5C09E

Hla class i histocompatibility antigen
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
244
structure length
244
Chain Sequence
GVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 45
structure length 244
sequence length 244
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c09E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c09E02
5C0CB 4BKLA 1GGCL 3PWJB 3KXFA 4UQ3B 1RK0B 1S3KL 4OUOA 5GRUL 3STLA 3IETA 4X6DA 4OFYA 1RURL 3U9PL 5DURB 4R97C 1OB1B 2W07A 1QRNE 1U8NB 1WCBA 4P3WA 1R5WB 1A3QA 3RIFF 2F53A 1D9KD 4OLEA 2BP3A 3JVGA 5K9KB 5ID0A 3GRWH 2R2CA 4NQDA 4S0TD 3EYSH 3WNKA 3G04B 5ECJE 2VWEC 4AMKH 1WTLA 5FEBA 2P7TA 2BVOA 3D39E 4NNXA 1P4IH 3IT8D 4N1EA 3DIFA 1RULL 2I5YL 2AEPL 5BO1H 3BQUA 3C09B 3ZT7A 1C5DB 3NFNB 4R8WL 3ARPA 1QRNA 4GKSA 5D6CA 3WFHA 1IAIH 3LEVL 2C1OB 2QHRL 3PGDB 4U6VH 2ED8A 2IH3A 3HUJE 5GIRB 3D9AH 4GRWE 5DJ8B 3TV3L 1MCOL 5KANG 3FQWB 1MRDL 5EBLA 1TIUA 2Z31B 1I7RA 2DLEA 2V2XA 2Z8RA 3K0WA 4KXZI 2UVFA 4RWYH 3RPKA 4ZTOH 5T5FL 3S3SA 4ORZC 1CL7H 5KSAA 4DAGH 1CZ8H 1X7QB 4I5BA 5ICXB 4Y5XB 2J2ZA 5ERWA 3HNTL 5LGHL 1FL3A 2Y06L 4HD9A 4MB5A 1QTYT 2VL5B 3O2VH 4X4XA 1NGZA 4IOIB 4HKJB 4XVTL 3GEWB 1LMKA 4LCWD 3PQYD 4PJEA 5F3HB 5DJ0B 3MACL 4RFEA 4X5XA 4JJ5B 2DJSA 3LQAC 3O3AB 1S7QA 3ZKND 4DTGL 2EC9U 3RUGF 3Q48A 2V5MA 4NDMA 4GW4A 1WT5A 5I1KL 4ZS6D 4U6TA 5F44A 5CWSA 3OKLA 3IJSB 2EDFA 4DOHB 1TXKA 1CD0A 1UM4L 5K93A 5INCB 3QQ3A 1CGWA 1EFQA 1LK3H 3I75A 4G42A 3FO0L 2DYPD 4I13B 1JPSL 5E8PA 4QOKA 4JY5H 2QQKL 4UBDD 1I9RH 4JY4A 1ZGLP 2BERA 2XTLA 5C9JB 1QACA 3VXUB 5BMFH 1RVFL 3T3PE 3BJLA 5I1CH 3CFJA 3T65B 1WEJH 4Y4HB 1MLCB 1JPSH 3LIZH 5E5MA 4D0BB 1IAIL 4XCYA 1FO0L 3GO1L 4CDHA 4FQXB 1ZTXH 4RRPA 4XCNA 1I7UB 2UYLB 5IW6A 5FA4A 5DHVH 2ID5A 3FTGB 1JNHB 2R0WL 2Y5EA 4PJXE 5BRZB 1YNLH 1RIUL 3O4LB 4YDIL 4Q0XH 1AR2A 3RPIB 3MBXH 4GKZA 4O2FA 4AM0A 4KRPC 3S3JA 1R3KA 4QRTA 5ICZA 5IESH 2FJFA 3BZ4A 4CKVX 3DNKA 5EO1A 2APFA 2IBZX 3D85A 3SQBA 3ZTJG 3MRBA 4FA8A 2G2RA 5DRZA 5FO9B 4MJ5A 4MX7B 5LGHH 3RTQA 4HPYL 2VXTH 3UTPD 4ETQA 3RY5A 2FGWH 4NUGH 3RWEB 1A4JA 2C3VA 4NN5B 1GPOH 3OR7B 3BZEA 3NOIA 5I1CL 5AZEH 5BMFL 5ICYB 1ZVSA 2AK4A 4JKLA 4LDLB 1DVFA 2EKSB 1WVZA 5D1XD 4MJ5B 4MX7A 5A2FA 1NGQH 4DEPB 4P2RD 1G9NC 4HJGB 3MPCA 5FF6B 4R96A 1E6JH 4KRNA 3D3VD 3OKDB 2WMPA 3BAEH 5CSGA 5L7XL 4DQOH 3FN0H 4ZSOA 2I60H 5D2LE 2M8XA 3H6JA 4JVWA 2OK0H 1C5DA 1K4CA 3MJ7A 3G6JA 5C07A 5C2BL 1ZHBA 1CICB 5EBGA 1FDLH 2VLJB 3ROLA 1ZT1A 4K3DL 3RI5F 1A3RH 1AGFB 1TNMA 1J0IA 5JDSA 3GSRB 1CGSH 5KN5A 1KXTB 3QG6B 1P1ZA 3P77A 3CFJB 3HHRB 3CVHA 2KPNA 2AXHA 4ZSOE 4OD3L 1ZVHA 5IHBA 1F4XH 1I7RB 5E2WL 5HYQA 3QULA 4LCCB 5C0AD 1DUYA 2WBWB 3VXMD 4GG6E 3MA7B 2VLLB 3TZVB 3VWJA 3A6CL 3QCUH 1C7TA 3HMWL 4OCXL 4H26B 4Y16A 5IK3B 4NQSA 4RMQA 4DKEH 3UAJD 3HA0A 4ZXBA 1AXTL 4RGOH 1M7DA 3QDGE 3UPRB 5DQDL 3SJVD 1LO4L 2ADIA 3O2DL 4KK6C 2B5IB 3D6GA 4O58H 4G6MH 4OT1H 1KIQA 4Y16D 3A67H 4K94C 5L0QB 4M8QB 4L9LA 4LCUB 2COQA 3L5XL 2ZUTA 5FXCH 1OTSC 4YX2L 3NPSC 4NUJA 5D7IE 5T1KB 2I9TA 3S35X 1OSPL 1IGYB 5E94B 3RWHA 4XBGA 1ZLSL 3VGHA 4LIQL 3PDOB 5JW4N 2BSED 3C6LB 2AJZA 4XPGL 4DN3H 1JV5A 4HG4K 4YHOH 5BZDB 5E2TH 4YPJA 5J6HB 5KOMC 2A1WH 1FNEA 3ZTJH 4BA8A 3VD9A 4LCWE 4KFZC 2GJ6D 3RL1B 2V9RA 4YDVA 4MS8C 4M00A 3JBG7 5C0IB 5C09E 1KIPA 1MRFL 3FHAA 4WWKD 1F8TL 1LO5B 1EO5A 4OJFL 2YD2A 1NQBA 5CINH 2OMNA 5F89B 1EHNA 3CVIH 5CBAA 2BVQB 3QIUB 1NUDA 4G6AD 3BQUC 5BJTA 3PHQB 5EU7E 3ALWA 4X5WB 2VDPL 2Z31D 1S7XA 4FNLH 3X12B 3NMEA 5BS0A 2ESVD 4DUXA 1UWEL 3V6OC 1ZHNA 4YDJA 3PWVA 2AW2A 2X4NA 2D4FA 3CFDA 1ORQA 4IJ3C 4OZIB 2ATKB 2J88H 1YEJH 3WHXA 3W5MA 2AJUL 3L3DB 5HDLA 5E08H 3NN8A 3O3BB 5IVXE 1NC2D 4J12A 1KT2B 4ODUB 3IFLL 5TE6L 2KUTA 1XFPA 4PRPD 4E9LA 3AS2A 4PRAB 3V6ZA 4V2BA 4WI8A 3VRLE 1J1OL 3C5JB 4MA7H 3SPVA 3KPMA 1G0XA 4MWFB 1ZEAL 4MJ6A 1U8QB 1AJ7L 4JFEA 1PG7W 2AABL 4HF5L 4TNVF 2W92A 4JDTL 4L4TB 