FEDD 4A2LA 4HEME 1KT2B 1LE9A 4WDIB 3V95A 1A6VH 2BCKB 4LIQL 1IRAY 1SEQL 2D4DA 4L3CA 2AW2A 5HD8D 1FO0L 1LDSA 4XVJH 4X7SH 4TTDD 4MVBC 5KS9B 1X5XA 2DKSA 1YNTB 2KQMA 3CUPB 3CSGA 3QFJB 1QR1B 1ES0B 3EFFB 1NANH 3QDGD 1WC7A 2PYED 1OTTD 2HFEB 3FMGH 1DE4A 4YC2C 3WL9A 1BVKA 4N5EC 4JZNA 1HXMA 1MAMH 1FL6B 2A74A 4K07A 5EO1A 4FXLA 4HZAA 3DVNB 3HE7D 3QA3A 4Y4FC 1OT1A 1I3RB 3F12A 2EECA 1HH9B 1JGLL 2NW3B 2IPTL 4DN4H 4PB0L 4FN0A 1FO0H 2ZUXA 4NNYA 3CXHJ 5ID0B 1FJ1A 3PL6D 3DX6A 1K2DB 3DRQB 4Y4HD 3NCMA 4X5LA 4ETYA 3ZKND 4S1DD 2DQGH 3P11H 4MAUL 4RIRB 2L7UA 5I73B 4NGHL 1FRGL 2FJGB 3IJYB 5D5ME 1KCVH 1T6WA 1SYSB 4P3CH 1A14H 4CNIB 3BHBB 1JUFB 2ARJB 4GBXC 1F6FB 2IWGA 2Z35A 4ZD3L 7FABL 2O26U 1VGEH 2D9CA 4U1GC 2HA1A 3R06B 3SE4C 4XP1H 3MNVA 1ORSB 5F7FA 5D6DA 1YEGH 5DYOB 3SDAB 2V5SA 3VH8A 1U93B 5DMGD 3QHTC 4G8IA 1QBAA 4WHTB 4KPHL 1X4YA 5A2KH 2VC2H 4GG6A 1JP5A 5FYKL 1E6OH 4OD3H 4XMKH 15C8L 2W07A 4ZD3H 4JG1H 1ZHBB 2P7TA 2F53D 4NT6A 3O41B 2R4SH 5CP3A 1D5ZA 1GGIL 1N8ZA 4ZXBA 4U1GB 5TE4H 1MCIA 5SX5K 1DBAH 3DXAE 1K3IA 4HPYH 2DIJA 5BW7A 5F8RC 2RGSA 3CPLA 4W4OC 3QG6B 1I8KB 5ANME 3SDCB 1NGQH 5IHBA 4AT6A 1LMKA 4AQ1B 4TN9A 4QWWC 2VLLB 2OJEA 2XY1A 2XFXA 4DWHA 1GIGH 1TJIL 1CVSC 4H88H 1U58A 2FEEI 4NM8H 3WFCL 2ED9A 5DC4B 3GMMB 5TDPB 3IDNB 4UDTB 3NIDE 4HFWB 5E8DL 5M94B 3G6JB 3KLAA 3U36B 5IEHA 5D1QC 3JV5A 4KUZH 2FR4B 4DN3H 2NQCA 4C4KT 4QXGH 1JV5B 2NY6D 4PFEA 4JRXB 3VWJC 4GQ9H 2AK4D 5DD6A 1IQDB 2ITDA 2ADIA 3QHFL 3P4OB 1S7UB 1MAJA 2DDQH 2YHGA 3T4AB 1YQVL 4TSAL 1T04B 2DMKA 2OXHA 4PJFA 3KPSB 3S37X 1C16B 3QWQB 3DARA 3CSBA 2Q87A 4XH2B 5JOFA 5C0AA 3KJ6L 4G8FA 1D6EB 2K1MA 3IF1B 4G42A 5JW5B 3G5ZA 1ES0A 3EFFA 1GC1C 3SE9L 5IVXA 2AAVA 1CF8L 3P0GB 3MNZB 5C0BD 5EU7E 4GOSA 3UPCA 5CJOH 3OAYH 3W2DH 1DE4B 1KXVC 4PUBH 3QUYB 3FONB 3TESA 2NX5A 1DUYA 1OF2A 1YEFH 5D1ZB 4ELKA 5FGBA 5AWNH 1KLUB 1NBVL 5HDQL 1J9CT 1OGAD 1KIPA 3WKMH 3WO4C 4B7LA 5TH2B 1U92A 4M5ZH 1CIUA 4HX1B 5HHOA 2GY7B 5ADPL 2CO6B 5GHWL 3GBML 1HHKB 4NNYB 3BZFA 5ID0A 3CCHA 1U8HA 4K55A 4C57C 5INDA 5F71A 4GKNA 5HGDB 3KPNB 2GIYA 1YY8B 1NCAH 3RTQA 2LE9A 4PRPE 5J1AA 1F8TL 1YJDH 1BFVL 32C2B 1X5LA 1ZLWH 4X99B 4JFYB 4MXQC 2UWEB 1TETH 1JUFA 2ARJA 4QHMA 4JO2L 2V2XA 5J06A 4YR6A 4HWBL 2Z9TA 5JHDD 4NSKB 3VXQB 5I74C 3MFFB 2JJVA 2CUHA 2FIKA 4WTXA 5C07A 4YX2H 3TO4A 1ZTXL 1UCBH 1DQQA 4CVXA 4QRTB 5LVEA 4NNXB 2FHBA 5JW3H 2VWEE 1QHPA 2D7TL 2HJLA 4OLEA 4EUPB 1DLFH 2YD8A 1BFSA 3EO0A 3EGSA 4CJ1A 5TFSH 3SOBH 5CZVH 3O41A 5GS0L 5F1NB 2G2RA 2HVKA 3IDIB 4M1GH 3PDOB 3HUJE 4ALAL 2GTWB 3PL6B 2FO4A 3B2VL 1S3KH 4FNLL 3X13A 1P2CB 3GMNA 1BM3L 1LILA 5D6CB 5DRZB 2DQIL 4EUPH 4UT7L 4WTZA 4J3SA 4BFIA 3BN3B 4KK5C 3QDAA 4LL9A 4O00A 5DD1L 2AV7B 2PR4L 2CLRB 4NN6B 4GO6B 4G8GD 2Z92B 2AV1B 1CXKA 5E4EC 1T7XA 2XFXB 4WNQA 2OR8A 3T04D 3UZQA 4MD0A 1KUMA 4RX4D 4LLDA 1XR8A 4LPWA 4NJAL 3Q3GA 3LMJH 1QKZL 1JPGB 2QHLA 4ZTPH 2BVOA 1BQHB 4NC1E 3TA3D 1RMFH 2CD0A 4NBXB 3T08A 1HHIA 4OCWL 1UFUA 3DI3B 5C09A 4NQEB 5DRNA 2NY4C 3JUZA 2IAND 1K4CA 2X42A 3UBXG 2NZ9D 1I4FB 1XR9B 2P8PA 2R0ZH 25C8H 2CRZA 3UBXI 3KPLA 1Y0LA 1QTYT 3BWAB 5KSBA 4JKKA 1IE5A 3GDBA 5FOBB 1UT9A 1CGUA 5HHQA 3SGDH 4X6BA 5DD6B 4DUVA 2EE9A 4Z7VA 3U0PB 4QGYA 4OV5B 1LDPL 4W6YB 3OKMA 1AHWA 5GRYA 5CBEB 3WNNA 3G04A 1AP2A 1DEEB 3JV6A 5EU3B 1T4KA 3K0WA 4ODTH 1EBPA 3MLVH 4BH7B 1F5WA 5FFLA 2DWDA 3GI8L 3VRJA 1RZJL 1Q94A 4ETQB 4FQ1H 5LJYH 1RIHL 4ZUSB 3G5ZB 3S8WA 1NC4D 1HSAB 1PZ5A 4JHBA 5FYJE 4CNIA 2X1WL 4DAGL 4J1UA 1TZHA 3MRRA 1F11A 1RIHH 4DKAA 1KJMB 3C6SB 2EDFA 1B2WH 3TVMD 3O3DB 4G6FD 5F89A 4E42A 3KJ4B 3WDHA 3PV6B 2Q8AL 4D3CH 1JN6B 2VKWA 1KIPB 1U41A 4O9HH 4TPRH 5ID1A 1IT9L 4OZFG 1MCSA 4XMLH 1H5BC 1WFOA 5DJYB 1WUNT 2HFFB 3BZFB 1CGWA 1ZHBA 2P7TB 4N9OB 4PB9L 4X7DC 2YMXH 2BXZA 5HGDA 1ZOXA 4YHIA 2ICWI 4D9QE 5I16A 2X4PB 5F1IB 12E8H 2ICES 1GAFH 3T0DA 1AGDA 1MJUH 