5C08E

1e6 tcr in complex with hla-a0e carrying rqwgpdpaav
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
244
structure length
244
Chain Sequence
GVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 244
sequence length 244
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08E02
2JJVA 1J87A 4CNIB 5MEOA 1BBJA 2VDRL 1JNLL 1WBZB 3BP5B 3UTSD 4H8WL 3LDBC 5FEBA 4NM4L 3TT1L 1JGDA 1D5XB 4PGDB 3RZCD 4H88H 1OGAE 2C26A 3BHBA 4GKZA 3DYPA 3MNWB 5DJ0A 3SCMB 2ZUXA 4BQ9A 1WFNA 4NRYB 3C5ZB 2HT3D 3X3FL 1CF8H 2AEPL 3PV6A 3S3PA 5D2NE 3IJYA 5F6IC 3ZO0A 1UH3A 1FAIL 2ADGB 4XWGL 2ADFH 5F96L 5DD6B 1KJVB 5CSGA 3GSQA 4D3CL 3TJHD 4WUUE 5CJ8A 3NIDE 5E8OA 2NY6B 2XA8H 3EYVA 3EYSH 3OKEB 4P46D 2VXUL 1MCNA 3X14B 1S5IL 5I1CL 4M7KL 1AO7A 4XC1H 4D0DB 1LWRA 3CH1A 2G2RA 4JQXA 4DVBA 4Q97A 4RFOL 1WAAA 1A6VH 3L3OA 3I50H 4WHCA 4NKOA 4PREB 5SX5H 3TCLB 1YMMA 5BVJB 1OGTA 2PTVA 2X5PA 4H0IA 4HIEB 4ONGH 4A2LA 1NFDB 3HN3A 4WHTB 5C0AD 1CG9A 3F12A 4M6NL 5CLTA 1HIMH 5MHSD 3ARBC 2LAAA 5CP7A 4KJWC 3FQTA 1IARB 4JO4H 3TBSA 3ZT7A 5JHDA 2FEEI 1HH9B 2NW2B 3UTTE 3V9FA 4HUXA 2C1PB 5HY9B 4HLJA 4KI5F 4MHHG 4P2QA 1U8LA 2P7TB 1FNAA 2ICCA 1G1YA 1ZGLM 2VL5A 4FQ2L 1HI6A 5JOFB 1ZT7B 4OCMC 3TV3L 4IRJB 4H1LB 1M6OA 3CFDB 2J8HA 5GGVH 2Q76A 5BV7H 1GGIL 5DJDB 1NC2D 1CDBA 1KJ2L 3K2MC 3WJLA 5CINL 3IU4L 4X9GA 2CKNA 3MCG1 4I5BB 2SEBB 5HGBB 4E0RA 2A9NL 3OMZA 4QRRD 4TRPL 4HMEA 3SPVB 4PJCE 3BFOA 2OTWA 3C60C 2NLJB 1G9NH 4OZIE 5JW4N 4HCRA 3B8SA 4EI5D 1UKTA 1BAFL 3F5WA 1RZGA 4L4VE 3JSSA 4L4TE 1NCAL 5DURB 1IEAA 2BX5A 1HILA 3O6KL 4NZJA 3EO9L 3V5DA 1G7PB 5HHXH 2RQ8A 1T7XA 4RBPH 3UTPD 4XCEB 1O7VA 1YEIH 4XMPH 2Y1VA 1YECL 2VLRB 3KG5A 4GRLB 4I4WA 4Z7VB 4HZLA 4RIRB 4MMZC 4FNLL 3QDMB 3OJMB 5A1AA 2FZ3B 5KSBE 2F9BT 4LHUG 4PGZA 3SQBA 1F4WH 1YNKH 1CFBA 2DMCA 2E9IA 3NAAL 3VWJC 2R0LL 2ZPKL 4OLXL 3VGAB 1XGYH 3BZEA 1YUHB 5C07B 1I9RH 2EO1A 1E27A 5I18H 4UQ2B 1CGSL 2DQHL 1MHPH 4YXHL 4G3YH 2VOTA 3G6AA 3OF6D 3NFNA 5IHBA 1T5XB 4RAUA 4YR6B 1D5MB 5LAXB 3TWCL 1T0MB 4MJ6B 1IQDA 1YPZA 3HMWH 4IIQB 2APBA 3MRLA 3VFWA 4JO1H 1MWAA 2H45A 5IGXH 1YN7B 3MBXH 5FGBC 1JL8A 5EZLA 3NGBC 4MLSA 4OCXL 2V2XA 3VCLA 1JF1A 2E5EA 4K7FA 4WVRA 3VRJB 3WS6A 5C0RL 1BFOA 5D7LE 1SYVA 4G6MH 5EBWA 3AAZB 4XPGH 4TUOB 5FHBH 4L3AA 5EG6C 2ICWI 1HHGB 4P4KA 4QEGA 1ACYH 4PFEA 3GJFH 2E7LA 5HHNB 4QRUA 1H3PL 1JHTB 3CVHL 1X5AA 4LPYA 3QNYB 4KK9D 4XCFH 5E5RB 1ZLVH 2UYLB 5I9QB 4OCNC 3P0YL 4A6YA 3SKMA 2AV7A 3PQYB 1LEIB 3HFMH 3MA9L 4RCAA 5F7DA 4FZ8L 3V8OA 1I3GL 1WGOA 5IOPA 5FOJA 5CHNB 3DIFA 3TBYB 3C87A 1YY9D 1WVZA 3ZL4H 2ZSVB 4JHWL 1ZA6B 3LPFA 4YGVB 1QFUH 3L3GB 2GTWA 3GDBA 4RGOL 5E1AA 1FZJA 5HYIA 3QDGE 1R5IA 2VLLB 1CD8A 3FHQA 3BKYL 2R2EA 1TFHA 4MDIA 2B5IB 5IVXB 3FTGB 2R0KL 1NLBH 4EN3B 2W0FB 1U95A 3RU8L 3MUGA 5FF6B 3RVVD 1XGQA 3R8BB 3NIDF 2IG2H 1KACB 4M1CD 4HWEL 2AV1B 4HWBH 2V17L 4W70A 3RL2B 3QPQC 1PZ5A 3MRBB 4PRIA 3MSPA 1JNNH 1GOGA 5HJ3B 1OF2B 1F6AA 3PGFH 1U41A 3ISWA 1K2DB 2ADJB 4PJ7B 3VWKA 3RVTC 5F6HI 2EC9T 4YQXH 4Z7UB 3RWEB 5EZJB 2BRQA 4NO2A 3O0RH 3HC4L 3RVXD 4Q9QH 1Q9LA 4MQTB 1CBVL 5E6IC 4HH9A 1F4XH 1KB5B 4G43A 1OARH 2HTLD 2E8YA 3H7BA 1A7NH 4PJ9B 2ZOKA 3DX9A 4I2XA 3MV8B 4OSUL 1E4XH 4M62L 1MJ7L 1YEEL 3MRNB 1XCQA 4RMRA 5JA8B 1EMTL 1RIVL 5JPMB 4CVUA 1RURL 2Z9TA 5GS3A 5GGSY 4MS8D 3PHOB 4EVNA 3LEXA 3VD9A 1G6RL 5TE7L 3S5LG 1EK3A 1HHJA 5DF0A 5DUPL 2GK2A 1GZQB 1OOAA 5BZWB 4QHKJ 5F89A 5HGAA 2BHYA 1TZHB 3BPLB 3FT3B 3T04D 1IE5A 4Y89A 1J1PL 5GGUA 1OAZH 2VXTL 5DUBB 3WNMA 3C08L 1WT5C 4RZCA 2EIEA 3V52H 5IBUB 5FM4A 3PG2A 1NAKH 1AR2A 1KOAA 4TULL 2YRZA 5C0BD 1KN4H 1SYSA 2RFXA 3KYAA 3OHXA 5F9JA 3RIFF 3D18B 5IV2B 4OZIF 3I9GL 4PJBB 5DHVB 1HYRC 2VISB 5F9WB 4JRYD 1M7IA 2Y4SA 1S3KH 3P9LA 4FQQA 1D9KB 1IC5H 2R4SH 3ARFC 4K7PL 3WFDL 4U33A 1Q1JL 4JN2A 3WBDA 4C58B 1UM5L 1VPOL 4APQD 1U8QB 5J89A 2GJZB 5DQDH 2PR4L 1XH3B 3KPMA 5EC1B 4Z0XA 3LKSB 1N5YH 1NGWA 4MVBC 3TBVA 3QT2A 1S9WB 5TDOA 2AEWA 4X8JA 4FTVE 4OF3A 3QYCA 3BKJH 5KSBF 2Z31C 3O4OC 1N2RB 2OJEB 5I1EL 3NPSB 3QCVH 2CRZA 3BJ91 2VUYA 1NGQH 2IH1A 3IDXL 3QQ9D 4S0SD 5SWZA 1T3FB 1NSNL 3BOVA 4XWOC 1ZGLB 2XACC 3S35H 3VFUA 1JYNA 4NRZA 3W82A 1ZHKB 2W91A 5DI8B 5SWQA 2HRLA 1AGDA 3D69B 2ZNXA 1ZTXH 4QCIA 2XKSA 3WFHB 5D6CA 2Q3AA 1OTSC 2P47B 1CD1A 1HSBA 1T21B 2DQJH 2C3HA 5ID0A 2AK4E 2CLVB 5H94B 4KK5C 3U6RB 3QUMH 4LGRB 3FN0L 3C2SA 4TPRL 1DE4B 4U1GB 1ZK9A 1FJ1A 3WN5B 5E00B 4LFHG 3VFOB 3BH9B 3KDMB 5D93C 4XP1H 2CMRL 5FHAL 4L8SA 3LIZH 4BUGA 3RGVC 3MBEC 1WIOA 1DQMH 3HPJB 2BSTB 4HS8H 2HFEA 2P5EA 3BDXA 2XWTA 3GGWB 3C9NB 1A4JA 2F5BL 4AMKH 3SJVB 1OSPH 1BHGA 4UIMA 4I0PD 3SN6N 1TJIH 4Y19D 4G6FD 3T2QA 3KPPA 5E5MA 4ZUUA 1ZLUK 1HINH 3S35X 4D9RD 1P2CB 2JB6A 2BJMH 2HN7A 4M8VA 4PRPB 2ZCKL 2Y6SD 4YHPA 4OQTH 3PWUB 4YAQB 4ZXBA 3PE9A 3SKJH 1QRND 1BVLB 3K81A 5EBMA 2X4TA 1RZ7L 1NANH 1WC7B 4HLZH 3F7PC 2F58L 2G5BA 1IKFH 2UWEA 4M48H 3FZUD 3TFKC 3MRRA 1DANT 1I7ZB 5BOPA 4HIIA 2E3VA 2R56H 3BI9X 3G6JE 3HKFA 4ZTOL 3L95A 3RL1A 3I75B 1HWGB 5TDPA 4Y16C 1B3JA 3RUGB 5D70L 4UDTA 5L0QC 4PB0H 4H0HB 3CUPB 1F90H 2V5TA 2A6KA 3JV4A 1T04A 3FAWA 3QCTL 4UBDD 2J4WH 4M9OA 