3WE6A 3D39D 3KNBB 5L8KB 4G7VH 5T1MB 2JB5L 4S2SB 1JHTB 4OGXL 2VDLL 1V7ML 4DK3A 5FCUH 3G5VA 1I1AB 2C3XA 2V9TA 1P4LA 4JZOB 4YBLC 1KC5L 2YD5A 5EFIB 3GJFA 2RR3A 3QDJD 4LNVA 4OFVA 3V6FA 4PJ5B 1S9WA 3SGDI 4LASL 1DL7H 3CZFA 1YMMB 3BPNC 4HJJL 2ENSA 5DJZA 1MI5E 1AHWB 1FCCA 3WIHA 5EC1A 4MAYA 2HJFA 3LB6C 1Z2KA 1NGYB 4M1GL 1T0MA 1FN4A 3SKJH 1MCKA 3PWLA 1BVLB 3WL9A 1RD6A 3CLFH 1QFWL 4BSVB 1LGVA 1A7NL 1N6QH 4N8VA 1E28B 5IJKC 4OCRL 5CWSB 1OGAA 4HUMB 4EBQL 4LSTL 3THML 4KDTC 4NWTH 2I9LA 3QXVA 5DFVD 4NUJB 4RGNE 4EUPG 5KSBB 1UZ6F 4P2OD 5A2KH 4JFXA 3QG7H 4HIIB 3MUGA 3P30H 3FQUB 4XBGB 1L0YA 1CFSA 4MNGB 3DUSB 4M48H 4HBCL 4BQ8A 5FCSH 5CILH 5IUSA 2A6KA 3BT2L 2AXGB 2NY1C 1MOEA 2X2YA 1WZ1H 1H8OA 2O61B 4P2OA 4UTAH 5IFHH 4XPHH 5B4MC 2Q7NA 1A64A 2DJ4A 2J6EH 4Z0BL 4WEBL 4E5XB 3ULUF 5HYSB 3TC9A 2BVOB 3UBXG 3EO1B 5ID0B 4WW1B 2FLBT 2W65A 4LSQH 2DIAA 5AYQA 5C08D 3MNVB 1NCUA 5B39A 1QBLL 2FR4A 5DJDA 1UWGL 2QJDA 5D2LA 1KB9J 4P3CH 1AGDA 4HPYH 3ZO0A 1B0GA 3MSPA 2XZQL 4ELMA 1CDIA 4ZUTB 1WUNT 4MAUH 4BH7B 4PJXA 4FFWC 1FE8L 3CFCH 3L5WA 3KYOA 3T4YA 1BJMA 5I15H 1H3UA 4XP4H 4C4KO 5BOPA 1NAMB 1RZIB 1UB6A 1RSFA 3CPLB 5SV4A 4GG8A 1QSFB 3QIWC 4QT5A 1LK2A 2MMXA 3TPUA 3SDAB 2ILLA 2Y5TA 4Z7UB 4YDIH 2UZYB 2CKBA 1KIPB 1ADQH 4UV7L 3L6FA 4OGAC 1T1YA 1ONQA 3JUZA 5C2UB 5SWQB 1QR1B 4OLYL 1D5IL 2B4CL 1FC2D 1W0VB 2QQLL 2GKIA 3Q0HA 4MAYB 1IKNA 1TMCB 2YD6A 4R96B 4HCRA 1DTUA 1X4ZA 2KKQA 4QOKE 5F9OL 4HJGA 3UPAA 4TRPH 3LQMA 5C0RL 4PJIB 3WMSA 3WIIL 3NIFF 5HI3C 2R4RL 1BAFH 2NY2B 1BJ1H 4ZTOL 2XA8L 2YUZA 2VQ1A 5JXED 5MP6H 4NO5B 2YR3A 4LVNB 2ESVB 2VXQL 2D7MA 5INDA 3L3IA 3PHSA 4LMQE 5A3IC 2QQNH 5FM5O 3MJGX 4PGCA 5IBUG 2PCPA 4HKXB 3S34H 4J7RA 4OQTH 1YQVH 4XP5L 4EVNA 3S9DB 3IDIB 4JFFA 4JREB 1QFWI 2ICWI 5J89A 1A7QH 3L3KB 2CK0L 4YJZL 1ORSA 1P84K 4CL7A 4YDLC 1RY7B 4PJBF 2C4FU 3T4AB 5TH2A 5T3XL 1S5HA 1HHGA 4RISL 1TETL 5BV7H 1I1YB 1ZLUK 1MHHA 4G9FE 4TTDC 2J4WH 1FZOA 3GSXB 3RA7L 1ZVYA 3NZ8B 3OJVC 5EPMB 4APQC 3TH4T 1KLGB 1AKJD 2P8MA 2YPLD 2R2BA 2GJ6B 2Q6WA 2PO6A 1EH9A 4YHLH 4X9HA 1MCOH 3FZUD 5ISZE 1U8LA 1MFCL 1TZIA 5TF1L 1V3KA 3VU2A 2RHEA 5B39B 1BGXL 4HWBA 4UI2A 2R2BB 3SE8L 1DQJB 5DD6B 3RVXC 2E7MA 3TT1L 5D96C 4HULB 1D5BB 5C0AB 2EEDA 4Y4KC 3EJYD 3V2AR 3WSQL 2JJWA 3S37X 1EHXA 2P48B 1G7JB 1A7RL 2F19H 5HJ3B 1OY3B 4GT7A 4P99A 1YEHH 5IFJB 3MRRA 4XX1E 4QXGL 1LO5A 3GSNH 4DVBA 4JZJC 5BJTB 4WTZG 4IRZH 5DZLA 3VXTA 5E1HB 1K2DA 1NSNL 1T5XB 1H5BA 1EO8H 3KGRA 1PJ9A 1U41A 2BHZA 4NQEE 4PJXF 5IMKB 3QEUB 5TDOA 4ZAKD 4EI5B 1CICD 3SDXF 3V0AC 5IQ9B 2OJZH 2BMKA 5GGUB 5TQ2L 4FQIL 3MA9H 5TE4L 4N5EC 5JQ6H 4KK9D 1KPRA 5IHZB 4BQ9A 3VFOA 5CEYA 1E0OB 1NFDF 4NFCA 1CLYH 3MREB 2OP4L 1QKZL 4P5TA 3GSVA 4FQXA 1FQ9C 1CLZH 4ZFOA 3ARTA 4R90H 5MEOA 3G5XA 2I26N 4L29B 4OLXH 5T3ZD 1SMOA 3C9NB 2AJVL 3O2WH 1A14L 2F8OA 4XC3L 1FH5H 5D71H 5J7CC 1S78D 2Y7QA 4H0GA 1XEDA 3PUCA 4HHAB 4XP6L 2BC4A 2GJZA 4XVSH 3MLWL 3OF6A 1GGIL 3MMEB 4JQXC 1UQSA 2D0GA 4L8DA 1N3NA 2F53D 3IF1B 1KJ3H 5J1SC 2P5EA 1VADA 1RZFH 1IJ9A 4JHAL 3MGOA 2FSEA 2VLKE 4RFNB 4MSWA 2VRAA 1R3HA 4Q2ZA 4NN7C 2GAZB 4DW2L 3MJ8A 1S7WA 5E8NB 3QFJE 4PJBA 3NH7L 3SBWC 5DI8A 3MOBH 3LPWA 2PYFB 2Q8BL 4KDVA 5BS0E 4Z7WB 3NPZB 4E0RA 3TYGH 4IOIA 5J6GA 1NC4B 4PBXA 4EQ2A 3WL9B 5AD0B 1MI5A 1F3RB 5EU6A 1S7VA 5DMJB 2F5BL 4HUKB 1S7SB 1U8KB 4GAYA 1BOYA 1N59A 5DA4A 4I4WB 1F2XK 1NGPL 1KF9B 3CFBA 2P5WE 2H26B 4HFWB 2DQHH 2E7HA 5E6IB 2EIBA 2DIBA 2DYPB 1JGLL 5DMYA 4EN3A 2XWTA 4JREC 3A6OA 1PQZB 1O0VA 2GJ6E 4R7NB 2X7LB 1OWRM 4MDJA 4JPIA 3EYFA 4PJGF 3MRIB 2WWMC 2XQYK 2H3NA 5SWZE 1Q72L 1RUPL 3N1GC 4JN2A 5IJKA 3CSYB 5DQ9B 1G6RH 1T66D 3MRNA 2B4CH 2XN9B 4DVBB 2R56L 1UYWH 2E27H 1QLFA 1ZA6B 5F1NB 3UZEA 3I6LE 1K5NA 3T0DA 1X9QA 1S9YB 4LCYB 3TO4D 3SGJC 3PQYB 1T1XA 5CD5C 4JN2B 5HDBF 3BP6B 2RBLA 4GMSH 2FBJL 4HC1L 3RUGB 5CKGA 1DQML 2Q76B 3QUZD 1P7QB 5I15L 3SY0B 2P7TB 2E5EA 5FYKH 1MREH 1AKJB 1S9XA 