1YYLL 1CFSB 4X0KB 1B2WL 3FT3A 3C60B 3PHQA 5HYSA 1VFMA 1P7QB 4X8JB 1NEZG 4JKMA 5K9OA 2NZ9C 4IMKA 2IBZY 2Q6WB 4L9DA 1MCBA 3F6IA 3BDYH 4ZFGL 4P2RE 1KNOB 3BPLB 3P9MB 4PJCB 4UTBL 3S34L 3AMLA 3TA3C 1K5NA 4OM1L 4TNVF 5C07B 4BZ2H 4OKVB 4NZRL 4CVXB 3WSQH 5IM7B 5K9QG 1Z5LA 2QJDA 4GKZB 5F7HA 1C8PA 2QHRH 1YPZB 3T8XA 3L5WA 1I9EA 3QQ9C 5GS1C 2ZG1A 4F7CB 4I48B 5IFHH 1BLNB 4K23L 1UA6L 5J57B 2Y07H 2DLFH 5I1DB 3H9HA 4WFHE 3KHQA 3UAJD 3ZKMC 3FN3A 4KK5D 2YOCA 4BSJA 1H3VA 4DJMA 2YPLE 3T0BA 5GXBB 4L3EB 4Z6AT 3ARBC 5DMIL 3V52L 3SDYL 3MLRL 5DGRA 3U9UB 5A43C 4K23H 3VDAA 1KSRA 3I2CH 2AGJH 1G9ML 1UWEH 5TF0A 1J1XL 5GS1B 1HH6B 4MJ2A 3GSNH 2Z31A 5ISZA 2WIIA 4MD0B 5DQ9B 4YEFA 4GAFB 3AUVA 2QQLL 4BYHA 3NCCB 2J8OA 3F12B 5C6TL 3MR9A 1TVBB 2CIIA 3HC3L 1KGCE 4PJDB 2XQYK 4HUXA 4M6NH 5DRXA 5CSGA 1E4WL 2RHEA 3T2OA 4HUUA 4WFHD 2ESVE 3G6DH 1Q0XH 4RFEA 2EIEA 4GAJL 1IQWH 3MA7A 4O5LL 1KBGL 1L0QA 3FHAA 4ELMB 5IFJB 1ZT4A 3T77B 4QHUA 4X6BB 1T3FA 3V5DA 5E4IA 4ZODA 4R4NC 2ID5A 1X5AA 3ARVA 4XPBH 1WTGT 4UNVA 4ODBD 3OAZH 4GAJH 1ORSA 2D31A 5KN5B 3LEVH 4F2MA 4TUKL 5INDB 4LCCB 5ICZA 4X98B 5DVKA 4I2XE 1NGWB 3QO0B 5HHVH 5IVZB 3EZJB 3HFML 5KZCB 1H8NA 3VWKC 1KENH 3HZYB 1S7SA 3GSWB 4YHZH 5E00B 2NY6C 2PTVA 3MRRB 1F11B 4KJWD 5F9OH 1J0JA 1FC1A 4QYOA 3LKRA 5K9QI 4Z77B 3TBSB 4I3SH 4YXLH 3O9WA 2YC1A 2BJMH 3D18A 3V7AE 4G6AC 3MRLA 1QFWL 5C0RH 5J13B 5DO2C 5ID1B 2ZUQC 4MA1C 1MUJA 4OUUA 3P77B 5GGQH 4AT6B 3MJGX 5DEFA 4MDJB 2YPLA 5EDXA 1R3LB 2H3NA 1KFAL 3ES6B 3TYFA 1NFKA 3SQOL 5CJQL 5I8CA 2HKFH 4ZFFB 4PBXA 1S7TB 2HKHL 3TIEA 2EXYD 1ROWA 5IB1A 3WLBB 1TZIB 3UTPD 4OCXL 1ZVHA 3UJIH 4NQCD 3PGFL 3CFBA 3E6HB 3UTQA 4ZUVA 1WCQA 1CLYH 2YUVA 1GCFA 2HP4A 2FR4A 3J8F7 1CLYL 4OSUH 4GXUM 1SQ2N 1F3DH 5EZIL 3BEVA 4L8CB 4GW1B 2P46B 3WIFA 2O5XH 5IMLA 4XMKL 3FFCA 3I02B 3DYPA 2FLRT 2B8OT 4L8BA 4G43B 4EXPX 2J3SA 5GS2D 4I77L 3KLDA 5I1DA 5D7KE 3P2TA 1K4CB 1WBZA 2E5EA 1IEBB 4IRZH 3RHWF 5C0AB 4WWKB 4GBXD 3DIFA 4HPOL 1Y0LB 3KPLB 4WUUB 1PX4A 2AS5M 4IRZL 3I50H 5D7IE 4I3GA 2WSKA 5ITBL 4Z7VB 2VL5B 4Z7WB 3U0PA 4OV5A 2FZ3A 4UUJA 4JFEE 4LGPB 1JF6A 4XVSL 4HUVB 4UAOC 4KGJA 3LQZB 4LMQI 3RA7H 4KK6C 5DQ9A 1FFQA 1RIUL 1T0NB 2EDHA 2R29H 2R0WH 2WWMC 4KHXL 1RJLA 3T0WA 3OKEA 2GJ6E 1T03H 3PXJA 3UXFA 5CEZL 2E7HA 4FTVE 5MEPB 3OKOA 3QUMH 5C0IB 5CJBA 5FAAA 1CLOL 3VFPB 1R3HA 4GW5A 1N4XH 5DVOA 1TQCB 3F8UB 4A6YB 4GKNB 2YBRB 4OQTH 1BZQK 3UJJL 2C7UB 4UIKL 1NLDH 1NBZB 1RPQA 4FQHA 4LCYA 5EU7C 2ZNXA 1QVOB 1G7PA 1JN6A 5MENE 4MZ3A 1U8KA 4HK0B 3U48A 3ME0A 1IZJA 3IFLH 2W38A 1IKFH 3N50A 3PHOA 4KRPD 4LQ1A 4CMHB 5FHBL 4KVCH 4FTVD 2JK5B 1OTSD 3TFKD 5EORL 1YJDC 4FQPA 5GS0C 2OX5A 2Z0BA 4LCCA 5ICZB 2OTUA 3QEQB 3K4AA 2YK1L 3MNWA 5I16B 2BNRE 4OZFB 4LPTA 1RZIA 1SY6H 2B4CC 4EUPA 3OKKA 5E9DE 3KNBA 2PKDA 4XWOC 3VXSD 4PV9B 4H0GA 1L7IL 4LARL 3TO4C 3AAZA 3ECBB 2ZUTA 1KTDB 1EEUA 4XBPA 3M8OL 1NAKL 4FS0A 2XOTA 3VXPB 1P2CA 4QTHB 2QR0B 4PJAA 4LASL 5DRZA 1G7IA 5AAWA 1FE8L 3M8OH 2BXYA 2IQAA 2X9YA 4NPYB 2BNQA 4X7FC 3NCJL 3UJTH 5IW6A 3KPSE 4OUUB 1C5CL 5IM7A 3BKCH 1JTOA 1BEYL 3JWOC 2Z92A 4NHCL 4P48A 5AAMA 3IU4L 1KG0B 1EVUA 5L6YL 5I8CB 2FATH 1Z9LA 3RJDA 4G6MH 4OFIA 5KSBE 2BVOB 3O6KL 5GZOD 5JXAL 4LSQL 1HHJB 3CH8A 3DSFL 3ARFD 1RI8A 4RGNC 3U1SL 4ODUB 3CFBB 1KJ2H 1KN2L 3PQYA 1YUHA 2AXHA 3RVXD 1XEDA 3OHXB 1G0XA 4OD2A 4Y5VA 1WWBX 1XR9A 3S4SB 1OWWA 1RUMH 4LNRA 3CXHK 3QIBD 3WN5B 5FO8A 3ISWA 3KLHD 2RB8A 1N2RB 1P84J 3C5SA 4P46B 3L3GA 1C12B 1ZA6B 3KYNB 1AHWB 4MYWB 3O3BA 3UBXA 4M6OL 1KN4L 1ERNA 4IBLT 3F7VB 4POZC 3SKJH 4E41D 5ESQA 1FO0A 2VIRB 4RMTA 4ALAH 3IFOA 4Y8AA 3IYLW 1XGTA 3LDBB 4F7EA 5L88H 4RFEB 4M7LH 4XBGB 2HT3D 1QSZA 3D1MC 1PVHA 4DOHE 5FO7B 3SDXF 3WXVL 3S35X 3K46A 3QG7L 3U7WH 1TQBC 1K8IB 4P5MB 3PJSA 4OD1H 1I1AD 4QHLA 3ZL4L 1UVQB 4R4FL 1IGJA 5E8PB 1IM3A 4PJ7F 3ZT7A 3AS1A 1RURH 5F89B 5IT2H 5C0FB 4F2MB 4RAHA 