2R2BB 1C16B 5K93A 3C6LA 4S2SA 1A4KB 4QGTA 3TZVB 2X9YA 3CC5B 2NY3B 4OZGB 5DTFA 3G5ZA 4MNQB 4JFFA 5KVEL 4PS4H 3SDXA 5IVZB 1U8HB 3QEGL 2R1XA 3RI5F 4B5EA 3FJTA 3LV3B 5JMRA 5TDNB 4F58H 5GGSA 3UZEA 1M71A 1JF5A 4A2MA 5IG7B 1E4KC 1LD9A 5C09D 1C5DB 2VIRB 4NBZB 4X80H 4RAHA 4F7PA 3B6SA 2F74A 4WFGD 2DBLH 4Y5XB 1XIWD 5IIEB 4HK0A 2FHCA 4HFWB 3IU3B 3HUJF 1BZ7B 2EIBA 1LVEA 5HI5D 2VXVH 1A7QH 5ISZD 5ICYB 2WUCL 4DZ8A 3VXUE 4XHJC 1YEFH 1UYWH 3BX7C 2Y06L 1AHWA 2HKFL 5FUZH 3RTQA 2AJXH 5FOBB 4ZSOA 3KYOB 3A67H 1R3LB 3W9EA 2IBZY 3JVGC 3O6FC 5KVDH 4B0MM 3JUYA 5HHVH 4KVCH 1F3DJ 4XZUB 5DS8B 2W65A 1S7RB 4YDJB 4LSTL 4JFEB 3R4DA 3NZ8A 4YHNA 3D6GA 3BMWA 5D4QA 3JTTB 4L8DB 4U1NA 3HC0A 1GGBH 2X1WL 2XQBL 4P2RE 5CEZH 4CVZB 2R8SL 3AB0C 4PLKD 2J88L 4LVEA 2X4OB 4N1EA 2GITA 4RGND 1FNSL 5DJZB 4P9HH 1PX4A 4NFCA 4OD1L 5IVNA 1VGEL 5HYJE 4U6XA 1JUFB 3EO1B 4XP6L 2VLJD 4K3JL 3RPIB 5MEQA 3LN5A 1RUKL 4OJFH 2P8MA 1B88A 5H2BB 5T3XL 5BZDB 3MODL 3P77A 5FM8A 1VADA 1QKZL 5SWSE 3LQZA 1A14H 3V4PL 3RDTA 3KYMA 3GNML 4Q6IC 3ZLQC 3BP7A 4HKBB 4KK8C 4HUKB 1FYTE 2X7LA 3GK8L 3IVKA 3LEYL 2WWKO 4QHLA 5TJWK 5LGKA 1FL3B 3SDAB 1Y6NR 3SBWA 2X4PA 4X4YA 3KJ4B 4JDVA 5HGDB 1J8HB 1RZIA 3JWOL 2NY4B 1HSAA 4U6TA 1BD2E 5DVNA 5IW6A 3T3ME 4RFNB 5ITBH 4M43L 3A6CH 5I1DB 5MP6L 4KJQD 5K33A 1MFEL 4ODVL 1KJ3H 2ORBL 1H9VA 4LHQB 4AG4L 3ES6A 5T1MA 3ZKMC 3P9MA 4DTGH 4B7IA 4XHQA 1VFAB 1REIA 2EDRA 4DKEH 5CEZD 4OCSH 1XGPB 2PXYA 1F8TL 1NFDE 4KUCD 3GJEB 3DTXB 3WIIL 2YPLB 3VI3E 3WIHH 4JG0L 3ULUD 2CDGA 4Z9KB 2Q20A 4K8RH 3QDJD 2P5WA 3G5XA 4HFUL 5F9DC 1PYWB 2DICA 1NGZB 4POZC 5CSBA 1FV1A 1JFQL 2IAMD 2CDFB 4JKPL 2QQLL 2BNQA 1INDL 5DK2A 3S37H 1I8KB 4TVSa 5KS9A 2BP3A 3GMLB 4HIJB 1RZ8A 4PY7A 2V7HA 2EIZB 2HLFC 4BZYA 4JAMB 4XP9H 3ARWA 4Y1AA 3OJDA 3KJ6H 4PTUB 3T4YA 2GHWB 1MCQA 2LQRA 5JXAH 3BKML 1KPUB 3G6JF 1S9YB 4U1HA 1BZ9A 3QQ3B 4X4ME 4PRNA 4XBGA 4GSDH 2ZUQB 1A7OL 2KKQA 1KIPA 4J4PA 4LEXL 2ZG3A 3H0TB 2H26A 4LIQE 2XQYK 1LEKA 3VD7A 4XTRD 2HP4A 2G75A 5CZVL 2FH6A 1L7IH 4JY5L 2FNBA 3SDCD 4JM2B 3CX2A 3AUVA 1HEZB 4QF1B 1OGAA 2FGWH 3ARDD 1NCWL 1L4IA 4JPKL 5KOMC 3SOBL 5BW7C 3MOBH 5C0IA 4F7MA 1TJGL 4JZNB 4NGHL 3S37X 3Q5TA 1ZSDB 4HQQH 5D1QB 4K8RD 5D2NA 4ZUTB 1FE8L 1IL1A 2EZ0C 3MRGB 2D7TL 3ZDZE 4J3WA 3MV9B 4D94A 1DQDL 4UDUA 4Z7VE 4OLWH 1T4KA 1X44A 3QDME 3NCJH 5F9AC 2HJLB 4PJFF 1WK0A 4IJ3C 4S1SL 1U8IB 4F57H 4PG2C 1P4IH 4ODTL 2ZJSH 3VGDA 3QCUL 4Z95L 1IAKB 2QR0B 1HNGA 3NACL 5IHUL 4GXVH 4NP4H 4YBHA 1UCTA 5CWSA 3CXHK 5AZEL 4G8GE 1NKOA 1PJ9A 4MHHI 2YN3A 1JI2A 1CFSB 3QAZB 3QPXL 4N0CC 4OAWA 4XT1C 4DZBB 4PJ8B 1AY1H 1DR9A 4MYWB 4AIOA 5I1JH 4ZFZB 1VGKB 4LRIC 2HG5A 3DX7A 4GW1B 3QUKA 4WNQB 5FYLE 3U9UB 4CN1A 1AR1C 3MXVH 5EIIA 3UTTA 5E1HB 3DV6B 4CN4A 5DFVC 3SGEH 3DVIA 1XF5B 1CXEA 4NQCD 1OPGH 2EEDA 1S7QA 4XVUD 5EZIH 2W38A 1D5ZA 3IJHA 5BO1L 4UT7H 5I66B 2G9HA 1JZ2A 3EOBB 1BZQK 2PYEB 3ZE0F 2XPGA 3HE6D 2RGSA 3B5TA 3EBAA 5JZ7D 2NY7L 3PJSB 5J57B 1IGFL 5HHOB 4YXKL 4WO4D 2CPCA 1AQKL 3NA9L 1MFAH 3BUYA 2IH3A 5BV7B 3ARBA 3T8XA 2VXSL 1KXVC 3UZVB 5EOCH 1A6PA 1AJ7H 2BOCA 2CJUL 2NZ9C 4QWWD 2A6JA 3VFNB 1P84K 5IR1A 1CU4H 4Y8DC 3CFCH 3T0ED 1P5VA 4HCRH 4WHYG 1A6TB 4JR9L 1S7XB 1BOGB 1RUPH 1V3LA 5FECB 3IFLH 2OSLA 4PJCA 1N6QH 2WUBL 4JPIB 1U6AL 3OGOE 1UG9A 1KCRH 5FA3A 4L4VA 2X4UA 3IDNB 3M8OL 2OR9L 4L4TA 1A5FL 3WUWB 2EXYC 2QQNH 5FCUL 1YMHB 1TJHL 4W81A 2Q87A 3REVA 1MIEH 3HG1D 1YEHL 1ZANL 2P8LB 4HWZB 4GS7C 5DO2D 5EDXA 8FABB 4P5KA 3DUUA 2IANB 2DYPD 4NFDA 4QRSA 1NAML 3T3MF 4GKSA 2X70B 5D1XC 4R3SB 4Y2DB 3BGFB 1TVHB 2Q86B 1U3HC 5KSBA 1TIUA 2BXZA 1IEBB 1VB9A 1MVUA 3C60A 4RISH 4OD2B 3EUUA 4QXUL 3UYPA 1TVBA 1QYGH 1NBZA 3TO4D 1OM3L 4XH2B 2QHRL 5GGTL 4FMFA 2ICWJ 5IHZA 2BVOA 4KHXH 5CCKH 4LHUD 5C7XL 3UCRA 3DROA 4G8EA 1NFDF 2YK1L 4Z7UE 3RWIA 3HR6A 3BE1H 3UTZB 3D85D 1MWAH 4M1GH 1G7IB 1MCRA 5JQ6H 3MLSH 3O2VL 5BS0B 3VI3F 4NQED 3BPLC 4NOBA 3OKOA 1JYXA 3O81A 3C5JB 3G04A 4DGVH 5IMOA 3DO7B 3MV8E 2VDNL 2NCMA 4X9HA 1MLBA 3DMMD 1YEJL 2H2PC 3VWJA 5D7LA 1P7QB 3QIBC 1FC1A 5DA0B 3GI9H 4F7CA 2HT2D 4EBQL 5KSUA 5FM5O 5GIRB 1ZT1A 2ED7A 3R8QA 5BMFH 1KTLB 5K9QG 1LGVA 3GJFB 2VDML 5HD8C 4YPJA 3B3IA 3MUY1 4A6YH 2AI0L 2NXZB 4N0RA 1EXUA 3GBLA 1JVKA 1O0VA 1IM9A 1EV2E 3ZSSA 4DKFL 2FR4A 4LVHC 4LSQH 5D7SL 3KPRA 4G6JL 3BVNB 4R0LC 4I9WD 4Z7OE 5E6YA 3MOQA 3UBXA 2X4RB 2NXYB 3OR7A 2GFBB 3FONB 4E42A 3HE7D 4NRXB 5FGBA 4E41B 4ERSL 5K59E 5I6XC 3VFTA 3AU1B 2YEZB 4PRHE 2GY7B 3BP4B 2XXCB 1R0AH 3BH8B 1YQVH 3NPSC 4V2BA 2APFA 4OIIH 2P48B 2DD8L 2QADD 3PDOA 3VXMD 4NQDE 2IPUK 4CGTA 4WW1A 4HG4J 4P3DA 3UAJC 2P49B 1DL7L 1MJJA 1RU9H 1KSRA 1QFWI 1N7MH 2RR3A 4NDMA 4X9FA 5DJAB 2NY0C 1FN4A 1J0KA 32C2A 4WJ5B 4HUWA 3ZDZF 4RA3A 2MTPA 4BK5A 4JKWA 4Z7VF 3W39B 1QA9B 4FQCH 1YNLH 1IQWH 3MLYL 4DGIH 1UEMA 2Z91B 3LQMA 1MFCL 3OAZK 3EYFB 4Q2ZA 3KXFB 2AERT 1QSEB 1JWMB 3RA7H 3GO1H 1G7QA 1GPOL 3GMQB 5IB2B 1FFRA 4U1GC 4P4RA 5EPMA 2OL3L 5J13C 4LSRH 3D87B 5AD0B 3FOMA 1BVKA 3BD5A 4ELMB 5DXWA 3LD8C 2XA3A 5CP3A 3D39A 4POUB 5D2LB 3OX8B 1XF3A 1IGMH 1R3IL 5FYJD 4Z76A 3M07A 1I1AD 3DARA 1HHIA 4X6FA 5L88L 1DDHB 2XKNB 5F9OH 5M7QA 3U36B 1MAKA 