4PREA 2BVUA 1T03L 1SMAA 3GRWA 1UB6B 4YBLB 1HILA 3REWA 2NCMA 3T4YB 4ZUUB 1ULVA 5HHQB 1KTLA 1I8MA 2AQ1A 3Q6GH 3T2PA 5F6IC 3RWFA 4NWUL 1S7RA 4XXDB 1BLNB 1R0AL 2D31B 3EUUA 4MD4B 3HRZA 3LKRA 3VXPA 4LLMB 1NFDA 1WJ3A 3U2SB 4XAKE 4LDEB 3TLRA 3AS0A 2NLJA 5GZNC 5F6IB 1KGCD 4OB5H 3WUWB 2IG2H 1OTUD 3QQ9D 2A6DA 3ZE2E 4EJ1C 3CH1A 3N9GL 1GC1L 2GYSA 4HXAH 3ZDZF 1EMTL 1P7KB 3NH7H 3UZQA 5ISZD 3BP7A 1ACZA 1MHCB 1QPXA 3W81A 5L9DH 3FN3A 5TFSH 5C09A 3DOSA 4XBEL 5ICXA 3QUYA 5GSRA 4WRLA 3SOBH 2NXZD 3TN0D 1HIML 4Y2OA 2IMMA 3EOTL 2PTUA 2JIXA 2K3TA 1FL5A 4YZFF 1U8OA 1S78C 5IBLD 1ZT4A 2PTTA 4V1DE 3V5DB 4CDGC 4CU6A 3R0NA 1WBYA 2D9QB 1D9KB 4OCWH 1OP5K 3L3DA 4DGIL 1UA6H 4PJ7F 2YD9A 1J87A 2YS4A 1AD9B 2NY1B 1JRHH 4JRXE 2HT3D 2FEEI 3QJHB 1C1EH 4GXVL 4HUUB 4ZS7H 3LQAH 3B6SA 1FRGH 1E4WL 5DQJA 5SWZB 2I9LB 4YPGA 5SX4H 1HYRC 2NMSA 1MCIA 5GGVY 3TO2A 1VEPA 3BPCB 3ZTNH 5LWYH 4TQEL 4M5YH 3NCFB 1EEYA 3WFBL 1PKQE 4M6MH 5CD3A 3NCYP 4ZYKB 1S7UA 4JDZB 4AG4L 4MQ7B 4PBWD 4ZFOL 1U8JB 15C8L 2HKHH 1T1ZB 3QNZA 3T3ME 2DQJL 1KJ2H 5CSBA 4H25A 4X83A 4QRRE 5LG1A 2Y36H 3RUGA 5E00A 3CH8A 4JPVH 3DV6B 5I30L 2RFXB 3G5ZA 3OPZH 1QSEB 5EFIA 2IH3B 3S4SA 2ZOLA 1MRFH 1KJMB 4GRLC 1MWAA 4M5ZH 3KPSA 5D93C 4YC2C 4Z7UE 1HKFA 1F3DH 5IVXA 1LO0H 2V2WB 5FGBC 4ENED 4K07A 4ODVL 3FT4A 1N64H 1EZVY 5C86A 2Y23A 2DQUL 3DETD 1C5CH 5HDQH 5SWZD 3VGEA 5I1IH 2WUCL 3U9UB 1A22B 1VPOH 3CSBA 3BH9B 4APQD 4KY1H 4OLVH 4QT5B 2NY1D 2A6IA 4GLRI 4ZFZB 3MRGB 1DQLL 1OGAB 3NTCL 2GUOB 5EOTB 2VZOA 3DV4B 1NFKA 1BVZA 4OF0A 2M2DA 2RCSL 4PV8B 2BCKA 3GSWA 3MGAA 5FYJL 3D2UD 2C3VB 1GXEA 3BHBA 2JCCB 1Q94A 3PL6B 4PJDB 5BCAA 5FYLL 4Y19B 1FCGA 1CLYL 5LGKA 3BWAA 2GSGB 4I0PA 4CMMB 2PYEA 4MNGA 3GGWA 4Y5VC 3WFCH 1G7QA 4HS3A 3P9LA 3QEHB 1FGVL 3E2HC 3UYOD 4E5XA 1CTNA 5E2UH 3F58H 2IGFL 1EO8L 2WIIB 4WHCA 3NAAL 3GKWL 1QQDA 3EOYG 3KJ6L 5MEND 4XI5D 4GJTB 3SCMD 3L3OA 1JYVA 3C6LD 5GS2H 2ZUVA 1X5AA 2CLRA 1EO7A 4HK0B 5EO9A 4JFEE 5EBWA 2X42A 4AL8H 5EH1A 1D5MB 2Y7QB 4ETYA 3L3KA 4U1MA 4KI5C 3VFMA 5JORA 4LEOB 5HHOA 1D5XA 4P4RB 4WU5A 4GAGH 5L7XH 3RY4A 5GSVB 3CIQA 5HI3D 2IMNA 3C6LC 5TF1H 4K94H 3ARGB 3HMWH 3QIWD 4XH2B 3DI2B 3HRPA 1QBBA 4EUPA 5C0JA 1KPUA 2XA8H 2X4QA 5CIPB 3P73B 2FHBA 4KVNH 4U0RB 1CT8B 1HI6B 5D70H 4NUGL 3HE6B 1I9JH 4Y16B 2BSSB 5IK3A 5C8JA 4ONGH 5I19H 3QAZC 4JKPL 1F13A 4PJHB 5DLMH 2R8SL 1AIFB 2EDXA 5F7DA 3SJVB 1TETH 5BV7L 4ONFL 2P47B 3SO3C 2F74A 4C83B 1D3CA 2DQDH 1WSST 3ESVF 4X4ME 4XCFL 5HHME 1XIWB 3RWDA 3TZVC 4OCNC 3NA9L 2QQQA 3U4BH 5IGXH 4UV7H 2VSDA 3DHMA 2VXUL 3D3VA 3MLVH 1QBMH 5EU6D 1RIUH 1DEEA 3GHBH 3MYJA 3KLHC 1OCWL 4WWKB 3QUMB 2NY6B 3RWHB 1EIBA 1XGUA 5IVXF 2A9MH 2FZ3A 3ULUC 1FBIL 1YA5A 4M6OH 5EN2A 4PRPE 3UROR 3PWUA 3EYFB 4OKVA 3ZHDA 5F89A 5F88A 1MF2H 2B1AL 4YO0B 5I2IA 4OLZH 5LXGL 1JPTH 2AVGA 4WNQB 5FDWB 3LV3B 3CGTA 1PY4A 3ILQD 1I3RB 3S36H 3BP6A 4MCYA 1IZJA 3Q6FA 2NY4D 2X4OA 3OBAA 5FDYA 2NY5L 3FB8A 3KYNA 4LOUD 3EO1A 2FEEL 4KJYB 1QLEH 4JEGB 4NZUL 2A9ML 2PKDA 43CAA 4HC1A 4ZFGL 5HDOA 2EH8L 2BNRD 1SEQL 4YK4C 3HAEH 4CJ1A 4Z77B 1RIVL 2KH2B 4QWWC 2MHAA 4JPWH 4MAYC 5DUMH 1QBML 3HMXA 4F7TB 1MIEL 1ZLWH 4UMGA 2C1PA 3WUZA 4QNPE 3QO0A 4PLOB 2HVJA 1YEEH 3K46A 5DUML 4KJYA 1E4XL 4KMTH 2R29H 2C3HA 2HTLD 4U6HB 2Z31C 2EH8H 5ADPH 2HKFL 4ZFGH 2DQDL 3QO1B 1S9KC 1IQDA 4JN1L 3FOMA 4KK5D 5F9AC 2WK2A 4AM0B 5C0FA 4L8DB 4RGNC 2IAMB 3SDDB 1KENL 1CZ8L 4UAOC 3D87B 1KIUA 4LCCA 1IGJA 1KCLA 1B0RB 5D1QC 5I8EA 1M7IA 3MODH 2FECL 3LSOA 5DD3H 4LSQL 3HR6A 3VJ6A 4WEUD 1Q9OA 5KVDH 2X1OA 4PRHA 3CZFB 1TVBB 2VZUA 4FQXC 3V4PH 1T7YA 1L7TL 2VLRD 1CU4L 5I8EB 4MQXD 1D6EA 1U8MA 1NBZB 1KTRL 3LN9A 4J3XA 4FQXD 3S8WA 2LU7A 3DIFB 4RA0C 4Q9CA 1IAKB 2P4AB 4J4PD 4DZBA 4WUUB 2PXYD 4OLWH 3PWPE 4ZOCA 3SKOA 1P6AB 4R8WH 4M3JA 4N1HB 5F7LB 3BZFB 4C58B 5ADPL 3UAJC 3MRKA 3ARDD 1XF4B 3V4VH 3CX5K 2FYYA 4DKFH 1BIIA 2YUXA 5F1IA 3A0OA 1U9KA 4U2YA 5C0DB 1ZT1B 4R2GD 