5C08E

1e6 tcr in complex with hla-a0e carrying rqwgpdpaav
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
244
structure length
244
Chain Sequence
GVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 244
sequence length 244
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08E02
4LQ1A 2X05A 5ENWA 1WWAX 4U1KB 4MD5B 3CFBA 3OF6D 3VXOA 1ZLSL 1EHLH 4MQ7B 3CC5B 4AG4L 3HI1B 3GJEB 2CDEA 4MHHG 4OUUA 4WFHE 3EFDL 4S1QL 4XAWL 2YC1B 3DYMA 4X80L 3SHSA 1F6FB 4G7YH 3WHXA 1DQQB 4I18A 2XOTA 3D3VA 1RIVH 1MH5A 2DQEL 3QNXA 3D48R 1UH3A 1NDMB 4M62H 3UCRA 4XHJD 4NDMA 2EIBA 3AS3A 3MREB 3OF6A 3GSNB 5C09B 5IKCA 4JQIH 1UM6H 2PTVA 1INDL 1HIML 3C6LD 5I8EB 3S35L 1NAMH 3MYJB 3RTQA 3W0WB 1JPST 1U3JA 5I30L 2GTZA 4WVRA 2BP3A 4JM2F 5ITFA 4O9HH 3NCJH 2QQLH 4PJCA 4UQ3B 2G2RA 4N0FB 4PP1C 4K7PL 1JZ6A 4XXCA 4QRRA 4ELMF 3N0PB 3VXUD 4L9DA 5D7LE 2FBJL 3KYNB 3WE6B 3TA3B 4BK4A 5I73B 4OV6F 5JQ6H 3MV9D 1C5CH 1BM3H 1KYOK 3C6LA 3PQYE 5E9DD 2R39A 4UTBL 4OZFH 2HWZL 4PLOB 5LQBL 4FZEH 1NQBA 1IKNC 5EH1A 2VXSH 1A7PL 2EH8L 2VTFA 2YA2A 4Q2ZA 4X4XB 1OAZL 3S36H 2DYPB 5HHME 2F8OA 4JY4B 4MNGE 2HJLA 2DM2A 3C60C 4JFDB 1JHTB 3ZT5A 2P24A 1FNGB 3CDGA 3Q5YA 2VQUA 2BFVH 1QSFB 1G6VK 3KPLA 4QOKE 4AEIL 4C83B 3MV9A 1EZVX 1TVDA 4MLSA 5CGTA 5BZWB 4M8VA 4GG6F 3QUZA 3CZJA 4P46C 5E9DA 4D0BB 1H3UA 4Y5XA 2CRYA 3UTSA 1AFVL 1XZ0B 4OLXH 1EUTA 3P30L 4C57C 1SJVA 4D9LH 5I1JH 4GAYB 3TWCH 1FE8H 4S1RH 1RHFA 2V7HB 1KEGH 3MR9B 3O6KL 3KR3H 4KKCC 2PW1B 5CD5C 1PEWA 5HYSB 3FN0H 2YSSA 1MLCB 1AGCB 3SDCD 1EXUB 4Y5YC 3U9UA 4FOMA 1G7PB 3QIUC 1WK0A 4ORZC 4B7IA 2D9QB 4CJ0A 3LKSB 4YPJA 2OZ4H 5A3ID 2YA1A 2G5RA 4GRLD 1I1AB 2CK0H 4KAQL 4UOW1 1X7QB 1MI5B 4DAGH 4Z77A 3E6HB 4NJAH 4L8DA 4ZOAA 4WHYG 3MFFA 4M5ZL 2HLAA 3P0VL 1ZT4A 2XXCB 3OR6A 4MD4B 5IFHH 2QTEA 3VXRE 5D5MB 1N26A 1MVUA 3GM0A 3VD9A 3AM8A 4X7SL 3QUKB 1PSKL 4HC1H 4Q0XL 4HWEH 1DBML 3JWOH 4ZPVB 1XF5A 2RGSA 1UACL 3PIQB 4KZDH 3PE9A 3QCVH 4XNQA 3RU8L 1JF6A 5INDB 5ISZB 3VI3E 3OKDA 4AMKH 2NLJB 2X7LB 3BEWA 5KSAB 4RAVA 1JPSL 3ROLA 1VFAA 1M7DA 3MLZH 1OSPL 4FFYL 4WFFD 5ID0A 4MJ6B 1GH7A 2KQMA 3ARUA 3MLUL 2XKSA 5MHSE 4IRJA 4PGDB 2Y23A 5D6CA 4TUKH 1KT2A 3HCVB 3MACH 4NSKA 1G7LA 2D0HA 3QDAA 5F7EH 4UT7L 1FZJB 4R0LA 3BIBX 5FK9A 4PBVC 2VLLA 3KXFE 1NBZA 2P8LB 2Z8SA 4OGYH 1E27A 1ZVHA 1RY7B 5GRUL 1RZGB 4W81A 1WEJL 4ODXB 3QDJA 5F7LB 4K3HA 2P46B 1GGCH 3KNBA 1F11B 3BISA 3NACH 4JO4L 1YEIH 3Q3GA 4E42B 5IMMB 1JWMA 4X4ZA 1UEYA 1X4YA 5C08E 2E9BA 2OLDA 4WFEE 2GITA 3MJ9A 2E7HA 4WGWB 3AS2A 3SKJL 1F3DJ 2AVGA 4NKMA 4ZO6A 2DIJA 5I1CH 3S9DB 3FFCD 4HH9A 2J5LB 5ERWA 5GRVL 4DN3H 3GGWA 1NGXA 3V5DA 4V2BA 4H1LG 4KRLB 1F8TH 3TN0C 4MJID 4P3CH 3VXMB 1LP9F 2PO6D 3D39B 4I1NB 4LOUD 5FYJH 4NFCA 1SVCP 2A6JA 1REIA 1U91A 2DWEA 4KDWA 4Y4HB 4NNXB 4HKZA 1XF4B 5CIPB 1A14H 2Y9RT 4J3OC 5C0AE 3FFCA 2BNRB 5EA0L 4Z5RA 5KG9B 4NQVB 3SE4A 4P2QD 2A73B 4D3CL 3VCLA 1GRWA 2VR5A 3LMJH 3QO0B 1DUYB 1EHXA 5HYFA 2K7PA 1XGUB 3CFDB 3LIZL 3EOBA 1GPOH 4D9RD 1I8IB 1D3CA 1KNOB 1CDBA 3V0VA 1P4BH 1KG0A 3ULVF 3E6FA 1ES0A 1TZIB 2VLRD 4N5UA 4PRPE 3KPRD 3JV4A 2FLRT 5DMIL 3ULUE 3MMEA 3P0YL 4P2QA 5DK2B 4X5WA 1ZGLA 3S3PA 1QNZH 1XR8B 3BIKA 5CP7B 1QR4A 4YHOL 2YRLA 1SJHA 5JOEA 3W39B 3JUZA 2W9DH 2GFBB 2NCMA 1G9NL 1FV1A 2AXGA 1OOAA 5F7KC 3DO3A 5E8DL 1OM3L 4LK4A 5HHPB 2XQYK 4H5SA 4I18C 2QSCL 3P9WB 4G6AD 3MRKB 5EU7E 4DZ8A 2VLRA 3BYYA 4XBPB 3KPRA 1OD9A 3LQAL 4OZGB 2YD7A 3KG5A 2E8YA 3RTQC 1G7JA 1IAKA 1K4CA 1AXTL 2Y07L 3WJLA 2DLHA 4B41A 5HVGB 3MBEA 4YHML 3WKMH 5DJ8B 1YMMD 3GKZA 4LLQB 3C5JB 1S9VA 3LZFH 4I3GA 4Z7OF 4XXCC 4KI1A 3OKLB 5JDSB 1FFOA 3PP3K 3I6LD 4XHJC 2MHAA 4OCWH 3BP7A 2GYSA 1G7IB 2HAZA 4QHMB 3UJJH 4PJXA 3D6GA 3VXPA 4D9QD 1CZ8H 3C6LC 4ZO7A 2BY2A 1CE1L 4J3TA 4P9MH 4IDJH 1RULL 2RFXB 3MROA 5EIIA 5IUSA 1JYXA 4WNQB 1JGLL 3P9LB 3S98A 1W0VB 2IALB 4XWOC 1MAML 3CVHH 4LNRA 1PEZA 1QFOA 1V3KA 3O3DA 5AUMA 4OV5B 4LSVH 2QSTA 2D31A 1MOEA 2XZQL 1QLEL 3O41B 4ZPTA 5ICYB 3D2UD 4XP5L 3L6FA 3QB7C 3P9MA 3QUZC 2OCFD 4Z0BH 4QGTA 3RDTD 4Y5XC 1F02I 3QUMA 3PHQB 4TVPE 5J56B 4MA7L 3HUJF 5JIKA 1GAFH 3U48A 1I9EA 5F93C 1ZA3A 3HHRB 2OL3H 2BSED 1DVFD 2CUHA 5KVFL 5FKPA 1OL0A 2F19L 3TBSB 3U36A 1IZKA 3SPVA 2DJUA 3BZEB 4P5KB 2ZPKH 4HHAA 3DWTA 2B4CL 3RVTD 5E2TL 3SO3C 4YHYB 2IBBA 3RDTA 3HC4L 3QFJD 4NO3B 4JFEA 2BHUA 4JHAH 2LAAA 2FGWH 5E1AB 1HCVA 4DVRL 1QYGH 5DJDB 3UMTA 3GMMB 1SEBA 4QNPF 1K85A 5I19H 3BVNA 2ILLA 2W59A 4KJPD 2CLZB 3FOMB 3AM8C 5GS0L 5FUZL 1KACB 4W6XB 2XTLA 3QXUA 3G5XA 2NX5B 1K4DB 2NPLX 3BDYH 4NQDD 3BKML 1NFKA 1T6WA 3O6MH 4YHPB 3BPCB 5T5FH 2JJWA 1JZ5A 2LE9A 2ITDB 3VXUB 4FQHB 1I1YA 5DEFA 4ZS7H 2XKNB 1SM3H 4W6WB 1K3ZA 1S78C 3BH8B 4CDGC 4LLMB 3NGBB 4ELMA 4HJGA 4Y0GA 4Y4KB 5ADPL 3HAEB 4IRJC 1IM3B 4WENB 1U93B 4JGMA 3MXWL 3QCTH 4R2GD 4YZFE 4X6BB 5F9WB 4ODTL 3RKDD 1FO0A 2R0LL 1A5FL 4R0LC 5ACMA 1TETL 3WFBH 4NQDA 4M5YL 5J6HA 3P73A 1WTGT 4PB0H 5D5MF 4O58L 3G6AB 2Q1EA 3WXVH 3NCMA 2CLRB 1JF1A 4GXVL 4HZAA 3VRIB 4BZ2H 3I6GA 5K93A 2NXZC 4QYOA 1W72H 4PV8A 4S2SB 5IOPA 3CH8A 2Q87A 1IC7L 1QBML 4GG6A 3PWUB 5IMOA 5DHXB 4WU7B 4GO6B 1FPTH 1XGPA 4YLQT 4HJJL 4CVXB 