2Y23A 5I73B 4LLQA 4BZ2H 4RGMB 1E6OL 1O7SA 3QH3B 2B1HH 4IRSB 1LDSA 2BCKA 1R3HA 4BH8B 2NR6D 2VDPH 2WMPA 4MD5A 4K3GA 2B2XL 2MCPL 2WP3O 4NKIL 2GUOB 1PDKA 1V7NH 2NTFA 1EERB 4OTXL 3MMEB 1KC5L 2WBJD 2GY5A 3GMRB 1U8OB 3E2HC 2J8UB 1J7VR 4K23L 5AAWA 1FNGA 4YFLF 1P4LB 2FATH 3SJVE 1HH6B 4V1DB 5E6IA 3Q5YA 4HUVA 2MJWA 3PHQA 5I1LA 2O93L 1ES0A 2J7LA 4GMTH 8CGTA 4QXWA 1MFBH 4TYUA 4Q9CA 1X7QA 4LVNB 2LE9A 4HMDA 1ZOXA 4MMXC 4LLAA 1I9IL 4O51B 5INCA 4Y4HB 2ITDB 4XNMA 1CGWA 4RFEA 5MERB 5ACZB 3G08A 3QWOB 4XMKH 5IUSA 2IALB 3LQAC 1D6EA 3QEHB 3MLWL 4YE4H 2G60H 4P5TC 2YHGA 3T0BA 4Y4KD 5IVXF 3AMLA 5LWYL 4P99A 4OM0L 4R4ND 4F15C 2YPVL 3O6ML 3NPZB 3ARED 1VA9A 3P0VH 2GI7A 1P7KA 5A2KH 4FFZH 3RWDA 3CDGB 1AD0A 3KPQA 1OQXA 1WT5A 1IFHL 1LK2B 4GMSH 4FFVC 3QIUB 4FTVA 4PGBA 3U0WH 5JORA 2IQAB 5KVMC 1GAFH 1B0RB 1KG0B 1NLDL 4JRXB 2A6IA 3ZDXE 2YD6A 1Z9OA 4M7ZB 2VH5H 3MJ7B 3ARFA 1F02I 3PWJB 1Q0XL 3MZGB 4PJ7F 2IADB 4Z7UF 4L3CA 4X5WB 4LDOB 4JZOA 4HX1B 1KIRA 3SDDD 1S9VB 5C92A 1NEZA 5KN5B 4LCWE 5J9PB 3VFMA 2D7OA 1QNZH 5DHYA 1MCFA 4I8DA 5T33H 1FG2A 2Z31A 1JF6A 1WCBB 3OL2A 2HTKC 2AK4A 2Z4QA 4H88L 4PJEB 1AI1H 3QUMB 1U2CA 4M1DH 4MDJB 1J1XH 1MI5D 3VGHA 5IMKA 1CF8L 1CR9H 1URLA 5I1HH 2VQ1B 1I3VA 2Q6WB 4UT9H 3NABH 2CKBA 3LHPH 4QXTA 2ZUTA 2FGZA 5DD3H 2ADFL 1HN1A 2Z93B 5J4MA 5DWUL 2PW1A 4KY1L 3T77B 4LCIL 3WSQH 3BQUB 4S1QH 2GSIA 3RWJA 3RIAK 1TETL 4LFHD 2IPKB 4Z7OF 4H0GA 4JFPB 4GAYA 3LRGA 2XWBA 4HC1A 5DGQA 1GCFA 4LOUD 2DWEB 4XC1L 5K59F 4MX7A 3CFJA 3TT3L 2QL1A 4BSWA 1NEZG 1A6VL 1A1NB 4F3FB 5IFJB 4BQ6A 4JFDD 3MJ9A 5I75C 3RY5A 1KBGL 1UJ3C 2YA1A 2WLZA 3PIQB 3W11C 4PJBF 3T4AA 3CMOH 3AS2A 3TLRA 2W9EL 4GQ9H 4YBQC 3KPLA 4LDLB 3RGVA 3MBEA 3T0AA 5GRJH 1NFIB 1QLRB 3O8XB 5HDLA 4PD4J 3B9AA 5C9KA 5CEXB 1I3UA 1G7MA 1XEDA 5GS0D 1HXMA 3P4NA 2R69H 3GHEL 1CICB 5I19H 1FCCA 3I6LE 1WEJH 3ZE2E 3ZTJH 4JQVC 2VZSA 3VH8B 4IMLB 5LGHH 1NCBL 4IOFC 4P23D 4LPUA 1VACA 2ERJC 3I3DA 1CDGA 2C3GA 2NY1B 5KG9B 1AKJB 3BIKA 1T7ZA 4HIHA 5GGVL 1N5AA 4M7LH 3U2SA 2D7NA 3ZDYE 2ATKB 1DVFD 3F6LA 5ESAA 1MH5A 3N0PB 3PL6C 5B3JF 4FQXD 1X3DA 2OTUB 2OTPA 1BFVH 5T3ZD 2X4NB 1J8HE 4U3HA 1JWSA 3CVIH 4LGPB 4Y16A 5DQJB 1BWMA 4OKVB 5FXCH 3E6FB 4QRTB 1G9NL 2BY3A 5B4MC 2IMNA 3VXSD 1FNFA 1N59B 1GIGH 5GRYA 1UVQA 4MJ5A 3RWGB 4H8WC 3HR5B 4Y88A 4NJ9L 5HHME 3FB7A 3QHFH 4UTAL 1X5YA 3O3AB 4B41A 2CLZB 4NNPH 2Z35B 3VXNB 3QEQE 3TA3D 4WFEE 1YEKH 4GW4B 1YN6A 4P5MA 3OAYH 4OI9A 4ODXA 1E4KA 1F4WL 1SMAA 5ALCH 2HT4C 4ZQKA 5E5UB 1IMHC 4NQSA 1F58H 1I9RL 2AJZB 4N5UA 1X4XA 2DQUH 2YPKB 5I18L 4KQ4L 2FIKA 1JZ4A 1MHPL 4N1HB 3T0XA 1XR9B 3KPSD 4JM2C 4UV7H 1J5OH 1ZKAA 3LKNA 2DWDA 4BFEA 3GMOB 4UILH 4JO1L 5IGXL 5LCVL 3IS1X 4P2RA 1LP9B 3MBXL 5HYQB 4CUCA 3ARGC 1FLTX 4F33B 1GZPA 1QPXA 3RWCB 5C0CE 3RUGF 5IT2H 4L3EB 2UVEA 2AS5M 3JVGA 3O6FA 1XGTB 5HYJA 2R23A 3VXTA 3QZWA 4ZMAT 2DLIA 4XPGL 2DTML 2XZCH 5F7HA 5I8OH 1HKLH 1JGLH 2YMXL 2DIAA 3IF1A 5IKCB 5DD1L 1ACYL 3V7MA 3TP4A 1U8PA 1K4DB 5JW3H 4LDEB 1FZOB 4XCFL 1OWWA 2H8PA 2WWKT 5SWSA 2WWMD 2F15A 3LEVH 2MFNA 3DI2B 1I1FB 3HFML 1OAKH 2FECI 1G0DA 3VFRA 2EYSB 1FYTA 1KULA 3MRCB 3MV11 5KSVB 5DJXB 1JZ5A 1X5LA 5T1KD 3ZKXC 2ARJA 5HDQH 5IEKB 5D1ZC 1U8KB 3OXSB 5C0JA 5TE6H 1CK0H 3UO1H 3ZL4L 1BD2A 5FKAB 1ORSB 1QFHA 1J0HA 5CMAA 2Z8RA 3WE6B 4F7TB 4YNYA 1OLZA 2B8OT 5FCSH 3MO1A 1T89C 3L7FA 1N3NB 4C56E 3D3VB 3S96B 5TQ0L 1X6LA 4LRNH 1U36A 3FQXA 2FO1A 4KV5E 3LKQA 1ZWIB 4Q6IA 5I15L 1FL5B 2QV2A 4PJAA 2ESVB 2X6MA 1J0YA 4NZUL 43C9B 1NLBL 1ZA3A 1RJCA 3MRQB 3BP6A 2IG2L 3G6DH 4K3DH 5A2IH 2EE6A 4MQXC 3GSRB 4K3HA 1ZS8B 2W60A 4JKLA 1RZJC 1UQSB 2C1PA 1OP5H 3WO4B 1JNNL 3GSVA 2CSPA 9CGTA 1IGCH 2IFFH 5GQBA 1DBAH 5EWIH 3I02A 3QO0A 1MEXH 4ZAKC 3TPUA 4KTDL 5JOFA 4YQXL 2CRMA 1RK1B 1RJYA 3O0RL 3W5MA 4NNXB 1EO8L 2XTJD 3FFCB 1IGYB 1HHHB 2MOVA 1CLYL 4CMMB 5J8OA 1OARL 4JFQB 3GEWB 2X10A 3U79A 3PWPB 4JEGB 1I4FB 3T2OA 4RNRA 5CD3B 1A7NL 5LGJB 4IS6B 4QNPE 3WS3B 4F8QA 2VLKB 5GSRB 3K8KA 1E4XL 1TZIA 5MEOB 3TVMD 2HFFA 3ZE2F 4X4MA 2Z8VC 1BBJB 1E4WH 3UJIH 4I5BA 5HGBA 5I17A 3DETD 2XTLA 5IBTH 3TNMA 1VEMA 5L2KD 1JGDB 3FQUA 1X9QA 1UWXK 3TM6A 4LCCC 3T1WA 4YUEH 3BHBB 1P9MC 5DJ0B 2GJ6E 2AP2A 3ZDYF 4G8FA 3PV6B 4JVUA 2CLRA 3IJYB 2AK1L 2IPUG 5EN2A 6FABH 1OAZL 5A2LH 2ZCLH 4R7DA 1LO5A 2PO6C 4H1LG 3RJQB 3GSQB 2ZNWA 3S6CA 1JPTH 2R9HD 5E8OB 3IFOA 3ZHKA 1EUUA 3EYVB 5FGRA 4QHNA 5E9DA 1KN4L 3DGGA 5E08L 4XAKD 5C9JA 2X40A 1ZHNA 2GYSA 1AO7B 4PB9H 4DVBB 2G2RB 4RMTA 2R4SL 3L3OB 5IB3A 3LCYA 4NKOB 2D03H 1YMMB 3JV6A 1OGTB 5CJQH 3KLHC 1LILA 1OHQA 5DQDL 4RQQA 3NVQA 4G8GA 3MROA 1CG9B 3F12B 3MGTA 3B43A 1AP2A 1ORQA 5BW7A 2BNUA 5T5FH 2NXZC 2EECA 5CP7B 4H25A 3CJJA 3FQTB 5BS0E 4WHYH 4WU5A 3TBSB 1C7TA 3BPCA 5JHDB 3ALWA 1MLCA 4HUXB 3KS0H 5EU6D 4PPTA 1NGQL 3ETBF 4P2QB 1U8LB 3TGXA 4QTIH 2F54A 5F7WC 3IDJA 2I25N 4PG2A 3S35L 3P30L 2VL5B 3VRJA 1MPAL 5H37G 2CO7B 4I18C 4HBCH 2CXKA 1M6OB 4QT5A 1YA5A 1OCWH 4JM4H 3KHOA 1FO0A 3D2UD 6CGTA 4WFHE 4YHOH 3RBSA 2YZ1A 1EHLH 3VG9B 2Q76B 2EXWC 4WTWA 2AJUH 3QEUA 3BEVA 1BIHA 5C0DA 1QR4A 2DQJL 5EH1A 2IBZX 5EOCJ 4WUUD 3Q5OA 5IMMA 4OKDA 3HB3C 5GSVA 1CGYA 4E0RB 4LRIA 5CUSL 