5C08E

1e6 tcr in complex with hla-a0e carrying rqwgpdpaav
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
244
structure length
244
Chain Sequence
b'GVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 244
sequence length 244
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c08E02
4JGJA 2R2BB 3VG0H 2J8UB 1G7LA 3TP4A 4MXQD 5DUPL 1UVQB 4UQ2A 4OUUA 4GAGH 5GS0H 3MO1B 4JDVB 4HAFA 1EEZA 3HI1B 5D7SH 5DDHB 1A2YB 1CLCA 1J7VR 2WM0A 3FT2B 5FEBA 2WAHA 3RVTC 5GGUA 1RJZA 5D2NE 2OYPA 1UCTA 4PLJC 4KTDH 1HE7A 1NCDH 4Q2ZA 4XRCB 4LEXH 4WV1A 4RX4A 4XPBL 2YA0A 2D03L 2XWTB 3QUZC 4H20H 1V7MH 1BM3L 2RCSH 3EOTL 4XP4L 4D2NA 3IDXL 1YJDH 1XCQB 3G08A 4I9WD 4PJXA 1YEJL 3FRUA 2ITDA 3QH3B 4P2RB 2CDEB 3NVQA 4PJAF 5CD3B 3HZKB 5IV2B 4HK3J 3FO2B 3RKDD 1G9EA 3DX9B 1JNLH 4MSWA 2A9MH 4MA7H 3RU8L 3CNKA 5IG7A 4EIGB 4P23B 4FNLH 5B8CB 3BZEA 1BREA 1D6EA 5FHAH 3QQ3A 4LLVB 5F6HJ 5IVXE 1PY4A 5BVPH 3GBNH 1UXSA 3IAQA 4PGCA 1RZFH 4UT9H 2UVEA 1F6FB 1J8HA 1U3YA 3TBYA 1LP9E 1JGEA 5JPMA 2ZCLL 3AC0A 2XI9A 4PP2B 3ZL4L 1AIFB 3VRIB 4YLQT 5HHQB 1JPST 5C71A 5HDLA 3FO1A 2V7NB 3MJ6A 1CXLA 3FQXA 3R1GL 2F58L 1K2DA 4CW1B 4PJXF 3IKKA 1MIEL 3MUZ1 2FH6A 5FYLD 3PNWB 1VGKB 3G5XB 5DD3L 1CE1H 2F54A 1KCVH 4KK8C 4PJGF 3G6JE 3MRKA 4K7FA 1MFNA 1HYSD 2IAMD 1V3MA 2ZUUA 3SCMC 4M1CC 1FZJB 1RZGA 2YBRA 4YEFA 5DMKA 1J11A 4NWUL 2NNAA 2BRQA 1I1FB 3Q1SH 3HN3A 4KI1A 5BJTB 3WFCL 4FQ1H 3UC0L 5I9QB 3TZVB 3ZE0E 5C07D 4JKKA 4LGRB 4XWOD 4ODVH 4Y4HC 5TJWK 3KYMB 5CJQL 4HS3B 4DOHE 1GOGA 5K9KA 3HZYA 5DMGD 4QXTA 1RJCA 3VFMA 1GGUA 5JORA 4PRPE 2EO1A 2X40A 4LPXA 1JWUA 2AXHA 3VFGL 3KDMB 1FV1B 5F7DB 4XP9L 3ARQA 2CRYA 4W68A 2MNUA 2MPAH 5IESH 1D5MB 2AV7A 1PG7H 3STZB 5A16A 3QIUD 5BO1H 5BRZE 3WFEH 5DA4A 1JPFA 3SGDH 2PYFB 4NNXA 5EWIH 4L5FH 1D6VH 2XWJA 3HCVA 4C56A 1RURL 3BP7B 1OTSD 1HHGB 3EDKA 4Y7MA 3HC4H 3AB0B 1A7QH 4BQ6A 4OD1H 4FFWC 2ZSVA 3HMXH 4LSTL 4JR9H 4P3DB 3MR9B 5DUMH 1OHQA 1FNLA 2WMPA 4P5MA 1FFQA 4WV1C 1IGTB 5IB2A 1AHWA 4ZO6A 2Y72A 3H9SE 1N2RA 1JHKH 2R1YA 4PJEB 4M5ZL 4PJAE 2GJ6D 4QCIB 4EUPG 3B9AA 4BFGA 3FZUD 4U6YB 3OXRA 3NCMA 4YX2L 1JNNH 2HH0H 5MEPA 3V7AG 2PO6B 2PW1B 4EIZC 2ZG2A 4HS8H 1B0GA 1XGRB 4LGSB 1ZS8A 1E0OB 1FNHA 1GCFA 1QBML 5B3JF 1R5VB 3SOBL 1MFAL 1DVFB 3G9VA 1NQBA 3F7PC 2FECL 5DTFB 5E9DA 3V6ZB 4O4YH 5CGMA 1LO5A 1S7QA 2P46B 2ZOKB 1YEIH 4PJXE 1GGCL 2HFFA 4OI8A 1FBIH 3CDCA 1RVFH 3ZDZF 3C8DA 3VFVB 3WLWC 4OLEA 4PJGE 5E1HB 1KENH 2Q1EA 4NN6B 3RWEA 3P0YH 2OLDA 4YHPB 4D9LH 4O2EA 5J6GA 5DJXA 1J8HE 2XOTA 3MREA 2C3GA 4YHYB 1JK8B 3DETD 1A6PA 3D3VA 5D2LF 3GJEA 4KJQD 5EA0L 3CMGA 1NGQH 4M6OL 3Q6FA 2F9BT 4UQ3B 4WI4A 3CFKA 3MRDA 4HHAA 4UILL 5D4QA 1S5IL 3V6BR 2UZIH 1JF5A 5E6ID 2AJ3B 1OT2A 4TSBH 4F33B 4YFEA 3DVNB 3G6DH 3KLHD 1NC2B 1XH3B 2C26A 5IB3B 1A3QA 3CSBA 5C0CD 3TYFA 1AXIB 2J7LA 4JZJA 3JSSA 2VQTA 4CVUA 1F58H 1BHGA 5ETUA 5HYQA 2DICA 2PYEB 4QTHA 1AH1A 2OL3L 1W0WA 1IGYB 4ZODA 2AP2A 3BWUC 4K8RH 4Q9QH 3P30H 32C2B 4OCLC 1QEWB 1U93B 1QACA 1G7HB 1FIEA 3L5XH 4TNWF 1FCGA 4G3YH 3QFJD 5F44A 3C6LD 3PIQA 4MZ3A 2R39A 3JV6A 4R26H 2WBJD 5GS0C 4AEIL 4R4ND 4NBZB 1OM3L 4OLYL 2BDNH 3HI5L 2DDQL 4AEFA 4DEPB 3RRQA 4G6MH 1Q9KB 4IHOA 4BZ1L 2J1KA 1BQSA 3TH2T 2F53B 1A6WH 3HMXA 3MJ7A 1FL5B 1QSFB 2Z92B 2HWZH 4JE4B 3IFPB 5C0NC 1F13A 2HVKA 3CUPB 3DSNA 3QXUA 4Z7UB 4O51A 2ADIA 5ALBH 1FO0B 3VFOA 1KCSL 3KPRA 5FECA 1ZGLA 1LD9A 5GZOC 4C56E 4O9HL 2NY2C 4LPCA 3D6GA 1WK0A 3VXMA 1YEKL 3GMQB 3MRMA 5B3JE 3MBED 5LQBH 3WE6A 2YRLA 3MXWH 5JOFB 5GSRA 2COQA 4WTZA 2YPLB 5EU6D 2L0DA 1BZ7A 4GRLD 3CSPA 1NBQA 4JY5H 1MVUB 5F9OL 1AQKL 1MCWW 2NW3A 3KPPA 4PJ5A 3VD4A 4KQ3H 4QKXB 3LB6C 2V9QA 4Y2DD 3DRQB 1I3RA 1OTTC 3D85D 4OZFB 4XBGB 2NZ9C 1U8MA 4RWYL 5A2JH 5EOCJ 1DUZA 3ZDZE 4DAGH 2ZNWA 4HMCA 4WTWA 4PGZA 1EZVY 1RUKH 4KK9D 4MDJA 1KC5L 2VZ1A 3GIZH 1RJLA 4OIBA 2ATPA 1H5BB 1P1ZA 1PYWB 2D0HA 3SKOA 1BVKA 1HEZB 3KS0H 3T3MF 1IMHC 3JV0A 3CFEA 4XVTH 1NCCH 3QCTH 1F97A 1B0RA 3FOMA 5D2LE 4LP4A 5ICXA 3U9PL 5TDNA 5JUEL 1G7JA 1INQB 2G75B 3T8XA 2BSED 1I8KB 1FE8L 3H42L 2VKXA 2Z8WC 1AE6L 5E2WH 5I74C 4FFVC 5IIEA 2KQMA 5LKNA 3MFGB 4KTYA 1TZGL 5EB9A 2VLKD 5LGJB 4LHQB 3RX8A 3SKNA 1S9YB 1F8TL 5JW5A 2VH5L 1X5YA 4OZHB 4WFED 5K93A 1JGLL 2Z91A 3MLVL 2LTQC 1WWWX 5EPMA 4YHZH 1I7TA 4JZJC 1EXUA 5SX4H 3ULUL 1KEGL 3OQ3B 3LHPL 1Q72H 3VW3H 4L9LB 4JZOA 1ZXQA 1G9ML 1KFAL 1T83A 5BMFH 1KIQB 2P43B 5F21B 3TN0A 3MLSH 1UQSA 3MOAL 2DBJA 4L3EB 4L3AA 4QHKI 1ZA6B 3BAEH 3NN8A 4OCXL 1ULVA 4M43L 2XZCL 4MA3B 2EDLA 4YO0A 1UB5A 2XKNB 2EDEA 2A6JB 2OZ4A 2BCKA 3OKDA 4JFDB 3BP4A 3U0TB 1NEZG 3R0NA 5JNYA 2R0WL 1FNGA 3OXSB 4X9FA 8CGTA 3OWEA 2FIRT 3QHTC 4CVZA 1BBJA 3BZDA 5D5MB 3HAEA 2BRRH 1GC1H 3BT2H 3QUXB 2X4OB 5C0RL 1T5XA 3IJYB 1VA9A 2H32B 3OKOB 3MRNA 5DJAB 1CLYH 1WZ1H 1QSVA 5EOCL 3WKMH 4M7KH 3DUUA 5E1AB 3CFCH 3HE7D 4PY7B 3VH8B 1H15A 4RA0C 2RHEA 2RIKA 3KAAA 3TT3L 3L7FA 4LVHB 4PJ8B 1IC4L 3QIBD 1HZHL 5HI4D 4Z7VB 5KANI 4JM2D 4JVUA 3OKNB 3VJ6B 3LKRA 2O5XH 2YZ8A 1URLA 1Q0YL 2R0LH 1GZPB 5E6ZA 4MAYA 3VFUB 2VZTA 1WTGT 4BFIA 1X44A 1I3UA 3L3GA 4AQOA 3BGFB 1M05B 3SDAB 1EGJL 1JPTL 1A6VH 1KJMB 2UYLB 3KPQB 3KPRE 