3MXVL 2BCKA 3WFCL 1U8LA 1I9IL 3E1F1 2YD6A 4PRNB 1RUPH 2KPNA 1YDPA 4Z7VE 1S9XB 4HG4K 5HY9B 3FQXA 4AL8L 3EYUH 1MRDL 3SDCB 3UAJD 3V7AE 4LSPH 1D5IL 1OTTD 4JRYB 4OLZL 3TP4A 4M3KB 5J12B 1ZSDA 4M1GL 3WDJA 2FLBT 4YAQA 2VLKD 4GRLB 4M93C 4WO4A 3PABA 5JW4Q 2NW3A 4GW5B 5B8CC 2CIKA 1OGTB 1NFDE 1CDUA 3LN9A 2XACC 1BQHG 1S7XA 1RZ8B 1KJMA 5L8LB 3GMNB 2XRAL 2A9NH 1RIUH 2BXZA 3PGCA 5GHWL 2EH7H 3SE4C 4PJ9D 4CDHA 5HHQA 3QDMB 1NEZG 1S7RA 4GSDL 4M6MH 4LOUC 4S1DC 3T0BA 4F33B 5J57B 5IF0A 5A16B 1EERB 5JW4N 5FYKD 4PV9B 1ED3A 1QSZA 2YOCA 1WICA 2R2HA 5HI3D 4PG9A 3MRNA 5C0FB 5GS1B 4K8RH 4OJFH 5EULV 4HFWA 3OGCB 4HPYH 5IV2B 4YWGL 1URLA 1P4LA 5LWYH 3HC3L 1XR9B 5DQ9B 5FEBA 4K3EH 3SOBL 1BFOA 3TPKA 5MERB 3RNQB 1A7RH 3EW3B 2BDNH 1XF3A 2QQKL 5A40E 3D85A 5I1GH 4UUJA 5C0RL 5CJQH 1OAKH 3O4OC 3QG7H 3U7AA 1NCWL 2IWGA 1A2YB 1FL5B 1S7UB 4YDIL 5C9JA 3OPZH 4PLJD 3T0WA 4XPTL 1YYLH 2P8MA 2PXYA 3WJLC 2DD8H 3MBEC 3P11L 1U8HA 1P5UA 4S0TD 4JFPB 2HG5B 2VH5H 4BSVA 5E70A 5IM7B 3O3AB 3BPNC 3GDBA 4KGJA 1MCJA 6FABH 4JLRA 3BKJL 2R23A 3ARBA 3QG6B 4HKBA 4YHLL 2OTWB 3QWRA 3O2DH 2ZUSA 5CAYB 4MJIB 2DKMA 2Y06H 4EN3D 4I2XB 2X4TB 1GGUA 5FYLL 3CD4A 5HDQH 3ARXA 2H1PL 3X14A 1YQVL 2ESVA 4DOHE 1I7TB 1LP9A 4ZSOA 2F58L 3ZKXB 4EXKA 1CFTB 3L5IA 1UWGL 3H7BA 4KVNL 1X5AA 2J6EA 1NCDL 5IW6B 1ZXQA 3DYPA 1E0OB 4P2OB 4X6DB 5FXCH 4UV4H 2AEQL 1GHFL 4HPOL 2I24N 4NQEE 1JHKH 4F3FA 4R90L 4LU5L 5F3HA 5I1DB 2PCPA 2UZXB 4LKCB 1B88A 4PD4J 4KGLA 3WIHH 3MNVA 2YKLH 3O4LE 4NO5A 3BUYB 2ICWB 4JKMA 5EZLA 2EE3A 4NQCD 3B2UD 1KPRA 3D87B 3CCHB 3STZA 4NFDA 1XCTA 1FZOB 5FB8B 2X6MA 4NZUL 1G9MH 1KCKA 2J8UB 3RDTC 4KKLD 2EIZB 4GRWH 3JUYA 4KVCL 1VCAA 3B4NA 1WWBX 2WIIB 4K9EC 1JNHA 4MGXA 1IC4H 3V8OA 2A6DB 5BO1H 5ADOL 2GAZA 3SBWA 4KKNA 1CU4H 2AJSH 5CBAA 2A6IA 2J88L 4NQCA 1KLUB 1SBBA 1G7HB 1QRKA 1KBGL 1X5XA 5CKAA 3UPRA 4ONGL 2EDKA 3EHBD 4BFGA 3UYPA 4GOSA 4H20L 2BK8A 3A6BL 1K5NA 1EGJL 3ILPB 3I6KB 2AK4E 1QPXA 5KZCD 1FC1A 1G7QB 1L4IA 2GTWB 3HI5H 4NRYB 4F8TA 4WV1A 4X0KA 5FKAB 1T0MA 3HMWL 3CLFL 1FGNL 2Q86B 4PJAE 4JPVH 3QUXD 2MNUA 4JANB 4GXUM 3B9DA 4LLWA 2VDLL 3HI6H 4O02L 1X5HA 3KJ4B 3MLXH 4HIXL 1ZV5A 4OLYL 4XCNA 5DRZA 5E94A 3GJEA 1QA9A 4XNXL 1CE6B 1TVBA 3B5TA 4UMGA 4OLEA 2YPLB 3LD8C 4NOBA 2DBLH 5IEKB 3W2DL 4DGVH 2FCBA 5DK0A 3D2UB 1NGZA 3F6LA 1NCAL 5FFLA 2Q3ZA 2Y72A 5C09A 5CSBA 4NZJA 1CFQB 2APBA 4HLZH 3W0WA 4FTVE 3RKDC 4QTHB 3VFRB 3KPSD 3KPOA 3QQ4B 3HUJA 1DVFB 3ESVF 5E95B 4GKSB 5GISL 4LRIA 1UJ3B 5D2LB 1T83A 3WNNA 3T3MF 2BMKB 4NNYA 1ACYL 1SYVA 4U31A 5HDLA 2AK1H 5DJ6A 5SV4A 1BQUA 4BZ1H 4CBPA 4WO4C 3FAXA 1S7SA 5MEND 2PTUA 4L4VE 4XCEA 2C5DC 3SDDD 3TBWB 5GXBB 3H3KA 3MRPB 2HKHL 5ALCL 3TIEB 4ODHH 4DQOH 1Q0XH 2ID5A 4MA8L 2FHBA 1YY9D 2EYRA 5TDPB 1DSFH 1A6UH 1INQA 1Q9KA 2R4SH 3PWPD 4HH8A 4UOJA 5DJXA 5H8DA 3T0EE 4HIEA 3MNWB 4Z7WA 3U4EA 5HYEA 1I3RB 3BZFA 3AROA 1WT5C 5BZWA 4XZUB 4OI9A 4D0BA 5C0IA 4WUUB 1UWEL 3O11B 1DFBL 1ZLSH 2F54D 3KPQB 1KCVL 3MR9A 2J6EL 4AG4H 5C6TH 2PW1A 5KW9L 3UROR 4P48A 1HILB 1UXSA 4UI2A 2IADB 3EFDH 2AKRA 3KYMB 4S1QH 4AQ1B 5E5RB 1AGCA 3QI9D 4XAWH 4CAGA 1VFBB 4X80H 4XB7A 5LAXB 3IXTA 4R2GB 4APQD 5I74B 4FABH 2DQEH 3LKSA 2JLLA 4WEMB 1E28B 1R5IA 3IKCB 4HAFA 1VEMA 3BZDA 2FJHB 2P5EE 4OGAD 4RDQG 5I6XC 1INDH 2X2YA 2VR9A 1FH5L 3S35H 4F2MA 3VXTB 1CXKA 3ULVL 5I30H 2XQYG 4P0DA 5D5MA 4OZIB 3UTZA 1MCHA 5HPMB 2VLME 1MAJA 1S7VB 5D7JB 4LMQI 4Q74A 1KTDB 3CSYB 5EIQA 1TCRB 1JPGB 2PXYC 4K7PH 3ABZA 2APVA 2FBJH 5IFAL 3VFGL 4HZLA 3OMZA 3O3EA 1VGEL 4H8WL 2X7LA 5KSBF 5KSAA 3JV6B 2DQHL 1JPTL 4OCRL 3VFSB 3U30B 4UTBH 5EORL 4G9FE 1MCIA 5LQBH 3IETA 1AO7E 2WLZA 2Z9TA 4F15B 2EH8H 5B38B 1OAZH 1VFMA 2FR4A 3OKNA 1BFSA 1FYTA 4OFDA 1AI1H 4PGDA 5I8OL 4LPCA 3K4ZA 5L0QB 3FZUD 1A9BA 5EOCJ 5T3ZD 4WU5A 4PJDA 1YNLL 3QEQB 4CL7A 4AEIH 5F9OL 2X9YA 2VZUA 4MXQC 1AP2B 1MEXL 4J1UA 5D93B 1AFVH 4H1LA 4M8QA 4ZAKB 1CT8A 2P8LA 3I75A 4JN1L 4A6YB 4ZD3L 4EI5B 3QXTA 2HTLD 1F11A 4ESKA 5C0JB 3T2NL 3RWGB 4PYGA 4R9HA 1ORQB 3OQ3B 3S35X 2AXFB 4XP6L 1AR1C 4P23B 4QT5A 3IFNL 4KAQH 4R7NA 1JMZA 1INEL 4LAJH 4QXGH 4Z7UB 4K7PX 1LEGB 4M5ZH 2EC8A 1BVLB 3BGMA 3S5LG 3DYOA 2F53E 4TNVK 3EJYD 5D1ZA 4ODUA 4X7SH 1PSKH 4Q0XH 3SBWC 4ONHA 1DBMH 3BSZL 2YD1A 1UACH 3DO7B 4JFDE 4R97B 1N8ZB 4HWBH 3KGRA 1KIPA 1T5XB 3F6IA 4QRTA 3RU8H 2X09A 1R3HA 3UDWA 4DKEH 3CU7A 3SJVD 1QSFE 3UTQA 3FRUA 3VDAA 1MAKA 4X6DF 3TIDB 3C6SA 4HV8B 4OQ1A 1OWRM 1JPSH 1C7TA 4G6KL 4QRQA 3VW3L 2R69L 4GQ9L 5T33H 2AJ3A 1R24A 4PRDA 3V5KB 1OSPH 4U1SA 3V4VL 4FFYH 1IM9A 5EPMB 1XGUA 3BD4A 1Z0NA 4WV1C 4XPGL 1G0DA 5I66A 4LPVA 1I4FB 2E6JA 1I8IA 5B39G 1MCWW 3VGGA 1CFVH 1S8DA 3MLUH 3B3IA 2CGRL 2DQTL 1ZS8B 2E6PA 5I8KH 3RGVD 3WHE0 1G7MB 4B7LA 3B83A 3EHBC 3BEVA 4EN3B 3LKPA 4XTRD 5CP7A 2H32H 1CK0L 4X4YB 1F6AB 3EDJA 1NUDA 5IFJA 1ZAGA 5GRUH 2GFBA 4R26L 1WEJH 1A0QL 1AGDA 5I1KL 4NN5C 3WXWH 4JO4H 1VADB 1T03L 3RGVA 4MNQD 3NCYS 3TBTA 4BYHA 5EC2A 1FZMB 5A43C 1ACZA 5ILTL 5E2VL 3SKOB 1M6OA 3BDBA 1V3JA 4PTTB 5ISZE 43C9A 3TJEL 1DLHA 2VDPL 5FHBL 4G6FB 3MLWL 3ARWA 4LLQA 4YE4L 3QJFB 4LRIC 3OKLA 1T83C 2XQBL 1UKSA 2L7UA 5C71A 2K9UA 1QTYT 2C9AA 1G7IA 1ZHBB 