3GKWL 4M6ML 3VFNB 3EFDH 1DQML 1GGBH 5SWZA 5HI3C 2YD1A 3CFJB 1ZT1B 4OCRH 5MEPA 3GKZA 4NQXA 1QQDA 4AEHL 3VMPA 5FOJA 2K9UA 5B8CB 4JFQB 2ED7A 3BUTA 3GMPB 1ZAGA 5D7JA 3NPSB 4PJGF 3OKYA 2F5AL 3UTZB 1CFSA 4JM2D 3B83A 5J9PA 1DQMH 1SYVA 3CDGB 2AJVL 3BO8B 4DVRL 1MHHB 1KXTB 3ESVF 5C08B 4PJCA 5JPMA 2ERJC 3OPZL 3ES6A 4FP8H 4RGOL 3OF6D 3CLEH 5JR1L 1YPZA 4KHTH 5H94B 2VDKH 2I25N 3L5WB 4YPJA 3JVGA 1YEDB 2BFVH 3EO1A 2JELL 4S0TD 5JOPD 4NZRH 3RL2A 3ECBA 2P8LB 1B4JL 2VXSH 2X4RB 3KPMA 3I84A 4ZDHA 3QUZB 4HC1H 2J4WH 4XP4H 3QQ4B 4I1NB 3FRPG 4ONFL 2XKSA 2HMID 5IW6B 1CD9B 1WWAX 2APFA 4DK3A 4P4RA 2ZP0T 5DJZB 3WIFB 5AZ2H 3E3QE 4X5WA 5I8OL 4PRPB 3OZ9L 3ULSB 5JUEL 1X6LA 5IK3B 2IALA 1KT2A 3KR3H 1LE9B 1PFCA 1UWGH 1T1XB 1ONQA 4JG0L 4G7VL 1FAIH 1WBZB 3V0AC 5HHOD 2P47B 1JZ8A 2IMNA 3FQRB 2HFGH 1U42A 4MQ7A 4RA3A 5JXEA 4XPTH 5KVFL 1J05A 1JCKA 1QR1A 3N1GC 3PQYB 3D25A 1YUHB 2MKLC 3EYSL 4AIOA 1SBSH 2FZ3B 4OBSA 1BVKB 4KAQL 2IQ9H 1BZ9A 5FYJH 4NZUL 2XNAA 3T77A 1I3VA 3UTSD 5KVFH 3BRGC 2ZJSL 3LIZL 1FG2B 1ZV5A 5IEKA 1AXTH 3BAEH 3SDCD 5T1KA 3UYPA 3CH1B 1FO0B 2VIRA 2QLVB 2A0LC 4J3XA 3ULUE 3JTTA 1R3HB 2FB4H 4GW5B 2QSCH 4XBGA 4BFGA 3S98A 3RVUC 2DIAA 4OFKA 1IAIL 5F1KC 4RIRA 5I1GH 4DKEH 3O9WC 5T3XD 5L0QB 1G7PB 5FXCH 4XPFL 3CAFA 5I1JL 1UVQA 1W8NA 3OR7B 4HJJL 5DD3L 2KL6A 3NFSH 1T0MA 1RVFH 3VD3A 4JPVH 5HGAB 4WRLA 1Y6NR 3DVIA 4MGXA 1U6AH 4PG9A 3VFNA 4DEPC 1MUJB 3BIAX 2VDNH 3TLRA 3CVIH 1KCKA 2P48B 4Q7DA 1L6XA 5ERWB 4NQXB 2YPLB 3ILQD 5A1AA 1GJIA 1CBVL 5JMOC 1EBAA 3MCKA 4PJ8A 4TUKH 5B8CA 1HEZA 4K7FA 5DMJB 2IH3A 1D5ZB 4QRPE 4HXBL 4KDTA 5D7LD 5IB1B 5E8NA 1VFOA 5AZEL 1UB5A 5DZLA 1UZ8B 1G7IB 4KROB 5EO0A 1VKXB 2BNQB 3G08B 2DTMH 2IG2L 5EOTA 1B9ZA 3T1FB 4ZUVB 2Q3AA 3GMRB 2APVA 3QG6A 3SDCA 3HPLB 5EWIH 5C0GA 5D2NA 2KQNA 5EIQA 4EN3C 3O2DL 2VLLA 4RBPH 3D87B 5I66B 1Q0XL 2X4SB 3G6DL 5HYQB 2VLKB 2AXFA 4U1JA 4TTGA 3W9EB 3VI3E 1G7HB 4Z7OF 3ULVF 3TPUA 2BK8A 3I9GH 4HWNA 5FGBC 5C0DB 7FABH 1GOGA 2B0SH 5E24E 4PD4J 4ODUA 4ZO7A 1ZANH 3T2QA 2EDOA 1YNKL 4QOKB 1KLGB 2IANA 4U7KA 4CMMB 5KW9H 2E27L 5D1XB 1CE1L 3U36A 1TPXC 2HYMA 3MLXL 1HZHH 2LVCA 1TJIH 4JDTL 5M95B 4TSCH 3FFDB 3P4LA 1HYRC 5JDSB 5A16A 5FF6A 4JG1L 4LSPL 4YHOH 1A6TA 5KSAD 1F4XH 4PP1D 3FQUA 5F7EH 5JHDA 2YS4A 3N06B 4X4YA 1NCDH 5FA4A 5A2LH 4OAWA 2YXMA 1CE1H 4FQIH 4YHZL 3KPTA 2NXYD 3OJDA 4Y2DA 2XWTA 1PY4A 1RJLB 5TE7H 3VRLF 4YXLL 4YDJB 1TPXB 2FHCA 1AIFB 4OCSH 1GGIH 4ZSOE 3FQNB 5C07E 3OKOB 2PYEE 3D25B 2GJ6D 4WJ5B 5J6HB 1HKFA 4JHAL 2EICA 2H32H 4M93C 4EI5D 1KACB 3E2HB 2EEBA 3NA4A 5E9DD 1DZBA 3QUYA 1MI5E 3MODH 1CICB 4X9FA 1QSED 4NKIL 4P9MH 1QBLH 1QRKA 1T83A 5DQDH 4I0PA 2APWA 1TNMA 3SJVD 3SCMB 1I7RA 2VYRE 3I6LD 2HFTA 3X11B 3B3IA 5GIRB 3AY4A 5HHOB 3CH1A 3GO1L 3MV11 3DV4B 1HQRA 4XI5C 2AKRA 1DQJA 5E2VL 1BQHG 2C3HA 4LSUH 2AI0H 1DBAL 3RI5K 4NYLB 3QWRA 4OF7A 3KPOA 4EN3D 3RTQB 2AJSH 4XZUB 1CICC 5BMFH 1JF1B 3ARWA 1RUKH 3PWVA 4PS4H 3CDGA 5EZIH 4LSDA 3B9KD 1J8HB 1MHHA 1OB1B 4WFFD 3GO1H 3AVEA 1E4XI 5BMFL 1OCWL 3GGWA 1J5OH 3SDAD 2X70B 3CLFH 2FYYA 3QWOA 2WBJD 1ZE3C 4MD5B 2R29L 1P4IH 5B3NA 1RJYA 1L7IH 3AB0C 3STLB 4FMFA 4PG9B 5EIVA 1HWGB 1MIEH 1AY1H 5HHMB 3A67L 1WCBB 1VESA 2Y7QB 4HPOH 5E6YA 3DX7B 3VFOA 4DQOL 3VFGL 4JO2H 1IVLA 3L5XH 3G6AA 4H20H 2ATKA 43C9B 1JYVA 2H2PC 4GLRH 3RWEA 4JY4A 4K7FB 1ZGLM 1RUKL 5ACZA 1MJJB 1LP9B 5IHLB 3MRIA 4CMHC 2EYTB 1UB5B 2OM5A 2BNRA 3O8XB 4S2SA 3RBGA 3QQ4A 1GRWA 2F8OA 4CUCA 4WFFE 3OKDA 5F1OB 2WUBH 5CJ5A 5LQBL 4WI2A 2PW2A 3HE7C 1S9VA 2AV7A 4RRPA 4S1RH 3WIIH 3BN9C 1J88A 1LNUA 2C1OA 4FFWC 1EH9A 2AV1A 4ESKA 5GGRA 4JFOA 3LN9A 5HGBA 2VLKA 3JWNC 5CIPA 3WE6B 2A0LD 4JDZA 4NKOB 3D0VA 1ZA6A 1NCNA 2E6QA 2VWEC 1OW0C 4TTDC 3W2DL 2YZ1A 3QSKB 2XWBB 4C56E 4CMMA 5KAQF 3TCLB 2XTJE 1WISA 1P4LB 1B6DA 1A47A 3K8KA 4HF5L 1NDGB 3RY6A 1DBMH 1RHHB 4PLOB 3O45B 8CGTA 1AI1H 4HJGB 4OQ1A 