3SKOB 1QR4A 1FAKT 5T3ZL 4XCCH 5B22A 2HH0L 1JTOA 4ZAKC 2AI0H 2WUBH 2CO7B 3X11A 3MYZA 4QGYA 3DXAA 1SVCP 1FVEB 4TTGA 1JZ3A 5J1AB 5ALCL 4S1QH 3LZFL 2NY5H 5CZVL 3FOLB 3MRQB 4HX1B 1PSKL 4HJ0D 5F8QC 4WWKC 3SE3A 2GK2A 2EXYC 4MVBC 3WIFA 4Y4FC 2J8HA 4UNVA 1R24A 4UOW0 4GUPA 2GITA 3BP5B 2H32H 1JPTL 2XY2A 4JE4B 4UQ2B 4K55A 3MBED 4Z5RB 4JVPA 1V7MH 2OQJA 1P4LB 4XPTH 2FWOA 4P4KC 5D7IB 4Z7WA 4E0RB 3PP3H 4LPTA 5IHLB 5DD1L 4XMKL 4U1GC 3TBWB 3T09A 1I7UA 1FJ1B 2HFEB 1INDL 2XNAA 5HBBA 1IL1B 4GRLD 4YDVB 4B7IA 3RP1A 3QEQD 4YC2B 2DWEA 3BPOC 1TJGL 2RJMA 5D93B 3DX6B 4UIMA 1RZ8B 2YK1H 3ULVE 3U0TA 1HDMA 4JFOA 4YHZL 3RZCB 1CDHA 2VKWA 1QVOB 2EZ0C 3N85H 3QDGD 4E41D 1ZXQA 1BFSA 5DJXA 1FGVH 4X8JB 3GK8L 4G9DA 5B8CA 1R3JB 5DVOA 4NOBA 2P8LA 2DI9A 5E7BA 1LVEA 5GS3A 3ELAT 3SQOL 1P2CB 1IQWH 3HZMA 3SEPA 1PZ5B 3PF2A 1LO4H 4PJFB 5C0AE 4ZSOB 1R5WA 2HN7B 1C5BH 2W9DH 4KV5E 3UJIH 4F9LA 2DM3A 1C5BL 1YEFL 4WUKL 2EEAA 4K7FB 4OGYH 4QXTB 1Q9LA 1JWUA 3GIZL 5D1ZA 3SDAD 5IG7A 1DQDL 1AD9A 3QIUA 3BGFB 2ESVA 4EZMA 1Q1JL 3GBNH 5F9JB 1JNLH 2VLMD 2DIJA 4JANB 5A3ID 2AXFB 4MMXC 1VPOL 5TGBA 1SBBA 2A1WL 5ACLA 5IHUL 5FUOH 2LU4A 1NUNB 4GKOA 4Q9QL 1BZ9A 1EA9C 4YAQA 4GQ9L 2G9HA 3TVMB 3MRBB 1A3RL 2VLJA 3ROLB 1S5IH 4RMUA 2VABB 4XTRD 5HY9B 4M5ZL 1AGFA 4ZQKA 5C92A 2GQHA 3TESA 5TQ0H 1KN2H 4QRPA 5DD5H 1KGCE 2A6DB 3JWDC 5ACZA 2V2XB 3W82A 1DBBL 4PG2A 2NX5B 1QLRB 2CLZB 3IDYB 2BSSA 5C8JB 2VC2L 1EMTH 5HSFA 5KSUB 3E6FB 1TCRA 3ARVA 4GBXC 3WNPA 3RU8H 4WFGD 4X7DC 4U1IA 3JTSB 4G8FB 3O6LH 5ANMA 4JJHA 1LD9A 4KK8D 5FKAB 3K7UA 3DSNA 1M4KA 2QKIA 2C26A 3MRPA 1TCRB 2F58H 1X5XA 4H1LA 3QIBD 4KQ3H 5CZXD 2QADD 2OQJB 4Z76B 4HIJA 4GRLB 4JFFE 4K7PH 4TSAL 2FZ3B 2EDDA 2HLFD 2P8PB 3EJZD 4OI9A 3QCTL 5DVNA 3P3YA 1ZT7A 5C71A 4M7LL 5TDPB 3H3PL 1RUAL 3MBXL 1KSRA 5EULV 4M61A 1A47A 2D4DA 4WI9A 1N26A 1MQ8A 5IB2A 1OB1A 3ULUD 1UWXK 4HUWB 4ELKB 5DJ2B 4HCRH 4UOW1 4HIIA 3GSUA 3E6HB 3HC4L 3KLHD 2CUMA 3ILPA 2NW2A 4WI4A 2W0LA 4HW6A 5DZOA 5E6IC 3BN3B 4D9LL 2VUYA 2NPLX 4DKAA 1EFXD 3PDDA 1QSEA 1TVHB 1ADQA 1GZQA 1U3ZA 1JGVL 1MQKL 2EIZB 3STZB 3QQ4A 3U0PA 1FZMA 2DLGA 3VGAC 2BFVL 4I8DA 2DQHL 4HUXA 2V5TA 5ALBH 4HK0A 4JY5L 3RJDA 4CVZA 1CD8A 5D7LD 1QD0A 1NCWH 3L3IB 1UVQB 5IVZB 5JNYB 2P5EE 3M8OL 5F97E 1FZKA 3QFJD 3K2UL 5F7UA 1RUKL 1D5MA 3RTQC 1U8HA 5DRZB 1JL8A 4ZO9A 1ZMYA 2G5BB 1P84J 1PEWA 5C3TA 3VFVA 2VH5H 5LQBL 4FQ2L 4LK4A 3PABA 3U46A 3CDGA 4JPWL 2R0WH 1FYTD 4X7EC 1P9MC 1CBVH 3JWOL 2YSSA 4L8SC 4KKCD 4WFED 4C57C 1WFUA 5E7FA 1ZKAA 4ZQKB 4W6XB 1VENA 1IC5H 3GO1H 3BHBB 3QUXD 5KSVA 5DRWB 1T1YB 5FO8B 2AXJA 2DLIA 2FNBA 3W9DB 1I7ZA 3RGHA 1CFVL 3HB3D 4NYLB 2FGZA 1F6LL 5DRNB 5HXMA 4G43A 1L7IH 4JO1H 3OKYA 5K9KA 5LXGH 2Y9RT 3SCMC 3O0RH 3VFPB 2XXMB 3D0LB 1OAUH 5CEZD 1MI5B 4LEXL 2B2XH 3UCRA 4I18A 5HYJD 1S7TA 4P23D 1T0PB 3KS0H 3EYOA 3NVQA 4EI5D 1KCKA 4NO5A 5B38G 3VFOB 3JV6B 4LRIC 5HVFB 3QIBA 5HHVH 4H88H 1PFCA 2O5ZL 5D6CB 1CYGA 1QKZH 3RTQD 2DQGL 1JGDB 4E41E 4EI5C 2XFXB 1I8LA 6CGTA 3TIDB 5D9SB 4O5LL 3LD8B 2A6JB 5E4EB 3DGGB 4QRPB 1V3JA 5FK9B 1EJOL 4XBPA 2EYRB 3MA9L 4HIHB 4XP1H 3CVHH 1FORH 4UDTB 3T04D 5DJCA 1U8JA 4DZ8A 5E56A 2P5WA 5I71B 5C0CE 1YECH 1H0DA 1MWAL 2OTWA 5A16A 4YBQD 2R2HA 4PGDA 2KQNA 1R5IB 43CAB 3ZYJA 4GLRH 4MHHI 4QHUB 1CXKA 1KJMA 5B3JF 3S4SB 1LWRA 4K3EL 4R4NC 1N8ZA 1BBDH 4TNWK 3VXSE 5CJ5A 4N5UA 1EHLH 4Q7DA 2MNUA 3PWLB 4LSUH 4PIRF 3UBXB 3O9WA 3BISA 4M8QA 3QXWA 4U49A 1VFMA 4R4FL 4C83A 2MPAH 1JGLH 4OZHF 1T2XA 1NANH 2B39A 5JZ7C 1AIFA 1X4YA 3JV4B 4PRID 1NJ9A 4W4NA 5BZWB 1MPAH 1CE6B 1PG7X 5C0FB 4DGYH 3QZWA 5EU5B 3WJLC 3DURA 1YEDB 4WI3A 1O7SA 4M03A 5D2NB 3VG0H 4ZDHA 1HOCA 4NO0D 2P8LB 2J5LB 2AJXL 3T0XA 1R3LA 1QNZH 4GRMA 4YNYB 3AXLB 1WF5A 3DI3B 3OXRA 5FECB 4FQHB 4FQPA 2AS5M 4M1DL 5DO2D 5SX5H 4NO0A 1PYWB 3IRPX 2Z35B 1ZANH 5A2IH 5GSRB 3H9SD 5F21B 1CS6A 4EUPH 1RZFL 4K7FA 4Z9KB 5JZ7D 1CVSC 5EUOE 3QUYB 3C6SB 2DDQH 1PG7H 2VO5A 