4YHNA 5JHDD 2V5TA 4C4KT 1MELA 2VKXA 4DN4L 4PJBB 3PXHA 1T04B 2RFXA 4HUUA 5EA0H 4U1GC 5F7YC 2DQCL 5CZKA 5IWLA 2UVFA 5KSUB 4D3CH 3ECBB 4RGMB 3BJLA 5CP3A 1CGWA 2XICA 4XRCA 4BUGA 2BVPB 2FO1A 3KAAA 3QQ3B 4L8BA 1G6RB 3LIZH 5E6ID 1B0WA 1KIRA 1F13A 4JHBA 2CXGA 3T4YB 5KZCB 2D7PA 4LCYB 1OB1B 1JMXA 2P49B 4JY5L 5HD8C 2ED7A 4X7TB 3QZWG 5DMIH 3P0YH 1MJJB 2R9HD 2CMRL 2WQ8A 1XCQA 2AJVL 1S3KL 3NIFE 4YHOH 5D2LF 3WKNA 4RZCA 1LHZA 3ARDD 2WW8A 1YY9C 1MJ7L 3QUXB 3F7VA 4RMTA 2DIAA 3TCLA 4I77L 1G9NH 2IBZY 4C54A 1MF2L 4P5KA 1C16A 5E8DH 4FXGB 3MRCB 4OZFG 1OM3H 3VXME 2QSCH 5DVLA 2DDQL 3D9AL 3F8UB 3D39E 3LQZA 3QRGL 5EOTA 3U46B 5KBNC 2ARJA 1WZ1L 4L3ED 4PGBA 4MA1B 1D9KB 2HYMA 4LCUB 3LQAH 3NIGE 3QFDB 3DX9B 4AM0B 1P6AB 2VC2L 2XA3A 1TTFA 2C4FT 1PLGL 3QUYA 1AXTH 2CLZA 2WINA 3VFVB 4M6NH 2YD4A 1A6ZB 1DLFH 2BVYA 4RDQF 4MD0A 4JKWA 2Y25A 5EU6B 5IJKA 4RGOL 3TJHC 4Q9RL 1OQOA 4N9GB 1CDIA 3W9DA 4OGAC 4E41B 1BD2B 4EDWL 1NGQH 2BVTA 1JP5A 4YIQB 1TITA 3GMPB 5BXFB 1CE1H 2D7TL 5EFIB 2G5BA 1BIHA 2Y5TB 1DQLL 4G6JH 3PJSA 4IRZL 1RULH 1U58A 5GZOD 1TJIL 3MZGB 3BH8A 5DD0L 5D7KD 3QNZA 1JGLH 4LLMA 2XKUA 1A6TB 5IHBA 3OKEB 1MAMH 3TF7C 1U93A 1KXVC 4LCWE 1KTLA 4NN7B 5HI4D 3PWJA 3MRHB 4JVWA 3LHPL 5DQJA 3FB7B 1QLEH 5EWIL 3A67L 3SDDB 4CADB 2VQ1B 4P57A 4H26A 5KTEL 1OD7A 1I7UB 4XP5H 5AEAA 5AZEL 5ACLA 2BVQA 4LHUD 1CGUA 1KC5L 2NY0B 2Q20A 4MA7H 4ELKB 4EUPH 3PWPB 4OZGE 2CLRA 1L0QA 4P2YA 3EOAA 3TT3L 1WC7A 5F72S 2Q8BL 5I8CA 4OLWL 4ZFOB 4L29A 3FZUC 2F19H 4WU7A 1BQHA 3H3PL 3WO3B 4JR9L 5EU4B 1A4KB 2F54B 5DXWA 3C5SA 2GSIB 5E2TH 3E8UL 3KPMB 3LN5B 2DLFL 5BJTB 1R3JA 3HC4H 4UIMB 5GGRY 1KJVA 5I76A 1LK2A 3L3DA 3QI9B 4DVRH 1MCQA 3NABH 2CLVA 4MXWL 4APQB 5B21A 1DEEB 3VGAC 4JQVC 3CX5J 3ZYJA 4YNYA 3G6JA 1R6VA 3HFMH 1KB5B 3ALPA 5D1ZC 3MO1B 5TGBB 4DEPB 5FUZH 2HT2D 1OGTA 2RIKA 4GBXB 5HHNA 1BPVA 3MJ8B 4N8CL 3Q5TA 1AR2A 1U8NA 4Y4FD 4L4TA 3UDWC 4LIQH 3DURA 5IW3A 3KS0H 5F96L 3SGDH 3MRQA 1NMBL 4U4BA 2Y36L 3TH4T 1F4YL 3DARA 4IHOB 3BKMH 3KPPB 5IBLD 4MCYA 4AENA 1Y0LB 4BUHA 3UTTA 1MNUH 2Y5EA 5MEPB 3QDMA 3VD4A 3EJYC 4LVHC 1WAAE 1Q94A 3D3VE 4YGVA 4F33A 1EZVY 5A16A 1XH3B 3BRFA 5MEQB 3WUWG 1JYNA 5AYQA 3DROB 4F57H 3MXWH 5JA9A 5KSBA 1IMHC 2IPUG 4YXLL 3DGCR 4ODTH 5L2JB 1A5FH 1TETH 1I8MA 4M5YH 2Z93B 1V8HA 4EBQL 5IV2A 3L3JA 4O58H 4PREB 3EYOB 1NKOA 4PJCE 5HDBF 5D1QD 3NN8B 4JDVB 2I5YL 2FECL 3OWEA 2UVEA 5MERA 4R3SB 3SGEI 1DUZB 2MPAL 1Z5LA 1E6OL 3RGVC 4OQTL 5JXAL 4AEFA 1RFDL 4HJJH 3MXVH 1RUKL 1I9IH 2NY1C 1S7UA 4LFHG 2OI9C 1D5MB 5CILL 1J8HB 4KC3B 4AL8H 1MRDH 1W8OA 1QBAA 2EE9A 5F7WC 4JFQB 3DIFB 3RNKA 1D5IH 3HZVB 4NUJB 4OLZH 1M4KA 3D25A 3VXUE 4JFPA 4M1GH 1YPZB 4IS6B 3SO5A 2GJ6B 3QPXL 2AQ2A 3RWJA 4FQXD 3MV9E 3UYOD 3OXSA 3O9WD 5E9DE 3MV8D 2OTWA 5L6YL 4NT6A 3MUGA 5DJ0A 3CLEL 3MV7A 4I2XA 4NZDA 1HYSD 2OR8A 5E8NA 5D8JL 4QKXB 4PP2B 5DI8A 5DQDL 3VD5A 3L95A 2UWEB 3UTOA 2XRAH 5IWLC 1CLCA 2YXFA 3L7EA 5F3BB 1YA5A 1CFTA 3VFTB 2Q7YB 3CVIL 5DDHA 4FFZL 2A1WL 4TOYL 1MWAB 4GSDH 2NY3D 3O9WA 5F1KC 4JFOB 4UINL 5IW6A 3RUGF 3I02B 3FB6B 3HS0A 4L5FL 1M7IA 1VESA 1IEBB 4JO2L 1T7ZA 3QH3B 4WEBL 4CU8A 5CFHA 4XNYH 3LB6D 5EUKB 35C8L 4YWGH 2MCG1 3BUYA 3DX6A 5L2KD 2CRIA 4S10A 3HC3H 5SWSD 3CUPB 4PRHD 5A2JH 1HWHB 2NXYC 3PDOB 3CCHA 3OKKA 3IT8D 2AABL 4HKJA 4PJBF 3F7YA 1MCNA 4N0UA 3BHBA 1RV6X 3PHOA 2QQKH 2LV4A 1RJYB 3WSQL 2DWDB 2HJKB 2WIIA 5HSFA 1S9WB 1NCWH 1E4KA 2R9HC 1S7WA 4U1MB 5C0CB 4YDIH 5I1IL 2D7QA 3GMQA 4XPTH 1SEQL 2EDNA 3ARDC 4K9EH 2OXHA 1KLUA 3QUYC 4MNQB 2XPGB 1HZHL 3QWQB 4M3JA 3FOLA 4CMMB 4ORGA 4YJZL 5GSVB 3P4MA 2Q6WB 3VH8G 2CJUL 1C5DB 5CEZH 4DFHA 5IJKC 4LP4A 3PL6D 1RHHB 3ILPA 2X41A 1JBJA 1IFHH 2I07A 1QRND 3HPLB 4JB9L 4YHLH 4KY1L 4R4BA 2XA8L 3AAZA 4X6FB 3HG1D 2B5IB 4EXPX 1ADQA 3U79A 2EKJA 4WFFE 4X8XA 1Y18A 2BSRB 5TDNA 3ZMRA 5FYLH 2FBOJ 4DK6A 1T80A 2H1PH 1MFDL 1Z9LA 2F58H 1L7TH 1HI6B 1HQ4B 1M1SA 1UWGH 3EZJB 1YEEL 3MBXL 1TVHB 4X6CB 3BP4A 1VFUA 2ZWLT 3KLDA 4KUCF 2IH3A 3OB8A 5FYJU 1CE6A 2EEAA 5DJ2A 2VABA 1YMHA 2AEQH 1YEJL 2C1OB 2YPLA 3EOTL 4MCZB 5CSZA 1FO0H 3GSWB 3VGHA 4LU5H 3NFNB 1KTRL 4TSCL 3L3OB 3U9PL 4JAMA 3UTPD 5E6IB 5INCB 4ZOEA 3GBNL 4NNPL 3TNNA 4WHCA 1RZJL 5HI4C 5BV7B 2QLVB 3GB7B 3O45B 3QDGB 5EG6C 4ODSL 4NZUH 1TENA 1WWCA 2HN7A 2OSLB 5IIEB 3FFCE 4FG6D 5I1AB 4KVCH 2XWBA 4I13B 1UJ3A 2X4QA 4OD1L 4PRIA 5ADOH 2P5WD 4MJIE 5FM5M 3FT4B 2L7JA 3K8LA 5AD0A 3UBXG 2J88H 2VQTA 4PJEF 1KBGH 1RIHL 2FJGA 4L3EB 5D72L 1ZT7B 5HGAA 3KPNB 1FJ1B 2H45A 1Z9SA 2CD0A 3MRPA 4HUKB 4H20H 3T65B 4KHTL 1YECL 4HKXA 5DURD 3TFKD 3A6BH 3M1BA 3TIEA 2O61A 1E4XL 1A1MA 4P2QE 5HHOA 4U7MA 2MMXA 1N3NA 4HQQL 3KWWA 4TVSa 4X6DE 3U0WL 5TDPA 5B4MD 3HMWH 5GRVK 3QIBD 2HVJB 1CLYL 1CFNB 4QTIL 3ILQD 3BPOC 1FZKB 4KUZH 5DJCB 5TDOB 4D9RE 3PGFH 2HFGL 3ZE0F 4ZUSA 4NN6C 1VGKB 4WUUA 5DZOA 3DTXA 2B1AH 5EC1A 2VDLH 2ENSA 2P44B 4U0RC 3SCMB 4O02H 5CEXA 2VLRE 4HIXH 4OLYH 5K9OB 2C1PB 3KPRE 3JWDL 4RBPH 4P2RA 4WW2B 4YR6B 2BOBB 1PDKA 4XNXH 3O8XA 2J8UE 3AREA 4KHXH 2Q76B 5IBLC 4XVTL 3H0TA 4L9LB 2E27L 5DMJB 4U1NA 3EFFB 3W2DH 5C0BA 1R3KB 3MLVL 1SYSA 4I5BA 5DSCB 1NCAH 1CFSA 4MQXD 4XMLL 5DRWA 5F7MC 1CXHA 1MY5A 