5HI4C 3O4LA 4WY7H 4JY4A 4PJ5B 3A0OA 2OTWB 4XP1L 3F5WB 1RZGB 3LIZL 3QI9D 4JM2F 1DQML 4KTEH 2V5SA 2VKXA 4HS8L 1IEAB 2JE8A 4W6XB 1FH5H 3N9GH 1HILB 1OSPL 3UTQA 3LB6D 3V5DB 3L3JA 1TJIL 5CZXC 4F7EA 2O61A 3Q3GA 2QSCH 4I4WB 4HZLB 3MLRL 4NN7B 4OQTL 4M02A 3SO3B 4UINH 3BZEB 4U1JA 5F3HA 1E27B 2DQFA 4M61A 2R29H 3ILQD 1QSEE 3QUXD 4N1CA 1IKFL 4FQPA 1X6NA 1KXTB 1NMCB 2YD5A 2CUHA 3G6AB 3DXAE 4KV5F 4RAUB 3DX6A 1FRGL 1FP5A 1IQDB 1YPZB 1KGCE 2KL6A 3JZ7A 3MRLB 3P4OA 4PB0L 5E7FA 3VFWB 1MWAB 3JUZA 2JELH 2OMBA 5CD5D 1F90L 1CVSC 4HAFA 2EDKA 2W0KA 5EZLB 1P7HL 2J4WL 4U6YA 2V2XB 3VCLB 1JF1B 3O11A 4OF0A 4WHDA 4K7FB 1G9ML 5D1XA 1BFOB 3MV8A 3QBTB 1SYVB 1U3HA 5EBWB 3BEWA 4MJIE 3JV0A 4NT6A 4MB4A 1ADQA 1K3ZA 4KROC 1T66D 2Q7YA 4PS4L 4Y5VC 5KVGH 1RIUH 4P4KB 1JRHH 4LPXA 1Z9LA 4QRUB 1DEDA 5SX5K 3LN4A 4A6YB 3MRPA 4PJHE 3SKMB 2AV7B 5F7DB 5IB5A 4KXZI 2DBLL 5IOPB 1RHFA 5ICZA 5CKAA 3DIFB 5FYKD 4U0RB 3HNVH 4HPOH 3BIBX 4OZFA 1LNUA 4RMSA 3DOSA 4O5LH 4PRHA 4KFZC 1XF2A 2VXVL 1KNOA 1A7QL 2GTWB 3QIBA 2EDWA 3LVEA 1UYWL 2WBKA 4NQDA 5E1AB 4PRAA 4JGMA 4M7ZC 2GJJA 1R5IB 1Z0NA 2AJXL 4KKAD 4G9FD 5D96C 2R2EB 3A67L 3AY4C 4MA7L 4MDIB 1IAIH 3RBGA 4Z8FH 1A7PH 4YBLB 5C08D 3WKNA 3X11A 1U8QA 4CU6A 5GZND 5KVDL 1IVLA 1D3CA 2XICA 1U95B 3B9KC 3MUGB 4R0LA 5HHVL 1XGQB 5GRXG 3RKPA 5JO5A 1HNFA 4MA8L 4HEME 1KIUA 1WISA 1PZ5B 4IBLT 3QULA 4HIXH 1PGRB 4PRIB 4X0KA 3A6OA 1GGBL 3BN9D 2YOCA 2XG5A 4NJAL 5KW9H 1F6AB 5IBUG 5CEZL 4GRWH 3V5HA 5ILTH 3QNZA 3VWKB 3WEXA 4UAOB 3T0DA 1IAII 2VDQL 2ILLA 5E2TH 1H3XA 1Q9LB 2NYYC 4HH9B 1UCBH 2AKRA 2F53A 4G43B 5DQ9A 1A3RH 1KF9B 1OSZA 3H7BB 1LK3H 3EOTH 4TVPD 4OFVA 3DWTA 4RBPK 2ZOKB 3DX9B 3CK0L 1JP5A 2E27H 4OJFL 3BJLA 5J12B 3BD4A 4M6OH 3RHWF 2WP3T 4BKLA 1XCQB 2C1OA 1RHHA 5IBLC 4PJEE 4WFFE 5IB4A 5CS7A 1JPFA 4ACPA 4L9LC 5GISL 1KCVH 1NCUA 1U42A 3BPNC 4QHUA 4EVNB 3LEXB 3WL9A 1WITA 4M7LT 3QDGD 4NO0A 5AZ2H 1HHJB 3KDMA 3OV6A 3RQ3A 2VDOH 5DGRA 5F89B 5HGAB 1UFUA 4NCC2 3BYYA 3H42H 3H9YA 4JFHD 1F3JA 4QRPE 4R96A 4HK3N 4L4JA 1X4YA 5ITBL 4MAYD 5GGUB 4RZCB 1I7UA 2BNRE 5SV4A 1MJUL 1KJ3L 3GRWA 5GS2H 1UM6H 1XAUA 3OB0H 1UZ8A 1SYSB 2RFXB 3OHXB 5F9JB 1FYHB 1AGFA 4DWHA 1M7IB 1BM3H 3LN9A 3P9LB 2DRUA 4OCSL 1S7WA 3KR3H 2F19H 3ULSA 4JN2B 1BGXH 1MHEA 4LMQI 1WC7A 1J11A 3WIHL 2Y9RT 2NX5A 4Y0GA 2VDKH 3UDWA 3GJFK 3V4VH 4K8RL 3KPMB 4DKAA 4Z0XB 3WD5H 3FQWA 1I7ZA 1IEHA 4PY8I 1NGWB 3VXRE 1Q8MA 3TBVB 5HHQA 1ZLVK 1T2XA 4YK4B 3SE9H 4U1MA 1UADC 4X8JB 1FFPA 4UQ3A 5F1KC 3CUPA 3B4NA 2IH1B 5SWZB 2VC2H 4HGWA 3IKKA 2Z92A 2BFVL 3PDDA 1INQA 5ETUA 1A7RL 1K8IA 1QSVA 3VFUB 4G6KH 4NRZB 4UOW0 2I5YL 4X98A 4PTTA 2D2OA 3MREA 3GMPA 5ADPH 1JBJA 2ID5A 4U1IA 5SWQB 1AGDB 4ELMF 5D71H 3MA7A 4BSJA 4RX4A 3QJHA 5D2LF 4QCIB 3FB8A 1W72A 4GSDL 4QXGH 4P5TA 5D6CB 4HG4K 1G7JA 4YPGA 1CD1B 1CDYA 1HSBB 5BCAA 5BOZG 5JR1L 3O9WD 3F7YB 5A3ID 1SJEA 1PLGH 4LCWA 3DECA 5ID0B 2W92A 3HNSH 4DFIA 5MI0B 43CAA 1BF2A 1MAML 1T1YA 2BK8A 1FJ1B 2D7QA 4X5LA 1M4KA 1T83C 4FXLA 4ZUVA 4EI6A 1CWVA 4OLYL 2FGWL 3L1OH 2RB8A 2BERA 4L8SB 2CKBH 4JJHA 2EIDA 1J0ZA 3MOBL 4BZ1L 1F4YL 2HFEB 1T2QH 2P5EB 5T1LD 4HQQL 2XWTB 1A4JB 5IESH 1B6DA 4FQJL 1RI8A 2Q8BH 4CMHC 4UIMB 4OLWL 4YHZH 5KSAC 2BVPB 2PW2A 1H3WM 1W2KT 3NCJL 3O41A 2BVUA 4HC1H 2PN5A 3U82B 3KPPB 5E5MB 4ZUUB 4F57L 5H35B 2JB6B 2ZJSL 3JWOC 1JWUA 2HN7B 3S7GA 4YHPB 2OJZH 1D5IH 4ZXBB 2UUDH 3FO0H 2OK0H 3NCYS 1LDPH 5EBMB 5FAAA 3TYGH 2X4TB 1F4HA 5AEAA 5HYSA 3HI6H 2G5BB 2UWEB 3MRRB 4L8DA 1SBBA 2DM2A 3V4UH 1AY1L 2ZKHH 5I1JL 1XMWA 2D4FA 5DD0H 3L95B 3RL1B 1LP9E 4HF5H 4WTXA 5IWLC 4QYOA 5TDPB 1FBIH 4QO1A 4UDTB 4WWKD 1IGJA 3X17A 2AJSL 2A6KB 2LV4A 2DQDH 2MPAL 3JV4B 5JW5A 1T04B 4OCYL 1OPGL 5EZIL 2D7PA 4OV6F 1MJ8H 1OLLA 4RMUA 1T7WA 2OM5A 3C6LB 2DAVA 4S2SB 4OF6A 3RPIA 3H2WA 2M8XA 2C4FT 1UJ3A 3FN3A 3MZTA 1ZEAH 5DTFB 5J1AA 4U49A 3G5ZB 4JFFB 4KRPC 3OB8A 1F6LL 3J7HA 3SDXB 2R1XB 1MFAL 3VGBA 4TN9A 3STLA 5GGSB 5EOCL 3SGDH 1M71B 1AJ7L 1T20A 5EU4A 4YXLH 2IWGA 4JFZL 1FL3A 1Q94A 3V2AR 1LD9B 5JOPD 3CFCL 2P46B 5KJRH 4YDLC 3QIWC 4U7SA 4HCRL 4JQVA 4ZS6D 5LVEA 4F7PB 3B6SB 2F74B 1RUPL 2XY1A 2LU4A 1RULH 3IFLL 5J11C 1N6QL 4EIZC 4HK0B 4PLNC 5GJSH 3JXAA 1K9TA 4PJEF 3CSGA 1ZHLA 1YJDC 3D3VE 2QQNL 4M9PA 2PCPA 1RFDH 5AG8A 2DQEH 1XCTA 2A38A 5C6TH 1MIEL 4DZ8B 1AHWB 3QUYC 1I1YA 3PL6A 5EU3A 3ARYA 3RTQB 5JA9A 4LF3A 4ZSOB 3QEQA 3OBAA 3W9EB 2W0PA 3IDMA 4GBXC 4YX2H 3MRMA 5HPMA 2FCBA 4R97C 4UV4H 3QFJE 3BESR 2W65B 5DMGC 5I1GH 3SE4C 1QYGL 3TJEH 2CDFA 1SEBA 3NZ8B 1BREA 4YHNB 2J12B 4NOFA 3UROR 5J1SC 1AFVH 1V8HA 1PEZA 5KVFH 3U30C 5DJCA 3WCYA 5CCKL 4U1NB 3HC0B 3RJDA 3LKOA 2ZCHH 3BE1L 2K7PA 5DYOA 1JI1A 4M1GL 3FFCE 3PGDA 3QHZH 3MLSL 4JAMA 3BO8A 3MV7D 2D7MA 2AQ3A 1OTUD 2GITB 3ARUA 4DGVL 1AE6L 1FPTH 3RVUD 1D5BA 5ANMA 5CSZA 4QKXB 1YZZA 1BVZA 4U6XB 1DBJH 1UH4A 4UMGA 1QR1A 5C0CA 5KZCB 5MEQB 3LN5B 2P8MB 2EE2A 2APWA 3T0WA 4ZUSA 3GI9L 3P77B 2A1WH 5EO1B 2DQIH 1VADB 4DW2H 3QXWA 3UJJH 4M5YL 5BMFL 3LQZB 3RDTB 4IOSD 3KYMB 4LSPH 3IXAA 4MQSB 4JM2A 5CGYD 3EYUH 3S3SA 4KZDH 5A2JH 1LQSR 2FD6L 3VXUD 2VQUA 1MHCA 2X7LB 4Y4FC 4LSQL 4QHLB 2BDNH 3D5OF 2GEEA 4LCUB 1QSFA 2X4PB 