2HWZL 4U2YA 5D5MF 4K8RD 3ZT6A 4YBQC 4L4VA 2BNUB 3EYOA 4Q9QL 5JDSA 4PD4K 1OP3K 1AGEB 1ED3B 4R90L 3TZVB 1T1ZA 1JNHA 3P30H 4KV5E 1WAAE 1CDHA 1AP2B 5HDOA 3VFTB 2Z8VC 3O6LL 3DNKA 4V2CB 2NTSP 5T1KB 1A7OH 1XGPA 2ORBL 1C5BH 1FAKT 5BRZA 2CDGB 5D7KD 3RDTC 4PRNB 1R5VB 1V05A 5BQ7B 4XPGL 2FWOB 3W9DB 4JPIA 1SHMA 2PR4H 3KG5A 4ETQA 4LPUA 1N6UA 2ZUSA 3D69A 4D0CB 1W72L 1DJSA 1FV1A 3PWLB 2P8MB 5KJRL 5E94B 3V5KB 3BGMB 3C2AH 1FDLH 2FATL 4NNPL 1R0AH 5HGAA 1FNGB 4A6YH 1A7OL 2BSTA 1G84A 4OF8A 1RAMA 1N5AA 5JPMB 1WSST 3WHXA 4PG2C 2ZCLH 4BZ1L 4W6WB 3PWUB 4P2OB 4AG4H 3S36X 4GG6F 3F7RA 2YD6A 3HRPA 4RFNB 4MJ6B 1VGKB 3FO0L 1BFTA 1RUML 5EZLA 4FFWD 2ZKHL 4OCRL 4J6RL 3A0OA 5EULV 1JYNA 1DANT 3PWNB 5EO0B 3MLWH 4X8JA 1VFAB 5AWNL 1WAAF 4YUEL 4KV5F 3C2AL 4ODTL 2GJ6B 5IGXL 1NGYA 5DHVB 4K94L 2NR6C 5T3ZH 4L3AA 4RAUA 3SE3C 4ZDHB 4Z8FL 4S1SH 2YEZA 4W70A 4UTAH 4NQTA 3V79C 1G6RL 4GKZA 3O6FC 5I0ZA 3GBNH 1EEYB 2IAMA 4OF3A 4OZIE 1WT5C 2JE8A 4HKJA 3BP7B 4APQC 2G5BB 3ZE2F 1MJ8H 2J8HA 2EO1A 4L4TE 3MJ7B 2J8UB 5D1XA 4QHNB 5GSRB 3LB6D 4MQ7B 3B9EA 3QEUA 1RUPL 2EYTA 4OIIL 4IRSD 3TP4A 2WWKO 5FHAH 5CEYB 3RZCA 3OKDB 2IBBA 4MNQE 4I3RL 2ESVA 5DD0L 3LHPL 4H26B 4MJ4A 2VAAB 3VFSA 4JFHD 3L1OL 4AIZB 1U8NA 4UV7L 4HK3N 3IU3A 2XN9E 3BYYA 2A1WL 2VLJD 1AD9B 3ZE1F 3MPCA 3ZYOA 3D39A 1UWXH 4FOMA 3D85D 3BGFB 1BBDH 3BDYL 1QNZH 4PJDA 5CD5C 1RJZB 2M2DA 5DRXB 1G9MH 1PSKL 3A6BH 1KV3A 5DGQA 3TCLA 4CRPA 5I15H 4YXKH 4F7MB 1OAZH 1A6AA 4GW4A 1Z9SA 3H9SA 3NMEA 4JPWH 1MELA 4IOIA 4HIIA 3U0WL 4OZFH 2GT9A 1G7QA 2Y5TA 2YD5A 4RGOH 4DGYH 2AK4B 1XIWA 5DZNA 2DYPA 2XKNB 3WNLA 3QFDA 4Y16B 1PSKH 3A6BL 1DSFL 2VN4A 5DFTA 1QFWM 1ETZA 1S78C 2XZCL 3MV7D 3VA2C 1DQJB 4Z7UF 3D9AH 3FN0H 1XCQA 1LWRA 3EW3B 3IDMA 4XPTL 3QO0A 4XWGH 2N7AA 2CRYA 1F13A 1LVEA 5D72H 4P23D 1FYTB 3MOBH 3MBEB 1AGCB 3ARFA 4KAQH 3Q2CA 3GSVB 1FVDB 5SX5H 3LKRB 2I9TA 3V5KA 3VXRE 1EAPA 3MOBL 4R8WH 3D3VD 2R69L 1A1OA 3SDDB 4N0RA 1K8DB 4PJ5A 4DOHB 1ZVSB 2ADFH 2PTTB 1UM6L 4HWBA 3HPLA 5JQHC 1W0VB 3DHMA 1R3LA 1RZFL 1FIGH 3HZMB 4UV4H 1T89C 2ATKB 3RKDD 43C9A 4J3WA 1CDUA 3MXVH 5EPMA 1DBJL 4N68A 3K81A 4JFPB 4QT5B 4PRBA 3BVNA 1S7TA 3TIEB 3LQMA 2OSLA 4OLUH 3O81A 4UB0L 5HYJB 1KYOJ 4KJPC 3O8XA 4EJ1C 4GLRI 3D2UD 5DS8A 3V7MA 4YFLI 5IESH 4P5TB 3SGDI 1I1CA 3VXSA 4JEGB 3MV9B 4F80A 4M7KH 1MQ8A 2UZIH 1NBQA 3R1GL 5DMKA 1IAKB 3K4DA 3D3VE 4PB9H 2F19L 1JHKL 1I9JH 4JDZB 4NKOA 5DJ2A 3VWJD 1AQKL 5EWIL 1I7TB 3CC5B 2Z31C 1P6FA 5CKGA 1FL5A 4OF5A 1UJ3A 2BRRH 5JOPE 2QBWA 4F15C 3LS4H 2XTJC 4HKZB 3VI3F 2H32B 3IFPB 4E9LA 2RIKA 2GITA 1W72A 1F90H 4YDJA 1N6QL 4WCYL 1U6AL 2ZZUT 3HNTH 1NGPH 3OL2A 1T5XB 5LCVH 4Y4FB 2QKIB 15C8H 3IFNL 5DSCB 4HUVA 2P5EE 1PG7X 2FNBA 3W0WE 4XTRD 3VXUD 1AD9A 3JWDC 4MAYA 2CDGA 3UJIL 2PCPA 4Z0BL 4FZEL 1TCMA 2IBGA 3I9GL 5DHYA 5HHXL 2NY0C 2BVPA 5F9OL 1MCNA 2XG4A 2PO6C 5IBLC 1MH5A 4KPHH 5KAQG 2HAZA 1X5JA 1W0YT 4E5XB 1P7QD 2X1OA 1GVIA 4JM2B 4YDKL 2VISB 4NO0D 1U3JA 1JZ2A 2A9ML 2DOCA 5AUMA 2IADB 1U91A 4HULB 1ZA3B 1G6RA 1OHQA 2OI9C 2VITA 4R7NB 4DZ8B 2VKXA 5CGMA 3FB5B 5IB4A 4N9GB 4GT7A 1CZ8L 2IGFH 4OUOA 4J4PC 1TMCB 1C1EH 1WFTA 3FHQA 1VGKA 4XAKD 2VABB 3ULUF 4OZFA 2VDRH 4M43L 3S3SA 1RZGA 2MNUA 1INEL 1TENA 2SEBB 4RWHA 3NFNA 4EIZC 1VDGA 2B1AL 5C0ND 1CU4H 3HC0A 5K59F 4K3JL 4JVPA 1JI2A 3FCTA 1CU4L 1EAPB 3K1KC 4PJCE 2C1PB 5FUZL 4PJXF 4L4VD 1RIUH 2Q86B 3EO9H 3MLUH 4Y4KC 1B0RB 1RK0A 2HRLA 4WO4A 1R3IH 1U8JA 4CW1A 3U4BH 4QXGL 3CLFL 1LNUB 3NACH 1OLLA 4ZUUB 4P9HC 5I1IH 5T1DL 5TPWL 4HH9A 3DYMA 4S0SD 1VACA 3RKPA 3GIZH 3MRJA 1UENA 1QYGH 5F7WC 5AEAA 3WUWB 5ALCL 3EO9L 3MLUL 5FKAA 2YK1H 5F6IB 3GIZL 4NUJA 4L3EE 5CEYA 3RZCB 5CJOL 3EBAA 3UTTA 4PGBB 3MRFA 3IU4H 4PGCA 4Y5VB 5CEZE 1NDGA 3ZYJA 4N8VG 1V7MH 3O6FD 4LAQH 4ZFOB 3O45A 1CDGA 4XB8A 3VGHA 4OLVL 1NAMB 1P53A 2FEDC 2HH0H 3EOAB 4O4YL 4XXCA 1T21B 4IRJC 2NR6D 3I3DA 5HDLA 