4L8CB 1UCTA 5J89A 2LFGA 4LHUB 2OMNA 1T2JA 3PV6B 1FNHA 4PJXE 2KH2B 4YDLB 4RISL 1U3HA 2VUOA 5D7JA 4UU9A 3GO1L 4AIOA 1DQTA 5GISH 3NZHL 3MRIB 4HIJB 3L9RA 1YMME 2EICA 2N7BA 5D1QC 1YY8A 4MHHI 1BIIA 2HMIC 5HHXL 3T8XB 1ACYH 2VITB 2R1XA 2C26A 2Z91A 1H8OA 3I6LE 5E99L 2QADD 3VFSA 3K81A 1KJ2A 4ZUWA 1WWWX 4Z9KB 4D9QE 3ZT6A 4KROD 4WGVB 4OT1L 4RA0C 3BFOA 1MCOL 2APXA 5DRXA 1RK0A 1OAXL 4HS6B 2H8PB 1EH9A 2HKHH 4X5XB 5ALCH 5GRZA 4Z7NE 4WWKB 5KAQF 4MNHB 2ZUUA 3RPKA 3CFEA 1XIWA 3MYZA 1OAQL 4MA8H 2CUMA 4LVOC 2WIMA 1EDQA 4YHKL 1JN6A 4NZTL 1ADQL 4WCYL 2EDOA 4Y4FB 5IQ7L 3IVKA 4KRMB 2YEZA 3JWDC 3S3JA 2C7UB 2I25N 5F8RC 1UWEH 1OWWA 3L7FB 4ZAKA 3O9WC 3S5LA 1IAOA 3ULSB 4H0HB 4IIQB 3BO8A 2M26A 3CFCL 1RZIB 3DXAD 3BWAB 4J23A 1KCVH 1FFQA 2J6EH 1HYSC 2LAGB 4BH8B 5KW9H 2VB5A 2OTUA 3JV0A 4OM1L 3RWGA 4CU7A 3ARGA 1YPZF 2WUCL 3RY5A 3QXWA 4FN0A 4KRPB 3G08B 2O5ZL 2JKXA 2W1NA 1FORL 1IJ9A 2OQJA 3CDYA 4DUXA 3DX8A 2NY3C 4OFIA 5H2BA 2DKSA 3QFJE 2NY5L 1FL3A 3MQIA 5M95B 5CJXA 1ZVSB 1PKQB 1FH5H 4X99B 2UWEF 1H8SA 3TBYB 3ULVH 5B39A 3MGTB 2AAVA 1P84J 4E0RA 1U8KA 1E4KC 5EIVA 2QJDA 4IOSD 3AC0A 5F9JB 4ZQKA 2IGFL 4U0QB 4XP1L 5FA3A 2EC9U 2GIYA 5IG7A 4IMKA 1KEMH 4PY8I 5IFAH 2WZPD 3VFGH 3DV4B 4H8WH 4L3AA 4HV8A 4LQFH 5GGRA 2DQHH 2A74B 4F37K 1JPTH 1H5BA 4F7PB 4OCRH 5B3NA 3EYQD 4NQDE 5EORH 4LHQB 5E6ZA 5DUBA 1FSKB 1AE6L 1EA9C 4ZO8A 5ECJE 3LEYL 1Q9WB 5I8OH 4G8FA 3TESA 1NMCC 2H26B 4FQXB 2GSGA 3CAFA 1PZ5B 5HBBA 1GGIL 3MV8B 1BZ9B 3PWLA 4X7DC 1IGTA 1YNLH 2IMMA 3QAZB 2D0FA 3MRDA 1AC6A 1NCBL 4JM4L 1X5KA 3PL6C 2E9JA 1FCCA 1MEXH 4OD2B 1KENL 1PG7W 4EVNA 2M2DA 3EBAA 4JN1H 4LLUB 3B6SB 1HCFX 4XI5D 4NBYB 4CKVX 4L8SA 4OZIE 4X8JB 4LSUH 1U3YA 2C4XA 1WZMA 4KI5D 3T2NH 4URTB 1I3UA 4XVSL 3FFDB 4XPHL 1I7RB 4XP6H 3LS5L 1B0GB 3JTSB 4HUNB 3UZEA 3RUGA 1KTKE 3IFNH 3KLSA 2R0WL 1SBSL 2CIIA 4ERSL 2FEDC 1INEH 4MDIB 1NANI 4HS8L 1OVZA 4Z0XB 2GUOA 5F7FA 1FHGA 4PRHB 5DVMA 3GZKA 1ZHKA 1NAMA 5IB5B 1PQZB 2VLKE 4XX1E 1ZHBA 2NY7L 3BSZH 5C6WH 4LLVA 1OHQA 1WFOA 5BQ7A 4PJBA 4V1DA 3QZWA 1ZWIB 3SE3A 1DCLA 5LBSL 4KK8D 1CD8A 1PX4A 1UYWL 4FG6C 4G6KH 3VW3H 1FP5A 2R69H 4GQ9H 2HFEA 2BVPA 2BVOB 4JFFB 5KN5B 3V4VH 1G6RA 3GMLA 5C6PB 4A2MA 3MRJB 4HLZG 1FLRL 3WFDL 4JFHD 2EDFA 2V2WB 3IKKA 2CGRH 2DQTH 3X13A 1S7TB 1QRNB 5L9DL 4ZXBD 5FYKE 4FFVD 3HG1B 1E4WL 2AJUL 4LCYA 1K8DB 1OB1A 3CZFA 2HTKD 4K7FA 5E8PB 4K94C 1E6JH 1CK0H 3O8XC 3AREC 1QLFA 2OTPA 4A6YL 4Z7UE 3VGBA 5B4MC 3QXAB 3FQTA 4R26H 2XZCL 1A0QH 4LSQL 3ILQC 1WBYA 5I1KH 3STLA 5I74C 3WS6A 3VFMA 5I17B 2ZCHL 1T03H 1AQDB 5DZLA 3QR2A 3QEUB 1MCKA 4HGKC 5ILTH 2K3TA 1A21A 2PW2A 1IVLA 4AM0A 3DX9A 1H3PL 2R2BA 3TJEH 3IFOA 1BEYL 3V52L 3TPUB 3ALWA 4NC1C 5FHBH 3L3HB 1U3HC 4MAUL 1X5JA 5K33A 1KYOJ 4PJGA 2UV3A 5EU6A 5T1LB 4AT6A 3A6OA 4PJ8A 2XQBH 3BPLB 4YBQC 1T2XA 4XC3L 4M43L 4XNZC 5IEHA 4QXUL 4MQXC 1QQDB 4JHZA 2PYFB 1J9CT 1CDCA 1LD9B 4WW2F 2DQIL 1MLBA 4MZ3A 4DN4H 3GMPA 5BXFA 2APFA 5BCAA 3GKWL 4MB4A 4PUBL 1S5IL 4OCNC 3RL1B 2P5WB 4X5LA 4OI7A 2KL6A 2EXWD 5IVXE 1YJDC 1OAYL 1OQXA 2FD6L 2ZOKA 4LLDB 4HF5L 1XIWC 4FQIL 5IHUL 2BHYA 4ZTPL 1UZ8B 1T66D 3HC0B 5F1OB 3LRHA 5T1KA 1AY1L 3PXJA 4PJEA 1I7UA 4PJFA 1AKJA 4B53A 4TRPL 4BFIB 1U95A 2ICEA 3W11C 4OCMC 4KROC 4MSWB 4ELKA 2EDEA 4UILL 5D7LB 2ZG2A 4JY5H 3QIBB 3H9SA 5L7XL 1Q9LB 4Y7MA 1A4JB 4ZFZB 2AJVH 1S3KH 2DI8A 3G5VB 3GJFB 1MJ7H 3LKOB 4HK3N 3ARGC 4JJ5A 4NQCE 2BOCA 2OJEB 3GM8A 2VIRA 3FQWA 1HXMA 2DDQH 3D9AH 4LPYA 3QRGH 1SVZA 4MNGB 2YBRB 1WZ1H 3P0GB 4O00A 1BOGB 1TDQA 5FYJD 2XTJD 5GGVL 5CJXC 2GT9A 3G5ZB 2QKIB 4D8PB 2IH1B 2HT4D 1DEEA 4EOWL 3QWOA 5AZ2L 2BXYA 1VKXA 4CGTA 4QRPA 4QCIB 4LEXH 1PLGH 3Q5OA 4X7EC 3T0DA 2YPKB 1LO5B 4KV5F 4WTXA 2BSTA 3VFWB 3ELAT 4RGOH 2JK5A 4Q9RH 1KGCD 4LFHD 4RFEA 2DL9A 1BMGA 1JPFA 1P7KB 4EDWH 1V7NL 1IILE 1H5BC 2ZSWB 4HJ0D 1Y0LA 5J9PB 4ZDHA 5MEPA 3TO4A 4IRZH 4GRMB 5CIPH 5I1LB 1TJIH 1WJ3A 4LPUA 5DD0H 3MOBL 1CQKA 5HGDB 3DMMD 3RL2B 2QADB 5GSRA 2NMSA 3DROA 5I0DA 3VG9C 4F9LA 4HUVB 1MFNA 2XWJA 3H8NA 3LHPH 1X6NA 1QSED 1G6RL 5EWIH 3A67H 1DE4A 3VXRB 3Q6FB 4LNVA 4TYUA 5KTEH 3TNMB 3V6FB 2ZP0T 2Z93A 5IB4A 1UENA 3WJJA 3LKNA 3NA9L 1FFPB 3EYQC 4N0YL 4AEHL 1Q8MA 4PREA 3MA7B 1KC5H 1NBQA 4M6AA 4U7KA 1KCRH 4PLKC 1I9JL 4N9OB 5J11B 1EVUA 4C4KO 4IM8A 2ERJB 3TT3H 4G7VH 4L8SC 1LNUA 1O5DT 2Q8BH 4OLWH 1DUZA 2P1YA 3VFPA 2EZ0D 3VRLE 3THML 5GGSB 5B3JF 2BNQD 2WWMD 4BQBA 3DXAB 3G5YB 4GAGL 4IRSA 3E8UH 3F7RA 3QIWA 2DLFH 3KPSE 2BNUB 3BDXA 1X4ZA 3MCKB 3QT2A 2A9MH 1J8HA 4RBPK 5EO9B 4JFQA 3DIFA 4HD9A 3HZVA 1OF2B 2YHGA 4NUJA 4RRPG 3AY4A 4MXWH 1HHJB 4XI5C 4N0CC 3CXDL 1NJ9B 1RSFA 3KXFB 4Z7WE 4TUJB 1XGYL 4P4KD 5T3XL 3ZDXE 4RFNC 3LKQA 2BNQA 3MCG1 5MENE 4N8CH 5J1AA 4NKDA 1I9RL 1WIOA 1A9EA 5GQBA 4ZYKA 1MIEL 3OHXB 5F96H 3SE3C 1NMBH 3EO0B 3M8OL 1CFBA 2Y36H 1F4YH 2ZKHL 3VDCA 1JZ3A 2FSEB 4OAWB 5C08B 5MEOB 2VWEC 2WWKT 4Y5VB 4HT1L 3QQ9D 3VFTA 4AH2B 5M7QA 3PWPE 2Q7YA 3HLAB 1S7QA 1QD0A 5C2BL 1U92B 1JGDA 1MWAA 5D4QA 1BX2B 4G6ML 2GJZA 1MVFA 2NY4C 1DN2A 5C9KA 3FB6A 4YXLH 5AWNH 1DBJL 1IEBA 1L0XA 1UADC 2F54E 3IJSB 5EO0B 5FF6B 4KK8C 4QXTB 3TV3L 4MX7B 1EHNA 3EJZD 4IOIB 5C8JA 5EBWA 