4X0KA 2GT9B 3T3ME 3QDJA 4HIHB 1J1OL 1KCVL 4K3HA 4LOUD 5JW4M 1BFOA 1YMHA 4JO3L 4HWBH 4F7PB 4H8WC 4TOYL 2YN3A 4URTB 1HK6A 4PJ5E 3WS3B 4M5YH 5DVMA 4EI6A 2Z0BA 3ULSA 4BYHA 5DC0A 3FN0H 3HC3H 4CU7A 1AGEB 3T2NH 3QUMA 2QQNL 4UI2A 4CKVX 2WANA 4F2MB 1IAKA 1LK3H 2B1AL 5DA0B 3GK8H 3GSQB 5BXFA 5DD5L 5KTEH 2QADB 5HD8D 4HV8B 1N0XH 1IC1A 5C09E 3R06A 2QQLL 4WI2A 2VABA 2BVYA 2VLJB 3QNYA 3NAAL 2MPAL 3QPXH 5CSBA 3HTLX 5AUMB 4RISH 4IOFC 5ANMA 3IDJB 4OIAA 3TN0C 1B6UA 4S2SB 2R8SL 4IRSD 4L8SA 1TTUA 1UJ3A 2PETA 4JRXB 1FLTX 1JWSA 5EG6C 5INCA 5IMLA 3S36H 2YWYA 1SEQH 4I2XA 4M7ZC 1GYAA 4N0FA 4FFYH 2WIIB 5EZIL 5C0AB 4V2BA 1EX0A 2Q87A 3TBTB 5ID1A 1MI5A 4NQCD 4ODTH 4JR9L 1T03H 1ZLSH 4WNQA 4YAQA 3CXHK 2J88L 1CDGA 1JZ7A 4GG8A 1C5CL 1T7VA 3SDXB 3OPZL 1JYWA 5CP7A 4H88H 1MQKL 4XXCA 3KLAB 1NH6A 5C08A 1U8NA 7FABL 1RZ7H 3EOBA 1MCWM 2YD7A 4PB9H 3FB5A 3ARDB 4JFXA 5SWSB 3BWAA 4BSJA 5DMJB 4G6AC 1QSZA 4K7PH 1CGTA 1IM3A 1KEMH 5IM7A 3GKZA 5D1XA 3OJVC 2EYSA 2VXTH 3U6RB 4M62H 4MAYC 4PBVC 5I19H 2YEZA 1VACB 2OCFD 4OF5A 1C08A 3W81A 2Y5TA 3QZWB 1WQVT 1VFBA 3IDGA 3VXSA 5IEHB 4Z78B 4JFYA 1ITCA 3MLZL 2NY7H 4NZDA 2BZDA 4YGAB 4V1DD 3QXTA 1CK0L 2H2PC 3K1DA 1P5UA 1QBAA 1R24A 3I84A 2Q6WA 4ODWA 1BIIA 1MRCH 3ZKMC 5FUZH 4D9LL 4DTGL 4PIRF 5DVOA 2OTUB 5ESAA 1Y18A 2FR4A 2VDQL 3FQRA 2NY3C 1C5BL 3IJHB 4IOIA 1CTOA 4LSPH 2R0ZH 3EIFA 1ZT7A 2LU3A 4TSAL 1I7ZA 4XNZC 5H2BB 1FQ9C 3AU1B 3HR5B 2BSRB 5C0DA 4PJ9D 2IBBA 2YA2A 5F9WB 5E99H 3WFBL 1FRGL 5HTSA 3SO3B 4NC2B 2VN7A 1RUPL 1XGUA 5IMKB 1PX3A 5IBTL 3WD5H 2PW2A 4KY1L 1XGTA 1Q1JL 2JB6B 3QDJE 1H3GA 4KU1A 4KTEH 5HGDA 3WFHA 3AVEA 1U8HB 2YD8A 3KS0J 1G0DA 5T1LB 2L4OA 5TQ2H 4QRUA 2EYRA 3QG6B 4KH2A 4DKFH 1IEAB 1UZ8A 5JLZA 4HC1L 5E4EC 3D39D 1QD0A 4G80B 3DURB 4QHLB 1CIUA 2AJYH 4L8SC 1FCCA 1T22B 3CU1A 3ILQD 1YN7A 2XQYG 3QCVL 3DMMD 1UJTA 4MCYA 4KRLB 5A2LH 5KN5B 4XXDA 1J88A 1NUGA 5DK2B 3CX5K 3QJFB 5GISL 4G9DA 4QTIL 1MWAB 3VRLF 3S35L 4OI7A 3MRFA 2EH7L 1NGWA 2YWZA 4Y4FB 1FYTB 4ONFL 3WN5A 3UTZB 1I7UB 4QHUA 2P5EB 1AY1L 1BFTA 4O00A 5B39A 2BVEA 3VG9C 4ZDHB 1U3ZA 4TULH 3RPIA 4JLRA 1AD9A 1TMCB 5ICYB 1T7WA 4J1UA 4XXCC 1BWMA 4RMVA 3HS0A 2JIXB 4HQQH 3GI8L 5ANME 1ZEAL 2HWZL 4DZBB 1YEDB 4LEOA 1WFNA 2J4WH 4JFFA 5KANG 4LSUH 1D5BA 5ALBL 1IAIL 4YHML 4I2XE 3UO1L 3C5SB 4UBDD 5HPMB 1TJHL 3STBA 3VXNA 4BSWB 1J8KA 4JY4A 3UTQB 3W0WA 3BOVA 1DE4B 5MEQA 5CHNB 3ARFA 5DGRA 4TVPH 1SBBA 5D1XC 1PEWA 1MI5E 4X5XB 5IQ7L 4W4NA 1JV5A 1R3IL 4AEHH 4WO4C 2EH8L 3MCKA 3BEWB 5F6HI 5C0FA 5IB4A 2DD8H 3IFOA 1SMAA 2R1XA 2G2RA 2E9IA 1A4JB 4KQ3L 4XPHH 5B3NA 1PBYA 3MRHA 3BPOC 5C08E 5T3XH 3NCJL 3LV3B 3O4LA 3NTCL 4YIQA 4G8GD 5ADPL 5F9JB 4HUUA 3AAZA 3CAFA 4HBCH 3GIZL 2I5YH 4K71C 2VZVA 1FNEA 1BD2E 1JGDB 3SJVA 3H0TB 2EDYA 4JGUA 4TRPL 2ZWLT 5C6WH 1KN4H 3BZ4B 3IB4A 4F7TA 3VCLA 1DEDA 1DBKH 1DBAH 3GB7A 4KWUA 2ZUXA 3VA2C 4X6BA 1TFHA 3HG1D 1P4LA 1KJVB 1RIHL 2J8UA 4NBXB 3O6KH 1MFCH 1UVQA 1N3NB 5DMIH 2X41A 2FECI 5IVZB 3MO1A 3T04D 2P42B 1WFOA 3HI1A 2C3HA 4YHIB 2Z8SA 1A2YA 5DDHA 4KK6D 2VMFA 3FT2A 4JPWH 3WNMA 4P5TB 1RZ8B 1EAPB 3FQWB 5MEND 3VXPA 5C9KA 2FHBA 1CQKA 4MXWL 2CGRL 1OP9A 4XRCA 3RWIB 2CJUH 5L88H 3LDBC 1DUYB 3EYOB 2IAMB 2XWTA 4BKLB 1P7KB 5TE6L 4NHUB 1GOFA 5IQ9B 5M7QA 4LNVA 1H8SA 3OJMB 5E8OB 3HZMB 4P59L 1ADQA 3V4VL 1XCQA 4CNIA 3MCLH 5GRVL 3PABB 5HDOA 4P2RA 3QH3A 2CDEA 5CD3A 3VRLE 3B5GA 3HZKA 4G7VH 5IV2A 2XT1B 5JDJA 3FO2A 3GSWB 5C07B 3U4BH 2O26U 3DSFL 3OHXB 4FN0A 3DX9A 1KT2B 3HPJB 2NY0D 3L7EB 2DMKA 4RMRA 4P23A 3WN5C 1ZLVK 5B8CA 4C83B 5CEXB 5EZOL 2DQJH 2E8YA 4OLUL 1LEGB 4P4KD 3RGVC 4LLVA 1UG9A 2I9TB 3E1F1 1GAFH 1CFBA 4DUVA 1NGPL 3BGMB 4PP2A 5HI5C 1AIFA 3KHOA 4CJ0A 3QIWD 5HHQA 4S1SH 1CLYL 2V7NA 2ZSWB 4YPJA 2VDMH 1OAQL 3ORJA 3WO4C 4CW1A 1BQLL 2DIJA 1VPOL 2FGZA 5DRNB 2R1WB 1VGKA 4J6RL 3QEQB 2FX9H 3BISA 4YHOH 3ARFC 5FYJH 2DWDB 4U4BA 3V6OA 1D5IH 1BF8A 3N1QC 1TQCB 3GFUA 3G5ZB 3TGXA 1WCBB 4OB5H 1NCBL 3X11B 1FZJA 1MFBL 5T3ZD 2R0KL 1A6ZB 1YQVH 4PTTB 3O6FB 1SY6A 2C4FU 3NCYS 4OKVB 1I1FA 3TZVA 1UWXH 5L0QB 5FIEA 1L6ZA 5LGHL 3KYMA 3K81A 3B9KD 3I3DA 4HS3A 2C4FT 4LPYA 5DD1L 1P7QB 2D4FA 3U7YL 3W0WE 1DSFL 2WWMD 5CZVL 1K3IA 3NFSL 1MJ7H 1E27B 4QLRA 3CGTA 1FV1A 2PCPB 1LDPH 1F4XL 3DYPA 4NKOB 1QFUH 3LKNB 4PGJA 4KMLB 1V3KA 3STZA 3MODL 4PYGA 1UH4A 1DQLH 5HHNA 1SM3L 4EUPB 2PYFA 3O4LE 4ZS6C 4YFLF 1X5GA 1KELL 1Y0LB 3FHAA 5D70L 2JJTA 1VFUA 2W0PA 3PWPA 3BP7A 5JZ7C 5SV3A 2QBWA 4XWGL 1HHGA 2C5DC 4GQPH 1U8JB 3VWJD 3SJVE 4P3DA 3MR9A 3QDGD 1ZT4B 5FUOH 3ARBA 2Y6SD 1IGTA 2B1HL 5EUKB 4IRZH 1OAXH 3HC0B 2GKIA 2WNGA 2EDKA 2NR6C 2X4QB 3LRSA 3BESR 4QCIA 5DK3A 4J4PA 4U6YA 5KSAB 4Y5XB 2DQHL 2IC2A 1OP3K 1DP0A 2PO6A 5ESQB 1HDMB 4QXUH 1C7SA 2PW1A 4P23C 5B8CC 1KLGA 4POUB 5E6IB 1XGRA 2B7DT 1E4JA 3LEVL 2X1WL 1RFDL 3ARUA 1R5VA 4P9HH 2XZQH 1DVFA 2X2YA 1SJEB 1XF2B 5HY9A 3CH8A 5DTFA 3V6ZA 3F7RA 2IFGA 1K3ZA 3F58H 4TVSa 4Q7DA 4MJ4A 4PJEF 4M3KB 4ETQB 4P2RE 4DK6A 1U8IB 4NO3B 4YDVB 4MQ7B 2X05A 3HPLB 5T1MB 2AJXL 3QFJB 3VFVA 3C6LB 1O7SA 3V6OC 4PP1D 3FOLB 2NCMA 3EJZC 4HUNB 1MCSA 4YHPA 1VDGA 5A3ID 5T5FL 3UJIH 1ED3A 1A64A 4EDXA 2N1KA 3VXUD 5I19L 1K6QH 