2VQTA 2OTPA 5GHWH 1JNHB 5MENA 2EDBA 4B41A 1KB5A 5GGTA 5HI3D 1NAKH 4OQTL 2YD9A 3QNYA 3B5GA 4YO0A 1RJZA 1N0LA 2Y6SD 4R97C 4HKZA 2FIRT 3QJFA 4LARH 3NIFF 1R5VA 4Y5VC 1P9MC 3QI9B 4Y5YA 5BQ7A 4M61A 4NQDD 3JWOL 2BDNL 4OBRA 4Z7UA 5C6PB 1SM3H 1OSZB 2R9HD 5L7XL 2APBA 1N0XL 2V9RA 4WY7H 3A67H 4EQ2A 3MMEB 3DMMC 1IAMA 5EORH 5IBTH 1R5WA 2H6PB 4OGAC 1ZGLB 4PJ9D 5EU5A 5HPMA 4M48L 3WKML 5BZWA 4U1SB 5E1AB 3VG0H 5D1QA 3W39B 1Q72H 3SKOB 4PJDF 4P9HL 4POZD 2FX7H 2BSTB 3KGRA 5FM8A 2YD7A 5KJRH 3CVHA 3QQ9D 5E8EB 3UTSA 3AREC 3QNZA 4PJHB 3HUJA 4IJ3B 2M1KA 3MRHB 4JFFE 5BVPL 5LQBH 2V2TA 4PJEE 4XBEL 2WP3O 1IC1A 2Z91B 4G5ZH 5HGHA 4LSRL 4XVSH 3GMPA 2B4CH 4XPGH 4F7PA 3EFDL 2JJUA 3QXDA 1A3QA 3WS6C 3G5XA 4D9RD 3A6OA 1GL4B 1PZUB 2G60L 1K9TA 1F58L 4U6VH 4JFZH 1NMCC 4RSVA 4AG4L 4ERSL 1OD7A 2OXGA 4K7PY 3ARFC 3OXSA 1LGVA 3O6LH 5IQ9A 5DHVA 2H8PA 5IB2B 5ADOH 5E56A 5IB4B 4N9GA 4PRIB 1GXEA 4MQXC 1FLTX 2QTEA 1MFBH 3WFDL 4U2ZA 3U7WL 1IGCH 4APQA 3RIAK 1XGYH 5HHPB 5C0JB 1OTUC 2YPKB 5KVMC 1KCUL 2IAMC 2W91A 2CLVB 3MJ8A 3RTQD 3LEXA 3L3OB 2H26A 3VFUB 4OFPA 5DS8B 4UTAL 1FGVH 2I9LA 2BVUA 5EG6C 4N0FA 3RUGB 2CKBL 2HT2C 3EYVB 4X6CF 5CP7B 2BSED 2D7PA 4JQIL 5HHOE 1T22B 4TUOA 1SJEA 1N5YL 1F4HA 1KTKE 1NCWL 4I0KA 5DMKB 2B1HH 2CR6A 2K7PA 5DJZA 5DJ2B 1Q9KB 5CINH 4H26A 3MO1B 2VAAA 3VFSB 3V6FB 2HJKB 5I71B 1J8HE 4JANB 1CR9H 1FL5B 5M7QA 4I9WE 4GXVL 3RGVD 4HH9B 1VCAA 2FBJL 2E9WA 4PR5A 1JGDB 3TFKC 4EQ3A 5FB8A 3HG1B 4U1HA 5DDHB 5C0AE 1U3HB 3CMGA 1RV6X 5CSZB 4P2QE 2UUDH 1VB9A 1G0YR 4FQ2L 1OAYL 3MRFB 2NNAA 3HI6L 3ABZA 4LLMB 4XX1E 3T3PE 4FABL 3H9SB 4D9QD 3H7LA 1F4WL 2A6DB 5E9DA 4NBZB 4O02H 1PEZA 3MRBA 1T21A 2XXCB 4YEEA 4RRPG 4LVHB 1CR9L 4JR9H 1BMGA 1QSFB 4XP4L 3MGOA 2QSQA 4NWTL 4E41B 3U0WH 5IEKB 2AJYH 4JO3H 5TF1H 1BJ8A 3SBWC 4YUEH 1D5IH 1RQ5A 1A1MB 5CMAB 3S9DB 3H7BA 4KK6D 4PJBE 3ZDZE 4KKBD 5LBSH 4JRYE 5GISL 5AZ2L 3SY0A 2O5YL 1A5FH 1D6VH 2P49B 3NN8B 1K6QH 4RMVA 4U6YB 2YMXL 3BQUC 4ZNEA 3P4MA 5AUMB 5I15L 4G6KL 4LLQB 1FYTA 1A5FL 1AGCA 4JPWL 4P2CG 2DJ4A 4HQQH 4JHZA 5I8OH 4DZ8A 4TPRL 3BZEA 2JIXA 1UB6B 1EMTH 1ZEAL 5DRWA 1S7VB 3ROLA 5JORA 2FRGP 4KTEL 4DKEL 3SDDA 1BBDL 2P42B 3BH9A 4EDWL 1QNZL 1PKQE 4HIXH 2DQUL 3VFVB 4BELD 1IARB 1IM9B 3S96B 4JJ5A 4LKXB 2ATPB 5IMKA 1K6QL 2XA3A 3D39E 2E3VA 5C09D 4RWYL 5HGHB 4DK6A 4U3XA 4XNXL 1GSMA 4NKMA 2XIDA 4JFDA 2IANE 3MRQB 3S7GA 1CI5A 3RBSA 2Z4QA 1R24B 3C5ZD 3ESUF 5JHDE 3BP6B 1WT5A 1YEJH 5IROC 3TBTA 3SGJC 2OYPA 3MRGB 1O0VA 2ZJSH 2DN7A 3EDKA 2VMFA 4I18C 2VZOA 4MNHB 3ROOB 5BO1H 4FFZH 5I1HL 1D5XB 2V7HB 4OLZL 4FXKA 4AMKL 3ARZA 3FRUB 1AQDB 5D7IB 5BCAA 1KIQB 2I60H 3L3KB 3QIUB 2F15A 4ODSL 1BP3B 1DVFD 3QB7C 1MIMH 4KJPD 4GMSH 2DJSA 4DW2L 4KZEH 2P5EA 1A7PH 5L2KB 2FSEB 1MQKH 2COQA 5ACMA 4OLZH 5K93A 3MBXL 2BRRL 4WI6A 1CE6A 3K8LA 4NZTL 4ZO6A 5F9WC 5E6IC 2B0SL 5HI4D 2MCPH 1U8LB 3NZ8A 1A6TB 2AJUH 3OSKA 1QBML 2FHFA 2E8YA 2QKIA 1IBGH 4PTUB 4YJZL 4JZOA 5FA4B 3CK0H 2VZTA 4HZLA 1Z0NA 2X1PA 4D9RE 3SDXA 1KEGH 2XWTB 1EEQA 4YLQT 4LLYB 4I3SL 1A6WL 3QT2A 5L2JB 5DZOA 1AIFA 3IXTA 4YDLB 2Y23A 4WW2F 1YEHH 4LLWA 4P23C 1CG9A 5IW3A 2D03L 3HCVB 4MSWA 4N1EA 5HI4C 4KUCF 3O8XD 1R5WB 3FO1B 2VXUL 4GRLA 3GMQB 1Q9OB 3PWPE 3ZKSD 4DGIL 4Y5XB 5A2FA 1DANU 3MRBB 2ZOLB 3PABB 4LIQH 2IF7A 4U1SA 5E1AA 4I0PB 5AG8A 3SKOA 1U91B 5FA3B 4E41A 1ZA3A 2X4QA 2PXYA 3X11A 1X7QB 3BE1H 1DN2A 4IDLA 1FSKB 3UTSB 1VGEL 3REVA 3KPPA 3AREA 1A1MA 5CMAA 1S5HA 4PJGA 2A6JB 5KSUA 1V3JA 5J3HD 4WO4C 3H0TB 4C83A 4I4WA 3V8OA 3HMXL 3BP5A 3WIHA 4NRYA 4YH6A 4X7CC 5LG1A 3RFZC 1XFPA 2ZUQB 3KYAA 4XAKE 1UM5L 2VAJA 3WEXA 1MCEA 5JO5B 2XACC 5EN2A 4EI6A 4IIQA 4EN3B 1HOCB 2FYYB 4L8DB 5SWZD 1CGSH 3DGCR 1VADA 4OTXL 3WCYA 1KEMH 4W4OA 1WCBA 4HUKB 2J5LC 4R6UA 2DQGL 4C56A 1JPSL 2AK4E 4GJTB 1FZMA 1RD6A 3D6GA 1U0QA 3FL7A 4FRWA 4KTDH 1WQVT 3VRLE 4I9WD 5ECJE 2ADJB 2NY5C 5CZXC 5CP7A 