2E9IA 2AV1B 3VH8A 3QCUL 1RD6A 1A7BA 2WP3O 2I5YH 5C0AB 1JNLL 1N5AA 1RZFL 1NLDL 2ARWA 2DOCA 4RQQB 2AP2A 2EDDA 5CWSB 3PWVB 2R8SH 3OJMB 2MPAH 4ZFOL 1E6OH 5I16B 5D2NC 4OQTH 2HJKA 5JXAH 5F6HI 2NNAA 4NRZA 1RFDH 1YEHL 5TH2A 1RUKH 4K7PY 1VEPA 4U1MA 5C0CA 5BRZA 5DC4B 2WBJA 2P42B 3B9KA 1LO4L 5CILH 1NFIA 4IDLA 5I9QB 1UFUA 4CMMA 4LRNL 2V2TB 4X4ME 4PRPB 4NQUA 2Q6WA 4PJDE 4UIKL 1DL7H 1MHEB 3QPXH 2VXUH 4PJ8C 1B0RB 1KB5L 1RHHA 3ETBF 1WIPA 2ATPB 2R2EA 3OXRB 5ESVA 5L6YH 4NRXA 1EEQA 1EUUA 2VDRL 3MJ7B 3WFHA 5FM8A 2VISA 3VXQA 3CLEH 1EIBA 1RU9L 3ARFB 3FO0L 4S0SD 3IS1X 4P9HC 3WUZA 5GRJL 5DD6B 5T3ZE 1HXYB 1TVHA 3CVIH 4FFZH 2A1WH 4TOYH 2ICCA 3FB5B 1DBKL 1NLBL 5AYUL 5ANMA 2IAMA 5C0GA 3WCYA 5HYJA 3HAEH 3CDFA 1XGTB 4L5FH 3P4OB 4KTYA 2HLFD 1U42A 4JO2H 1TIUA 4NYLA 3NFNA 2Z35B 3UBXA 3MRGB 4NCC2 2XZAL 1LE9B 3NZ8B 5INCA 35C8H 4NPYA 8FABA 5F6IB 1HN1A 3QDHA 4HMDA 4RX4D 4ZXBB 1T66C 3T4AA 4LASL 4I4WB 4NO0B 5I71B 1MFBL 3MRBA 3TZVD 4M00A 5ID1A 2AABH 4RMQA 4JKLA 1JGEA 3IJHB 32C2A 2IQAB 3RIFF 5I1AA 3WSQH 1FNEA 3LRSA 1YNKL 1TNNA 3TC9A 5BVJB 3MFGB 3ZDZE 5E7FA 3WD5L 3FO1A 4KK9C 4DZBA 5EU3B 5I1IH 3V4PL 4M1CD 2DQDL 3VE0B 2HJFB 4TPRL 2UWEE 3MUHL 4YBLC 5EUOB 1BREA 1FN4B 1HZHH 3HE7B 3LS4L 3TZVA 4LVNB 5C0ND 1ITBB 2CRZA 5SWZD 5HVHB 3SJVE 4KXZI 4N68A 1F4HA 3WIFA 1T1ZA 4EUPG 4OGZA 1HSAB 4ZFFB 1KCUL 2A6KA 4N8VG 4JB9H 1R3IL 1T1XA 2XA8H 1F4WL 5DYOB 5C07A 4WIQA 3CH1B 4XNUL 2VE6A 4LP5A 4ODVL 4MB5A 2HVJA 1MHPL 1CFNA 3U0PB 4HWZB 3TO4C 5DHVB 1IKFL 5SX4H 1S9YB 1MFDH 3MZTA 3S6CA 1NUGA 4K8RD 5SWZA 4Z8FH 4PJ5D 4HS3B 2X4NB 4YC2B 1YEEH 3MBXH 4F9LC 3SKNB 1JWSB 1KJ3L 2C1PA 4O2CA 3LEXB 1GZQA 1MWAL 4WW2A 5JO5A 3ZKND 1B6DA 5FGCE 1YEFL 3WJJC 1H0DB 1JVKA 4N90D 5CBEB 3IF1A 3WS3A 3ZYZA 3FO2B 1YEJH 1KELL 1IGMH 5DLML 3RPIA 3HZYB 4I0PA 4TSCH 3U9PH 4ETYA 2JELL 3DMMC 4G8EB 1NC4D 2ADIB 4LBEA 4LEOA 3GBNH 4HG4J 4NNPH 3UYRL 1T22A 4MNQE 4JE4B 1RZJH 4CVWA 1TQBC 2DN7A 3HZMA 5FO9B 1FNLA 1FIGL 1N7ML 4ODSH 4HMCA 7FABH 2W0FB 3N85L 4IRSC 1IAMA 3QIWC 2FO4A 2V9TA 1F2QA 5F7UA 1GL4B 3TVMA 5IR1B 2DS4A 5FDWB 3RZCD 5GGTA 2BJMH 5JW4R 1CS6A 3MRIA 4U6VL 1AGBA 1SJXA 3AY4C 5SWQB 3DVNA 1FFNB 1U6AL 2IAND 4NKIL 4U6TA 7CGTA 5JHDE 1RIHH 1HE7A 5D72H 2FJFB 2A77L 5CD3B 2XTJB 2WWMC 1Q9OA 3W5NA 4X6CE 1H15B 2BRRH 3U7WL 2AI0L 1E4XH 3EOYG 4N5ED 3VI3F 1PBYA 4HQQH 3U0WH 3U0TA 3O2DA 1EJOL 1CLYH 3ET9F 5CLTA 4XCFL 4CVZB 2IANA 3CIQA 4DCQB 3CFKA 4TN9A 2HFGH 4Z7VB 5D71L 4P4KC 1JF5A 2C7UA 4I8DA 2C3XA 1Z9OA 3NFSL 1LO2L 1ND0B 1BGXL 3M07A 3UC0L 1G0YR 1BBJA 2ZSVB 4Z18A 3TGXA 3T2OA 12E8L 3JWDH 1CDJA 3QDGE 5FUCC 4BH8A 1YZZA 2ICES 4U05A 1KF9B 3MV11 3U7YL 5DK3A 2RAMA 5DJZA 4OFYA 1L6ZA 3WNKA 3IU3A 1NFDB 5BS0D 3G08A 4XVTH 3QQ9C 2MWCA 5H94A 3RVVD 3KVQA 1OARL 1FL6B 3PNWB 3BP6B 2E27H 4TNWF 4MA3B 4PRBB 5DMKB 3IDJA 1MIML 3TYFA 3MLVH 5L88L 5DUML 1BVZA 2YR3A 3FL7A 4XMLH 1D6EB 3N50A 3C09B 1XF2A 2X1WL 4FXKA 4L3EE 5CINH 3OG4B 4GUPB 4X99A 4R8WL 5BV7L 2FWOA 4FNLL 4RISH 1T0NB 4XPAL 4KU1A 3IDNA 1WBXB 2NY2C 5EZIL 5BS0A 3GO1H 2WBJC 3C5ZB 3B9KC 4CMHB 4UQ2B 3NZHH 1KPVB 1FGVL 3KJ6L 5ESQA 4DVBB 4F9PA 2P7TB 4OB5L 3RWEA 1KN4H 3QP3A 5E99H 3OX8A 2Q3AA 2F74B 4JN2B 4JZJB 2JIXD 1NCNA 2ZUQC 4OT1H 4Q6IA 1OAXH 5ACZA 1A3RL 1QFWL 1RVFL 1PZUB 4E5XB 5D7KE 4WHDA 1OAQH 4A2LA 4LARL 2DL2A 4YHKH 2K7QA 4NZTH 4G80B 1ADQH 3NCCB 5IQ7H 4J2XA 4G5ZH 4YFLF 3QHTC 1ORSB 4JDTL 3X3GL 4YBHA 5JLZB 2IAMC 2DRUA 1UXWB 4NKQB 1N2RA 4LLUA 1BAFL 1ETZB 4XCCL 1RJCA 1J0KA 3CFCH 4JRXD 5IMKB 1MHCB 5IW1B 1KOAA 3VJ6B 4X8JA 1MCDA 1S9KC 1W0WB 1C1EL 2WUCH 3ULUF 1N4XL 4QHKI 3G6JE 2OBGA 4LF3A 3NTCH 1FORH 4OTXL 3JTSA 3LAFA 5KS9B 4Y19A 2M1KA 3E0GA 3MUY1 2DQFB 5GRWA 2ZCKL 5BOPA 2NY5H 3UO1L 4DOHB 1AIFA 4QHNB 1RK1A 2HLFC 4M61A 3X3FL 4PP1D 4WFGD 3HPJB 4ACPA 2I9LB 4RFOL 5IB5A 3ZDYE 2F9BT 3VWKA 2VZTA 4XBGA 5SV3A 4I3SL 2IGFH 1Q72L 4XP1H 3J8F7 5DUPL 3L3IB 5A2KH 1XFPA 3WO4C 1CBVL 3TZVC 2VDML 1TJHL 2ADFH 3C9NB 4PB9L 4JKPL 3O4LB 1NGYB 4KPHL 3O6FB 5I18H 1AD0A 3C60D 4Y1AD 5IVZB 3LQMA 1ZA6B 1IC5H 2F15A 1RURL 3LPWA 1KLGB 4GT7A 1CG9B 5D96C 3AXLB 1GC1L 3LEYH 4OCYL 4PIRF 3LDBC 4P46D 4Z78A 1HH6B 2R1YB 4U6XA 3MLTA 3HNTL 1PW3A 5JZ7C 1GGIH 5C0NC 3S7GA 4MVBC 4JPWL 1A7NL 1K8DA 5JQHC 1C08B 3NFPB 4JM4H 1NSNL 3OJDA 4KKCD 3B43A 3F12B 4YEEA 1KENH 2EXYC 3ZE1E 4EI6A 3IGAA 4M7ZB 5JPNB 2W38A 3PUCA 3RY6C 4HCRL 4G43B 4Y89A 1I3VA 3PWNB 3QULB 5LG1A 4HIIB 4HX1A 3W5MA 4G8GD 4Y8DC 2CKBB 1OSZB 1N0XL 4R7DA 4I0PC 3PHSA 1J7VR 1Q0YL 2QQQA 3EO1B 5D70L 2AK4B 2IPTL 4F7CB 4UBDC 4XVSH 4XPHH 1IEHA 1SMAA 3GSXB 5HJ3B 3REWB 3V8CA 4EDXA 4YK4C 2R0WH 3NOIA 5D9SB 5JA8B 3QJHB 4ERSH 2VAAA 4D0CB 4KDVA 4HWNA 3GMRA 3GSRB 4HS8H 5FGBA 3LOWA 1FDLL 1TPXB 1BVKA 3HN3A 4G8GA 2YD8A 3TVMC 1A1NB 1XGQA 5JNYB 4YGAB 4GQPH 4PTUB 4RA3A 1PD6A 1KIQB 3BMVA 3RI5F 1QQDA 4F7MB 2PYFA 1KXQE 2ZUWA 3MV8E 2XY2A 2J8OA 3DX7B 1A6WH 1P7QD 2FB4L 3O0RL 4RIRA 5E5MB 3O2VH 3IJYA 5LBSH 4PJHB 3WLBA 1UYWH 4P5TB 4UAOC 1HWGB 1KJ2H 1MFAL 1F3JB 1JUFB 3SY0B 3RZCC 3LN4A 2H2SD 1AXSB 1B2WL 3D69B 4RWYL 4UV7L 2QR0A 3HC0A 4G42A 3V6ZB 1OGAD 4F7EB 1FLRH 1U8IA 2VMFA 3QPQD 3WFDH 5DMGD 5HYQA 3UXFA 5B22A 4HGMA 