1JK8A 2AS5M 2GY7B 5FDYA 4LMQE 4NJAH 4OBSA 3OR7B 5ECJE 1JWMB 3TZVC 1YYML 5I9QC 4UQ3A 1NJ9B 2O93L 3RIAF 1OOAA 1ZLWH 4F9LA 3TCLB 1J0ZA 1WIOA 4XAKE 5F8QC 4LKCB 4YHLL 3JWDL 1UACH 3UYPA 5J56B 2AJ3A 4F33A 3IFLL 3WHE1 3P4LA 3DVNA 3P11H 1ZVSB 1NC2A 4K2UH 2VAJA 5IB3A 5TGBB 1MJ8H 3G6AB 4D3CL 2VERN 1O5DT 3V6OE 1QLFB 2K3TA 3MBEB 4Q74A 1F11B 5AYUL 1SQ2N 2PYEA 3CVHB 3GHBH 1GGBH 3ZYIA 1JF1B 1IGYA 4GRLB 3OR6B 5BQ7B 32C2A 4KKCC 1XGYL 2QSVA 5DJZB 5DT1H 4KZDH 1U93A 2GSIB 4YHNA 3THMH 1MCJA 1G7HA 1JIBA 3D0LB 3WFZA 3D85B 2JJTC 3U0PB 4K3JL 4GKOA 2YXMA 2YPKB 3AB0C 3N85L 4OGXH 3CZJA 5L7XH 2H32H 4GS7B 4X80H 5FYKD 1KYOK 5EH1A 1KIRB 3K80A 3ZKQD 1Q9KA 4YBQC 5HI3D 1FH5H 1INDL 4OM1H 2F53A 1JVKA 1FL5A 1NAML 1QSFA 2Z92A 4KK5C 3IFPA 4J4PC 3UXFA 3H9YA 4WI9A 3CUPA 1JGVH 5KVEH 3EO0A 4F58L 1FO0A 3PXHA 2PO6C 4F57H 2A77L 4X6CB 1I1RA 2J3SA 2D9CA 2VLKB 2X89A 1QA9B 3MXVL 2EKSB 3GMQA 3AY4A 3I2CH 2J6EL 4HAGA 1QYGH 5C6TL 4KKBC 5IJKA 1DVFC 2YOCA 2YPLA 1RV6X 1K4DB 4R96A 3ABZA 4X7EC 4KFZC 3L6FB 1MVUA 1I9IL 2VSCA 2ZUWA 4U1KB 1YNKL 4I77L 4PJEE 1N4XL 3DRQA 1KCLA 4XBGA 4OZFA 2DL2A 5E5MB 3CCHB 4UU9B 1YEGH 3IRPX 2CPCA 3TPKA 4M6AA 4GLRH 4JN1H 1CTNA 4NM8H 4Z7UF 1U91A 1C1EL 4NN6C 1BOYA 4JRYD 5KVDH 1H5BA 4MNGA 3SE4A 2JJWA 4U6VL 2H1PH 1RULL 4HBQA 4LLMA 1PQZB 4MNQD 4YHYC 4PUBH 3AS1A 3BQUD 4HK0B 3RY4A 5L2JB 3DRTB 2FHCA 3O9WD 5JTWA 4XPHL 1INQA 2A9NL 2G75A 1WBXB 1OWWA 1I8KA 5DRZB 1I1AD 3N50A 4F9LC 4J3SA 4XPGH 3DIFB 3WNNA 1CFVL 3GSNH 5LGJA 1S9YA 5D72H 2C1OA 4JANB 1EVUA 1Y6NR 1CZ8L 1ZVYA 4OZHA 4U2ZA 3HE7B 4EKXA 4NO5B 2NY5C 3C5ZD 4NJ9L 2ICWJ 2OR8A 3QIBB 1NEZB 4JM2B 3U1SH 1KXQE 3NIGF 5DQJA 5I18L 1MVFA 5DC9B 2WWKO 4L9LA 5IUSA 1CD1B 4Z18A 5D7KE 1T4KB 1CGXA 3JWOH 2BJML 5FYJE 1KIQA 4ZOBA 4PTUB 4J8RB 3T4AB 2IBZY 3RBGA 4IRJD 4PJDB 1PLGH 4L3EA 5HYEA 1ZA6A 1W72B 1F3DH 1VFAB 2CUIA 2JB5L 4RMUA 3HA0A 2CQVA 4KKAC 3SGEH 4MA3A 5DD0H 3WO3B 3D2UB 3MLTB 4M6MH 2XKNA 2A6JA 3B5TA 4JFDA 4K94H 4OZHF 3U0TA 4P2QA 2HRLA 4M4PA 5EOQL 4DEPC 4NKIH 5ALCL 3OXSA 2PYEE 1YY9D 2BVOA 3KPLB 5D5MA 2AV1B 2X4OA 3F8UB 3QUXA 4F80A 3IJYA 4L4VD 1CI5A 5HHME 3EW3B 2BVQB 3RVWD 3UTTB 4G7VL 2R4RH 3CU7A 5E1AA 5DJCB 2AXJA 3BHBB 4PY7A 3VH8A 4KUCF 3O45B 1PD6A 4PJ8A 4AIZB 3AY4C 2W07A 4KJYB 3VJ6A 3OKNA 5FGRA 4JHAH 5IJKC 4HXBH 2X1PA 2RFXB 5TDOB 1CFNB 3T0WA 4JFPB 1A4KB 1GZPA 2AJZB 3PGDB 5GRUL 4HH9B 4HULB 3VFUA 4PG9A 2VL5B 5GS2H 2JJUA 3I02B 3EUUA 3HI6H 3IFNH 3OB0K 4P9HC 3BVNB 4S1SL 1QSFE 1ETZB 1I8LA 5D5MF 1CYGA 1M05A 4PJFB 4X98A 3SDAA 4Z7UE 1KJMA 2UYLA 3KPQA 5HYSG 3DO7B 1I9JH 2QKIB 4A2MA 15C8L 2AK4D 4XP1H 5DMYA 4MVBD 2GT9A 1H5BC 3RVUC 3SDDB 3SE4C 4I0KA 1OSPL 3CXDL 4HIHA 4XCCL 3VXQB 1AC0A 3ULUD 4PJHB 4QRTB 3WDHA 4Z7VF 2DLFH 1CBVL 4HWNA 2YPLE 5C6PB 4F7PA 1HI6B 4X6DA 2D7OA 1OARL 4FQPA 4W81A 4L4TD 4LRNH 4MA8L 3WS3A 3RZCB 1X5ZA 4ODBD 4N0YL 3WIHA 4OCRH 4ENEC 3SDYH 4KGLA 2P5WA 3ARRA 1MPAH 4PV9B 5GRYA 1MREH 1AGEA 4XP6L 1NBVH 4HJJL 5EIQA 3UTSA 1L7IL 3IF1B 4GMTH 1F6LL 4XBEH 1IAII 4JKPH 3NIGE 3BPNB 4HXAH 2ED7A 3GHEL 1MJ7L 3S97C 3WIIH 4HV8A 4L9LC 3M1BB 5CLWA 2ZPKL 4RGMB 2VLJA 3KJ4B 5MERB 1T2XA 5FA3B 5CILL 3UDWA 5AUMA 1F3RB 5D8JL 1MWAH 3IDJA 3Q6GL 3VA6A 5B4MD 1WJ3A 2X44D 4HG4K 5FAAA 4JRXA 1YNLH 2E9BA 4OQTH 5T1KD 1DBJL 2AJVH 2UY6A 3TM6A 4OD3H 2D2OA 4POZD 5SX5H 2WIIA 4OZHE 1RY7B 1CWVA 2BMKB 3CSYB 4V1DB 5C0AA 4DCQB 1TJGL 3U4AA 5JHDA 3TBTA 4NGHL 5F3BB 5HVHB 4YXHL 4XT1C 4KJWD 1AC6A 1MHHB 4P2OD 1CFSB 1OAKL 4X7SH 2V5MA 3H3PL 1F4WL 1E6OL 3SDXA 5HYFA 2AK1H 3QUXC 3FFDB 5DZOA 2VISB 5SWQB 4JCMA 5I30H 4HWUA 2QHRL 4LCYB 4L3EE 1S9KC 4PJ9B 1MAKA 3ARDA 4E5XB 1A22B 1H3XA 1FC2D 4LVHC 3RL1B 2A6IB 4PJ8C 5SWSA 4ZNEA 3OF6A 4OLZH 4TTDD 1WCQA 2ICES 4JFDE 3OAUL 3I75A 4X8JB 3MNZB 5EIIB 3MBXL 3PWUA 3UBXI 4LVOB 2XA8H 3GIVB 1JZ2A 3CPLB 3IAGC 1VACA 5CINH 1NCUA 2VLME 1QO3B 5D5ME 4HFUH 5CBAB 3D39B 4A6YB 3SDXF 4Z78A 4XPTH 3BGFC 3SDAC 3O6LL 1GGTA 4D0CB 3DI3B 3VMNA 2YK1H 3S34H 1CDIA 3DMMB 3DX7B 1IAIM 3FO9B 4MMXC 2OR9H 1AXTH 1Q38A 2VC2L 4Z7VE 2DIBA 4B50A 3LSOA 3K2UH 2OTUA 5IFAH 3MV01 3IXTB 1CE6B 4UT7L 3OJDB 3IJHA 2NMSA 4D9RE 5DQDL 3FT4B 3VI3F 4KI5D 1K4CB 1BQHB 1XIWD 4XVJH 5H2BA 2APWA 3AU1A 3HR5A 2BSRA 3IDMB 5IROA 5FYLH 1TIUA 5M94B 2I07B 4Z0XB 4XVSL 1GIGL 2Y7QB 1G7MB 2EEBA 1T20A 4YE4L 3OZ9H 3P11L 5IMKA 3ZDXF 2JB6A 1BJMA 3RTQD 1U8HA 1EEYB 2QADC 5IGXH 4Z7QF 1RZKL 5T1LA 3TYGH 1HINL 3QG6A 4FQLL 3GHBL 1IKNA 5IOPB 1FG2B 4U3HA 2HKHH 4DGIH 4G80A 4QHLA 1BJ1H 4ZOCA 4EOWL 4AEEA 3ULVH 1N26A 3QA3B 5KN5A 2P49B 5DK2A 1QRND 4DKAA 4D9QE 3WV0A 4Y1AD 3DXAD 3GNML 3QJFA 4JHBA 4NZTH 4G7YL 4G8GB 4YDLB 4OM0L 3WJLA 1EMTH 3HRZB 3NCYP 1X5AA 4Y4FA 1FYTA 2IGFL 5L7XL 3UTZA 4OQTA 1I7UA 4NQDD 5I0ZA 1QNZH 5C0GB 3C87A 2P5EA 1I85A 4CMHB 1NUFA 1YECH 4K94C 1B4RA 5ICYA 2VLJE 2JIXA 3X3GH 4DZBA 2FBOJ 4PLOB 1W0YT 2HN7A 4JRXE 2L7UA 3ARDC 4DKDC 4F57L 5DD6B 4HKBB 4R97B 3TIEB 4DN4H 4YJZL 4YDIH 3C5SA 4BSWA 1I9EA 5C0AE 4G8EB 3UTQA 1XEDA 1S7UB 1DE4A 1EFQA 2YS4A 3L1OL 2YD6A 3P73B 3A6BH 3GRWH 5MENB 3OKKB 4NDMB 4X5XA 4FG6D 4LCUB 1KJ2H 1ZHBB 5GGTH 1P2CB 3PHQB 4K23H 2CRZA 4OUOA 2NQCA 2HKFH 2HMIC 2ITCB 3SDXE 3S3SA 