3NOIA 2X4TB 4JN1H 5I30L 1JWUB 3MRQA 1KEML 4OCLC 5KS9E 1JYWA 1OSPL 2ZSWB 4OZHB 1UYWH 2PW2B 2KZWA 3VGFA 2QEJA 2PXYD 3HHRB 3IDXH 3P11L 4MAUH 3BDBA 3RWHB 4P59L 4WEBH 3KJ6H 2Z93B 4KUZL 1P7HL 1P1ZA 1XGRA 3QDME 4MNHA 2I07B 3ROOA 3S37H 3VXUB 5B38G 1MCRA 2PW1A 3CSYA 2GI7A 4LGRB 2FJFB 3QIBB 4R7DA 3QIWA 3BD5A 3KAAA 1LK3H 3ZHDA 3LKQA 2PO6A 4OZGB 1RZKL 3GM8A 3RPIB 3RGVC 5DA4A 4QCIB 4TNWK 5E8DH 4LBEA 4FQXB 1I1YA 5F9DC 3S5LB 1H3XA 3KXFE 5ENWA 5KZCD 1M71A 1MCLA 1NUGA 4XCFL 4HJGA 2IFFH 5D1XD 5L8KB 1P69B 1IFHH 1WGOA 4KMQA 1OSZA 1G7LB 4KI5F 3V5HA 1NC4B 4OZ4B 4IHOA 2AXGB 3KPRB 4AEEA 2EEDA 3P0VL 5E2UL 4JFDD 2XA8L 1OT2A 2NTFB 3FO2B 3BOVA 3H2WA 3U4AA 1FC2D 4NQSB 3KVQA 2A6KB 3H7BB 4PRNA 3VGAC 2VDOL 4FFYL 1J1PL 4CVWA 4MB5A 4U0QB 4S1RL 4PYHA 4LLWB 1FORH 3C08H 1GZQB 3HLAB 2P44B 2AJZB 1L7TH 3ZKXC 3RQ3A 1AXIB 4XCCL 4PRDA 5CBAA 4NQDA 3SKMA 1DQDL 5I9QC 3JWOH 5E94A 1BJ1H 1U3ZA 2DLEA 4Q6IA 2OR7A 3QXDB 5CWSB 4FQQB 4V1DD 5B21A 4LHUD 1S7VA 1D5BB 4Q74A 1WFUA 2OMBA 2XI9A 3OXSB 2B4CL 2WP3T 3TBVB 4DN3L 5FGSA 1I1AC 4DZBA 3KPPB 2DQDH 2H8PB 5IB2A 3CFKA 2UZXB 4JKLA 4LHUG 1WAAA 3VGDA 4PRIA 2ITCB 1JPST 2HJFA 2ATPA 2BMKB 4AQOA 2JB5L 4Y2OA 3C08L 3OJVC 3TV3H 3VXME 2DDQL 5JXED 5EZLB 4TUJA 1KF9B 5DR5H 5D2NC 2LAGB 3L3OA 3VMOA 5F7YC 5DJ6A 1W0WA 3RI5F 3TV3L 1BAFL 2AABL 3FB6B 1A9EA 1C5BL 4Y88A 4ONHA 3MLZL 1NGYB 4NOBA 4FNLH 4UI2A 4C59B 5E2WH 1PW3A 4JKPH 1X44A 4IMKC 4OKDA 4XP6L 3D5OF 3CX5K 3MLTB 5D2LB 1XGUA 3WFCH 4XNMA 4JRWA 3MJ6A 2JLLA 4HW6A 2IBZX 2CDFB 1AC6A 2R8SL 4PP2B 4GRMB 1NCTA 4QRSA 4XAWL 1MFBL 1CFVH 1NMCB 1E4KC 1FDLL 1JGDA 5F7MC 3U1SH 4JKPL 4M6OH 4PJIE 4QNPE 5GSRA 2VLRA 2EDEA 4OT1L 2ZUUA 4QXUL 2H41A 4ZTPL 2UWEF 2FH8A 2MSPA 3L9RB 4X80H 1WK0A 5IFAH 1NFDE 3O6ML 1P84K 1NEZB 2ORBH 3QJHA 5E6IA 2R8SH 5GJSL 1F00I 1MCWM 3ARTA 3L3IA 4GSDH 4YXHH 1OP5K 1U8NB 4NHUB 5E99L 4POYA 3VA6A 4JB9L 4OB5H 5B39B 1ZVYA 4JFFB 4JREB 1UG9A 5FDWA 4HKXA 5DK2B 2XT1B 5IVXE 5JNYA 4FQLH 1FGNL 3MRMB 2WW8A 4QCIA 1FN4A 3CFEB 3TO4D 5EUOF 2HRPH 3DETD 3SGKA 2CKBB 4FQXA 1I1YB 4QOKD 4J3OC 1U3HD 3MLVL 3GNMH 4NO0B 1M71B 1IAOB 4P5KB 3LV3A 4GKSB 1T89A 1MCKA 3IJSA 1G9NL 4ZNCD 4YNYA 1CFNA 4BFEA 1MFAL 1NC4A 2OL3L 4OZ4A 2DM2A 1VPOL 4Z8FH 2DQJL 3FO9B 4FA8A 3ZHLA 4KRPC 5ADPH 4NQCE 1WZMA 1ETZB 5C86A 3GBNL 3RX8A 2A6KA 1T20B 3PDDA 1U8OA 3TBYB 2A6JA 5KSUB 5FYJU 4H0HB 2WQ8A 1PY9A 3L3HB 4XX1G 1HIML 1R6VA 2KPNA 4QRRD 5DJXB 4ZFGH 3CJJA 2VOTA 2VDMH 1GZQA 3QCVH 1ADQH 2X7LA 1KPRA 2FJHB 5F7DA 3WEXB 5CGYD 5EZJA 1QLFA 1BGXH 3QXWA 2YRZA 4PRAB 4KK9D 5GGSY 1J7VR 5H35A 4ZAKB 2QSVA 3P9LB 4XMPH 2ZNWA 2QHRL 5FM4A 3CUPA 3QFJA 4Q6IB 4NFDA 4JFDB 3EHBC 3JWDH 1V7NH 3MV8A 2C3WA 3OX8A 3HZKB 1VADB 1A21A 3O2VL 4JFEA 1K8DA 4PJ5B 4HC1L 3FB8A 4NUGL 2QSTA 5FUOL 3VXMD 3WJLA 1LEIA 5E7BA 3VDBA 5DTFB 4BZ2L 1HH9A 2NW3A 3MRKA 3O4LA 3KR3L 3BVNB 4JAMA 2X10A 3FRUA 2WQRA 2YSSB 4OGXL 2F54E 1YC8A 4XCYB 4AEIH 4UIMB 1MREH 5JZ7D 3D2UB 1NKOA 4BZYA 3QUXB 3FFCE 2GUOA 2CLZA 2VO5A 4DCQA 3LD8C 3O4OB 1JHLH 2J4WL 3VXSB 2F53E 4M9OA 2VTFA 2WIMA 3UPRB 3O6FA 2AXJA 2FSEA 3NCYS 1R5IA 1JGUH 2BX5A 2X4UB 5IJKC 3VW3L 4IMLB 4R3SB 1FHGA 1PDKA 3VXTB 3BPNB 3VXMA 1I1FA 3Q5TA 3MV9D 2FJFA 3QIBA 4PTTB 1GAFL 1YQ2A 3I2CL 1PD6A 2E6PA 2NY0D 2R56H 1HWHB 4U0RC 2WK2A 4TVPE 5EA0L 2DLFL 4AL8L 1VEPA 1UM4H 2BVYA 3GUTA 1T1YB 3HKFA 5DUBB 4U1IA 3TJHC 4AJ0A 3IJHB 4D9LL 3ZHKA 1T66C 3PGCA 3UMTA 3HAEG 4ZOBA 3HNVL 4N90D 1IJ9A 2AXGA 2IPKA 3KPRA 3DUSB 3IAGC 1BQUA 3QCTH 3EOTH 4OCYH 1A6WH 4H1LA 4BQ8A 1C7TA 2CGRL 4OV6F 4LLUB 3S4SG 2WM0A 3QCTL 3BZ4B 3CU7A 3MROB 5IVXF 1GHFH 1XIWC 1A1NB 1KENL 4V1DE 3STZB 3ALXA 5FA3A 3X14A 5AZEH 2X4QB 3G5YB 2BVPB 2FB4L 1JHKH 3ET9F 1FN4B 1C08A 1J0KA 3CFEA 5GZND 1JWSA 4KJQD 4Y8DC 3ULUD 4X6DB 2HG5A 4YDVB 3H0TA 3H9SD 3RVUD 1DL7H 4WWKD 1KIUA 2VLMD 4FZEH 2VZSA 5HHVL 1JNNL 4OFYD 3ARBA 3FMGL 1HNGA 3TYGH 5JA9A 