1FVCA 2FECI 4WNQA 1FFNB 2QR0A 5D6DA 3RIAF 3QUYC 1GOHA 4CRPA 3E1F1 2MCPL 3RKPA 1INQA 5F70A 1AP2B 1NDGB 2Z4QB 1KOAA 2ZWLT 4HWBL 5JNYA 4JFPB 1UXWA 3F5WB 3PDGA 1JFQL 3B5TA 4HIXH 2DBLL 1SBSH 3EKCA 5FIEA 1FYTA 4XMPH 3QXAA 1FZJB 4MD0A 4Z7VB 4YHKL 5CHNB 4KVCH 3JUYA 1DQTA 3KLSA 1QFHA 4H5SB 2WBJA 4HWBH 2NXZC 3WNLA 1A1NB 1HILB 3Q1SL 4JRYA 3GSQA 1B3JA 1W0VA 2DI7A 3LQZB 5D5MB 3N1FC 1JWMB 3CMOL 4EDXB 3MLUL 2A77H 3DVGB 2ZCHL 1OGTA 3MV7E 2EYRA 4P9HC 1JF5A 4Y4KB 3GUTB 1IEBB 1ZA6A 4WTZA 1T2JA 5DHYA 4OLYH 3RHWK 3UJTH 4JPVL 1K85A 1HI6A 3OXSB 4I3GA 3HE6A 1FSKB 3CXDL 4GW1A 3RPIA 2MTPA 1N59B 5E70A 3ZE1E 4AG4H 3INUL 5T1KA 2I9TB 4J6RH 1CDGA 1PLGL 3LEXB 5ILTH 1F90L 4PJCF 2FCBA 4PJEB 2YD7A 3W2DL 3T3MF 3LKPA 5IJVB 4ELME 1JN6B 3KPLA 1F6FB 1M7DB 4YHKH 2I07A 2CD0A 3O9WD 5HGBA 1SHMA 2CXGA 4XGZB 1JF1A 5F7HA 2MJWA 2DTSA 5IB1A 4HZAA 1CCZA 1BECA 3VI3E 5CEZE 3O0RL 2NXYB 2DQCH 5IVNA 1BIIB 2VDRL 1J9CT 2H1PH 3TIEB 3TO4C 1FAIL 5F7WC 4LBEA 4P2OB 2AGJL 3IDUA 4BSWA 3FJTA 2A6KB 3V5KA 3I75B 3LN4B 3V4UH 1DDHA 1U2CA 3GMNB 4UBDC 1X5JA 5A2LH 3U4EA 4S1QL 1DEDA 2Q86B 5I17B 1TCMA 1ZHLB 4LSRL 1H9VA 3N0PB 5GISH 1JZ2A 4NBXB 4FXKA 1ACYL 2WINB 4M7JH 3AREB 1BZ7B 1FP5A 2F54A 4XRCB 2JJVA 5E5MB 3CVHL 2IADB 1CLCA 1G7LB 3DSFL 2EDQA 5KVFH 1RFDH 4YHPB 4QHMB 3SN6N 1J88A 4MA3B 4FQLH 1WBYB 1BX2B 2EZ0D 2CKBH 1OP9A 4Z77A 4Z7UF 4ODSL 3PJSA 1RIHH 1HH6A 4G80A 1MCPL 4LSSL 1QFWH 2AV7B 2CK2A 4XP5H 4FP8H 4NC0B 4KMQA 4QO1A 3E8UH 4HK3J 5D2NC 1GVIA 1RZGB 4F9LC 1KEGL 5I8CB 2FDBP 3SKMA 5CGYD 1TZGH 5EU4B 1OAXH 5EUOB 1JGVH 1MQKH 4GKNB 3U9UA 5J1TC 5I1DA 4N8CH 1JCKA 2GY7B 2A6IB 4PRIE 3I84A 2C3GA 4NQEB 4JO1L 2H41A 5DJYA 5C7XH 1WZ1L 5K9OB 2HLFC 4KU1A 1MJJA 1A6ZA 5IV2B 1JVKA 3SKNB 3AMKA 3VGAB 3VXME 1U8IA 1G6RL 4Y5XA 1PZUB 3QNYB 3ISWA 1NEZB 3MLXL 3MLPA 2HKFH 4WV1A 1XGPA 2KZWA 3VRJA 5C09B 3BFOA 2YMXH 4H8WC 2IQ9L 5ETUA 5D5MF 4BSJA 1UT9A 3F6LA 2NY6D 1A4KA 1ZHKA 4MVBD 5DT1H 35C8H 3QNYA 4ODXA 4P59L 4NZTL 3UTSA 1Q9KA 2OXGA 1U3HA 4BSWB 1OAZH 3MJ9H 2ESVE 4M1GH 2UZIH 1FFRA 3NCMA 2R39A 2IF7A 4Q9RL 2ARJA 1XGUB 4IDJH 4RNRB 2GSIB 3TEUA 3O11A 1JP5A 4LHQB 4WWKA 3SE3C 4GRWB 4HGMA 4MA1B 5DQ9A 1X5GA 3OB0K 2MQCA 4LARL 5E6ZA 3OX8B 4HIEA 2LFGA 4PRDB 3ULUH 4MS8D 2BFVH 3D3VE 2F5AH 3MLTA 2Q8BH 4J23A 3R8QA 3T0EB 2K1MA 4O9HH 3OHXA 2X1QA 4N8PA 5TF0A 4M43L 1AO7B 2A74A 5GSVA 1BD2B 3SY0A 5KTEH 1JHLH 2Q6WB 3QQ4B 3U0PB 4M6NH 3BUTA 4GG6A 1Q0XL 2EIZA 3HC4H 3GNML 4J4PA 5GS0L 1MFNA 3FQXA 4I77H 5DVMA 4QYOA 5E6YA 5H94B 2VZ3A 2NZIA 3EJYC 1T7ZA 4L5FH 2CMRL 4L3EB 2HVKB 3TYFB 3QUXC 3OG4B 5HHXH 5I74B 3WS6C 2NLJB 4FXGB 2QV2A 3HCVB 5CAYB 3F8UB 1J1XH 4YX2H 4HS8H 4Q97A 4WW2B 5JA8B 5B38B 1YC7A 4LEOA 4PJHF 1U58A 4Y19E 3REWB 5GGSA 3S98A 3VXSD 1KNOB 3QQNA 3WD5H 1U95B 1XF3A 3U36A 1KTLB 5DFVC 4LCCC 3CFEA 4PJEF 4FFZH 2LTQC 4YXKL 2YUVA 2PW1A 4XH2A 3WLWC 5K59F 2Z93B 1L9MA 3A6CH 1VFBA 5D1XB 3C6SA 3TP4A 1KPRB 4Q58C 2VQ1B 3F62A 2NTSP 3U7WL 4PJ8D 1CE1L 3P0VL 2BK8A 1T1XB 1CL7I 1G9MH 4I0CC 2ZG3A 1FFNA 2QR0B 2OI9B 2H8PA 4ZO7A 5BW7C 3QJHA 3T2NL 4ONHB 3KPRE 4LOUC 4IRZL 1AE6H 1IRAY 4AEFA 4PG9A 5DWUL 4P3DB 4RIRA 4Y8AA 5HI5D 4X5XB 4ZD3L 1YEHL 2AABH 3CCHA 4K3DH 3U79A 2RAMA 2BC4B 2FX9H 1PDKA 2D7PA 3L5WB 4OT1L 3GKWH 5D1XC 5DC0A 4OI8A 3CFKA 4HS6B 2AJYH 5EC2A 1AY1L 1BGXH 1AO7A 1LEIB 4HQQH 1AGBB 1CE1H 3KHOA 4UT7L 3KR3L 5D5MA 3H8NA 3O6KH 4FZ8H 3X3FL 2B0SL 4IMLA 1GH7A 3OAUH 2QADC 2IWGA 2EIDA 3D25B 4NRZB 5FYLH 3VD3A 4PRNB 2G2RB 5E8NA 2ZG2A 1F4XL 2GJ6A 5GHWH 3ARDC 4HQQL 1BF8A 1VGEL 2IAMA 4XC1L 3Q6FB 2V5YA 3IFPB 4MNGE 2ZJSH 5KJRL 1FFOB 3DO3A 3DTXA 5FO8A 4OJFH 1DLHB 1XR8A 3O6FA 3HAEA 3BKJH 4J3WA 5IKCB 3NCJL 4N0FA 1IAIM 2WWKO 4XNQA 4GBXD 5IMMA 4MQXC 3IDNA 1YJDL 2EEBA 1PX3A 3MRJB 5EBMB 3L1OL 2DD8L 3ARBB 3U1SH 4Y1AE 1WISA 1RHHA 2NY4C 2D2OA 4GW5B 2AJZB 4GAJH 2A9NL 2BVEA 4UT6L 4PJBE 5MERA 5AEAA 3BPCA 3K2MC 4B0MM 5BOZG 4AYFA 2YRLA 2ZSVA 4NQCD 3U0TB 