4N0UE 3DECA 4K23L 5L9DH 4U1HB 3T77B 2XN9D 1BHGA 1P7QA 1E4WH 2AJUH 5D7LA 1JHLL 1FNSL 2UYLB 1ONQB 5FGRA 3QA3B 5JXEA 1Y6NR 4J3XA 4I3RL 1UB5A 4ZFZA 4YZFF 3PQYA 1DQJB 4AIZB 25C8L 4A6YH 2YPVL 4HK3J 5L2KE 5SWSE 4L4VB 2XZCH 3PGDB 4PRHE 1C12B 4M9PA 3GBLA 1HDMB 1HHGB 2X4UA 2ZCHH 2CH8A 3BIAX 2YBRA 1MCBA 1V05A 3VU2A 2NY6B 5F89A 5JORA 3O81A 1H3PH 2VZSA 3TN0D 2ITCA 3GSQA 4QOKA 1BEYH 3V52H 1SY6L 1K8IA 2IQ9L 4WHTB 3C8DA 5FO7B 4BKLB 2Y1VA 4MAUH 2XIDA 1YNTA 3AU1A 4HBQA 2YPKA 1G9MC 1LO5A 3DV6B 3RVVC 5BMFL 1HKLL 1U8JB 3LSOB 4Z7VF 4F9PC 1EMTL 1J18A 4FQLL 4XC3H 4M43H 3F7PC 1U8OB 2ZUVA 4QXUH 2VLJB 2FIKB 3L3GB 5CHNA 5ICXA 1QRNE 2DQIH 4OFPA 2XFXA 2WNGA 3FHQA 1KULA 3HG1E 2YXMA 4PUBH 4XCYB 3EAKA 4OD3L 5I1LA 1NFDF 4Q6IC 4NHUB 3SDYL 3MLRL 5D1XB 1OAYH 2FD6H 4I0CC 2IPKB 5DGRA 1LK3L 4FQIH 5IHUH 1MHHB 1H8NA 5CJOL 1AY1H 3UJIL 4RMRA 3V6FA 5K9KB 5H35A 4QHUA 3S96B 2VXQL 5E0QA 4TRPH 5JW5B 5EZJB 2CDGB 4RRPA 1J05B 1KPUB 1DBBL 4IOFD 2R1WB 4JZNA 2FHCA 4K3JL 5L7XH 5DA0B 5EO1B 2CPCA 3UTPE 2WUBL 5C2UB 1NDGB 2JJSA 2X4SB 5L8JB 2H32A 4AK1A 5ABDE 1RQ5A 4G9FB 3MGOB 4FQ1L 3JBG7 5GGSA 1UKQA 2LU7A 5FGSA 3RWDB 1AO7B 4X6EB 2PUQT 4WW1A 3MCLH 3G5YA 5D7IB 3RTQD 3MX0A 4C55A 5HXMA 4ZUVA 4ZOCA 3U4AA 4PGCB 1DQMH 4AY0A 4BSWB 1EFXA 1JZ7A 3ZYIA 2W0PA 2Z31B 1YYML 5GGVH 4L1DA 1PX3A 2P5WE 1WSST 4QRRD 1HYRC 5AZ2H 1CVSC 3KXFA 3VWKC 1EK3A 5JTWA 2R4RL 4XNMB 4POZD 1JWUB 2EYSA 2IFGA 3T0XA 4LCCA 4XB8A 1X5FA 2QSQA 5FA4B 5CSGA 1QBBA 3H7LA 3GEWB 1H3VA 3M17A 5DRNA 2OP4L 4Y2DD 5HGHB 1HQRA 4XWOD 5DJYA 2BC4A 3H3BC 1HEZB 2YUWA 1MCLA 3WMSA 1U92A 1EV2E 3VRJB 3B2VL 1L6XA 2EYTA 2JJTA 5FYKU 2HFFB 5DWUL 2GQHA 2E7MA 3QUZD 4O2FB 2JIXB 4TTDD 3UTSD 1BLNA 1G6RH 4L3CA 3BRDA 1FAKT 2F53B 4Y2DA 4PJ7A 1IGJB 2EDWA 1UVQB 3CSGA 3JXAA 5KVGL 4IOIA 5DS8A 1HOCB 2AV1A 4XVUD 1I9JH 4I48B 3E2HC 3MJGX 4OSUH 3GSUB 4R4FL 5CUSL 1HSBB 5CWSA 5HVFB 3PWVA 1J1XH 3VI4E 1H3GA 4QEGA 2X89D 5DEGA 2B20A 2VDKL 4NO2A 3C08L 4JRXB 4LPTA 4GAGH 1WBZA 2W92A 2UZYB 2YMXL 1MJ8L 4MMXC 4PRAA 4P99A 2JJUA 3QHFL 5E00B 1OT1A 3TYGL 3DRQA 5FGBC 2V2TA 1QR1B 3OR7B 3CXDH 4U1IA 3VXNA 3O2WL 3IFPB 2V5YA 3EO9H 3JTTA 2FZ3A 3TH3T 1XGYH 2AV7A 5T3XH 4WY7H 4LGRB 2X89A 2B2XL 1ZTXL 4ODWB 1LGVA 4BH7B 5LVEA 1I9RH 3NPSC 1MIEH 3SKMA 3I2CL 1U2HA 5I0ZA 1S78D 1NC2B 1EBPA 1VSCA 2P8PB 3LV3A 2NYYD 1DQDL 3VGEA 4CW1B 5FO8A 2YUVA 5HYSG 3OB0H 4IRJD 1A1OA 3CNKA 5AG9A 4HT1H 4PGJA 1HXYA 3OL2A 2CRMA 5E8OB 5C2BH 3B8SA 4P9HH 4G6MH 3R0NA 1U2CA 3P4OA 3C60B 4Y1AB 2LTQC 5MI0C 1GXEA 4PJAF 1RUQL 1C7SA 4JREC 5T1MB 3DXAE 3TV3H 1CXIA 1UT9A 3NZ8A 5JXEC 3QDJD 4QRSA 1QVOA 2NXZD 3P77B 4MXVE 4P46B 4G8IA 2H2SC 4LKXB 3QCUH 4IJ3C 1LE5B 3W81A 1YEGH 4EUPA 1GZPB 1NGWB 1LDPL 1JNLH 1RZFH 3GSOA 1NLDH 3QPQC 4N8VA 1ZANL 5DMGC 2PTTB 5BVJA 1YEHH 3FTGA 4OCXL 4Y5YB 2RB8A 4QF1A 3QIUB 3P4NB 1HHKB 3MODL 4NKOA 5EU3A 5A2LH 1DANU 1DR9A 2BVEA 1LO4H 3BH9A 3HE7A 2WBWB 3NIDE 3VWJA 4GKOA 4LRNH 2FEEL 4ZUUB 5LGHH 3CJJA 4WTZG 1MRFL 4UIKH 4F7TB 4XMKL 5EBLA 3VFNA 1KB5H 3N1FC 6CGTA 1I7ZA 2VDRH 1AHWA 1QO3A 5DYOA 2ATKB 3U0PA 3KLAA 5IMLB 5DHVA 3WN5A 2DLGA 5JR1L 2AS5M 1RU9H 3FO0H 4S1DD 3SDXB 2ADGB 2ENYA 4G9DA 2VZ1A 5GRJH 2X4NA 1RUML 2GJJA 3SKNA 1JWSA 5IGXL 1P1ZA 1JTPA 1DBKH 1T3FB 3C87A 4N1HB 1NLBH 5AYUH 1H0DA 5CZXD 1MUJB 3I3EA 3KDMB 2EDHA 1FVCA 4MJ5A 3GUTA 4DW2L 1U8PB 4X9FA 4YQXH 3AB0C 1OGAB 4KJYA 1T21A 3RVUD 2XZAH 4EIZC 1EHLL 3TT1H 1LILA 3HRZB 1P9MA 3QNYB 4KI5E 5IB2B 2JJSC 2GK0A 4X9BA 4ZMAT 5DGQA 4LASH 3LKRA 3CMOL 1XGRA 4HUXB 4NQSB 1T4KA 2VN7A 2WWKO 1F90L 1U41A 1U36A 3FB8B 3MNZA 4GG8A 3RVWD 1J11A 5FDWA 1JK8B 1IC1A 1YNKH 3FQUB 4LCWB 4IOFC 1LVEA 2VWEE 2Y6SD 1JV5A 3MBED 4HDIB 3RWIA 3IDMA 1LEIB 1HH9B 2ZOLB 1ZHNB 4IBLT 1IGYA 2DQDH 1JCKA 4TPRH 2OR7A 3MSPA 1IEAB 2B1HL 4W6YB 4Z95L 2FJFA 3S4SB 4O9HL 3DUSA 5T5NF 4MS8D 3WIIL 2XWTB 2OS7A 4YHIB 4XC1L 4FQQA 3VFOA 3TN0B 2BERA 4QHLA 4ZTOL 4LCCC 3TO2A 1PYWB 3ULUL 4MWFB 4QRUA 1BZ7A 1KCUH 3DVFA 1CL7L 4H25A 1NCCL 3FCTB 4C56D 4P3DB 1R3IH 1CDHA 5HDOA 5CEYB 1P2CA 1F4WH 5E4EC 4GLRI 4XNUH 4R96B 1MHPH 1CICA 2A83A 5TE6L 1IKFH 3D0VB 1BJ1H 4FZEL 4Z7VA 1T20B 2W65A 2X4PA 4JFHE 1MCEA 2R56L 4POZC 2FYYA 5D2NE 4C58B 2ZSVA 5DJAB 1OY3B 3A6CL 2WANA 4Z76A 1KJ3H 3UBXI 1MWAH 2PNDA 3L3KB 4K71C 4C56A 1YEFH 2Z4QB 4Y2DC 43CAA 5GZND 2XNAB 3FHAA 5EU5B 1TQCC 1AGEB 1OLLA 3EGSB 3MC0A 1NFDA 4JY6A 1DDHA 1KELH 4RGND 5DLMH 3BP6A 5ENWB 5DEZA 1CIDA 1YUHA 1MCSA 3KYKH 1CWVA 1UH4A 3CFBB 4OLXL 4D9LL 1P4IL 4DUWA 5I1JL 3TWCL 4PJGE 1FE8L 3VXOB 3HE6B 5CGYD 2JELH 1D6EA 3KR3L 5EUOE 4TTDC 2CDEB 2NW2A 4GUPA 4JFED 4OUUB 3IDYC 3FO9B 3A0OA 4JPIB 1MFEL 3ZL4H 1FIGH 5J3HC 1UQSA 1N7MH 1G9NC 1T0NA 1T1YA 3WHXB 4I18B 5C0DA 3D3VB 1MH5B 3QNXB 2OZ4L 3WL9B 3C5ZA 1RJZA 4LVEA 5CEZD 2OK0L 5E2UL 2CK0L 3BT2L 4U1LA 3U2SA 1KPVA 4XVUC 4DVBA 2VL5A 5IKCB 3MRLA 3OAYH 2EDBA 3LQAC 1QFWI 2D2OA 3RTQB 3RWCB 2HT3D 2YD2A 1GIGL 5KVEL 2ZNXA 3FRPG 2GTZB 4NKIH 4JZJA 4FMKA 3CPLA 4PJFE 5FYLD 2Z8VC 5GGUB 4TVPL 5ITFB 5J0BA 3JWOL 4HFUH 4J3SA 4PJCB 4JM2D 1KXTB 2G2RB 5AAWA 4QRRB 1IAII 3U7WH 3VXSD 3LPGA 5CCKL 2AI0H 4PJIE 3QXDA 4NGHL 4BQ6A 4ETQA 1EJOH 3C6LB 2IFFL 1YEDA 