1A4JA 4P9MH 5T33L 1UXWB 3KPMB 3CVIH 4M61B 3S5LG 4YZFF 3LV3A 2BVPB 3B4NA 3P4MB 1NGZA 4YXKH 5F9JA 1AXSB 1S78D 4LHUG 1HQ4B 5SWSE 4ZNEE 4M7JL 2NY0B 3I6KB 4NSKB 1JGDA 5D7LD 3H0TA 1AO7A 5FB8B 4XAWH 3BZ4A 4P4KB 3LEYH 5JO5B 3ZKNC 3H6JA 5E2JA 1X5KA 3VI3E 2V7HB 5F96L 1KJVA 3RX7A 4NOFA 1P84K 3H2WA 2VDPL 5IROC 1HIML 3QIWB 4X7DC 1RMFL 5F9WC 2XY1A 1RUAH 5IVZA 1KG0B 4K3DL 3SO3C 5TDPB 4FTVB 3QCUH 2UZYB 5D72L 4LHUD 4YHIA 3ZDXE 2BY1A 3V5KB 4MB3A 4MS8C 4P5TA 5BV7B 1RZ8A 4Z7QE 1EAPA 3FQWA 3N06B 1KN2L 2X42A 1AQDB 1ZLUH 1QBLL 2P48B 3U1SL 5ILTH 3F7VB 4L1HA 3RWIA 1UB6B 3VD5A 2W9EH 5HHXL 4JG0L 2BSSB 1IKNC 4G9FD 4JO2H 1DUYA 1NUNB 3FN3A 3EYOA 2IAMA 5FUCC 4BKLA 3JWOL 5CEZH 2V5TA 5E8OA 3HZMA 2CK2A 4JFQB 4CN1A 4HWEH 3WKNA 2EE9A 3PABA 3KYKL 2AJSL 2X4RB 2W0KA 3GSWA 5C07A 1EO8H 1RU9L 2J2ZA 1JNJA 4MNHB 4AIOA 4GMSH 3B9KB 4HCRH 3HPJA 2DQDL 3WJLC 3L7EA 2QHLA 4M6ML 4Y4FC 4TQEH 4C83A 5CEXA 2BSTB 3NMEA 1LEGA 1ZE3C 1VENA 5F7UA 1QLRB 1JPSH 3V5HB 1I85C 1BZ9B 4GW5B 3UPCA 4NWTH 1OAUL 3T77B 3BGMA 5FUCE 2DWEB 3FAWA 3BH9B 3P4NB 1MNUL 2EYTB 2ZSWA 4MXQC 1FLRL 5C8JB 3V7MA 1P9MA 1F2QA 4FQIH 5DRNA 2R1WA 3QEQA 2H26B 2CKNA 2GK2A 3EFFB 2DWDA 2EXYD 3NACL 1FYTE 4JHWL 2X4PB 1MRFL 2R23A 1ZHKB 2MHAB 1WCBA 4H0IA 4XHJD 1WICA 4HKXB 4EI5D 1F6AB 4JPKL 1HKLH 3MV9D 3G9AB 2QSTA 1WEJH 1A6ZA 3QWQB 4MQTB 4PTTA 4Q0XL 3O6FA 2DYPB 4YZFE 1PKOA 1N5YL 3FQUB 3QRGH 3GRWA 4NUGH 3D5OF 4XMPH 4H8WL 5GGTA 3BDYL 1AI1L 3QAZB 4EDWL 1YQ2A 5EC1B 3DJ9A 1J1PH 3QHZH 4R2GD 4XP1L 4JO4L 3RKDC 1P7QA 5AZEL 5DRXA 3WS6A 4BZ2H 4G42B 1J5OL 1IBGL 1E27A 2PCPA 3W11D 4ERSL 4NKOA 1QTYT 2D31B 2DQIL 3LKNA 3UYRH 5EZJB 1NCAL 2F5BH 2ZUQB 5CFHA 4EVNA 2Y36L 1E28B 2KKQA 5HGBB 1EPFA 5HDQH 2GAZA 4EUPA 2IF7A 5I1JL 1N6UA 3HFML 2O5ZH 1MREL 4I9WE 1Y0LA 4JKMA 1YEHH 4ZYKA 2NY1D 1JPGB 4P5TC 3NGBB 5CIPB 1HSAB 3OAYH 4M1GL 3PV6B 4KHXL 3SE9L 1U8JA 3HNSH 4NPYB 2JLLA 1A0QH 2OZ4L 1ZT4A 3PP3K 4B5EA 2XTJD 1HYSC 5EUKA 4ORGB 1WBYB 5GRJL 2IAMC 5FCSH 3E2HB 4UOW0 3QQNA 3VXUB 3BP5B 4RFEB 3HC0A 2GSGA 5H37H 5TFSH 3R0MA 2BY2A 2NX5D 2HVJB 2X4QA 2KDGA 1QP1A 3MOBH 4ZXBD 1MFEH 3W5MA 5KSAA 3F6LA 4Y5XA 2AI0L 3BKJL 3BP6B 1LQSR 4I8DA 2VQ1B 3LKQB 4XWOC 5KVFL 1HDMA 2EEDA 5T1DH 1LP9B 4WFFD 1IFHL 1F2XK 4MZ2A 5E6IA 3NA4A 4P57B 5FYLE 3UZQA 2VDKH 5DMGC 4RCAA 3AUVA 1KSRA 4KJPC 4FFZH 2M8XA 1CCZA 4H1LB 1SJEA 1XF2A 5IB5B 4NZJA 3EGSB 4LPWA 4JFED 3ARGB 3GMPB 1EHNA 5D71L 2BNRD 3DOSA 3DX8B 2ADGB 1E4XL 3QEUB 5EN2B 1NCWH 1MCPH 1P53A 1P9MC 3CFBB 1U8IA 3PL6D 3P4OA 4YDVA 1DQMH 4YXLL 4MQ7A 2WUBL 5C07E 3HPLA 3BE1L 4IDJL 3QFJA 1U8KB 2VQUA 5DRWB 1OTSC 5A40E 4Y89A 3QEGL 1DN2A 3FOLA 3UYOD 1YNTB 3RFZC 1TQCC 5J7CC 3C6SB 4R7NA 5DEGB 1I8IB 3O6FC 2EZ0D 3CXHJ 4J2XA 4QY8B 4HFUL 1JWMA 5L0QC 1NJ9A 4DGYL 2EDNA 5GGQL 1ES0B 3RBSA 3FZUC 4LKCA 1CVRA 3Q48A 3OAZK 4OLXL 2HFEB 4XMKH 1OPGH 3V0WH 1ZVSA 1BBDH 3WS6C 3QEQE 5TGBA 3E3QE 3G6AA 3QUML 1QLFA 2FJHB 3VRJA 3MBEA 1HXYB 1F11A 3EFDH 2FLRT 2CSPA 2DI8A 3CVHA 4KMTH 2YZ1A 4XX1E 1JGUL 3JTSB 1W72H 3STLB 1FAIH 2VE6B 1JF1A 4MX7B 4G8IB 4GRLA 3VI4F 4AMKL 3OR6A 4U1IB 5BQ7A 5DJZA 1R3KB 2GSIA 4UDTB 5DJYB 5FXCH 1DEEB 3D0LA 5L6YH 3D85A 2X4SB 3U0PA 2ZCKH 3ESUF 3RUGB 5EORL 2DLHA 3OZ9L 2YPKA 3H9SB 1IC7L 3BKMH 3FL7A 1N6VA 1NDMB 2QQQA 5I75B 1ZHLA 4JRYB 1JP5A 2DN7A 2KL6A 1KIRA 4MNQB 3K4DA 3AM8A 2OL3B 2CO7B 3IGAA 1PSKH 4OFPA 3K8LA 3O9WB 5LJYH 4P4RB 1TETH 2VDRH 3ULVL 3VMPA 5KSAC 4Y5XC 3BN9D 1JJUA 1RJYB 1HHKB 3MRCA 4XNUH 5E8NB 4GKZB 4HX1B 2FO4B 4APQB 3BEVB 4X6CA 2VLKA 3P0VL 3V7AE 5E6IC 3E0GA 1QA9A 2EKSA 3KLHC 2V6HA 3C5ZB 2BP3A 2AERT 1KACB 2JJVA 5FF6A 3I50L 4HPOH 3TO4D 4UT6H 4BSVB 1BEYL 2IBGA 3L6FA 1MF2L 3BKCH 2CLZB 4U1KA 2F5AL 2ORBL 1WGOA 2OS7A 4FQJL 3S35X 1LMKA 3NZHH 3GI9H 1PDKA 3CCHA 3UZEA 2EDWA 4OGZA 4IRJB 3NABH 4KKNA 2VAAB 3C6LC 3ARXA 1U36A 2P8LB 4ACPA 1R5IA 3CX5J 1IAOB 1A1NB 4X6CF 3E6FB 5HYJD 3SY0B 3GGWA 1CR9H 3KJ6H 1QG3A 1PQZA 3MGOB 4K23L 1YEFL 4HK0A 5L2JA 3DRTA 1WZKA 1WBXA 5DRZA 1HH9B 3TC9A 3V52L 4L4VB 3AFLA 2RBLA 2JELL 1UM4L 1NFDA 3DIFA 4M1DL 3QYCA 2ZCHL 1OLLA 3WUWG 2X70B 1WC7B 4JANA 5I73B 4NO5A 3QFJE 4OD2B 3OX8B 3DVIA 3MBEC 2OTWA 3QIBA 1DBMH 2WIMA 1NEZA 1RZJC 4OGAD 1X4ZA 3QQ9C 3LAFA 3LEYL 3V4UH 3VI4E 5D1ZD 3KPNB 1CD1A 4OTXL 4GRLC 2N4IA 1OAZL 4GXVL 4L8DB 1Z6JT 4J8RA 4ZQKB 3QJHB 3T4AA 4QRQB 2IQAA 4PJDA 3MNVB 4HMEA 1JZ4A 4RRPG 4P0DA 3V0VA 1W72A 1VFAA 1VGEH 4R7DB 4NQTA 3D2UA 2W1NA 2OP4L 5ADOL 3MLTA 3TVMD 3ECBB 3BSZL 4RBPH 1J1XL 1B2WH 4JQIH 4GRMA 1HCFX 4KPHL 4KVNL 2MOVA 4GS7C 3W9DB 1Q9LB 1I9RL 3AM8C 4YPGB 2XN9D 4JM2F 3MJ9A 3KPLA 5CEZL 1P4IH 3PWLB 4DN3H 3TA3B 2AV1A 4B53A 1XR8A 4M8VA 2ZJSL 4PBXA 4F8QA 3OB8A 4TSCH 4X5LA 3QI9D 3RWJB 2UZXB 3UTTA 5ACMA 2I60L 5E03A 2DQTL 4GOSA 5CUSH 2WW8A 5DJCA 3BHBA 2VXSH 5HYSB 2XYCA 3O45A 1UM5H 1BMGA 2YD5A 4HCRL 4UTAH 3QQ4A 4KJYA 3VWKD 4U33A 4ZFFB 4PR5B 4AJ0A 1A1MB 3EJJX 4OF0A 1EO5A 4CDHA 4A6YH 1AJ7H 3GKWL 4L8CB 4HEME 5FKPA 4JFPA 1A4KA 2ADFH 2CLRB 1XGPB 2AJZA 3PGDA 4HH9A 2NW2B 2IH3B 2VL5A 3I02A 3BIBX 4X99B 5D93B 2CLVB 1DLFL 1MAML 3BVNA 1BECA 1XZ0B 4JGMA 1ETZA 3TJEL 5FOBB 4PJFA 1SBSL 4MJIB 1GPOH 5EBMB 4FQIL 1AKJD 1NLDL 