2OR8A 3D1MC 1JTTA 5D1XA 4HZLB 5IIEA 3S35H 3LRSA 1AGCA 4CNIA 1PBYA 1WV7T 3D5OF 4U05A 4PR5B 3OPZL 1JHLL 3CLEH 1A5FH 2P5WD 5KW9H 3QNZB 4Z7VE 3SJVE 5B4MD 3VW3H 1N4XH 2WP3T 4MA1C 5EG6C 2ATPB 4RGOL 2FO4A 2R0ZL 4NKQB 4YXKH 1GPOL 4M6ML 5DYOB 1AGCB 4CNIB 3PHQA 1GOFA 4AIOA 4KZDH 2DQEL 4Z6AT 3BD5A 2QSVA 4OZGA 2XG5A 1DUYB 1H8NA 3P4MB 3WLWD 4NJ9L 3C60D 1OAZL 3OKNB 1HEZB 1TITA 1UH2A 2HH0H 3TNNA 3UBXA 3JWDH 3PQYE 4X6CE 4WU7A 2IAND 1E4XH 4KMTL 3NN8B 2DTML 3O3BA 4JFFD 4R3SA 2DOCA 5FGSA 2J8UA 4QHNA 3MRDA 2EDWA 1NMAH 4Y5XC 1C16A 3GSRA 4NQED 3V0WL 3VA2C 1FNGA 1U91A 4NC2B 3S37H 4JFEB 4PRAA 1JZ8A 1UJ3B 1FE8H 1A9BB 3AFLA 1KJVA 2NR6C 3BE1H 1I85A 3EDKA 3QUZB 4G8EB 2OK0L 1FIGL 3C08L 4M62H 3QDGB 4NN5C 5A40E 3VFUA 5KTEL 4DGVH 4F7EA 1CDCA 1ZLVH 3WJLA 1J0KA 2P24B 4JRYE 2HLAB 1EV2E 3Q5YA 4KAQL 5JW5A 1LDPH 2VLME 4ENEC 1ONQB 4A2LA 5LCVL 2K7QA 5HGAB 5C08A 4MNQE 3RL2A 2XTJE 2R4SH 5CJBA 3I3BA 2AKRB 1HH9A 1IGMH 4HHAA 3MV8E 2MKWA 4X98B 2V17L 3P4LA 1WZKA 4NQSB 4HAGA 3HE7B 4HK3N 4JKMA 5GS1A 2GCYB 3EYVB 4LLVB 1KV3A 3MGTB 1C08A 1RJYA 1VGKA 4FABL 1DVFB 1Y18B 2EKSA 3VGBA 4AENB 4Q9RH 4YFDB 2EXWD 5DD0H 4X7CC 1DEEB 1DP0A 3KPLB 4XCCL 4XMLL 4PJ8C 3DX9B 2YD1A 4DGVL 3GHBL 2D9CA 2H9GA 3GM8A 4F15C 2P44B 1RK1B 4JN1H 4MNQA 2VL5A 1T03H 4X6DE 4PPTA 1O5DT 3AREC 4FQLL 4NWTL 3BIKB 4EN3B 1XF5A 3MLXH 4BH8B 2HFFA 5GGSY 1MJ7H 3TCLB 2JKXA 1U36A 3IAQA 4NQDE 4R2GC 2C4FT 2NY6C 3ZT5A 3T0EA 4EI5A 1YYLH 3E3QE 2UWEB 4XNXL 1U6AH 3V5KB 4MXVE 1CL7L 2X70A 3ZDZE 2DQEH 4O2CA 2PYEE 3MQIA 3O41B 4MDIB 2A83B 5IQ7H 4L4VE 1OTTD 5GRUH 1KXQE 4RMVA 3WS3A 1KEMH 5LAXB 1MELA 2ZUXA 2DF3A 4IRSA 3MODL 4LHUB 1IEAB 5HYSA 3MA7A 1A6WL 1KEGH 1KENH 4Y16C 5HI4D 3NCCB 1HNGA 4IMKA 1HH6B 4OZHE 2HJLB 4XP9H 2WWMD 3DLQR 1MH5B 5D1QB 4NNXB 2EECA 2EC8A 4RRPG 3T77B 5CGTA 4Y89A 3V0WH 3VFUB 3HPJA 1S8DB 1J12A 5E2VH 2VR5A 2YXFA 3BPLB 1KNOA 1FNHA 4OM1L 4TUJA 1NAMA 1U58B 4KK6D 1J8KA 4FFVC 3KYOB 3HFMH 3FT3A 4AMKL 3B3IB 1IM3A 4X6FA 4X7TA 4X6EB 1RZIA 1XR9B 1FJ1A 2HFEA 1RUQH 5MEPA 4N8VB 1FNGB 1P7KA 1U91B 2G75A 4KKLD 3B9DA 1NGXA 3BKYH 4HG4J 3QUZC 2ZCHH 4HLZH 2NW3A 1HHKA 3S7GA 4EOWL 1LNUA 2PYEB 1TQCB 1UJ3C 1T83A 1Q9LB 1IM9A 5CFHA 2X4UB 3JWOC 3GSOB 3TM6A 3W9EA 3MXVL 5T5FH 3FB8B 1NBVL 4TVSa 1T66C 1MFDL 4FTVA 5I8KL 1X5ZA 1B4JH 5KW9L 3BJ91 4Z7OE 1MCWW 1SYVB 2JJUA 1NUGA 3ZL4L 2HN7A 1FBIH 1Z9SA 2XPGA 3HI1B 4RX4A 2CIIB 5IM7A 3VMPA 4OZIA 3MO1B 3RWGA 3HZYB 1J86A 2IBZY 2WUCH 5JLZB 4ODWB 5JHLL 4KTEH 5LBSL 4HGWA 2EH7H 1T7WA 4HWZA 2DLFH 4OCYL 3O11B 4FQ1H 5HHOB 3QUZA 1OLZA 1LO0L 1A1OB 3VXRB 3G08A 1EEUA 2D7TL 1XMWA 3RQ3A 3MRKB 5FHBH 3PP4L 4XVJL 3SDCA 5IOPA 3L5XH 3AC0A 1XF5B 4FQCH 1R6VA 4BZ1H 5CZXC 1HHGB 2R8SH 2JJSC 4O58L 3LQZA 2DKUA 4LLUA 1S5HB 5HY9A 5FYLE 1I1CA 2CIKB 4PTTA 1Z9MA 2MKLC 5GGVL 1SJVA 3NIDF 3MRFB 4JO2H 5CEZH 3HC0A 4AENA 5DMIL 3QHFL 1T04A 5E8EB 3VG0L 3UZVB 4OZIE 4K94L 3Q5OA 4AEHH 2VDMH 1UENA 5J9PA 4CVUA 3VDAA 1U42A 3VXSB 1DSFH 4R4BA 3X13B 5HHQA 4OFYD 1TZHB 3VI4E 1UH3A 4LF3A 3T1WA 4CBPA 3M17A 5I1GH 3LQAL 4RZCA 5DC4B 5IF0A 5EU6B 2MPAL 4X6CB 4R4FH 3ZDYE 3HZVB 4ZNCD 2QADB 1JI2A 4JRYD 3PDOA 3B5HA 5I71C 4ZFFB 1C8PA 4F57H 4OD1L 4PUBL 5E9DB 3AB0C 1MHEB 5HHMD 1VFAB 2J4WL 1QSFE 4TNVK 3FZUC 3QUMH 3MLTB 2DLTA 1N2RB 3LN4A 3VFNA 3EDEA 3QEGH 4CADB 3ULVF 3DUSA 1CIDA 3N9GH 3Q3GB 3REVB 5F7KC 5EZLB 4JQIH 4K71B 2DQJH 4ZUTA 5KBNC 4J8RA 5D1ZC 3E2HB 4JFDA 2BRRH 4K2UL 4JFHD 1BVKA 2Z92B 3UXFA 3E0GA 3GSVB 4LLWA 3GDBA 4KKLC 4RDQG 3VD4A 3PWPA 4Z95L 3PL6C 4LSPL 5EWIL 3WDIA 1N5YL 1KCSL 5F1KC 1OHQA 1WWWX 5D6DC 5HHNA 4JO4L 1OQXA 3FOMB 4FQQA 5SWSD 3STZA 5EC2B 3ZKQD 3FRUA 2ZNXA 4RFOL 5I1HL 3G04A 4KC3B 1EHLL 4LKXA 1NAMH 3G9VA 5CUSH 3ZE1F 1DQMH 4JM2C 3IU4L 5L2JB 2Q8AL 3C87A 3MV9A 4MNHB 4KKAC 3MRCB 3O2DA 1L7IL 1NEUA 4L3CB 1D6VH 1ZVSB 2VJXA 4NRXA 2B7DT 1XT5A 2ZSWB 4FTVD 4PB0H 1WBXA 4P2RB 5LJYH 1JHTA 3BSZL 1JGUH 1NDMB 5D2NA 1JNNL 1J05B 4ZG1A 