4FFWD 4X4YB 2H1PL 4JDVB 5CBEA 1KN2H 3TN0C 1RZIB 3ARGA 2DM3A 1HSAB 3CSBA 4CRPA 2J3SA 5IW6B 5ESVA 4X6CE 1MQ8A 1R0AL 1YQVL 3VD3A 4OIIL 4EDXA 1HZHH 2NY2D 4YC2B 4P2OC 4LEOA 1FVCA 3ME0A 4OGAC 1CFNA 4XNUH 3D48R 3ES6B 4LPCA 3P9MB 5T1MB 3LY6A 1CZ8H 1RU9L 4S1DC 5I8KH 4YGAB 2QR0A 5DEGA 4C56A 1N7ML 3K2UH 4H20L 2PXYB 1N6VA 4U6VH 4D9LH 1ED3A 1UT9A 4HGMA 1IAIM 1CGXA 2VUOA 3V6ZA 4YIQB 2CDGB 1S7VA 3UPRA 2P5WB 3G5XB 1IQWL 4DGIL 5D1ZA 3VD4A 4BUHA 5DMIH 2W9DH 1FV1B 1KJ2A 4Z0BH 1PY4A 2BNQB 3T2NH 3RA7L 3GO1L 5DK2B 5I8CA 3LH2L 2EYTA 4NHUB 1G84A 3U9UA 5KS9B 4LSRL 3BYTA 1DUYA 1QLFB 1TQCC 1RZ8B 4PY7B 1T89A 2J6EL 3SCMD 4W68A 3KLSA 4P59H 4IRZH 5FYJU 4Y1AB 1U3ZA 3C5ZD 3OJDB 3T4YB 3U7WL 1QVOA 1U3JA 3H9SE 1EHNA 5D7JC 1KPVA 1MCIA 1DBMH 2W07A 2HFTA 5F9OL 4U1HB 5JUEL 1BZ9B 1LP9F 3VD5A 4BZ2L 1ZE3C 1CLOL 3RAJH 4L1DA 4PRNB 2AJ3A 2NY6D 4C4KO 3ULVC 2ED8A 1I9JH 3F7VA 1KIPB 4NWTH 1DQLH 3VFNA 2VN7A 1LO3H 5I71C 2XG4A 2H26B 4PJ5E 4ZODA 1LEKB 1V7NL 3SO3C 4LIQH 2G75B 2FRGP 4K7PY 2CO6B 1KCUL 5DD5H 3O3EA 1MCBA 5FECA 5ERWA 4ZAKA 3F8UB 4PYGA 1OGAB 5TFSH 1MQKH 5IVOA 2GJ6A 4MAUL 2DIBA 3ZMRA 5C0IB 2X9WA 4F7MB 1L6ZA 1MRFL 5D2NB 5C1MB 1IL1B 4I13B 4WTZG 1MFBL 3VXPA 4UDUB 4PJXA 3ULVE 4G80A 1T4KB 5H37H 5A16A 3X3GL 4D0CA 3IAQA 2EDTA 3KHQA 3LS5H 4N90D 4PJDE 3PDGA 2J5LC 3LDBB 1GGCH 4G5ZH 3VFPA 5J56B 1OAXH 1MCHA 2FIRT 4IRJD 2FEDD 4XMKL 4LCCA 5CWSB 3S88H 4XX1E 1P9MA 2VITA 1R24A 1B2WL 4YE4L 2G60L 1FIEA 4XH2A 1IAOA 3G5VA 5FA4A 5DMKA 4OAWB 1AGEA 1YPZE 5F6IB 2E7MA 3AS0A 1CXFA 4GT7A 4FFZL 1WTLA 4JLRB 4R2GC 3KYKL 4FS0A 3KS0J 3WUWG 2HG5B 1T2JA 3DX7B 1OWRM 3QUKB 4XPHH 1GAFL 5EIIB 1YYLH 5FYLH 3UTTB 2VDLH 4GJTB 5K9JH 4YDIH 1S7QB 1D5ZB 3K74B 4MWFA 2IMMA 5DURD 2G9HB 4RDQF 4WEBH 5C70A 1A21A 3Q6GH 4QOKB 2XPGB 3RY4A 2O5ZH 4XMLL 5K9KA 1NQBA 2A74A 4DN4L 4TTDD 1IKNC 3DV4A 3BDBA 5GS0L 3BUYB 2IH3B 5HVHC 1QNZL 1H3GA 2VLRD 3ARBB 3T8XB 2AGJH 4GRLD 1I85C 1NMBH 4AM0A 2XN9E 2BOCB 3BDYH 3QDMD 1T22A 3OPZL 2A6JB 4NYLA 5IR1B 1FVEA 4PJIA 3ROLA 4M1DL 1B4JH 3B83A 5C07D 4MSWA 3AU1A 3B2UC 2OSLB 2YEZA 4KK6D 1CR9L 4PJCB 5I1HL 3BP4A 4O9HH 2VABA 4PV8A 3LHPL 5DMYA 5GRVL 3BH8A 4FQLH 5DD3L 4I18A 5FA3B 4L4VB 2H9GA 2X4UB 3QUZC 4L4TB 4YFLI 3L3KA 4S1QL 4UT6H 1X5IA 3QQ4B 4PP1D 3REVB 5T3ZL 3SQOH 5BRZD 2VR4A 2Y7QA 4P5KB 3C8KA 1GHFH 3DUUB 4UUJA 3ZYIA 4QRSB 4GKSB 5L8JB 4G7VH 5KSBB 4OBSA 1MVUB 3C60B 3CMOL 4QGYA 1WAAF 1TVBB 3H7LA 4MJ2A 4GQ9L 5FUCC 1NBZB 3DVGA 2CR3A 1T1WA 2R0ZH 3QWRD 5T3XD 1RZFH 3R0MA 4XCYA 3RZCC 2XT1B 2F5AH 4M00A 5IHZB 2BVOB 3WO3B 3DXAA 3DROB 4G8EB 2FX9H 2HT3C 2R69L 4FOMA 1UB6A 3PQYD 5C71A 3OKOB 4RWYL 3IKCA 3G04B 4HKJA 5IMOB 3RVWD 3UMTA 3TJHC 3K1KC 1MLBB 2XKNA 1Q9OA 3EFFA 2VZ1A 4P46C 1ADQH 3VWJB 5KBNC 5FUCE 12E8L 5D7LB 3RGHA 4LBEA 4LLWA 3H9ZA 4M7LL 4TUJA 2Q8AL 4MJIA 1ERNA 4F7CB 4DK6A 4JDTH 5DZNA 5KSUB 2K1MA 2M26A 1ZT1B 2VZUA 3FAXA 3WNPA 1K4CA 3B3IB 2WW8A 1BFVL 3NN8A 2EDYA 3JV5A 4NSKA 1IM9B 2FR4B 3MACH 3KPRB 2VTFA 4EN3D 3UBXB 4HXBH 4PJHA 3OR7B 4E42B 4YK4C 1GIGL 2BY0A 1AXTL 3NGBB 4WW2C 3VFTB 4OZFH 5DRXA 3MYJB 1WZ1L 2DQTH 3MYZA 5EB9A 3PDOB 4WCYH 1FFOA 2XZAH 5KAQF 1J1OH 4NNPL 5T5NF 1V3JA 4Y5VA 1CYGA 4WW1B 4P3DB 1MJJB 1YEKL 4EXPX 1U93A 1YNTA 5C0AE 1EJOH 2VAJA 4NDMB 4DQOH 4QHKI 5C0ND 1B6UA 4W4NA 32C2B 5ALCL 2CGRL 4HUWB 1DUZB 4PJ9D 1F58L 3MV8D 3ULVF 2DQUL 5DLMH 4P9MH 4OFYA 4WEUD 4HWNA 1UACH 1FVDA 1EFXA 3TYFA 4Q2ZB 1LK2A 1T0PB 4PJDF 2GKIA 2B39A 1J5OL 1G7QB 4MD0A 2CIIA 5GPRA 5EPMB 4EI5C 3GBNH 3ZZ1A 4C57C 1BVKB 4LL9A 3D39B 1OTTD 1X5FA 4GRWB 3ZSTA 1XF3B 2FECL 1P6FA 1YPZF 2B20A 4Z76B 3AY4A 2QTEA 3O3DB 4ZOBA 5IT2L 1MCWM 1HHIB 4X6FB 4K55A 3B9KA 4LLQB 1EPFA 5I8OL 1NBQA 1NGYA 4QHMA 4N0UA 4LKCA 3MLUH 3CZFA 5E94A 2A0LD 2BCKB 1R3HB 3DSFH 4MD5B 1WCBA 2NTFB 3LEVL 1D9KD 4WI3A 4GW5A 4XBEH 5HD8D 4CW1A 3HZVA 3TNNA 4AL8L 1FNGB 2PTTB 2CRYA 3MUZ1 1N0XH 5HDQL 1V3MA 5TE6L 1HCVA 3UTPE 2VERN 5E6IB 1CK0L 1NDMA 2UZYB 3PWVA 4HW6A 3UO1L 4PY8J 4QRPA 3T77A 1HOCA 1WLHA 3PHQB 4HUVB 4OFIA 5I1LB 1I3RA 1ES0B 3HA0A 2OR8A 4PYHA 4I3RL 1NC4A 5J3HD 1X7QB 2HRPH 2BNRA 3MLTA 5HYFA 5SX4H 5INCB 1T6WA 2JIXA 3QHTC 3NZHH 4XNMB 1MFDL 4HAGA 1D7FA 4JANA 4L9LA 4XCCL 4X83A 1SVZA 3G08B 3VXQA 2UWEE 3O2WH 1J8KA 1D6EB 2X1OA 3G6DL 3EJJX 4KK9C 2VZVA 4XP5H 3IAPA 5CEXA 3V0VA 3GKWL 3BUTA 1P7KB 3VXRA 3RWDB 3WHE0 4DN3H 1AD0B 3KPQB 4I48A 5IF0A 3V7AE 4M5ZH 1I1RA 4PGBB 3IDIA 4FTVB 1IGCL 2IFFL 5DR5H 4MCZB 1DBAL 5SX4I 3FFDA 5JORB 1DBKH 1MEXL 4DKDC 4OV5A 3B5HA 1YY9C 3BKCH 1DFBH 2A6IB 3KPTA 5C0GA 5D8JH 1FQ9C 3ARFB 1JZ7A 3SDXE 2WQ8A 1OT1A 1AKJA 5FDWB 2FBOJ 3SJVD 4KKBD 4Q74A 4JO3H 3G9VA 4L3CB 4JREB 4XVJH 5F88A 4JZOB 1KIRB 4OD3H 1AGBA 1NEZB 4LSDA 3VFMB 2V2WA 1R5VA 4HLZG 3FL7A 4MXQD 1E4WL 2Y5TB 5DHYB 5AWNH 4PRPD 4HXAH 3RVVC 3FQNA 1FG2B 1CD0A 2Z31B 5DK3A 3O4OB 2AK4B 2Z4QB 4M1CC 5E2UL 4IDJH 3SO5A 3GSWA 3BZ4A 1ZHBA 2IQ9L 4EOWL 3FO1A 2WIMA 4DVRL 1A6WL 5I1AA 5IMKB 1INEL 2WAHA 3VH8G 4K3EH 3VGFA 4LPWA 4NHCH 5E56A 2CKBB 4NO3A 4QXTB 3UC0H 3C09C 2ZCLL 4XPBL 2PW1B 5EUOE 4ZO7A 1JPTL 2GSIB 3RWJB 4LSUH 4JCLA 3RVXC 1Q0YH 3MOAH 2HTLC 4GAYB 5D9SA 2XWBB 4PB9L 3L9RA 4MX7B 3CFJB 4KRNA 