3DO7A 3O0RH 2QKIA 4X6CE 5T1KB 2P44B 4Y88A 2VLKE 1NBYB 2Q8AH 3SDDA 4S1QL 4WFEE 2VXUH 3VXQA 4QXGL 3RPKA 4PJHA 4I13B 4QRTA 3RVTD 2YPVH 2BFVH 3M8OL 5M95B 1HI6A 4P2OB 3BFOA 3ARED 2P4AB 3RZCA 4I4WB 3TJHD 2VYRE 2FX8L 1QUNA 4NQVB 1U3HB 4DW2L 1K85A 2M2DA 1QPPA 1CXHA 4PV9A 3W2DL 4OCWH 2OJZH 4Z8FL 3HE7C 2V9RA 4PJFF 3IF1A 4WY7L 1B4JH 1DBBL 3QIBC 5DK0A 2HRPL 4FXKB 4QOKA 4JM2C 4K3EL 5F88B 1LE5B 1Q94B 5GHWL 1ZWIB 2YR3A 3M17B 3QEHB 4OCSL 1JL8A 4PJHF 4BQBA 5MERA 5FA3A 3MQIA 5I1CL 4UV4L 3RHWK 5I8CB 1T04B 3LMJL 3CLEH 3ZTJH 3LIZL 1ADQL 2CKBH 4ZPVB 5CD5C 1H8NA 2CD0A 4U1JB 8FABB 1H8OA 2BMKA 4V1DA 3FB6A 1QQDB 3PUCA 4DCQA 5CJBA 5ELIA 1CF8H 1QHPA 2AVGA 4GLRI 6FABH 4LARH 4QO1A 1KB9K 4PRPD 5F3BA 2G5RA 2B4CC 2F74B 3DX6B 25C8L 4KK8D 4R90L 1MHHA 1CFSA 1FORL 1CXEA 3RZWA 4ZFGH 1EFXB 3BRDA 3PXJA 4G5ZL 3LPGA 3FFDA 5TFSL 1DTUA 2VISA 3PWNB 5SWQA 1JI1A 1IQWL 5BRZD 1KCUH 4LFHG 4WW2B 1XIWB 1NLBL 2V2TB 3C09B 4RFNB 4XC3H 3TWCL 4E5XA 5C2BH 4Y4HD 1IGCH 3U7AA 4G6JH 4HDIB 1YDPB 2FYYB 3WSQH 1IL1B 1ZHNB 4U6XA 1MHCB 2VDKL 3B43A 4X8JA 3G04B 3MNZA 5EIIA 4GG6B 1ZANH 3RTQB 4PY8J 2HJFB 5GJTL 1YYLL 3GIVA 4NO2B 5HD8C 3CPLA 4GW1A 1JRHL 5DEFB 1N6QL 1MEXH 1MCNA 1DQDH 1QO3A 3FN9A 4LFHD 1KJ3H 3NCFB 4QRRD 5CBAA 2CK0L 3D39A 4CN6A 2G60H 2XY2A 4D0CA 2O5YL 3U48A 4HF5L 1N7MH 1MCPL 3UTTE 3FO9A 1DQML 1TZIB 2DQGH 3MYJA 1QRNB 3R8QA 1CLOH 4E0RB 4Y1AB 3DXAB 2R69L 4PS4H 3SDDC 4LPVA 1GGIH 4MA1B 5IHZB 5ITBH 3MRQB 5KW9L 5BCAA 2Y06H 1KCRL 1Q0XL 2B8OT 4N9OB 3IXTA 4LSRL 1CE6A 4NQDB 5D1QD 2NY6C 4H26B 1LO4L 3OJDA 3DUSB 4RX4D 4BZYA 3RZCC 1LHZA 3FT4A 3MROB 1MOEA 1K4CA 5BV7H 2H8PA 3LS5H 2AEWA 4YGVB 4K7PX 2ATKB 2I07A 4Z0XA 4PJFE 1KNOB 4NQSB 5I1IH 2Y7QA 1G7MA 4NZRH 2Y07H 4M93B 5ERWB 3V0WL 4OIIH 3DYOA 2SEBB 3QG7H 3BPNC 2Z93B 1IC5H 5T3ZH 5C0EB 4PJHE 4GRWH 5DUPH 3ES6B 4RGMC 4FP8L 1J8HD 3KJ4C 4KMTL 3MUY1 5IOPA 1RIVH 1FG2A 2FJGB 1HXMB 4UUJB 4OFDA 5EFIB 3U4EB 4EQ2A 1QVOB 1NGYB 2CDFB 4LLUA 3PP4L 2IWGA 1JMXA 1TTFA 3QA3A 4JKWA 5FO8B 2D7PA 4P49A 4FXLA 4I18B 4U6HB 2EDOA 4KROB 4XPBH 3OGOE 3QDMD 2EIBA 2D03H 3BKML 3HRZA 3EOTH 1BM3H 1I3GH 5C0IB 3WLWD 5HVHC 3IDXH 3C5JB 2F54D 4RWHA 3CDGB 5C0GA 2DJSA 1YEJH 2GTWB 5F1IB 5DWUL 1DZBA 4Q58C 1IGFL 3B8YA 3CDFA 3RU8H 3EDJA 3S88L 4LCIL 2AKRB 1FPTL 3S5LB 2W9LA 4PJ9C 4PYHA 3VE0B 1HOCB 4HKBA 5DD6A 1F4YL 4CGTA 1ZV5A 4LHUB 3GJFK 4V1DE 2ZCLH 2R56L 4EJ1C 4G8EA 1ZGLM 1S7UA 3ZL4H 3P73A 5MENA 1JCKA 3OKKA 4NDMA 4LCUA 4LVOC 1ZHBA 4RMWA 5JQ6L 1P2CA 3PHQA 3TBWB 3H3KA 3U7WL 5IHUH 3EYVA 3R1GH 4H5SB 2EIEA 2ITCA 4NHCL 4G9FB 4DVBB 4KC3B 1KYOJ 1MIEH 4KVCL 4CJ1A 1UXWA 3KPMA 4M61A 1UFUA 3OTTA 3ILQC 5DD3H 3P4MA 4XMLL 7CGTA 3NH7L 1AXSA 3HNVL 35C8L 3OL2A 5I1DB 3S4SG 5EU5B 3K4ZA 3N0PB 2LFGA 4AIXA 3SQOL 3I6KA 4NSKA 3ZO0A 2OMBA 2NY4D 4LLDB 2A83A 3WFCH 5IW3A 1G7PB 2NY5L 3QXAB 4P4KA 3UC0H 2FATH 3ZMRA 5EU4B 5JO5A 1IGML 2DM4A 5E5RB 4RAHA 4WW1B 1HH6B 5CJQH 4Z9KB 2V7HA 5E2UL 3D39E 3QIWA 5CIPH 2EDXA 1SYVB 2GCYB 3SGJA 2BXZA 1KG0A 2WV3A 3X14A 5TDPA 4FTVA 5KVGL 2APBA 3GBML 3VFGH 4HGWB 1LWRA 1E4XI 1S3KH 4N9GB 2RQ8A 4XP9H 2EECA 4D0BB 2NYYD 5FHBL 5GZOD 3WL9B 4KKLD 4UBDC 2D9QB 5K9QG 3N1GC 5E00A 2Z8VC 1AQDA 5I8EB 1DBML 5DXWA 2P8MA 3F7VA 2Q3ZA 1S9VB 1UB6A 3VXRB 2BSSA 5F1SA 1CDJA 4EI5B 3MV9B 1RURH 2YSSB 3MA7B 2PKDA 4GKNA 4JFQA 4OZ4B 5E9DD 4U05A 4FS0A 3L5WA 2FLBT 2MCPL 1SJXA 4QWWD 3HR6A 3G5VB 4LSTH 3FQNB 2NZ9D 1A7NL 2X4RA 5DJ8B 1IZJA 4O58L 2DM2A 4YDLC 4MNHA 2XG5A 4PREB 1NMAL 3B9KA 4H1LH 1FO0L 2NXYD 4R2GB 4NRZB 5GS1B 3UBXB 4RMSA 2BSTA 3PGCB 3IJSB 5ISZD 4ZFZB 4M5ZH 1QLRA 3V5HA 1V3JA 3E6HB 4WFHD 4CMHC 4FQ2L 3QXWA 1BZ9A 4GW5A 5TE4L 1QLEL 1JI2A 3T77A 1EHXA 4YX2H 1P4IL 2DWEA 2B20A 1M7DB 3D3VD 3BH9A 3P4NA 2EYTA 5EO1B 5C8JA 1QBMH 4FFVD 4GRWF 3DWTA 4R97C 3TESA 4LBEB 3SOBH 4U31A 1MFAH 3ISWA 2OJEB 4R9HA 1FNAA 4G8GE 4KK6C 5IT2L 2NY1B 2CR6A 3EFFA 1HSBB 3U0WL 3U9UB 3GO1H 2X4PA 4Z77B 1DQQB 1ZHKA 2MHAA 3MRGB 3TCXA 4HKXA 4ZUWB 1GGCH 1EZVX 4GH7B 5ITFB 2XTJB 2DYPA 3FQUA 4QEGA 1WIUA 3O41B 5DJ0A 3VFRB 1BD2B 3PHOB 3MJGX 4ZXBB 4JRWA 4NCC2 1Q9WB 4I3RL 1FL6B 2Q8AL 2NY0C 1AGCB 4G42A 5EA0H 1GJIA 2DQUL 4M6OH 4BK4A 4P4KC 1A8JH 3S7GA 5MENE 1N8ZB 2BFVL 4LDOB 4NCDA 5GGVY 4PGDB 4UILH 2EDBA 1S5IH 1KTDA 2D31A 3FO0L 3BJLA 5E2TL 2CIKA 5EZJA 3WNLA 2I9LB 3RY6A 3QIWC 1E28A 3MNWB 2KZ1B 4JFEB 3SGJC 5D2NA 4ZUTB 2BNRB 3VGDA 4GO6B 5IB1B 2OJZL 4EN3D 1WBZB 3IAPA 4B7LA 3PL6B 4ZSOB 2DKMA 1JPGA 1FZOA 1JNHB 5BV7C 2I26N 3ARSA 3KPSD 1B4JL 5CIPA 1HSAA 2OL3H 4X7CC 1KLUB 3PV6A 1R3LB 4N5ED 3VXMD 5IR1B 3QZWG 1T1ZB 2A1WL 3PG2A 4Y4KD 2X4TB 4NPYA 2DB8A 1J12A 2DJ4A 3SHSA 4ORGA 3VXUA 4RFEA 5EU7C 4RNRB 4D0DB 1QRKA 4PJ5D 2HVJA 3WMSA 4FRWA 4AEIH 5BVJB 1HHJB 1WWBX 3BP6A 1OM3H 4OLYH 4ZS7L 5BW7A 4O5LH 3D9AL 3LKQA 1KB5A 3HI5H 4WWKA 4K9EL 2DDQH 2QSCL 1LP9A 3B9KC 2DQCL 4UIKL 2Z35B 3IETA 3N9GL 4BZ1H 1G6RH 1TDQA 4P57A 4QT5B 2ESVD 2P47B 3MLUH 4LARL 2CIIB 1QFWL 2WWMC 4OQ1A 3U83A 5KG9B 1J87A 2I25N 3QULB 3S37H 5E8DL 1CGYA 1KCSH 3EGSA 2H2SD 1T3FA 3GMLA 3X12B 1X7QB 3ARGA 5T3ZE 2Y1VA 3L5IA 2DLEA 4GRWE 1YEKH 3DX8A 1IGJB 2ADGA 3B6SB 5L9DL 5EN2A 4JEGB 3CFBA 4HG4J 3Q5OA 2E27L 