3ROOA 4XCFH 2VR4A 4J4PA 3BP5B 2NZIA 3DRTB 5F1NA 3EYVA 1FAIL 4XVJL 5D71H 3BN9C 3F5WB 1QP1A 1V7MH 3CK0L 4PYHA 4Q2ZB 1LO2H 3UC0H 3AVEA 4JM2A 4GLRH 4PPTA 1FRGH 2HJLB 5SX5H 3RHWF 12E8H 3VXSA 5F7EL 3VG0H 2H6PA 3KPLB 1IQDA 2JTDA 3F58L 2NYYC 3MV9B 1W0WA 1F2XK 3QUZB 4Y16A 5E9DB 4BM7A 4Y5XB 1OARH 4BSJA 1YN6A 5EN2A 1OTUC 2DQFA 5DUMH 3BI9X 3OKYA 2ZNWA 4QHNA 3L5XL 1X5IA 2YSSB 3BQUD 1YEIL 5FYJE 5BV7H 2XTJE 4XPAH 3U9UB 1VEOA 5EZIH 3SO3B 1J10A 5DHYB 2B4CC 2OYPA 4WO4D 2X4OA 1U0QA 1FGVH 2VDQL 3KJ6H 3L5WA 3HAEG 4NQEA 3VWJC 1CF8L 4L8DB 4OB5H 3MFFB 2DTSA 2HLAB 3REVB 3OR6B 1KGCE 4ONOA 1T7YA 3O6FA 1MVUB 3BQUA 2N56A 3IU4H 1CIUA 1UC6A 1HHIB 5IVZA 2O5XL 5GS0C 5IBUB 3O3UN 4O51A 5K9JL 4KTDL 1AHWC 1XF5B 4XP4H 1KLGA 4KQ3L 1QFWH 2B39A 1RVFH 2B8OT 4TULH 4XNQB 4NFBA 5DTFA 5AAMA 2N4IA 3WN5C 3MJ6A 2IJ0C 3OKDB 2UY7A 1A14L 1EGJA 2EKSA 2R1YA 1B90A 1TLKA 2XT1B 3BEWB 4LARH 3IAGC 5EB9A 1R5WA 1B6UA 2DICA 1F5WA 1QSEE 3NFPA 4FXLA 5JOFA 2FATL 1ZHLA 3LMJL 4LSSH 1M7DB 1IAIH 4BQ8A 4JDTH 3X3GH 5J13C 4QXWA 5ID0B 5JPNA 1AD9A 4JGJA 3SN6N 1GPOL 4P59L 4RMVA 1BAFH 3QEHA 4XCCH 3Q2CA 3OAUL 1A64A 1MFCL 3EJJX 3B5GA 3DGGA 5D6CB 1KT2B 5F7DA 4NSKB 1G7LB 4OZ4B 2CDFA 4R0LB 2IBGA 5FK9B 1C1EH 2AK4A 3QO1A 1G1CA 4F7CA 2D7NA 1N4XH 1P9MC 1DEDA 3GSXA 3NIFF 2WM0A 3D85D 1E27B 1GOGA 2BNQE 3REWA 5GJSL 1FG9C 2ZCKH 5CZXC 4PJAA 3SDAA 2NXZB 3UO1H 3KNBB 5J4MA 3JVGA 4X83A 2PXYD 3Q3GB 4KMLB 1JWMB 4U6YA 3SDXF 4RFOH 1D7FA 3RVUC 2GITB 4FP8L 2APTA 4YEFA 3NIGF 1CTNA 4I3SH 1Q72H 5DUPH 5GGTH 4NKMB 4D94A 3U83A 5ERWB 3ARBD 1CBVH 1NGXB 4GFTB 1L7IL 2VDMH 3QWRD 1N59A 1TJHH 1VACA 4ZS6C 4JO1L 1QG3A 4PB9H 1YN7A 4JKPH 4KTEL 3RVWC 5TF1L 4KPHH 4M93B 3KPTA 3DLQR 1FVEA 4AJ0A 2HRLA 5B8CB 3TCXA 3MA9L 5KSVA 2Y6SC 3BW9B 2A6JB 2ESVD 1U91B 4FTVA 3X12B 5CMAB 4GS7C 4P4RA 1CICC 1GC1H 1PGRB 4OCYH 1FQ9C 2O26U 4MXQD 1FG2A 1B4JL 3FFCB 3HNTH 4MAYD 4Z5RB 2X1QA 4P49A 4MS8C 4JPWH 1A7NH 4TUOA 3VCLB 2C3GA 3FT3A 5KS9E 3K4DA 2B7DT 5E7BA 2AEPH 1NSNH 4WEUD 1D5XA 1J5OL 2EECA 3D18A 2SEBA 2PO6B 3VMPA 3OV6A 3EOBB 3FN9A 4HCRH 1ULVA 2ZUTA 5ELIA 3QQNA 4NBXB 3PGDA 1HHHA 2C3VA 3ZSTA 1FBIL 3E6FB 1AR1D 3OB0K 1WLHA 3WNMA 1N0XH 1CD1A 1Q0YH 3O3BA 3ULVD 4MAYA 4OZGF 5D70H 3L1OL 5TE7L 2IPTH 3MMEB 4P2QB 4X5WB 1ZGLB 4KKAD 3BIKB 4P5MA 5K59E 3CXHK 3T0EA 1SJHB 4NUGL 3TH2T 5IVOA 1WZLA 5EBMA 1FV1B 3GSVA 5GZNC 4UNTA 1ODAA 4H5SB 1RPQA 1FDLH 3LSOA 4RGNC 3GI9L 4LDEB 4GW4A 4Q6YA 4JHAL 2DLTA 4DZ8B 2VLRB 2FGWL 3O4OB 3KPRB 2AJZA 4MDJA 2H9GA 5CGYC 4NP4L 4HBCL 2FIKA 1G7JB 1IAKB 1K4CB 4JZJC 5ANME 4ISVA 3ARVA 2PYED 4BK5A 4XCYA 3MBEB 1S5HA 1JTTA 2FB4H 3O0RH 1S9VB 2V9QA 1G1YA 5D1XA 2P5EA 1MFAH 2IPKA 3BPNB 1ZLUH 1DTUA 3IDIA 1R0AL 1B2WH 1MHHA 4RWYH 4UV7H 1NCTA 4PJXB 3VXPB 1WTLA 5T5FL 3RWFB 2HT3C 3EYFA 4J4PC 5JIHA 3K3QA 5EIIB 1A7OL 4JO3L 1SM3L 4K23H 1A47A 2PYEA 4LCIL 2RHEA 1WAAF 1GOFA 4HUWA 5ALBL 1YMMB 4JM2C 1JHLH 2Z0BA 1FNSH 2IPUK 4LNRB 2E3VA 3O3DB 5AUMB 5EO1A 1I75A 4I3RH 4BJLA 2D31B 2X4SA 1ZKAA 4ZPTB 1CLOL 4G9FA 4U1KA 3L6FB 4MD5A 2YPVH 4Y16C 4E9LA 1MRCL 5C09D 1AO7A 4MQ7A 3QUMB 2JCCE 2CKBL 3CC5A 3W0WD 3HI1A 2WK2A 4Q9QH 4PJCF 2QHLA 2NTSP 3OSKA 4BZ2L 4U7SA 5KOMC 2YC1A 1ZLVH 5E56A 4FFWD 1DQQA 1SY6H 3OKOB 2LU4A 2IQ9H 1FPTL 3SPVB 1NDMA 4PJHE 3AUVA 3SE9L 3B9EA 3MREA 4XWGL 3TA3D 3GSNA 5HYIA 3S34L 3RDTB 5BMFH 4J3UA 1HKLH 4XNMA 3ZHLA 5I8EA 3FAWA 2QV2A 4JFEB 2MKWA 3MYJA 4M48H 5SWZE 5FA4A 2X42A 4LSPL 1EMTH 2W91A 3QXVA 4HEME 1SEBB 4YFEA 4UQ3A 3BVNB 2DYPD 3BQUC 4N0FA 3BD5A 4JFDD 4OD3H 3KYNA 3WE6A 3TA3A 4EQ2A 4GH7B 4MLIA 3SDYH 2HFFA 3MLRH 3GHEH 3QFJB 3KS0J 1LK3H 3G5XB 4WI6A 4PJ5E 5CJOH 3UJIH 3MLYL 5HD8D 3GBMH 4M6OL 2F5AL 3MLPA 2DJ4A 4X4XA 4CUCA 5JOPD 2VXQH 1I1YB 2DYPA 5DEFB 4JY4A 3DVGB 1BQLL 4N90E 5KVDL 4JFDA 1JHTA 3RX7A 4ELMB 1FNGA 4HJGB 3EDEA 5DFVD 1QSFA 4K3JH 2J7LA 4C83A 1HSBA 2WUBH 1FO0B 4NQDB 1XZ0A 4K8RL 4OJFL 3DI3B 3WFZA 3P73B 4FQ1H 1MI5D 4GAYA 1ZT1B 4HPYL 3LD8B 2V7HA 5HPOA 3WHE1 5HYSA 1BJ8A 2VLJE 4K3EL 1JYVA 1MLCA 3QHZL 1JF1B 3U4BL 3I6GB 3SDAC 1EXUA 1YYMH 4QYOB 3R06B 1QR1A 1G7PA 2DM3A 4GG6B 2BRQA 1QHPA 5I1GL 5IMOB 4FZ8L 5J06A 1XGPB 3TJHD 1I1AA 1G84A 1X7QA 2BCKB 4XXDB 4OGXL 1MI5A 1U8LB 4Z7QE 2IANE 5KSAD 3E6HA 2R4RH 1YDPB 1HIMH 2IC2A 2J12B 4KJWD 3FQXB 2AXHA 4MD4A 1TZGL 2MQ0A 4BA8A 1WVZA 1ZSDB 2OP4H 3OZ9L 3QUKA 1HNGA 5I1HL 4ZPVA 2VH5L 4RMSA 4YAQB 1FYTD 4WO4B 3PIQA 3PABB 4XBEL 2DB8A 5INDA 5ISZA 2CIKB 2NLJA 4KJQD 3B2VH 2BSSB 2R0KL 1T5WB 2VZVA 4D2NA 3OAYK 1KJMB 2DMCA 2E7CA 3ARBC 2HWZH 2J4WL 5T1MA 5D7IE 2E7LA 1A7PH 4MJ6A 2VLKB 1I1FB 4DGIL 3DSFL 1S7RB 1U3ZA 4U1JB 3HCVA 5IF0B 4WTZA 5BS0E 1FZJA 1LE5A 2KZ1B 4GRWE 5JMRA 1ED3B 4H0IA 4R4FH 5C0EB 5CUSH 3DSNA 3RY4A 1JHKL 5JDJA 2R2HB 3L5HA 4IMLB 3BMWA 4PG9B 2I9TB 3MRNB 3GJFH 4MAYC 1N64L 1Z6JT 3P30H 1D5ZB 1UEMA 4PJ9B 3WIHL 2AJXL 4HFWB 1RZGA 2VDKH 1P4LB 4ODXA 3QIUA 3T0EC 3O6KH 1MJ8H 5SX5K 3V2AR 3RAJL 2FX8L 3QHFH 5IMMA 5B38G 4E42A 3TYGH 5I2IB 5D1ZD 1BFOB 4XX1G 5I6XB 1IL1B 4ZUUA 1BZQK 3O2WH 3CFJB 3V6OE 4UUJB 4Y4HD 3EYSL 3RRQA 3ULVC 5BO1L 1MCWM 1N6VA 3WNLA 3GSNL 2B2XH 1ZTXH 2BNRD 4KKAC 5C9JB 1UA6L 1CU4L 2AJSL 5DC9B 3P0VH 2PXYB 