4BSWB 4U05A 3AS1A 4YDKH 5JLZA 3KWWA 1SJXA 1OB1A 1Z6JT 2E6JA 3TZVD 2RAMA 3F62A 1T83A 2NY3D 3T4AB 4MNQD 5D93B 2Y36H 2MSPA 3ORJA 5E95B 3KPLB 4MS8C 3RGVB 3MBEB 5T5FL 3LKRA 1G7MB 2YA2A 5IP4A 3P4NB 1RK0A 4W6YB 5ACLA 5KSAA 2I60H 3LOWA 4OLZL 4FFVD 4UB0L 3R0NA 1BX2A 3V6OC 1BFTA 5LQBH 3JWDL 3B2VH 3NCEB 3QG6A 4HT1H 1M7DA 2FYYA 1VACB 5EBGA 1HHKA 4Q7DA 1J12A 1OCWL 4JM4L 2N7BA 3BIKB 4HIHB 4YHOL 1EHLL 3GIZL 1N5AB 4O2EA 5KTEL 3U2SB 4B50A 2AJUL 4OGZA 2BVQA 1MH5B 5JIPA 5CJBA 2YSSA 4APQC 2V9TA 2MQ0A 4X7TA 5IWLA 1JWSB 1U92B 4Y16B 1W0WA 3V6OE 5L0QB 1X5KA 1BLNA 1LO0H 1ZXQA 2VL4A 1T7YA 3ARQA 4JFED 4N5ED 25C8H 5ADOH 4LPVA 4LAQL 1UVQB 4FXKA 4MJ5B 3RWFA 1EFQA 3GHBL 2R15A 3I2CH 1FH5L 3FT4A 3FB7B 4V2CB 3WNKA 4GLRI 2WV3A 1KB9K 3Q1SL 4KPHL 1DBBH 4NCDA 5HI3D 1YN6B 1W0YT 4P5MB 5H8DA 4ODXB 1C7SA 3HZYA 1I75A 4ALAL 3V0WL 4UINL 1JPSH 4NQSB 3QIWA 2H6PA 3H9HA 5E8PA 3D9AL 1H0DA 2BNQE 4R8WH 2FIKB 5EBLA 1W8OA 3QFJA 1JNLH 5KS9E 3C8HA 1Y0LA 4H8WH 4M4PA 5F71A 4NIKB 3ET9F 3LS4H 3TEUA 3W5NA 4ZG1A 4K94L 2DWDB 3ROOA 4HS3B 2UWEF 1ZAGA 1CTNA 2FDBP 3SDAD 2J8OA 2JELL 2VLME 3NTCL 4LLUA 3X3FH 4B7LA 4NNXA 4P2RB 3SE8L 1IGYA 3QUYA 5DT1L 1J8HD 5GRVK 4JE4B 2NY4D 1PVHA 1GZPB 1FAIH 1LE9A 4I0PC 3CXDL 2R0WH 3WFCH 3VFSA 4D3CH 5J0BA 4XCNA 4GBXA 3O6FB 5HYJB 2R23B 3VXTB 3QZWB 3OZ9H 2Y6SC 4U2ZA 3SE4A 2VXUH 2DLTA 3IF1B 5KVGL 1RIUL 5FDYA 1IGTA 1U8PB 4JZJC 1YQ2A 4DUWA 2F8OA 4P49A 2H8PB 5SWSB 4LCYA 1WQVT 3VMOA 2LVCA 3SDXF 4M93C 4U2YA 3FZUC 4J7RA 3VFRB 5I2IA 1MOEA 1FYTB 2YPLD 4RDQG 3AB0B 4Z7WA 4JRWA 5FYKU 3DHMA 4TVPL 2ARJB 4NN6B 3HC3H 5C0JB 4Y19E 2DTSA 5B4MD 3HNVL 3WIFA 1PY9A 2D3VA 3ARSA 4HPOL 3H3PL 1DSFL 4JQIH 4D9RE 5FKPA 1BD2B 4ZFFA 1A6AA 2ZZUT 4JFYA 5TE4H 4X7DC 2ZG1A 4X6CA 5CMAB 4YNYB 4UBDC 4EEEA 3MO1B 1QRNE 1KUMA 3L7FB 2AXFA 4DEPC 5DEFA 3FQXB 4FQ2H 3E6HB 3LKQB 4MZ2A 5EC2A 3WLBA 4Q6IB 2ZP0T 2JK5A 2YD3A 3VG0L 1IAIL 4G7YL 4PJAB 1H8NA 1N0LA 1A7PL 1V5JA 2DMBA 3CLFL 4Y4FA 4K2UL 1ZA3B 2E9BA 5EUOF 3BP6B 3HAEA 2F8XC 3SE3C 1KLGA 3T09A 1GGIH 3VA6A 3TN0A 3QWQB 2DI9A 1KJ2H 1F42A 5BJTA 2AXGA 2D0FA 4KMTL 2IGFL 2VR9A 4QLRA 2W60B 4HIXL 5EOQH 4UTBH 2XI9A 1OQOA 3GSVB 4P2OA 4DGYL 5KW9L 1XIWC 3S36H 3I02B 4X6BA 3QO0B 3OR6A 3EO0A 3TPUB 5F3BA 5J1TC 1NH6A 4QOKE 1RJYB 1XFPA 4XC3L 5HI5C 2YR3A 5E24E 1UCBL 1F00I 4KKCD 1A3RL 3H9SA 2V9RA 1LK3L 3EO9H 3EOTL 4RNRB 2GQHA 5D1QD 1KTDA 4IEFB 1U2HA 2E27L 3MV9D 5GHWL 4C4KT 1MCKA 1TZIB 4M6OL 1EGJH 4XXDA 3G5YA 4N8CH 1P4BL 4IM8A 2HFFB 5C09E 3MUHL 2ENSA 4EQ2A 3E1F1 5DJ2A 1JYWA 4OUOA 2NPLX 3OAYK 1RZJH 1S78D 4OZ4A 4WFGE 5I17B 5E7BA 3TNMB 1KCVL 1FORL 2VWEC 1UZ6E 1G9MC 1NAMA 3FQUB 3NAAH 4XNZC 2ZPKH 4PJ5A 5IK3A 5AZ2L 3PWLA 4OFPA 2VDOL 1JHKL 4JFXA 3CU7A 2KQMA 2DQHH 3H42L 5ISZE 1QACA 4G8FB 5D7JA 3HS0A 4FN0A 1CQKA 3TIDA 4JCMA 2CLRB 2R2HA 2B0SH 5EN2B 4PJ8D 5GGTA 4R7DB 3OG6B 3RNKA 4C83A 1LO5B 4PLKC 1NKRA 4ZS7H 4XNQA 3S36X 1SM3H 4MNGE 4RGNC 4PLJD 3EYQD 4ZUWA 2ZUWA 3IFOB 4EXKA 4XRCA 4QHNB 5E9DB 5IB1A 3DGGB 5C9JB 1ZHNB 2VWEE 5EA0L 1BM3L 1C5BL 1TQBC 1NUFA 3V5KA 2F19L 3QSKB 5IB3B 4PJDA 1BGXL 2PYED 3JV6B 4FQ1H 5CGTA 5FB8A 5I1KH 2VDKL 3V4VL 4QRQA 4RQQB 3DLQR 2PYFA 4G8GB 3MROB 5HHOD 3MGTB 1SJVA 1JN6A 3WD5L 1CQYA 2UV3A 5M94B 1AP2B 1G7HA 1ORQB 2DQGH 2BNUB 2EKSB 3REWA 5KAQG 5T5NG 4H25B 1U3YA 3P0YH 4RGNE 4WU5B 5FO9A 2C7UA 3BPCB 3C8DA 2HJKA 1MLCB 1HKFA 3MA9H 4BH7A 5CAYB 2C3WA 3C2AH 5ALBH 3H8NA 3K80A 2NQCA 2VC2L 2VLJE 4IJ3B 2F54B 3FKUS 3IDJB 1II4E 3W0WB 4KJQC 4G6KL 4AIXA 3D0VA 5KS9F 2ICEA 2NMSA 4QT5B 5D71L 2HVJA 3RX7A 1FO0B 5F7KC 5B39A 1JGEA 1QZ1A 2Y5EA 5EUKA 3OKNA 4RGOH 3QEUB 3BEVB 3WDHA 3JBG7 5C0DB 3KPRE 2AEQH 1PLGL 2APTA 2IAND 4X4XA 4XX1G 5IMMB 1L0QA 3ULUC 2R0KH 4LLMB 5GSVB 3O45A 1KELL 3RU8H 3O4LB 4Y2DD 2XN9A 2AQ2A 1VHPA 4JY4B 1DLHA 2IAMC 3L1OL 1KJMA 2V17H 4UOJA 3FRPA 3OJ2C 5DJ8A 3Q6FA 4KDVA 1OP5K 1T2QL 5I30H 1R3JA 2YC1A 1ZV5A 1S7SA 3UTQB 5IESL 1AXIB 5IEHA 2OL3A 3FCTA 4YHZL 3L3JB 1C5CL 1IKNA 4ZDHA 2VZOA 4F7EB 5BS0D 1EEZA 4HMCA 2O61B 3Q3GB 4LGSB 3ULUE 2YUZA 2OJZL 1W8NA 1G7LA 1D5IL 4YHKL 1DEEA 2R1WA 4U3XA 3FO0L 4GOSA 2OK0L 1P53A 2ATPA 3BZDA 4M62H 4U1JB 3WFZA 5F3HB 5FO8A 3TYGL 2DQFB 3N1FC 1U8NA 4M61B 1P7QD 3CSYA 4XTRC 4ODBD 2BZDA 1QSZA 4ZPVA 3PV7A 4Q0XL 4WFHD 3V4UL 1RURH 2WINA 3FRPG 2ZKHL 3DX6B 3QUZA 4ENED 5DD0L 2B1AL 5TE7H 3D39E 4GRWE 3ARDC 3WDJA 2YRLA 1QO3A 3P4OB 5F1OB 4HJ0D 1MCPH 2NXYD 4GS7B 5IW3A 4K8RC 4GFTB 4E41D 1RZKH 3VRIA 4KGJA 2X89D 4U6YB 1MJ8L 1EZVY 3O11B 4FFYH 1R3KA 3OTTA 4HS6A 1BECA 4U7MA 3C08H 4JVWA 3VXOA 5D1XB 1KV3A 4RAVB 4NKDA 5FO7A 1U3HB 1NCTA 3BEWB 4NT6B 1ZEAL 2QLVB 3MFGB 4TULH 1U58A 2GSGA 2Q7YB 3UTSA 5CJOH 3I9GH 1MY7A 3RZCA 5AUMA 3T08A 3D25A 2A77L 3GSXA 4K7PH 1CT8A 1Q1JH 3IS0X 3LN4B 4BQBA 3KPOA 4Z18A 3MRPB 1VPOH 5KJRL 1NCCL 5IROC 5MEPA 5IB5B 2OZ4H 4KC3B 3HI1A 4YDVA 5ICZB 1E4XI 5GJSL 1UXSA 2LFGA 2I07A 4OZFB 2AJVL 1LNUB 3KXFD 4IOIA 4P46A 2WLYA 1QSED 4PRHB 5I1EH 4PLOB 1XF2B 1BFSA 1RFDL 5DA4A 1KNOB 3BT2L 4PJCF 3NMEA 3QIBB 4XVUC 5GRUL 3E8UL 3MNVA 4NQDB 4PRAB 1FL6B 2BVTA 2BXYA 3HE6C 5CJXC 4L1HA 5HXMA 5JZ7C 1QPPA 3FHAA 4WO4C 5C0AA 4K71C 3X11B 1TLKA 1WUNT 4LVHB 