1U8KA 2BNQD 3OG6B 3IRZA 3TNMA 5F9OH 1AQKH 1YNTA 5K59F 5FGSA 4LAQL 4GSDL 3C6SA 4ZUVB 1LDSA 3VGBA 1I8IA 4RWYH 1S7XA 3BGAA 2ADJB 2BHZA 4QY8A 1MQ8A 3QAZC 2CH8A 4IOFD 5KSVB 3SEPA 3QDAA 5TF1L 3TN0D 5F70A 3HUJB 5KJRL 1U92A 4KGJA 4ZAKB 4ZFOL 3WIHL 1EEUA 2HFEA 4FOMA 5EC2B 1OSZB 5CJXA 3TFKD 1PVHA 3RDTD 3LH2L 3P9MB 4P3WA 4WEBL 4K55A 4X6EB 1G9NL 2Y9RT 3U9PH 4F37K 2Y06L 5JUEH 4NKMB 4BQCA 2FJHA 3ZTNL 3P0GB 1AD0B 1FE8H 1HXYA 3H42H 1MHPL 2D7QA 1AE6H 4BH7B 3PWVB 1TZGH 2FL5B 3JTSA 2VIRB 4O2CB 3STLA 4MX7A 1KGCD 1F8TH 3EOYG 2VH5H 4G8IA 3TO4B 2ZUQC 2DTML 3RY6C 3REVB 3HB3C 4U1IA 1JGLH 1UT9A 3MLVH 2CUHA 4JN2B 1R3KA 3LS5L 2OM5A 4UDTA 3ROOB 5DJYA 1DEEA 2QJDA 3BDBA 3ULUH 1KEGH 2AW2A 1YUHB 4NZRL 3RUGA 3LHPH 3NGBC 3H9SA 2E7LA 5EBWA 2VLRD 3A6OA 1G9MH 1KFAH 3K74B 1NDMA 4G6AD 4PP1C 4JRYA 5I15L 5A3IC 5HYJB 3KWWB 2GUOB 3PJSB 1RQ5A 1XF3B 1CL7L 3P3YA 3E2HC 3MOAH 3DYMA 4MNQA 1RIVL 2OL3A 2YD4A 4MAYD 4OCXH 4M43H 2XZCH 3LKOB 3LKPB 2Q7YB 3O9WA 4P4RA 3L3IB 1RJYA 4J3TA 1HHKA 5BW7C 5E8NA 4GKZA 4HX1A 4WWKC 4APQA 3BEVA 4XTRC 5F97E 2R0WH 4KZEL 3JWNC 3OBAA 4GXUN 1I3GL 4I48B 2QSQA 4NCC1 3QDJD 5C0RH 3RUGF 1L9MA 3ZKMD 2X10A 5SWZD 4F37F 3ZZ1A 5EOCH 5EO0B 4BSVA 2ED8A 5JXAL 3QB7C 3V5DB 1TPXB 2CLZA 3ARGC 5D1ZB 3CH1B 3VXUE 2J5LB 3K2MC 3BH8B 3Q5TA 3TT3H 4PJGA 1NAMB 1IC4H 1HZHH 1CXFA 2X1OA 2PF6A 3TPUB 4IRJA 2PR4L 2VAAA 4NQXB 3WUWB 5K59E 1Q0YH 3RNKA 4MJ2A 2P8LA 1IAOA 1A1NA 3E6FA 4ZTPL 5LAXB 3SY0A 3TVMB 3VGEA 3C9NA 4OFKA 5D7JD 3MGOA 4U1HB 2IALA 5DJDB 3FJTA 5IHUL 1EGJH 1JPTH 4TN9A 1CDHA 4N1HB 1CXKA 2XN9B 4NO0D 4FZEL 1J0JA 3C8KA 2DKSA 1J1OH 4JDZB 1DANU 1DFBL 4LNRB 3IDUA 3QI9B 4NFCA 5CJXC 2X70A 1WC7A 4WJ5B 4JO3H 4OD2A 4UINL 4UV7L 3OX8A 3SBWC 4TOYH 5I1AA 2BNUB 3IT8D 2KZWA 1LE9B 4P3CL 5J9PB 3MRIA 3VWKB 1DANT 2NXZD 3FRPG 1F4AA 3J7HA 1CICB 2E7HA 3B9VA 2FATL 4Z76A 2Z31A 2DS4A 3KPNA 4MYWB 5FYKE 2F15A 3ZYZA 3ULVD 4L8DA 5L2KD 2QQNH 2HTLC 3EYSL 4ELMB 4XNYL 1JRHI 4ZQKA 3QJHA 2B1AH 4QRQA 2IQ9L 4G6FD 3MNVA 2GK0B 1NCTA 1MLCB 3QP3A 5DD5H 4XX1G 4R7DA 4V2CB 4YUEL 5LCVH 5FGBA 1S3KL 2E7LC 5CKAA 1AKJB 2QQLH 2K1MA 3ECBA 3C2AH 3NAAH 5I75C 2X1QA 1J05B 5EZLB 4YDJB 2R8SH 5D1XD 3W9DA 3K8KA 1MJUL 4YPGA 4A2LA 5KVMC 5KSBB 3FT3B 3TA3A 5CJOL 3O9WC 2BVTA 2X7LB 5C1MB 5EZIH 5I1LB 3AREB 4ODSL 3RA7L 3VXSD 1RUQL 3EZJB 3RAJL 4PB0L 1P84J 3RWJA 4APQC 3OV6A 4ELKB 3BKYH 1A3RL 1YEEL 5HYSA 1DLHB 4J7RA 4DVRL 2J88H 3RGHA 3RUGE 1C5CH 1IAMA 4NKDB 3OPZH 1UH2A 4ZFFA 4PR5A 1MQKH 3C5ZC 1MLBB 1A1MA 2HT2D 4JRYE 7FABH 5MHSD 2VXVL 3MRPB 3HMWL 3WCYA 1UH3A 5KS9F 4L8CA 2MQCA 4FQXD 2CLRA 1XGPA 2WSKA 2NW2A 5K9OA 2IH3A 4WU7A 3H7LA 4MNQE 2MCG1 1KPVA 4OF6A 4X4ZA 3NIDF 1XZ0A 4JPVL 3P9LB 1EDQA 5FOBA 4IRJC 3NFPA 2IMNA 2D0FA 4MJIA 5EBMA 3ARVA 1PZ5B 1T7XA 5D2LA 4C58B 2IFFL 1OW0A 1NBYA 3JTTB 5SV4A 5J1SC 4U0QB 1A7RL 2APXA 2V2XB 3GO1L 3QR2A 4WIQA 4MXVF 4TNWK 1LGVA 4XNXL 2XFXB 5AZ2L 3R8BB 3D48R 3MLZH 5ENWB 1YY9C 2CXKA 2I27N 4PY8I 3QHFL 1CK0H 1NBZB 3V8CA 4N8CL 4I4WA 1A3LL 2CRIA 4NQVA 1U3HA 5C0BB 4R0LB 3L3JB 4DTGH 1PJ9A 2D4DA 1K9TA 2VDQH 5I73C 1B3JA 1C5BH 1JHLL 1P7HL 4C4KO 2ICWB 5I1GL 3SE8L 2HFGL 3WFDL 4FXKA 5F88A 2EKJA 4TSAH 1Q94A 5C2UB 3ET9F 4GAJL 2VITB 1ZWIA 2Z31C 5CEZD 3M17A 3QEHA 3WFBH 1FRGH 1WITA 5CGYC 1RUPH 4X4YB 2HYMA 2W60B 2D7TL 5HI5D 2V2WB 5I71B 5IBTH 4QRRB 4KY1H 5I1KL 1Q1JH 4L4VE 4PFEA 3ESVF 1F00I 1T2QL 1KOAA 4JFFD 4ZPVA 5DQ9B 1A1OB 1WLHA 5FGBC 2VB5A 1LO3L 1B0WA 4FXGB 4U1JA 8FABA 4TUKL 1QQDA 4OZGB 4MVBC 4HC1H 3W0WD 5HHMB 4D94A 5DR5L 3ARFD 4ALAL 3DX6A 2F74A 5I8OH 2VUYA 3QCVH 1MRDL 1RJZB 3MZGB 1EFXA 4Q2ZB 3TA3C 5D1QB 5GISH 3H9HB 4QTIH 3PWNA 2P45B 3S35H 4HUWB 1MCRA 3QSKB 2EH7H 2Q8BL 4WW2A 1S7TA 5E2VH 4G43B 4ONFH 3O4LD 4QNPF 4IDLA 2V2TA 5IK3B 4O5LL 1D9KB 1AY1H 2MKLC 5TPWL 4HDIA 1YDPA 1IL1A 1G6RL 1ZHNA 1MHCA 3G5YB 3MLUL 4MSWB 2PTUA 1OCWL 5IG7B 3GI8H 1FSKB 1ZEAH 3G04A 2EIDA 2GY5A 3RTQA 4XCYB 3S37L 4NO2A 2DOCA 2BY0A 3NIDE 1IAIH 4BQ9A 3ROLB 3TBYB 4HUXB 5CP3H 1YJDC 5D93C 4YHMH 3UO1H 1T7ZA 1IRAY 1XMWA 2DLTA 1HHIB 2EO9A 2ZKHL 1QKZL 2XACC 1TJHH 4L4TE 4HJGA 4S10A 3QXVA 1HNGA 5HXMA 1PAMA 1EJOL 5IQ7H 1TZIA 1QRNA 1R3IH 4WW2F 1OW0C 4KI5F 2EH8H 2NTFB 3DXAA 4POZC 4Y1AA 4F7CA 4E0RA 5IHZA 4WFGD 1FZKB 5JZ7D 3GUTB 3VFPB 3MRQA 4MXVE 1V7NL 1ZMYA 3QDMB 1F3JA 3WEXB 3ZHKA 4DQOL 5IMOB 3EAKA 3NCJH 3GSOB 1INEL 2F54B 3MC0A 4KJWC 4H26A 3DUSA 3NTCH 2DMCA 5H37G 1E6JL 5IW6B 5DO2C 5ADPH 4GG6F 1UM6H 4JM4L 3EYQD 4OCMC 1BF2A 1MCBA 1U3HC 3MROA 5GGRY 2NNAB 4JB9L 4LCWB 2IPTL 4YGVA 2ATKA 4LKXB 1KNOA 4LQFL 4RAVB 4WENB 1TVBB 3HZVB 4MJIE 4NQSA 4PRDB 4TRPH 1YC8A 2YKLL 5C09A 1MCHA 3HRPA 5ERWA 5DGQA 1XF5A 4R4FL 4JFHE 2SEBA 1A5FL 2Z93A 4TPRL 5C0EA 1RIHH 4R8WL 1PKQB 1AGBB 3ES6A 1WTLA 2XWBB 3FAXA 3INUL 1Z9SA 2CMRH 2FJGA 1HXMA 1IGIL 1TLKA 4UUJA 1MCLA 5EFIA 3U4EA 1QVOA 1NGYA 1OTUD 2CDFA 4CADB 5JIKA 5TH2B 4KHTL 1CD0A 2PTTB 1OL0A 1U8PA 1BIHA 5FO8A 3LQAL 5JIIA 3ILPA 4MXWH 2CGRH 4I18A 4XC1L 4U6HA 3U46A 1A14L 1BFVL 4B7IA 2IPUG 3HCVB 1UKSA 5TE6H 2EEAA 3GSXB 4P59H 3V4VH 1FVCB 4Z7OF 2VXQL 1BGXH 3CDGA 5DI8B 2WUCL 3VFTB 2NY4B 2GTWA 3EO1B 5F1IA 3PGFL 4Z95L 1IEBB 2H3NA 3DSFH 1WFUA 