4O5LH 3OKEB 2X9WA 3MV7B 4LLAA 3HNSL 3HAEB 1DJSA 4HFUH 3V8OA 2V5RA 1HSBB 1RJYB 4MCZB 4LCIH 2E8YA 4HBQA 4H0IA 3MLYL 1T5XA 4PGJA 1GL4B 1RUKH 4LLYA 4JFZH 3I50L 4M4PA 3GHEH 4WCYL 2HJFB 1FNSL 1RZKC 3QDAA 1BQHB 4PJ5E 2PO6C 3LEXA 5AD0A 1YYML 2UZIL 2ZOKA 1DFBL 3JSSA 5J56B 3VFSB 5CJ8A 4BK4A 5KN5B 3Q6GL 2E3VA 4LF3B 1I1RA 2R1YA 2E9JA 3FO2A 4U33A 3H0TA 5EN2B 3VI4F 3FFCB 4LSSH 4PJEE 5BRZD 1YQ2A 1E4JA 4TUKL 5J12B 1QFUH 2NW2B 1OP3K 4N0RA 3NIGE 1T21A 4M7KH 3B9KD 3HPLA 4WGWB 2J8OA 4NQXA 2FBJH 4HC1H 4YR6B 3IVKA 3UO1H 3BSZH 4MB3A 4N9GA 2VXSL 3SKUD 5A1AA 1ROWA 5ABDE 1LE5B 1UZ6E 2VIRB 3T4AA 3JWOH 3GMNA 4MGXA 3IJSA 2F53E 1NCNA 4P23C 2D0HA 5IWLA 1U3HC 1A1NA 4LPXA 5C7XL 3RVUD 4XPFH 1MFBL 5IW3A 3L5JA 5I6XC 3IGAB 4R4ND 5D72L 1W8NA 3UP1A 1MAML 1MRDH 1KG0A 2AK4D 4UTBH 2Y6SC 1FNFA 1JUFB 4Y5YA 4I2XE 4XC3H 1XCTB 4N8VG 4LSPH 1KCRH 1OAQH 2NXYD 3QUYD 5EWIH 4EXPX 1N5YH 4JFPA 4ZFOB 4M9OA 5HPMB 4ZDHB 3F7YB 5L2KA 1FLRL 2DQTH 5FO9A 2R2EB 3KYNB 5CJQL 4XXCC 3O9WB 5I75C 4AQ1B 4ETQB 3S97C 1KBGH 1CVRA 3LDBB 4LVOC 1JJUA 1CXIA 5E8DL 2D31A 2ADGA 4ERSH 4ZFZA 3IDYC 1T7XA 3KG5A 4K9EL 5B38A 4HKZB 4QRRA 2W91A 4PG2C 1NJ9B 1P2CA 5GGVH 4O2FB 4ELKA 4PJCB 3GSOA 4IS6B 2NXZB 2IPUK 2X4UA 5SWQA 1IM9B 3C60C 5FB8A 1V3LA 2VDLH 2JTDA 4I9WE 1MRCH 4Y4KD 4X4XB 3K4DA 3GMMA 4OQTA 4MD5B 2BVYA 3CX2A 4NBZB 3X14B 4F57L 4YLQT 3MLUH 3FO1A 3H7BA 3IDJB 3WKML 2ZOKB 4D0BA 4NM4H 1U8IB 4W70A 1FFPB 1F45A 1U92A 3BEVB 3I6LD 4JHWL 1E4KC 1MNUH 1EK3A 2DL9A 4MA7L 3EO0A 2JE8A 4XVUC 3I02B 3LMJL 5CBAB 2JB6A 3IJHA 2R1WA 1E4KA 2AXFA 4X9BA 3MO1A 3BDXA 5IM7B 3EGSA 5INCA 2F58L 2XN9D 4KVCL 3LH2L 4LVEA 1XF2A 1WTGT 4JZJB 4K8RC 1CWVA 2C7UB 3JTTA 5E8OA 3OKDA 5KS9B 4F2MA 1QUNA 2VSCA 1XGTB 3HUJB 2B1HH 1T6VN 5MEQB 4JO2L 3MR9A 2CJUL 4P2OC 4O2CB 2R2HB 5LGJB 4U6XB 1UJ3A 3TO4B 4PB9L 4C55A 2XY1A 3ZDXF 2EDTA 4H0HB 5F1OB 4PS4L 1IMHC 4E42B 2XV6B 4WFGE 5AAWA 4NO3A 3EIFA 1YY8A 2ZG1A 3O6ML 1AR1C 5C6TH 3RIFK 4U6XA 3IXAA 3PP4H 2ZOLB 3PIQA 1SEBA 3DRTA 1IAOA 3CXHJ 3IB4A 4N90E 4QY8A 4FG6C 3G5ZB 3GFUA 5ITBL 4W4OC 4RFNC 3HFML 1MWAB 5FM4A 4PY7B 1A7QL 2Z9TA 2X9XA 3TBWA 4BM7A 3VRLF 3QZWB 3VWJB 4OZFA 5T1LB 3GUTA 5E6ID 2OJEA 3S34L 3VFGH 3U30B 4GQPH 4WUUA 4UV4L 5DJAA 2GW5A 1E6OL 1YY9D 4KUCD 5ACMA 5E8DH 1A14H 1F4HA 5I66B 2ICWJ 1YEIH 5ANME 12E8L 3CU7A 4G6ML 1AC0A 4GBXA 2CRIA 3U4AA 2CDGA 4WDIB 3EYQC 1GYAA 1T1WA 3RWCA 2R9HC 4QRPD 1UKQA 2YN3A 1JIBA 1QZ1A 3EJZC 4LGPB 5I66A 3ILPB 4YHLL 1IQWL 2FD6H 2Z93A 1PSKH 1BBJB 1CK0H 4IRSD 1ZOXA 3ZZ1A 4M8VA 3D69A 3RZCA 4LVNC 2AI0L 1VFOA 3EDJA 2BSTA 5ITBH 3RA7H 5CJXA 4WW2F 2WIIA 5DS8B 3ARFC 4CN4A 3ARGD 3LKQA 1BQHG 1DBJH 2UY7A 3CX5J 4KK9C 4H1LH 4LGRB 3UO1L 3QJFA 5T3XH 3BD4A 4FXKB 5JLZA 1F4WL 1G9NL 5D7IA 3OKNA 5IP4A 1EFXB 3WSQH 4WTWA 3SE9L 1MCEA 5GGRB 1YUHA 1IC4H 3TT1H 5M95B 3FN0L 3IXTA 3DURB 5CD5D 3DMMD 1ZLVK 2J12B 4OUUB 4RMSA 2ZKHH 4QRSA 1EPFA 5I73C 1L7TH 1W72L 5SV3A 1XF1A 3EFDH 4UAOB 1G7MB 2VLKB 5F3BB 4ZO6A 5C08E 2H2SD 1FHGA 2UVEA 2DM2A 1IGML 2RGSA 5EBLB 2HT4C 5EB9A 1OT2A 2NW3B 4LCIL 1NEZA 2OZ4L 1UM6H 4PGZA 3QHZH 1NGXB 1H3PH 1NH6A 1MNUL 4JPKH 1YYLL 2JCCF 4PJDF 4UIKL 4CMHC 3JV5A 1Z9OA 3VXQA 1HXYB 4FHBD 4YQXH 1AQKH 3LKSA 3P4NB 1I1FA 5FGBA 5EPMA 4NZRL 3DROB 4PB0L 3MBEC 5EIQA 2AEQL 1U3HB 4IRJC 4TSCL 5IV2A 1MJJB 4GRLA 4UILH 4LQ1A 4JJ5A 4JFYB 4KGJA 1ZGLB 2XPGB 3HI1A 2E7LC 2VH5L 4WY7L 3D2UA 3R1GL 4RMWA 3OAZH 5EA0H 4YDLB 4NCC2 2HA1A 3OJDA 5EOTA 1RJLB 2ICEA 2ORBL 4U1LA 4CW1A 5D9SA 7FABH 2XZQH 4IEFB 3N1QC 4WCYH 2HT3C 2ITDB 3B43A 1H3WM 2JJTC 4J3VA 4X5WA 4KHXL 1NBYA 3QDMB 4YDKL 4XTRC 4XT1C 1YEGH 1KC5H 4OLZL 3E3QC 1KN4H 1BPVA 2AK4E 2X70B 5JOFA 2G60L 5JW3L 3HUJF 3NGBC 1I8KA 1UEMA 3TNMB 4ZXBB 4QHUA 1A0QL 1MFBH 3IGAA 3MRFA 5D2NE 1MJ8L 4PYGA 5KAQF 1CFQA 3IFNL 1OTSD 1TNNA 1CBVL 3LEYL 1OOAA 1MCSA 4UT6H 5B3JE 3P11H 2A9NH 3ARDA 1D6VL 4FQQB 2HJLA 3VDCA 3QQ9C 1OSZA 5MENE 2ZUWA 3IFLH 5TE6H 3JWDL 3RI5K 