1MVFA 4JREC 4YX2L 4R0LB 3UYOD 2OR7A 4UV4L 4WDIA 5JO5B 5I1GL 1QP1A 2E8ZA 4I0KA 4JB9L 4J6RH 4IRSD 4QWWC 5I6XB 4WW2A 4J23A 2GAZA 3LSOA 4K7PX 1AFVL 1KFAL 4N0YH 3T0EC 3QULB 3MLPA 4X0KB 2AABL 4TPRH 5TF1H 2ZCHL 4NUGH 5IW1A 4I0CC 4U7KA 3RIFK 2KZ1B 1RUML 1UWGL 3EDFA 3V5HB 3QNZB 3WEXB 2FBJH 4RMQA 1HXYA 3L5JA 1EHAA 1VEPA 1FPTL 2XIDA 2AKRB 2ICES 2F53B 2NY0B 4V1DD 5DQ9B 2YKLH 1OSZB 1DBJL 3ZKND 1Y18A 4PGJA 1NC2A 5TPWH 5DO2C 3VW3L 1EEQA 4HUUA 4BKLB 2C1OB 2DQIL 3F7YA 3T0EE 4DW2L 1RHHB 2B4CL 2FWOA 2XWJA 2ZCKH 2H41A 4Y4HD 3BRGC 4AYFA 5IB4B 4QRRA 1CFVL 1E6JL 4LSPL 1WSST 3DI3B 3STZB 3EYUL 2EICA 1T0NA 2WBWB 3UJTH 4KZDL 1JPFB 1JE6A 3EJZD 4QHUB 3U4EA 3WL9B 1J9CT 3BAEH 4EI5A 5J13B 3TO4C 2BDNL 4UIKL 4NO0B 3IDYC 4TSAL 1JNHA 3LRHA 3HZMA 1NJ9A 3LD8B 1KN2L 1VENA 1F3JB 4R96B 3GZKA 1A6ZA 3HG1E 3E3QC 1HQRA 3T0VA 1DN0A 4TSCH 3GB7A 1FZMA 1I7UB 3K4DA 2BVPA 5D70H 3QIUD 4KRLB 3EJYD 5H35A 2EDOA 4MXWL 1CLCA 3QCTH 4KZEL 3DMMC 1UZ8B 4JRXD 5I8KL 1AGFB 2YBRA 1A22B 2M2DA 2CQVA 4OB5H 1S7WB 2EDNA 3K2UL 4FG6D 4X7SH 5DUMH 3ULSB 2HT2C 1MHEB 3E2HB 2Z0BA 5KVEH 3OF6A 1T5WA 2VKWA 2NX5B 4KUCF 5JIHA 3DRTA 2CUIA 3E3QE 4XVSH 1N4XL 1DZBA 3FQWB 4WU7A 2DKSA 5DMIL 5HHQB 4Z0BL 3ARTA 1YC7A 4NQEE 5E4IA 4U1MB 3ULUF 3FOLA 1FFPB 3T2NL 4UQ3B 1JPST 2VB5A 1HK6A 3HE7C 2L7JA 4YHYC 4L8CA 5CFHA 4WFFD 1RJLA 4HGWB 2Z92B 5ETUB 2HKHH 1INQB 4P59L 1K8IB 1QOKA 1JJUA 5E8NA 2EKJA 4X98B 1NANI 2QADC 4PTTB 3MREB 3GMPB 4U1IB 1DBML 3EZ8A 5JNYA 3MA7B 1JIBA 2N56A 4GRWF 4P0DA 2V5RA 3QJHB 3O3UN 3BQUD 3FB8B 1W72B 4P5TB 3RP1A 1G7JB 4YPGB 1MCWW 4I9WE 2NW3A 4F15B 3ECBA 1DQLL 1FZKA 5B38A 1LO3L 1SJEB 2YD8A 4IHOA 4LCWB 2Y25A 1PFCA 1GSMA 3MGOA 43CAB 2RIKA 3DSNA 2HYMA 1T1YB 5DD5L 4ZUVB 1MCEA 4EI6B 1IILE 3I6KA 1MQKL 3VXME 3PNWB 3V7AG 3ZTJG 3CX5K 5CGMA 4OIBA 3BMVA 4FA8A 4HBQA 3O8XD 1N6UA 5C0FA 2ICWA 3L5XL 2XQBH 1FDLL 4L8BA 5T1DH 2PW2B 1CICD 3RI5K 3ALPA 7FABH 4EKXA 5EUOA 3O41B 3GUTA 1I1AC 5GGQH 3HI5L 1JWUB 4MNHB 2OI9C 3IFPB 3LS5L 4ORZC 4G5ZL 2DQCH 1OAXL 3JTSA 4GKNA 3WUZA 4OT1L 2K3TA 1SJHA 4LPTA 1UGNA 1RUKH 1YEDA 2DL2A 1QBBA 2NR6C 2NY1D 5L8KB 1AKJD 2R1YA 5DK0A 1R5WA 5HYSB 1ZLWH 3DURA 2FLRT 4ZD3L 2WBJC 1X5JA 4ZFOA 3GBMH 3QP3A 5GGRA 1KCSH 4I77L 3GK8H 3LEYH 5FYJE 4QYOB 3MUJA 4XPHL 1F2QA 1AD9A 2D9CA 1YYLL 1IGJB 3JWOH 4NN6C 2FX7H 5E0QA 4KKLD 3P0GB 5GJTL 5JW5B 2VDLL 5JDSB 1UWEH 1CTOA 3UTOA 5K9JL 1KLUA 4YDIL 1JYVA 5MP6H 2WQRA 3Q6GL 5I75B 1MFEH 1FIGH 1NPUA 1UJ3B 3OB0K 4LQFL 4OZHB 1AC6A 2O5ZL 5J1AB 4KUZL 5EO1A 4EUPA 1GOFA 1LO4L 4AQOA 1TMCB 3KGRA 4H5SA 4Q6YA 5C3LD 5D7KD 3LZFH 3STLB 4UOW1 2BY2A 1NMBL 1F8TH 3BDYL 1QBML 1T20B 2QQKL 5EU4B 5JTWA 3K4ZA 1TTFA 4LCUA 1Q94B 1P1ZA 5DRNA 3U0TA 4JG0H 4Y4KC 2XOTA 4R4NC 1IM3A 1B4JL 1JCKA 3AREC 1SEQL 5CLWA 3V6OA 2QSTA 1NGXA 4JKPH 3PWNB 4FP8L 2V2TA 2QQLH 4FQLL 1INDH 4NZTH 2DB8A 1ZHLB 1K6QL 2FSEA 2ERJB 2WSKA 5C0BA 2PCPB 2YXFA 4UT6L 1XCTB 3O3BA 4JRYA 2K9UA 2N1KA 5HHMB 3NOIA 4ODHH 3SQOL 4PJAE 3TH4T 2KH2B 4ETQA 1I1YB 1AGCA 4FQIH 1GHFL 3BSZH 3PL6B 5EU3B 1T6VN 3BKMH 1MIML 4LF3B 4S0TD 4APQA 3QEQB 2ITCA 3SDDC 1DTUA 4L3ED 3IDMB 3NCCB 4G7VL 5BXFA 4YIQA 3DVNA 3MRMB 2DL9A 2LTQC 5HPMB 4XVTH 5F7YC 2DLHA 4LEXH 4WI5A 2PUQT 1SEBB 1NBVH 1YJDH 2R0ZL 4G6AD 4NHUA 4JY5H 5DJCB 3WXWH 1HYSD 1QLFA 3LKOB 2FX9L 1JK8A 1EAPA 5DYOB 4AEIL 3PGDB 3OWEA 3BO8B 1YDPA 3EDDA 1KB5L 2OXHA 4JPKH 2CDEA 4RRPA 4XPFL 1TJGH 5F7EL 2ENYA 1D5BB 4Z7NE 5ANMB 5CSZB 3ZT6A 1FE8H 4NKMA 4GUPA 1QR1B 5C0CB 2X1PA 1FLRH 2ZUVA 4LOUC 4BK4A 4ZUSB 2APXA 4JDTL 3D3VD 5C8JA 4Y5YC 4ZO8A 3IXAB 2UUDK 1ZLSH 5JPNA 3WXVL 5AZEH 1MHCB 2ESVD 1MF2H 3MACL 4O2FB 1QSFB 2BSSA 5CBEB 3ARGB 5GS0C 3IFNL 4I0PA 4ONOA 4LLDA 5ESVB 3RKDD 1K85A 3PXHA 2DQTL 5F21B 1MUJA 2X4QA 4Y19A 4RRPG 5E9DE 4EDXB 4JFDE 3K0WA 4WCYL 4Z7QE 2XZAL 4LEOB 2EYRA 1J1OL 1FVCB 5IM7A 4P23C 1CFNB 5L7XH 3DRQA 1PEWA 2MNUA 1Z2KA 4JZJA 1QRNA 4C56B 5DEGB 5EO9A 5ELIA 5AYUH 3FFCD 4NZRH 2MWCA 2V5MA 3GM8A 3PWPD 1DVFC 2NY7H 1ED3B 4PIRF 4D0BA 3V6ZB 2VLKD 4FQXC 5DLML 3ZKXB 1S7VB 4LU5H 4P9ML 3UPRB 1M05A 15C8H 1RMFL 5D1ZB 1UACL 2VXSH 2JKXA 2OLDA 2IF7A 2FX8H 1KJ2B 4JLRA 4K9EL 4GQPH 1IBGL 4DUXA 2CJUH 3GI8L 1RVFH 4NQVA 2F54E 4TSBH 3H6JA 5I8CB 3BGAA 2EYTB 3W0WE 3VMPA 3GBNL 1NUNB 1FSKC 4F37F 1UB5A 1DUYB 3IETA 4JR9H 5MENB 1N64H 1QVOB 4QOKA 1KPVB 1J05A 4DAGH 1F13A 5T3ZE 3SE3A 5AYQA 3TA3C 5BVPL 4XNXH 2AJ3B 5C0EB 1ZANH 2XZZA 1EH9A 4J1UA 4O02H 3MLUL 5JOEA 3W9DA 3F7VB 3O4LE 5C09A 4FZEH 4ZO6A 2UY7A 1AO7D 2ZG2A 3C5SA 5HSFA 3SGEI 3VXSE 5F1NA 1CDIA 3MXWL 3K7UA 1Z5LA 3PUCA 1XIWA 1YMMD 3WNNA 3O3EB 5ERWB 4TOYH 4ZAKB 1LEGA 1MY5A 1N0XL 1OM3H 3HLAA 2GJ6B 2QHRH 4ZTPL 5GGTH 4LSVH 3LMJH 2EC8A 1TTGA 2A9MH 5ISZA 4JGJA 1QBAA 1TCRA 1YEGL 2DF3A 5JHDD 3QQ4A 3VXPB 3O2VH 4G9DA 3L6FA 4PJXB 4G80B 3ULVH 1Q9WA 5A16B 5L9DL 4P2QD 4MNGA 4OCWH 3TH2T 4CVWA 5LXGH 4Z78B 4D0CB 1F11A 3MCLL 2VDNH 2O26U 1E28A 3RZWA 1OAQH 3VFPB 5DSCA 3S3JA 1DQJA 3O2WL 4LCCB 3VA2C 3KPSE 4NNYA 1F5WA 2JJWA 1R24B 2VITB 3N50A 2WWMC 4RMWA 4XP5L 1IAOB 3G5VB 2YA0A 3FB5A 5FA4B 4PJAF 5B21A 5DMKB 2JJSC 1AGEB 2VDMH 3F7QA 3CVHB 4DN3L 1EO7A 3RY6C 2PO6B 4M5ZL 4XP4L 4C55A 2P43B 