1AHWB 2A0LC 4QNPE 1MCEA 2AKRA 4WW2C 3S5LA 4KI5C 4AL8L 1XIWC 5EZOH 2ZG3A 3NZ8B 1GHFL 3C09C 3F7QA 4RFNC 4OLUH 4Y16B 4MAUL 3VE0A 4DZ8B 3O2VL 2GI7A 3C08L 3AMLA 3JVGA 4RZCB 4AG4L 4LHUA 3S4SB 1UYWL 5MEPB 1NGPH 1U6AL 1EBAA 4N0RA 5GRWA 3RTQC 1ZS8B 2YD1A 3MPCA 3TBWA 1OAQH 5FCUL 3GMNB 3NBNA 4G9FA 4S1RL 1BQLH 4DVBA 1VPOH 3LS4H 1C8PA 2P7TB 4J6RH 5MP6L 2VDNL 1JE6A 4KKCD 1I4FB 4RAUA 5JQHC 1YY8B 4KI5E 3TH3T 3TH4T 5CP3A 1FL3B 4LSDA 1NCBH 5I1DA 4MA1C 1CQYA 3PWPD 5J1TC 4U0RB 1MFBH 5EU5A 3UX9B 2R0KH 1D7FA 2JTDA 5I76B 4KAQL 2NXYB 3EZ8A 4LLDA 4NQUA 2JJSA 3VGHA 5ISZB 3QXAA 4GG6E 3ARBD 5EU4A 2W65B 3MLWL 4WW1A 5LGHH 5J6GB 1HH6A 1RZJL 1QFWI 4OFYD 3W82A 1EBPA 4NP4L 3QUYB 3CVHL 5DD1H 1M71B 5DC4B 1SYVA 2GCYA 3U7YH 1DSFH 1YPZF 5CZVH 3NFSH 4XBPB 4M93C 4HGWA 3MRDB 1QRNE 2DBLH 1F4XH 4D0BA 4Y1AE 1JYVA 1NSNL 3DXAE 1SHMA 3L95B 1OF2B 4G6KL 4NKQB 1JZ5A 4LPTA 2FSEB 2YC1A 3MODH 4XCEB 1S9VA 3VXRA 5F1KC 1SM3H 4BUGA 4KUZL 4NQDE 1WZLA 4WU5B 1KELH 1SEBB 5D70H 3MV9A 1A6TB 2R2EB 1TCRB 2YSSA 5HYQB 4UNUA 3MA7A 2Q76B 4XWGH 4OZ4A 2K9UA 3O8XD 5H8DA 4P99A 1MY5A 4JHZA 4LRIA 2MTPA 3G5VA 3GSNB 4I18C 5DJ8A 1KPRB 4C54A 3C60B 5LCVL 4KROC 5C7XL 2B1HH 4PREA 1S78C 4Z7OE 4NRZA 5GS1A 3C2AL 5KZCD 5F7HA 2VN4A 3PGCA 3IJSA 4P2CG 4ZFZA 2OI9B 3E6HA 4ZG1A 1OY3B 3FFCD 1U58A 2C4XA 5HGAB 2A6KB 2DQHH 4PRIB 5D7KD 4K8RC 5I1HL 4WHTB 5F89B 4NYLB 5ESVB 1EERB 1FVDB 5JW4R 5E08L 3FKUS 4HLJA 1KIUA 3LEVH 4YHKH 3BKYL 5KAQF 1RFDH 3MUGB 4LBEA 2XRAL 3JVGC 4EN3B 5KSUB 2ADIB 3LQMA 1HSBA 3IDIB 4ONOA 3KPSB 1G1YA 3U9UA 3VXMB 1QFWM 1FIGL 4AENB 3MRMB 3SKMA 4Z77A 1DQQA 2K7PA 3H9ZA 4Y4KB 3MRGA 4ZUWA 5KOMC 3U82B 5GSRB 4OZIB 1CL7I 2AJXH 1FFNB 4LSSL 3O41A 1T1WA 5IBLD 3VFRA 1BD2A 2BOCB 3PHOA 2DM3A 3MACL 4P5KA 2VDOL 4HIXL 4ZXBA 5T5FH 3LN4A 4MHHI 3N1MC 4PLKC 1TVHB 1MSPA 2WK2A 1Q9WA 1U8MB 1FP5A 3BJ91 3KR3L 4WO4A 1FL6A 4KKAD 1L6XA 3K46A 2VSDA 1AGCA 1UWGL 3QXDB 1QSEB 2JJSC 2ESVB 2AJUL 1YYMH 1N8ZA 3QRFM 5E56A 4PGDA 1GZQB 3Q3GB 4YHLH 3JWDH 4G9FE 3FOMB 2I9LA 3CSGA 3GMOB 4WI6A 3IFLH 2F53D 1YPZE 1VSCA 3MNWA 5ICXB 4IJ3B 4JFEA 2B5IB 4ZUTA 2EC8A 4C4KT 1BX2B 5E8EB 2QQKL 3UPAA 4D3CH 5IB1A 4ZUSB 5JHLL 5E24E 5AYUH 3PL6A 4ZSOA 4MGXA 3SKUD 5GJSL 1CD8A 2X89D 4R6UA 1KPUA 1R3LA 5IR1A 2BNQB 4JZNB 5F7KC 2HT4D 1T1ZA 2IBZX 3HNTL 1DN0B 2EXYC 2X4TA 12E8L 1CGVA 1XGYH 4HWBA 4XHJC 4EI5C 2YPLD 4NRYA 3BN3B 4XPFL 5F7EL 2B4CL 4RNRA 4D0DA 4K3JH 4XH2B 3MA9H 1CD9B 3MJ9L 3N85H 2F8XC 1EHLL 5BVJA 1UKTA 1HHJA 4LRIC 5JOEA 3QWRD 3SDCD 2WBWB 2BHUA 2Z35A 5GS1C 4WHCA 1GOHA 3P77B 3NN8B 1TENA 3RDTB 1R3JB 4QT5A 4HWZB 1INDH 2WBKA 3RVUD 2CIIA 1BQHG 1G0XA 1NAMH 5INDB 5I8OL 4M3JA 5LBSL 5KG9A 1X4XA 3QULA 3VXRE 4F58H 3W11C 2A77H 3TV3L 3X12A 1LK2B 1X7QA 3MV9E 2DLGA 1OVZA 5I66B 3MXVH 2LAAA 3EJYD 5E2VL 3B6SA 2J6EH 3VGAB 2AEQL 5DURD 1R6VA 5C6TH 3RGVA 2ID5A 1WFTA 2NY1C 2V17H 5LXGL 2FGWL 3T08A 1H15B 1I9IH 3S98A 2D7MA 4HZLB 4R3SB 3ZE2F 5ID0A 1YNKH 5GGVL 4I77H 4WUKH 2VLRB 1N4XH 1K8DB 4ZUVA 2IEPA 2KUTA 1T6VN 2WZPD 3S96B 2MMXA 2NLJA 2VDLL 1KB9J 2XTJC 4PRHD 3PWJA 2WLYA 1GC1C 2ARJB 4OV6F 1C1EH 3ZTJG 5KSVA 4O2FB 1VESA 4ZXBC 3HUJA 4ZAKA 4U6VH 1MIML 1L0QA 1RULH 4JJ5B 4L3ED 5EC2A 3NFNB 1I8MA 1MH5A 3P9MA 1HNFA 4X6EA 3NPZB 3WBDA 5I1EL 4U1LB 4X0KB 4HMDA 2A9NH 4JFDD 4NKMA 1AD0A 4P2QD 3JV4B 4BH7A 1P4BL 2FL5A 3K8MA 5SWZB 3O2DL 2C3VB 5GRXG 2VIRA 4O2CA 2XTJE 1CFVH 2ICEB 1YMHB 1UM6L 1CZ8H 1TQBB 2FZ3B 2H45A 4JN2A 4AH2B 4NJ9H 2JKXA 3WIFB 2DQFB 2R29L 4OCNC 1UCBL 4EI6B 5BS0D 4O02L 3PL6C 5AWNL 5GSVA 1JFQL 2XNAB 1YUHA 5I18H 3HUJF 3L3HB 2G9HB 1OGAD 1JN6B 4PJ8D 1MELA 2FWOB 3BMVA 2YD9A 2BJMH 4HIJA 4WFFE 2GITB 5DHVH 2R2BA 4KQ4L 4M8QB 5HYJA 3KWWA 3PJSA 1Z9OA 1T1YB 1UGNA 1XF3A 1AR1D 4JFZL 1UA6L 3Q2CA 4S1DD 5FOJA 2CMRL 4JDVA 5JMOC 5D7JB 2JB5H 3W39B 4D9RD 5GPRA 2EZ0C 1UWEL 5L8LB 3LKPA 4Q9CA 2Q7YA 4FQCL 1NMBL 1IILE 3ZYJA 3L3IA 5J6HB 4JFEE 4NO0B 2BNRE 5I8KL 3FHQA 1UJ3B 5EOQH 4ZSOE 5ALCH 3B2VL 3U2SB 4N0FB 1GVIA 4I48A 1BGXL 2H6PB 1KLFA 2ARJQ 2NXZB 5EO0A 3DPBA 4YAQB 3V5DA 1S5HB 5D1ZA 3RP1A 3CH1A 3DUHA 4OT1L 3BH8A 2ZP0T 1CGSL 5L2KB 4TUJB 2M1KA 2GYSA 1U8NB 4EBQL 3DGGB 2P5WD 1BFSA 3O6ML 5IWLA 2E7BA 4JVPA 3WUWA 3ZE2E 5GRUH 3UTSD 4JKLA 1F42A 5AG8A 3ZKXB 5CSGA 5LAXA 3TVMA 1XF4B 1FNSL 3VRIA 1HILB 3C2SA 1RPQA 4M9OA 4XCFH 2IAND 4HJ0C 1EUUA 3DV6B 1IM3B 3SKJL 3QIUB 4U1HA 3PDGA 5DJDA 2IG2L 2VLJD 1U42A 15C8H 4DKEL 4I0PD 5T5NG 3LS4L 2AGJH 3PNWA 1YN6B 4UDUB 5HGHB 3G5XA 4ZAKC 1OSPH 3CXDH 1ZOXA 4XCCH 1AP2B 3VXSB 3WNPA 1YMMD 3BN9C 4JDZA 5E7FA 4RRPA 4LNRA 3ZDYF 2CO6B 3QI9A 4N0UB 5B22A 4WJ5A 1KBGL 1RHFA 1JTTA 1CBVH 2AQ3A 5DS8B 1OARH 2BNUA 4U7MA 4N0CD 5AYQA 5J9PA 1LE9A 4MA8H 2VZSA 5JHDD 4NNPL 5BJTA 4N0YH 1KJ2B 1CICA 2UY7A 5CCKH 2GJ6B 4YDKH 4FQXB 2FR4B 4XP6H 4HJJH 4FQQB 1L7IH 4ELMA 4WRLA 1FFRA 4M6NH 3DTXB 3JV5A 3T0ED 1CGWA 4M00A 2GK0A 3HUJE 1MLCA 5IFHL 3GHEH 1J18A 4LP5A 3KDMA 3ARDD 2DBLL 5F7DA 2AQ2A 2X4UB 2E9WA 2ZPKH 3KPOB 2WQRA 5SWSD 5CWSB 1CT8B 1MCDA 1W8NA 3OF6D 5CILH 4RSVA 2X9WA 1D5MA 1J0YA 1J05A 5D8JH 5EZLA 3Q6GH 4YNYB 3S9DB 4YDJA 2UUDH 4F7MB 5KSBA 1DBJH 4Z0BL 4JREB 3FT3A 5F7WC 2X7LA 3QDHA 4KMQA 5I1LA 