4GMSL 5IMLA 3VXMA 3G04B 1IM9D 3D39A 1U8HB 4H8WC 5JW3L 3HR5B 3NCEB 3MUZ1 3FN3A 4RAUB 5E1HB 4JLRB 4U49A 4HEPG 4Y4HA 4NNXA 2YZ1A 1XF4A 2E5EA 5CIPA 2BNRA 5KG9A 4NQVA 5JHLL 3Q0HA 2A73A 1MUJA 3F65A 4ZNEE 5IK3B 3QO0A 2L0DA 1DUYA 3X14B 4JPVL 1U8PA 1RUQH 4ZSOB 2I60L 4JRXE 3CFDA 4JFZL 1RZKL 3HI6L 1KNOA 3H7BB 1H3XA 2R29L 5ICZB 4YFLI 3EUUA 3FT2B 1MCPL 4UT7H 1TZIA 2J8UF 4YDKL 4HUXA 2GY7B 2A38A 5DK2A 5C7XL 2NY1D 3RX8A 2GK2A 1ZANH 1XR8A 4I0KA 4F3FB 5IVXB 5F3HB 1UGNA 1J0JA 2PCPB 4XT1C 3W39A 5IHZB 3ZT7A 3MNVB 4LCWA 1I8KB 4CJ1A 4OCXH 4B5EA 4HDIA 4WFGE 1X4XA 4BZYA 3MODH 5HHPA 2AJYL 1KPRB 1MPAL 4JEGB 1CL7I 3PDDA 2D4DA 3STZB 4PJXF 3MRKA 1XCTB 3KYAA 3RJDA 4KZEL 4XBPA 4ONFL 3OTTA 4YHIA 4OZGA 2J8HA 1MRFH 3SKJH 2IMNA 1JNHB 4XMKH 3DI2B 4P3DA 1G0XA 4NM4L 5CBAB 2AK1L 5DJ8A 2A6IB 4NQCB 4BZ1L 3C5JA 3EDDA 4FFWC 4Y1AE 3FJTA 5JDSA 3UPRB 3HRPA 3BZ4B 5HGGS 2QSVA 1WIUA 2DQUL 3TA3C 5I73C 4QHMA 2P43B 4Z7NF 1K5NB 5C86A 1RUMH 5DJAA 1M7XA 3U1SL 5IGXH 4RMWA 1A7QL 1A6UL 3L3KA 4WV1B 4X0KB 1T0MB 1ZGLM 4WNQA 3P9LA 1W0VA 2IALA 5EU5A 1RZ7L 4PGEB 4OIAA 3EGSA 1X5YA 2V7NB 1MREL 4OV5A 4DW2H 2NXYD 2RBLA 3O41A 4LLWB 4G8GE 1O0VA 3FRPA 3HE6A 5ICYA 1NAKL 4UT9L 1FYHB 4M7LT 5IB3B 4XCNB 5DRZB 4J7RA 5E94B 1N6UA 5C6TL 1QA9B 3ARZA 2KQNA 3PHQA 1TVBB 3FO9A 4JPIA 1UB6B 3CMOH 2V17L 1J87A 1F90H 4ODBD 1WAAA 4J12A 4NN5B 4FABL 3WL9A 5DK0B 4WI2A 2A0LC 3QUYD 2N7AA 4OQTA 2WMPA 3TBSA 4XP9L 1NGZB 5DFVC 3BZEA 2X1PA 1EO8L 1G9EA 4KK5D 3RWCA 2EDYA 2B1HH 1I1AC 4NO3A 4Z95H 3SDXE 3KPOB 2NX5D 1EJ6A 5E1AA 2KZWA 3HUJB 5GGUA 5DJDA 3ZTNL 3WIIH 1RMFL 4XC1H 3GMMA 4ZTOH 1YC7A 4OZHE 3ULUH 3SGDI 4QLRA 1CL7H 5D7SL 4NNYB 2Y07H 3FOMA 1NCCH 1CCZA 3W9EB 1SYVB 4YHMH 1KCSL 5DJ6B 4Y4KD 1S7SB 3GHBL 5TE6H 2VXVL 1OGAE 3BP5A 3DRTA 4XCEB 1TFHA 3KPSB 2NX5A 1K4DA 3QYCA 3F5WA 4CU6A 4LSTL 4U1GB 5KSAC 2R56H 4YHPA 4KJWC 3BPCA 1AI1L 2XN9E 1EVTC 2ITDA 3A6CH 3VXUA 4FQHA 2EYRB 1Q9KB 1INQB 5DJXB 2XKNA 4HIEB 4Z7WB 3U4EB 4HW6A 5F88B 2E7LC 3F62A 3BZFB 4Y4KA 3HAEA 1IM3A 5C0IB 5MENB 1WFUA 4X6BA 2XZQH 1ZLUK 1P4IH 4KJQC 1E4JA 5IHLB 1WFNA 2FDBP 4OZIF 1UXSB 2NZ9D 1MFEH 3IS0X 2AKRB 4N8PA 3G6AA 3D5OF 5FV1L 2R15A 4HMEA 4JRYD 4YPGB 3IXTB 3VRIA 2EEBA 5DHYA 3OJ2C 5KVFH 1R5IB 4S2SA 2OK0H 5E2UH 3BT2H 4NQXB 3GRWA 2FHFA 3PWUA 5J7CC 2UZIL 3V4UL 4M7LL 2DLEA 4LMQE 4CVXA 2XXMB 4OF0A 4QXGL 4JPKL 2B4CH 4PRNA 3REVA 4F2MB 4L4TD 4M03A 1UCBL 1GIGH 5KVEH 1T6VN 1S9XA 3UTZB 2VL4A 2ZUYA 5HY9A 3VD7A 4FQJL 1LO0L 2J5LC 3SDCA 4TVPH 1HHIA 4JRYA 3UTTD 4HWBL 1ZLVK 5CCKH 4DKEL 3QDMD 4GRLA 1T89A 4HZLB 3O3EB 3RFZC 4NGHH 4GW5A 5GS0H 2VDNL 5I75B 3S36X 4Q9BA 2IFFH 5T33L 5TPWL 2VSDA 5DHVH 4Y4HC 1RZ8A 3G9AB 4XVJH 1FAIH 3IETB 4Q9CA 3GMNA 3CK0H 2FR4B 3OKNB 1CFVL 1FYTB 2IF7A 2AQ3A 1ZEAL 3VA2C 2OX5A 5I8KL 1A9BB 5E8EB 4GMTL 4OZ4A 4WU5B 4ALAL 4PJDB 4M4RA 2D9CA 3DETD 4M7JL 1R3LB 3F58H 5F44A 5ADPH 3ME0A 4PV9A 4J1UB 4H1LB 4JCLA 4M8QB 1CT8B 3I75B 5J8OA 2R0LH 4TQEL 5GGVY 5C0FA 5GS1A 1OPGL 2VZ3A 4Z7UF 3OGCA 4HAGA 2P47B 3N9GL 3WXWL 1RAMA 3L5XH 1XR9A 5DQ9A 1R5VB 4CN1A 1M05B 2HMID 4QRRE 4GXVH 3RNQA 1D6VL 1IRAY 4BFBD 4QT5B 1EFQA 2OM5A 3FQNB 3TLRA 4R7NB 1IC7H 1QBMH 2VDQH 1JYWA 2LQRA 1CF8H 1W8NA 3WFCH 1A2YA 1FL5A 2LABA 1NKRA 3VGAB 3MV7D 1CGTA 3BGMB 3MTRA 2XG4A 4KFZC 1OW0A 5D1ZB 4ODUB 5B8CA 4ONHB 5K9JH 2O5XH 4PJ7E 3BW9A 4KTDH 3X12A 5CMAA 5KAQG 4KQ3H 1KIPB 2HG5A 4QRTB 1KV3A 1R3HB 5IM7A 1CN4A 3UTQB 3O3AA 3FRUB 4U3HA 5JIIA 2QQNL 3C6SB 3OAZH 3QG6A 5IVXF 3UTSE 4H0GA 4P2OD 4QRQB 4MJIA 2FNBA 2AJ3B 2FATH 1R24B 3K2MC 4PRDB 2X4TA 4U1SB 1CXEA 4PY8J 1IM9B 2PO6A 4LVHB 5I66B 3LEVL 4DKFL 3VFUB 4P59H 5GHWH 1I7TA 1S8DB 1F42A 3B3IB 5E5UB 3ZHKA 3V7MA 3OAUH 4OKDA 1MFCH 3SJVB 2UY6A 1CI5A 1FC2D 4OCLC 5IROA 1UM5L 5DT1L 3OBAA 3RIFK 3HE6C 3BEVB 2X10A 4P2OA 3LKPB 4FQCL 4X6DA 5E6YA 5JIPA 2VERN 3CSPA 2V2XB 4FQPA 4R4NC 5IFJB 2Y7QB 1KLFA 5I1DA 5GJSH 2VZOA 4LKCA 4UOW0 4BELD 1AGDB 3J7HA 2ICWA 5D6DA 2MCPL 1AC0A 4MQTB 4XGZB 3RGVB 3TBTB 5EC2B 2CXKA 3SOBH 1M6OB 1FZOA 4FP8H 5FB8A 1J8KA 5FGCB 1TJGL 2NY1B 3ZLQC 2J8UA 43C9B 4O4YL 4YHYC 1DLHB 2OI9B 2EIZA 3GRWL 3JWNC 3ZE2E 1IZJA 2O5YL 3T3PE 5C0RH 1L7IH 2A6DA 2MQ3A 3GJFK 4M6NL 2Q8AL 1DLFL 4JO1H 3RIAF 4KWUA 2B0SL 4KTEH 5TF1H 1CYGA 1G7HA 1NUFA 3MA9H 5IBTL 1OP5H 4YHNB 1NGQL 4MJ4A 3P11H 4CRPA 4KK5C 3RWFA 4G6JL 1B4JH 2YN3A 3I6KA 3BKJH 4HUUB 1DJSA 2GTWA 1G7QA 4NRYA 1YMMA 1IGCL 5FKAA 1BQSA 3BXNB 4XRCB 2YPLD 1L0YA 4NHCL 1J5OH 5FCSH 1VPOL 2Q86A 4HUMB 4WI8A 4L8BB 4WI5A 4JFXB 3QDJE 3ZTJG 1YQVH 5JHDB 3NGBC 4JANA 4Y4KC 1KIRB 4RNRB 2AGJL 3GNML 3WNPA 1FBIH 3K8MA 1AJ7L 4KVNH 1B4RA 5F9WC 3Q6GL 3D0LB 1NCDH 3ARSA 3L1OH 5TE7H 2FEDD 3OG6B 1XCQB 1K6QL 1GHFH 4HPOH 4RZCB 4NUGH 2IEPA 4POYA 1QSVA 4R90H 3F7VB 5IEKA 2NXYB 5I1EL 3OKOA 3TCLB 2I26N 3U82B 4PRID 3VRLF 1C16B 2VJXA 3D2UA 2X1XR 1GGYA 3MRMB 4LIQE 5DFWH 1J0ZA 3VGDA 3GI9H 3LQZB 1CFQA 2F5BL 5EOTB 2ARJB 4PGBB 4QTHA 3VFRA 1A6AB 3V79C 2YZ8A 3MJ9L 3NABL 3DHJA 4NP4H 2PKDA 5CJ5A 3QQ4A 2WV3A 5FUOL 3S97C 2E6QA 4HBCH 1DVFA 2ZG3A 3ARDB 4GKSA 4OFKA 4KMQA 2NZ9C 3QUYB 3MRRB 4Z7WF 2WINB 3HFML 1BWMA 3SDCC 5HHOD 4K07A 5D2LA 3ZDXF 2BMKA 1LEKB 4MD0B