2O5YH 5DR5L 4YHIB 4JPVH 5EORH 3NCFB 4PJ5D 1PG7L 1DFBL 4ERSH 4LAJH 1AH1A 2VLJA 5IMLA 5D8JL 2HFGH 4MWFB 5CBAA 4NC0B 4OCRH 4MA1C 3KYNA 5E99L 2I9TA 3L7EA 4LNRA 4Z77A 1SHMA 5K9KB 5HVGB 2AVGA 2A74B 4XVJL 3WKMH 1QHPA 2ZSWA 1FAKT 2GK0A 4OD3L 3DV4B 5HVFB 4U4BA 1R6VA 4ODSL 3WYRA 2Q3ZA 5FK9A 4N8PA 4GG8A 1T80A 4AH2A 4AM0B 2J2ZA 1T22B 4NYLB 1FVEB 3KNBA 4PJIB 5TQ2H 3ROLB 1NGPH 5D7IE 3KLAA 2EDLA 3CFKB 1SY6A 3N85H 4MSWB 3MYJA 3FQRA 3TIEA 1MFCH 2VABB 3OJVC 3CFEB 4HK3J 4K3EL 4KJPD 4NHCL 2EC9U 4PV8B 2G5RA 1RAMA 4JO2L 3UC0L 1I8MA 3EOYG 4I18B 2H9GB 4X6DE 5ID1A 3L3KB 4OLUL 4LSUL 4F2MA 5IFAH 2XTJC 1FGNL 2GT9A 4XBPA 4M7JL 1Q0YL 3P9WB 3MOAL 4L5FH 5FV1L 2I9LA 2Y7QB 3C8KB 4UUJB 4WV1C 3X13A 4JY6A 4YDKL 1DUZA 4LASL 1PZUB 3TVMC 1A7BA 3QDJA 1S9XA 2DM4A 4Z7QF 2IAMA 1HWHB 4JJ5B 3F58L 4X6EA 1L0YA 1S8DA 3DETC 3UBXG 4Y7MA 1A1MA 3AMKA 4LKXA 3DVGB 2MCPH 1T1WB 4P4KD 4XCYB 5EFIB 2NY5L 4OTXH 4Q9RH 4ZFGL 2XTJE 3DXAB 4CJ0A 3MV7B 4HWUA 1XF4B 5DZOA 1CN4A 2I60L 1UB6B 3MRIA 4P3WA 1WBYA 4LLYA 2F53E 3ZTNH 5LQBL 5HDOA 3EHBD 3ARZA 3O3DA 3IKCB 4HKJB 4JDZA 3B2VL 3EAKA 5GS1C 1Q9OB 4GAFB 3EFFB 4HT1L 3U9PL 2R9HC 2CXGA 1IC4H 5SV3A 1GRWA 4LBEB 4LLWB 1JHLH 1PG7W 1I9IH 4TUJB 3U1SL 4MJIB 2RCSL 2PETA 3NBNA 4E9LA 1KCLA 3WLWD 1K4CB 4QY8A 3NN8B 2APVA 3ARDA 4Z5RA 4NSKB 2PTTA 3MLWH 4KQ3L 4NUJA 2H2SD 4NKQB 2XZQH 3UEZA 1TDQA 4PJHB 1LO0L 2H32A 5LWYH 3WNOA 5ADOL 4LP5A 5DRXB 3L5IA 1LHZA 1WZLA 3I2CL 5I74C 1MCLA 1RUAL 4PRID 3FN9A 2VO5A 4KROB 1FFOB 1NMAH 2E7CA 3T2PA 3PGCA 5B8CC 4Y5VB 4TUKH 3VWKD 1QHOA 3QXAA 1NEUA 1U93B 1YNTB 2D31A 2NX5E 1JGVH 1CXIA 4CAGA 2FJFA 3S4SA 4JPWH 1JPSL 3BXNA 1TENA 5DC9B 5BQ7A 5IROA 5C6PB 4R8WL 5EU6E 5FGCE 5I0ZA 1Y6MR 3P4LA 4U0QB 1FVDB 3QB7C 1EFXB 3TYFB 3LS4L 2FO4A 2KDGA 4MCZA 4MD0B 2CIIB 3DJ9A 4ZPTA 1F6FB 5A43C 4NQCA 2KPNA 3I84A 3TO2A 3QI9C 1EJ6A 1C12A 3F65A 2ADIA 4GAJH 4PJGE 3MJ8A 2WANA 3HE6A 4AEHH 5CJXA 3VFGL 5I16A 3LB6C 3OAUH 5D96B 5DWUH 5FDWA 4KY1H 2R0WL 3WFCL 4LCIH 4WO4A 5F8QC 3CDYA 4KAQH 5D5MB 3B9KB 3CZJA 3O2DA 1TETH 1ULVA 1DLFH 1QG3A 3OZ9L 3S4SG 1NGYB 5JIKA 4QHMB 4N0UB 4LKCB 3CZFB 2Y5TA 5E94B 2OP4H 3HPLA 3TT3H 1IGIH 3VGGA 3JWDC 2OMNA 4NPYA 4YFDB 3T0EA 3RX5A 1DANU 2D0HA 1KBGH 3ILQC 4GW5B 3QUXC 1L7TH 4CW1B 1B90A 3HZVB 3TNNB 1NL0H 3D0LA 1GYAA 2W9EH 2A83A 2BSED 4G42A 3U4BH 4PUBH 1QTYT 3HC3L 4KRMB 1NDMB 3PWVB 5DRWA 4JQIL 4QRPB 1HOCB 1I3RB 3HG1A 5TE4L 1WFOA 5EO0A 5CD5C 3DUSA 3GHEH 3ZKSD 1NC4B 4ODUB 4KVNH 2XA8L 3EYSL 3HRZA 5GRZA 2DYPA 5D7IF 2BNRB 1VESA 5SWZD 3MLTB 3BZFA 1NCBH 4DK3A 2JIXB 1HQ4A 3I50L 1X5XA 2EDDA 4NO5A 4LSSH 3QG7H 4JANB 4L9LB 1EAJA 1T66C 2VQTA 3BPNB 4X6DF 3VXQB 3TO4A 4ONGL 1HIML 4LHUA 5HGHA 2H3NA 4JO4L 4XXCC 3V0VB 3D85A 1JV5A 2XFXA 5EOTA 5IF0B 3VXRB 5EOQL 4I48B 4UTBL 4NQEA 3IDIB 2FB4H 3FFDB 3S36L 5B3NA 1KEMH 4XI5D 1CFTA 4OV5B 1BIIA 5FIEA 3DMMA 3L3HA 4BQ8A 5DC0A 4OZHE 3W2DH 1RSFA 5C0GB 3L3IB 5F1IA 5JMOC 1YY8A 3MRFB 4O4YH 4Q58C 2XXMB 2P5ED 3DX8A 4NJ9H 4UTAH 2IJ0C 3I6GA 3MNZA 4K94C 3TESA 5BV7L 3L5WA 4KKAC 1MCOH 1EGJL 5F88B 4N8CL 1DP0A 2JCCB 1J0IA 2F8VA 5INDA 1AGBB 3BRDA 2DKUA 1WICA 2V2WB 1R5VB 1RZJL 2HWZH 2Z8WC 5GZNC 3B8YA 4WUKH 1LO2H 1U92A 1GGYA 1P5UA 3FQNB 3MCKA 3FMGH 5FYKE 3FO9A 3HE7A 1KCKA 4ZXBD 1S5HA 3TCXA 3GSWB 3NIGE 4KQ4H 3BZ4B 4BFGA 1ZHBB 3FO1B 3SY0A 4OIAA 5I1AB 1PD6A 1U91A 3BN9C 4J8RA 2DMKA 3VJ6A 1I7RA 4YFEA 3VXMA 2MQ3A 4NO3B 4KGLA 2B0SL 3F6IA 2X2YA 5HHXL 4ZS7L 4G9FE 1DQTA 1SM3L 1QUNA 1YEIL 5LCVH 4XMPL 5BRZB 5C08E 1EZVX 4PP2A 5D9SB 3T1FA 3L9RB 4HD9A 2OQJA 1GGTA 1YNKL 4R26H 4OUUA 3WJJC 5JLZB 3KWWB 1XGYL 3C6LD 1OB1B 3WDIA 4FQ1L 3VE0A 3EOAA 2DTMH 5GZOD 1UM4H 5F7MC 2YMXH 1MCDA 1S7UA 5I1KL 4KU1A 4G3YL 1PBYA 1ZVHA 4JFFD 5DD1H 2DQGL 4CVXB 5GXBB 4S1RH 3LKRB 3HTLX 4HS3A 4U1SA 3HMWL 4QTHA 4ZOEA 4CMHB 3LAFA 1RK0B 3C2AL 5KSAB 5ALBL 4U1KA 4TVPE 5DFTA 5F7NC 1I1AA 5ANME 4MAYC 1BX2B 3MRKA 1BWWA 2QSQA 2W9LA 3QG6B 4NN5C 4D9QD 3EFDH 4G6ML 1M7DB 2FYYB 3WHE1 4M8QA 1HHKB 1WF5A 4EUPH 4YEEA 5FHBL 4U1LA 2QJDA 2XNAA 2HMID 5E8EA 3S97C 1ONQA 4O2EB 3OKMA 5TQ0H 3ZDXF 3L5HA 3MGAA 3A6BH 2X9XA 4XPAH 2BVQB 2WBJA 4PJGF 5I76A 3PP3H 2P24A 2YD1A 4CKVX 5I15H 2AEQL 4LARH 3RTQD 2Y72A 1QSFE 2DJSA 2P8PA 2YSSB 4JFHE 4NZUH 5JXEC 2E6QA 4X7TB 1MNUH 3HMXA 5DVMA 1W0WB 1ITCA 4I3GA 4CADA 3DBXA 1BF8A 1BLNB 3AM8C 3GSUA 1GC1H 4KI5D 1H8SA 2HJFB 1X5ZA 3NH7H 4ISVA 4YHLH 3S5LA 3U7YH 4FXKB 1IJ9A 3RWFB 2QBWA 5I30L 1QFUL 2EDBA 3FT4B 3QZWG 1BQLH 4KRPB 3M17A 4KTDH 3TF7C 2J6EA 3E6HA 1EO8H 1TPXC 4P57A 4YJZL 5F7LB 1CLYH 2V5YA 3HZYB 5DJYA 4BFBD 1FFNA 4Y4KA 4YDLB 3QIWB 2H6PB 3H9HB 3O9WC 5E8PB 3AREA 4C54A 5KZCD 5A3IC 1H0DB 4HWBL 3SKOA 1BBDH 5J11B 3ABZA 5EBLB 4KI1A 3QFJB 3HUJE 1KYOJ 1Y0LB 1TNMA 3RDTD 3QXTA 3AXLA 4AEFA 4BFIA 1WIUA 5MENE 3N1QC 3PGFL 2DJ4A 3ROOB 1XGUA 4HJGA 2VAAA 1GVIA 1FNEA 4LMQE 4M6MH 5E4EB 4LLUB 1MCPL 3RFZC 4Q9QL 3QUYB 3CU1A 3CLEH 1EEYA 1F4XL 4F8TA 2AK1H 1RZKL 1LE9B 4HKZA 4FFYL 2NZIA 1IC1A 3SDDA 3VFSB 4XCNB 2VZTA 4MGXA 4GBXB 4R97B 5CJOL 5E08H 2VE6A 3EYOA 1IGTB 1XZ0A 2DBJA 2PTUA 4OZHF 3U30B 1IRAY 4R4BA 4LCYB 3UX9B 1ETZA 3CD4A 1MI5A 5E2WH 2PXYD 1PKQE 1BEYH 1ZT4A 1FG9C