5I1HH 3HG1E 2AQ3A 2W9EH 4N8VB 5IHUH 2BHYA 3R0NA 4MMXC 1H9VA 4IIQB 3O2WL 4NKDA 1URLA 1G6RB 2OCFD 3BW9B 4FQCL 4M1DL 4EVNA 3W11C 1IGFL 3I3BA 2E27H 3LEVL 1UM5H 1KCRL 2BMKA 3B2UC 1QFWH 3P4OA 2VABA 3TH3T 4PREB 4UT9H 1NDMB 2ICWA 3MCG1 1HKLL 4Q58C 1EEZA 2F53A 1DLHA 1FFPB 1A9EB 1T5WB 3FB6A 5J13C 5MHSD 4PYGA 1OAUH 4GKOA 3QIWC 1I9JL 4MNGE 4Q9BA 5ICXB 3IF1A 4G42B 4Y19E 2PTUA 2DI7A 5D4QA 5EFIA 3QDGA 4Y5YC 3DXAB 4JRXD 1INEH 5EB9A 5HJ3B 1P5UA 2G9HA 1B0RA 1RK0B 4WO4B 1JMZA 3MYJB 4CW1B 5D7IF 1DUYB 2QQNL 2W65B 3OGCB 3U2SA 2EH8L 1ZT7B 3KPQB 5BRZD 1LE5A 4TNVK 3BGAA 2N1KA 2B7DT 3I50L 3RGVA 3B43A 3SQOH 4OSUL 1QRND 4JPKH 4NO2B 2AK1H 1IGYA 5IQ7H 2A77H 3FFCD 3QIWB 1XF3A 4OLXH 4YDKH 1HHKA 4JPKL 3LKQB 3BH8B 1HN1A 4Y4HA 4P4KA 3PGFH 3NBNA 3DO7B 5EU6E 4U33A 4GBXB 4LEOB 1J1XH 4TSAH 4W81A 3RVWC 1WZ1H 5J1AB 3RVTC 3RAJH 3V4VL 3PWPD 4RDQG 1DFBH 1GPOL 4LSPH 1J12A 1TTFA 1YYMH 3RIFF 2JCCF 4H25A 5MEQB 3VWKA 3MRNA 5ITFB 2EH8H 4BSVA 1X5FA 1GPOH 3I6KB 5HY9B 2NTFA 1NKRA 1CXLA 2R0KH 4L8SA 3QNYB 4KRLB 1JGVL 1AO7D 1FP5A 4APQD 3LS5H 4ISVB 4D94A 1MRDL 1LO2L 4JRYA 4JM2C 5EOCH 5KTEH 5T1KD 1N6VA 1YEFL 1NUFA 3KHOA 2WANA 4J23A 4GRWF 3LKNA 5EBMB 4U1NB 5HDQH 4Z7UB 4HDIB 1FYHB 4WV1C 2BC4A 1CFTA 4OM0L 5FO9B 4Z7QF 3PHSA 2DM3A 4KWUA 4DQOH 3C5JA 4NQDB 2XPGA 3GMNB 3SKMB 4BSWA 1U8QA 3UJJH 5L9DH 3UP1A 2HLAB 3UDWA 1AJ7L 2YA0A 4FQXC 5TQ2H 3ZDXE 5A2JH 4O4YH 3LEYH 3VFRB 2CLRA 2EEAA 2GSIB 1CLZH 3RWFB 1ND0A 4GQPH 1C08B 1TETL 1HSBB 4K7PX 4MZ2A 3VU2A 1EJ6A 2GHWB 2X7LB 3EJZC 5CILL 1CXFA 5F7DB 1KELH 5EZJB 1XCTA 2C3XA 3FT4A 3QFJD 3GRWL 1YMME 4RCAA 5MHSE 5C09B 5B4MC 4M5ZL 3VXRB 1RY7B 3QDMB 2XV6B 2ZCKL 3MV8B 3OX8B 5CFHA 4CADA 1CFQB 5C0BB 1FLRL 4FZ8H 4HT1L 4O2FA 3K2UH 3U7AA 5LXGL 3MUHL 3UO1H 5IQ9B 2OR9L 4M7ZC 1QRNB 5HVWA 4HUWA 4UZGA 1CGXA 1N0XH 7CGTA 4M48H 4P46C 1UXSA 1JWMB 1YPZF 5CUSH 4OCXH 1VEMA 5F21B 2CIKB 3U79A 2P5WB 2AEIT 2HT2D 2VUOA 4UIMA 2VE6B 1UJ3C 3D2UA 2JB5H 5DJCB 5E7FA 2DI9A 1BFVH 1HDMA 1S7RA 3EYVA 3HPJA 1T22A 4PRHE 1SJEB 4TUOB 2EDLA 4L4VE 1A6ZA 1YMHB 5ESVA 4ZUSA 1OTUD 4NJ9H 1YC7A 5IMOA 1QKZH 1BAFH 3DXAA 3ARUA 2G9HB 5HVHC 1GH7A 3IDJA 4IS6A 5ALBL 2Z8RA 4I8DA 3LY6A 3ULVC 3OKNA 3ULUH 3U46B 3NIGE 2XZZA 4YHMH 2D3VA 4XCCH 1EDQA 3LKPA 4ZTOL 3BEWB 1HQ4A 4HKXB 5DFWH 2HFFA 5FHBH 1HK6A 3RHWK 1XGYL 5JNYB 1MCPL 1U3HA 4PJEA 3B2VH 2X5PA 1HILA 5CSZA 1W2KT 1CFVL 1U8IA 4XWOD 3G9AB 2VR5A 1H15B 1QD0A 1UH2A 4LLMA 2HT4D 4YHYB 1I75A 3GIVB 5C0EB 1EERB 1KB9K 4J3VA 3D0LA 3CVHH 3KJ4C 4LLUA 3BUYA 5KSAB 2HRPL 5MEQA 3W5MA 3LN5B 2D9QB 4LHUB 3VFMB 3STZA 3MGOB 4B5EA 4BUGA 1KNOA 5L8LB 3P9MA 5E5MB 4YK4C 4X4MA 1TZGL 4HWZA 5KVDH 2CSPA 2OJZL 4I0PD 4FFVD 1P6AB 2XRAH 4P2RD 2FD6H 3QPQC 4ISVA 2H9GA 2G60H 1XZ0A 4JHWL 4LRIA 4WU5B 2HG5B 1V7ML 3L3HA 5H37G 4F7CA 5D7LA 1GGTA 3DBXB 5F9AC 5L8JB 3VXUE 4NQVA 3SO5A 1J1OH 2EDKA 4QXTB 3C60D 4CVZA 4N8VA 5DF0A 2DIBA 4K8RH 4F3FB 3V2AR 4PRAA 4ZAKA 4LHJB 3GI8H 5F96L 4U6HA 1ZXQA 5K9KB 4CN1A 4TRPH 3U6RA 1CICD 5JORB 1QFHA 3BISA 4FQLL 2ADGB 4LNVA 4WW2B 4DVBA 2WIIB 1M7IB 1TITA 3TIDB 1NFDB 5FM5M 4RZCA 1L9MA 5DTFA 1WBXB 5F3BB 1NC2B 3MR9B 1TVBA 5KS9A 3RL1B 3AM8C 4NO3B 1B90A 1FIEA 5CZXD 4GUPB 4Y4KA 2DQJH 1RZ8B 3H3PH 1QBBA 3C5ZB 3QDGB 3ZTNL 4O2FB 5IJVA 4MJ5A 4DCQB 4XHJC 1RUPH 4OIIH 1BOYA 3MGAA 5FK9B 5IWLA 4EI5C 3O6FB 2PYEA 4K71B 5C2BL 1KC5L 4QHUB 5T1MA 2IMMA 1ZT7A 3KPQA 1RZ7H 4NN7B 4FXGA 1N59B 1WV7T 1W8OA 2VDKL 1JZ4A 4NP4H 2GAZB 3U4EA 3KS0H 3L3KA 3T0VA 1F58H 4Y4HB 1MCQA 4CN6A 2YXFA 4P49A 1HDMB 3MLSH 2P5EB 3QI9D 4N8CH 4EDWH 3MBED 5F88B 3TJEL 4YXKL 2DQFB 1YDPA 2EDWA 5BXFB 1EMTL 1ZEAH 4KXZI 5INCA 4G7YH 1L0YA 3VD4A 3I6KA 5HY9A 1SJXA 1HCFX 3OZ9H 4Z77A 2F5AH 2E7MA 3C9NB 4H1LB 5FIEA 4F9LA 4M8QA 2YC1B 3SDDD 3IKCA 3F6LA 4JZOB 2BNQD 4JO4L 3CZJA 4L1DA 4OLWL 3ZTJH 1UADC 3BXNB 3LD8B 4GG6B 1OAKL 2R1WB 3G9VA 2HTLD 2C4XA 4C56D 4NBYB 5DEFB 