3AREA 4RGND 4MB5A 4HUVB 4LIQL 1TJGH 4QGTA 4NGHH 4ELMF 3BPCB 4ELKA 4YXHH 4MCYB 5DLMH 1DLHA 1EA9C 1OAKH 3H3PH 1F4WH 1E6OH 5FKAB 3TF7C 4NKDA 3RWCB 1RUML 3RIAK 4MD5B 4PJEA 2VZOA 1BP3B 2ERJB 3LOWA 3CMOL 3QWOB 1X5XA 3MRPA 2YMXL 4CVWA 5HYJE 4OGAC 3OKLB 1J0KA 2APTA 4NM4L 2QHRH 1TPXC 5D1ZC 4HS6B 4YK4B 2J5LC 4I3SL 3LY6A 3A67L 1BQUA 5KSBF 4H0HB 4J1UB 3P9LA 43CAB 4IMLB 2WP3O 3OAUH 4YHKL 3UTPD 3WJJA 5IWLC 5C0CB 1PZ5A 3MBXH 1PGRB 3JTTA 3B2UC 5F6IB 3TVMC 1F90L 4CBPA 2V2XA 3RVXD 3VXNB 2ZOKA 2XFXA 3O6LH 4N90D 5ENWA 1WAAA 3WXVL 1WIPA 2FEDD 2FBJL 1NBZA 5C3LD 2Z4QB 5C0FB 1MCIA 5C0BA 3VD7A 3ZDYE 5D6DA 4R0LA 1UWXK 2VC2H 3V95A 3ME0A 2R15A 2WBJB 3L3JA 3QI9C 2R4SH 4FMKA 4H1LG 3RI5F 4UT7H 1EH9A 5TE7L 2ICWA 5EULV 4FA8A 5F7YC 3VWKC 2EC9U 1U9KA 3I85A 5DQDH 4F8TA 1CICC 2VITA 4WVRA 1Z3GL 4OI9A 4E42B 2P5ED 1MCOL 3I9GH 1Q9OB 5GGSB 4XVSH 1GIGH 1C7TA 4X4YA 2XN9E 4YE4H 2EC9T 2V2WA 1CU4L 1XH3A 3UCRA 1NC4D 1WAAF 4QRRA 3W9EB 5CBEB 4GUPB 5DQ9A 1A1OA 3WXWL 3RNQB 2ZG1A 1RZKH 4TTGA 4FXGA 3UTOA 1HINH 1U3JA 5EU3B 2DF3A 1DL7L 4FQLH 3CLFL 5HHPB 4OZGA 3GM8A 4NZUL 4L29B 5EU6B 2XZAL 3L3DB 3TLRA 4M48L 2DLIA 2GFBB 4OF7A 4TVPE 2P8PB 4EOWH 4I1NB 1QEWA 3VXPB 4Y2DB 4UB0L 3DROB 3QPQD 5D1QA 3GNMH 4KDTA 3BD5A 3H9HA 4G7YH 3MA9L 4JCLA 3AREC 1DJSA 4HUWA 4ZD3L 4ELME 4OM0H 3TJHC 5T3XE 4G43A 5KBNC 2IGFH 3V6FB 4CNIB 4FZ8H 5IK3A 2M26A 3D87B 4LSQL 5HGGS 1D9KA 1HYRC 3T0DA 5E95B 3G5YA 5HVFB 5L8JB 1AO7D 4OZGF 1OQXA 2EDDA 4TUOB 4XCYA 4Z7UA 1ND0B 4LSVL 4J3XA 3BIKB 5KSBE 3ROLA 1ACYL 4OCYH 4HUXA 4UTBL 4GAFB 4Y2OA 4NT6B 1MJJB 3S8WA 1HHIA 1M6OB 3FQTB 3CK0L 1TNNA 3MRLB 3L1OH 2FD6L 3WJJC 5JOFA 5D6CB 3WNKA 2LVCA 2NTFA 4CU6A 1VEOA 1FZKA 3GUTA 2V17L 3VFPA 4P5TD 5J4MA 1T0NB 1RHHB 3QDMA 5HHVL 3WEXA 4WUKL 3T1FB 5T33H 5IMOA 2BVUA 2HLFC 3GSOA 4LCCB 4AY0A 2UV3A 5IW6A 2GHWB 2Q20A 2X4NB 3AXLB 4FABL 5D6DC 4R0LC 4LCWA 4M7JH 1PYWA 1ZLWK 3MV8D 1R0AL 2PNDA 5JR1L 4LKXA 4KDWA 4RAVA 1P6FA 4AZ8A 1BZQK 2W0FB 1HEZA 1TVBA 3HZVA 1JZ8A 4PRDA 5F9DC 2B0SL 4M03A 4L9DA 3T09A 4AT6B 3ZSTA 5F7MC 5I17B 1NAKL 5F96H 5F71A 1PKQA 2XIDA 2VDPH 1AGBA 1HIMH 2ILLA 3CX2A 3ARWA 2XWBA 1RMFH 5H35B 4ZMAT 3L3OB 4K3DH 4KJPD 4K7PY 2RJMA 2N56A 3A6CL 1ZTXL 1WAAE 4CADA 1JBJA 5TH2A 5I71C 1KULA 3ALXA 5C0BE 2PTTA 1KN2H 4U3XA 1QBLH 4ZO9A 5HHNB 2EDHA 5HHXH 4JG0H 3MLXL 2QV2A 1U0QA 1KB5L 2VUOA 3PWPB 3QEQD 3GSXA 4Y8AA 3BUYB 2QTEA 5DFVC 4LLAA 1FVCA 5D7IB 5DI8A 3BDXA 3VFTA 3EO1A 3KYKH 1F02I 4NQED 1G84A 5D1QC 4KDTC 5IKCB 2AJSH 1IEBA 3ARBB 4GXUM 4YR6B 1RU9H 3O6FD 4FQHB 3SN6N 2DQDH 1CIDA 2LAGB 1HQRB 4HIEB 2XPGB 3NZ8A 4QRRE 3LRSB 1C16B 2E3VA 2E9JA 4Y16A 4DZ8A 4L1DA 3LVEA 1D9KC 5K9JL 1GGYA 3RWDB 1OAUH 2B2XL 4RZCA 3P9WB 3S4SA 1NL0L 4RGOL 2WINB 1LO2L 1P7QD 4OZGE 1FSKC 4F3FB 1KLGB 2H32A 1MNUH 3OKOA 4P46D 5DJAA 4UOJA 2P1YA 3MLYL 1FLRH 4X9GA 3GMNA 3MLRL 4YWGL 1A9BB 4OJFL 1V3LA 2P7TA 3T2PA 5FYKL 3GZKA 1CLZL 5HY9B 1HWGB 1ORSB 1X5LA 2Y23A 4Z7VA 3ARTA 5J3HD 2YRZA 1I4FA 3O8XB 1YY8A 3NACH 3MGTB 4JHWH 4LU5L 1ZT1B 4YBLB 1MRFH 1FL3A 3VD9A 4JPKH 5F72S 5J0BA 2OXHA 4Q0XH 5D9SB 1N5YH 5I76A 1E4WL 3DNKA 2EXWD 3UEZA 5KZCB 1WISA 4XCFL 1DQTA 4H8WH 5ISZA 1R3HB 1AI1H 2LVEA 3BDYH 4EDWH 2W65A 1ACZA 3FFCB 4IRSB 1ED3B 2AXFB 2EIZB 2F8VA 3VFNB 5FGCB 4EDXB 1S7RB 4HT1L 3VFWB 3QUYA 2AGJL 4JO4H 1M71A 4XI5C 1UC6A 5AZEH 1A7OL 4KRPD 1JTPA 5KSAD 4I5BB 2UVFA 5B38G 1J5OH 4XBPA 1IBGH 3I3BA 3T0XA 4NQCB 3NA9L 5F7NC 4XP5H 4ERSH 3L95A 1OF2A 2DQIH 1OP5K 5A2IH 3ELAT 4Y19D 1NCAH 2FSEA 1CFQB 3QDME 5AEAA 5CKGA 3JUYA 2Y36H 4XCEA 1ODAA 5CCKL 1TTGA 4YDKL 5DFWH 3FMGL 5I1JH 2F54E 5IEKB 3HFMH 4WU5A 3T4YB 3IU4L 1SEBA 1A6TA 2R2EA 1TCRA 4HLZH 4NRXB 2VOTA 1V8HA 2Q76A 4F2MA 4M6NL 5F1OB 5DUBB 4MD0B 1BVLB 4LCWE 4M1GH 1T6WA 4KHXH 5FM4A 3SE9H 4BFEA 3GSQA 1T66C 3KHQA 4OLVH 4JDTL 5AD0B 3GSNA 2OZ4H 4YHNB 1KPRA 1YZZA 3C60A 1RIUL 5GRJH 3BW9B 3QNZB 1S7VB 3ZT6A 2J8HA 3UJTL 1RZKC 1PKQE 3LZFL 2NY4C 4LAJH 4S2SA 3AS3A 4OSUL 2DKUA 3HAEH 4GBXD 5DHYB 5HGAA 2A6KA 2FX7H 2AI0H 3BKJH 4RA3A 1H3PL 2EDJA 4ZTOH 4PRIA 3O4OB 5J13B 4WHTA 1AHWC 5KVFH 5F89A 1NANI 4NYLA 1IVLA 4NFDA 1N64L 1IFHH 5ESVA 1ZAGA 4Y16C 1FVDA 5CEYB 4BA8A 2HTKD 1KTRL 5AAMA 2DL9A 1FFOB 3MUGA 5DLML 4EN3A 3EO0B 5FO7B 5KSUA 5DSCB 1IT9H 3E8UL 2NYYC 2BK8A 4XPAL 3IDIA 2XQBL 4KKLC 3KPSA 3SQBA 4M7LL 5KOVC 1TJIL 3KLAA 5D71H 5GZND 3WDJA 4AENA 4PRNB 4WCYL 3AGVA 4Y4KA 1E4XH 3QQ9D 3VDCA 2W9DL 2QR0B 2WP3T 2ZNXA 4YXLH 1OAYL 2WUBH 4R96B 2OTPA 4OZIA 3BE1H 4IDJH 1FFNA 2ENSA 3OKMB 1BAFH 2BOCA 3QEGH 4RDQG 5F3HB 3DECA 4QWWC 1TVHA 2Q7NA 4X9IA 3DARA 3U6RA 4U0RC 3HLAB 2OK0L 3SDCB 4BELD 2NXYC 1A6UL 3RWHB 4GQ9L 1AFVL 1FAKT 2AABH 3QZWA 1U91B 3QXDA 1QSEA 1MFDL 2ESVA 3TO2B 4YEEA 2V9TA 5IEHA 1EEQA 4MNGB 4DGYH 5GGQH 2AQ1A 1GZQA 4LLMB 4OLXH 2DI7A 3Q3GA 3QUYC 1X9QA 1O0VA 1QFPA 3GMOA 3X3FL 1HN1A 2ICCA 1BX2A 5E8EA 1MHEB 1SMOA 3QUMH 4OZIF 2R4SL 4PV8B 5E9DE 4ZUSA 1FFPB 1WWCA 5DURB 3B8SA 1KUMA 1JGUH 2C1OB 4OLWL 3MZTA 2BNQA 1IZKA 3OKEB 4JZNA 4W6XB 4AMKH 1DN0A 4YBHA 4HFWB 5TQ0H 4YQXL 1A7PL 4EQ3A 5ISZE 3I9GL 3QO1B 4WFHE 4OV5B 3JXAA 5DQJB 3DO3A 4PRHB 3PHSA 4XH2A 1XFPA 5EORH 1IC7H 1Y6MR 3D3VE