4CU8A 3IXTB 1VFUA 3GHEL 5F7KC 3BQUB 3REWB 4ZYKA 3HR6A 1C5DB 1OAZL 4U1NA 5HDBF 3V6OC 4Y19A 1JJUA 3DTXA 1RVFL 4ZFFA 1JFQL 4JPVL 2UY6A 2PN5A 3T3PF 5DMIH 5FO9A 4KHTL 2WBJA 1YNLL 3WLBA 5C7XL 4TSBL 1KEGL 5IUSA 4KZEL 3N1FC 2HLAA 2R69H 2Q7YA 1IEAA 4J4PA 2CH8A 4OGYH 5BOZG 1MFCL 4PJIB 5IHZA 1YEHL 3MBXH 4WWID 1CGVA 4UB0H 3GJEA 3H8NA 2JCCA 4JM4H 3K7UA 5DHXB 4NKDB 2PXYB 1AXTL 1CL7I 1X7QA 3OB0K 2CXGA 2OJEB 4HJJH 2MCPL 1QSFD 3REVB 3A6CL 3I75B 4QLRA 2H9GB 3ILQC 3VRIB 3FT2A 4LLVA 3FB7A 4LFHD 4ODSH 5GZNC 4NN6C 4O2CB 2DJUA 5IMLB 3FFCB 4G3YH 3VXSE 2DBLH 3VI4E 4I4WB 3IDNA 4NQVB 2QADD 3L7FA 2ZSVB 1XIWD 3QXUA 5EN2B 5D96C 2VDPH 5C2UB 5I73C 3C6LC 5DD3H 4JFXB 4AMKH 2OQJB 4Y4FD 1Q9LB 3D3VA 4ONOA 1L4IA 4U6HB 5K9KA 3R4DA 5CEXA 2RFXB 4HG4K 2VZ3A 2MJWA 2DLGA 2R23B 1T66D 3KYOA 4N5ED 3T4AA 1OTTC 3L6FA 4F57L 3D39D 1M7IA 1A6UH 2FX9L 1OP9A 3QA3B 4OJFL 9CGTA 2F19H 35C8H 4HK3J 3FQTA 4N0YH 3HI1B 4HV8A 4ZS7H 1WBXA 5F3BA 3OKEB 3I6GB 4P5TC 1OARL 2GQHA 4DN4L 1D6EA 4HQQL 4NN5B 3ZKMD 1XF3B 4GRLD 5TJWK 4BA8A 3RGHA 5C9JB 4P99A 5EO9B 2CPCA 1HKLH 4OM1H 5IJVB 3CK0L 4HG4J 2UZIL 2BJML 3O9WD 4HXAL 5ABDE 1MF2L 5BV7H 2WLYA 2NY3B 4WW1B 1QFOA 3L95B 3IJYA 5CZKA 2NYYC 3OKNB 1MWAA 2FX9H 4HK0A 4PJDE 3Q1SL 3OG6B 5SX4H 4LKCB 4JFDE 4PLJD 3MACH 4RMQA 1T0PB 2FEEL 4LPCA 4L8SB 5IHUL 1HILB 2E6JA 3RP1A 1CGSL 3S5LA 3BQUD 1H15A 3KPNA 5IW1B 4FQCH 4M1DH 3TCXA 5FKPB 5IQ7L 1RZIB 1A7QH 3H9SE 3OKKB 2R0LH 3FQWA 4KY1H 5EUKA 3EOBB 4C4KO 3IT8D 1GIGL 5BO1L 1QACA 1JNLL 5INCB 2V2XB 3RNKB 1I3GL 1IGTB 2WINB 3T09A 3VFMA 1GGUA 1II4E 4DKDC 4PY8J 3C5JB 2XPGB 4QTHA 1I3UA 4PJAB 3SE8L 1HCVA 4XRCA 4NQSA 2O5XL 1R3KA 3TNNB 1B88A 2QSCL 2BHZA 5CGYC 1AH1A 3QRGL 1T83C 1BD2E 1PQZA 2WBKA 4QRTA 2AEPH 4NNXA 5J89A 3RZWA 1I1RA 3VFRA 5TDOA 4M93B 4UILL 2Y36H 3JBG7 1H5BA 2AJ3B 1J5OL 2DLTA 4FG6C 4ZOAA 3EO0B 3EGSB 4P46D 4Y19B 2Q1EA 2LQRA 2J88H 4KI5C 4KY1L 5IF0A 2FO4B 5HVFB 3O3AB 3T2NH 5IP4A 1F97A 5GGSA 4OI8A 4CJ0A 1YY9C 1NMAH 1UACH 2W9DL 4C58B 4BFIB 3GK8L 2Q7YB 1IEAB 3TT3L 1VHPA 2V6HA 3HAEH 5DC0A 4QNPF 5C92A 3OXRB 4LDOB 4D8PB 4JQVA 3C09B 4F8TA 4XNZC 3S4SA 4Z76A 3RWDA 3TBVA 1OCWH 2GCYB 3ETBF 2Y06H 1FL6A 2A74B 5I1KH 3CFIC 2W60B 3QZWB 3TIDA 3MV7B 3FJTA 3L3GB 3HMWL 1UXSB 4NWUH 1JWMA 2AJXH 3CMOH 1J0IA 5D1ZD 5ALCH 3IDYB 2ENYA 4TUJB 1ZS8B 3VE0B 1MNUL 4PJFE 1F3JA 2F74B 1D7FA 4FQXD 3GSRB 3BP4A 1JTPA 4Y4KB 2NY4D 3DX6B 1Q0YH 3C5ZA 5DJCA 1Q1JH 1A9BA 5JOFB 2R1YA 3O2DH 5DJDB 4KJYA 2XZQH 2OQJA 3QUXD 5JW4N 2A83B 2EKSA 5HVGB 5LGJB 2DRUA 1ORQB 4HWUA 3FZUD 1MRCH 1PG7W 5A2IH 1MNUH 3KYOB 4LSQH 4H5SB 4NFBA 1LQSR 5E8PA 3OBAA 3TPKA 4DFIA 3QUKB 1CLZL 5CBEA 4BUHA 4XNMB 1NJ9B 4GS7B 2GYSA 3IDYC 4QF1A 5EU3A 2NX5B 3HMWH 1I9IH 1DBML 1J1PH 1EHXA 3HE6A 5DYOA 3SDAA 4M7LT 3HG1D 1U93A 1ZHLA 5DQDL 3CDFA 1ZGLP 3FTGA 2VXQH 1YY9D 3RZCC 3UYRH 1M6OA 1U92B 2MQ0A 2PF6A 5BOPA 1OAQL 2NXZB 3MLXH 1Q94B 3VCLA 3QDJD 3WJJC 2VLRB 3BEWA 1HQ4B 4BK4A 5I2IA 4D0DB 3CFDB 3BKCL 4U3CA 1DQTA 4PJ8D 5F88A 4RQQA 2DB8A 1ZWIB 2VNCA 1U8IB 3DVGA 4YGAB 4LASH 1A7NL 1L0XA 1KJMA 1NCDL 1XT5A 3B9AA 4GS7C 1QZ1A 4KRNA 5J0BA 1IC7L 4U1MA 3VG0L 3T65B 1X5GA 1NBVH 1Y18B 4XBEH 3D48R 4RGND 4QHMB 2X4NB 3OR6A 3GMOA 4G6FB 5C08A 5J11C 3DLQR 4WI9A 1C5DA 3ZT5A 5CJXA 3TO4B 5HYSG 5DC9B 4WU7B 5E2TL 4XPHL 1JHTA 1AGDB 3HRZA 4CN4A 1YEDA 5E1HB 3C60A 5I74B 5HYSB 1IKNC 1RULL 3QR2A 1DDHB 5K9OB 5F1NA 2NY2C 2G2RB 2HVKB 1JPFB 5GS0H 3CXDL 3PDOA 3KWWA 1FGNH 3SKJL 4PLJC 3E2HC 3G6JA 3KLAB 1PKQB 5DD5L 4XNUH 5DQJB 1T03L 2EH7H 4F33B 4H88L 3TNNA 4J12A 4G9FE 3G5VA 5C07D 4JM2F 1KCSL 3WUZA 1PQZB 4JZJC 1WVZA 2GEEA 2ADIB 2ITDB 2NY1B 4IJ3C 4NNPH 2OP4H 1WEJL 4PRPA 2AJSL 3ULSA 5HHME 4XCFH 2IALB 1OW0A 1BLNA 3T1WA 2F58H 3NCEB 5L88L 2ICCA 4G5ZL 4YE4L 4LLDB 4TRPL 2ZSVA 5IFAL 4X6FA 3RWCA 3F7YB 3DJ9A 2OLDA 4YE4H 4JCMA 2HVJA 4Z7NE 3P9LA 1F4YH 4L3EA 3NA9L 4L9LC 4G80B