4YHPA 3AS1A 1A8JH 2CKBB 4LPUA 1QFUL 4OCSH 4JO4H 3BQUD 3DXAE 4QGTA 3QIWB 1YEJL 4WI6A 1HK6A 5IEHA 5MI0B 1ITBB 2EDEA 4L8SA 5D7JD 2O5XL 4D9RD 4MB4A 1I8MB 2YPLE 4NHCL 2MFNA 1JZ7A 4PJIE 2NY3C 1I75A 3TA3D 3ARGA 2DRUA 4PJ9B 5HGAA 3FQWA 3LPGA 3ARED 2WBKA 3CVIL 3O3EB 5DJ6B 1U95A 4XNYL 3ESUF 4H20H 3U36B 5ESAB 2K9UA 3O6KL 4FZ8L 1MHEA 4YBHA 5ADOL 4MAYD 1F8TH 3S35L 5T1DH 1WWAX 4ODHL 4POZC 4IJ3B 4P9HL 2EXWC 1A6VH 1UCBH 1DBBH 4P2YA 1I8IB 4MA8H 3WXVH 4JKWA 4PJHE 5CSZA 2HT4D 4TPRH 3PWPD 1JZ5A 2FX9L 3GMRB 1VFUA 5H37G 1ZLSH 1XIWA 4EDWL 4U1SB 2DD8H 3OKMB 1ZHBB 5AZ2L 1S5IL 4M02A 4YWGH 1GJIA 3WLBB 4UINL 4ZOAA 1KUMA 4XWOD 1J1OH 3C60A 3P4MA 5FYJD 3BKJL 3WO4C 4W6WB 3KLAA 5IHUH 5MEQA 4HWZB 1DLFL 4KQ3L 1J8HD 4YXLH 3J8F7 4TUOB 4UB0L 3VFVB 5B3NA 3OKOB 4LKXB 2NY0D 1CT8A 5IT2L 4KVNL 5CJOH 4OKVB 3MCKA 4YH6A 4TTDD 1GGBH 3MJ9A 4LHUD 4TN9A 3UEZA 1YNTB 3RWIA 5JTWA 4ZYKA 1MEXH 2XWJA 1UWEH 4LLUB 4K2UH 3RU8L 1FZMB 5F7MC 3Q5TA 3U83A 5EZJA 4HUXB 1FVDA 5J11C 4KKBD 2RCSH 4JO3H 3STBA 4Z78B 5K9JH 5FHAH 3CJJA 2WNGA 3D0VB 5FKAA 1HSBA 3MOAL 2IC2A 2XIDA 5DD5L 4JRXD 3OKEA 5DGRA 3RAJL 3L3GA 3S4SG 5EDXA 3BKYL 1CGUA 2BDNL 4HS8L 1I1AC 4JDTH 5FHBL 4OLVL 4GKZB 2BNRE 1LO2H 4ODXB 4DOHE 5HDBE 2XNAB 4PJGA 5L2KE 3EYQD 2DLFL 2DWDB 3KYKH 2W0PA 4OCYH 1NGZB 2Y5TB 3V8CA 3L3HA 4N0FB 2LV4A 4Q9QH 4PJAA 4OFPA 3O6FB 4HKZA 4QRRB 4YUEH 3NAAH 4AK1A 3DO7B 4NNPH 2P8PA 3T2OA 2D7QA 1NC4D 1CXHA 4GW4B 1BFVL 2BNUB 1JWSB 4G8GB 5ADOH 2OR7A 3VXOA 3TWCL 5CP3H 1IGJB 3HLAB 1NBVH 2HKHL 3MXWH 1LNUB 2BRQA 2ZSVB 4PV8A 5DR5L 3MV8B 4OCMC 3MNZB 2EE3A 5FV1L 1HOCB 2HTLC 4PJ9A 3GMPB 5TPWH 6FABH 1MEXL 4QKXB 2W65B 4OV5B 3EYVA 1ODAA 32C2B 1BREA 2E7BA 1GGBL 3ZTNL 2NTFA 5IMLA 5H35B 4IDJL 5DO2C 3PJSB 3MFFA 4FFWD 3AU1A 3QEUA 3CD4A 4J1UA 1E27A 3VD7A 2VLRB 4MXQC 1RZKL 3WIHL 3ZMRA 1XF2B 4UT9L 1VCAA 2E9BA 2W38A 4K8RL 1CGSL 3TIDA 4HH8A 5HDQL 3MV7D 4KUZL 4FQCL 1H5BC 3K80A 1XH3A 5IMOA 5FOBA 1P1ZB 2HFFB 4G3YL 2EH7L 3OJ2C 1Q0XH 2NY3B 3A67L 1H0DB 3HNVL 3PWNA 4JY6B 4UIKH 4QRUA 3V5HB 2CGRH 3WEXA 2GT9A 4ODHH 2EYTA 3GBMH 1EEYB 4H8WH 3S5LB 3V4PL 3DX7B 4OZHA 4KZEH 2VDKL 1Z5LB 4PGEB 4YDKH 2Y72A 1KEML 3HRZB 3VXPB 2VZ1A 5F6HJ 1VHPA 3D18B 5EIVA 1PKQA 1S9WB 1M71B 4CUCA 4OZFH 4WVRA 2R4SL 1LD9B 4P49A 5DXWA 2Z0BA 1P7QD 1UM4H 5FF6A 1MFAH 2ZKHL 4GAYB 3HZMB 4P3DA 4RIRB 3OB0H 5KAQG 3LRGA 4NZTH 4P59H 4HUUA 1IC4L 1F42A 3IJHB 3G9AB 1EAJA 4M1CC 5I16A 4ZXBC 3LRSB 3NGBB 5GJTL 5D8JH 3MRRB 1G9NH 2BY1A 4Y1AB 4AH2A 5FGRA 3AXLA 3TJEH 5M7QA 5DK2B 1VSCA 1NGWB 2EDYA 3QZWG 3KJ4C 1MIEH 5HHMB 1RAMA 1PEZA 4A2MA 4A6YA 1U93A 5C0EA 1BBJA 1Q8MA 1K3IA 4ZAKA 4PJGE 1CXFA 3C5ZA 3SGKA 1H3PL 1YNTA 1F3JB 4JRYB 2FX7L 4YR6A 4WO4C 1UQSB 4LRIA 3VFTB 4WFFE 4ZUSB 4Y19A 1IKFH 2YRPA 3WFEH 2OTPA 5E9DE 3WBDA 3QSKB 1MCDA 2J6EA 2AGJH 5ITFB 4P57B 5CCKL 5EZLA 4D0CA 4F8QA 3E8UL 2BHUA 4XI5C 1T6WA 3O81A 2YD8A 4WI5A 4FXGA 5J57B 2YC1B 4M6OL 3O3DB 1F00I 1X6NA 3AVEA 4KTDH 3LKOB 1JNJA 1AXSA 3MCLL 3FMGL 4OQ1A 2NY7L 4PY7A 1HCFX 1OF2B 1BZQK 4UV4H 5IW1A 5T1LA 2G75B 1K8DB 2BY2A 3TNNB 3O4OC 4NQDD 4GAJL 2A73A 3AY4A 1F2QA 3VFWA 3U82B 5E2JA 3SPVB 1P4IL 4YGVB 5J4MA 1LK2B 1ZLWK 4GG8B 3U1SL 4FZEH 2FJFB 1PX4A 1SYSA 2UUDH 3JV0A 2P42B 4U6HA 1ACYH 1X5FA 5FM5M 4UIMB 1UYWL 5DJ6A 1S8DA 1WAAA 3BH9A 1K2DB 2VQUA 1A6AA 4MDJB 3QRFM 5EUKB 4NCC1 4NKIH 2AV1B 1I9JL 4M3KB 4POUB 2CXKA 5E0QA 2WBJC 5JUEH 3LOWA 3HB3C 5CBEB 2EC9T 4TOYH 5ENWB 5CCKH 3MXWL 4HGKC 3QUKA 4GXUN 2VNCA 1MF2L 2CSPA 1JK8B 4P46B 2ED9A 5JIKA 2QEJA 3PP3K 3OAUL 2QQKH 3GMQB 2V17H 4GMTH 5DMKB 1U8KA 2XWBA 2XTJD 3WFEL 1DQQA 5IB4A 4N0UA 4HSQA 4L4JA 1S7XB 3TFKD 5BVPL 4QTIL 1W72H 1RZ7H 2ZPKL 1P7QA 5EBWB 5DDHA 1BX2A 3EFFA 2VABA 3I85A 1RHFA 4Y2DA 3NBNA 5DMKA 1FIGH 4ZNEA 4OBRA 5GRWA 2MQ0A 1FPTL 2X40A 3KYKL 4OTXL 3L1OH 3OSKA 3UTTD 1FYTE 3MYJB 3TT3H 1Q9WA 5F1IB 4KJPD 4BQCA 2AQ3A 1KJ2A 5E95B 2DKSA 3QA3A 3NFNA 3FFDB 2ICWB 5D2LF 4HIHA 4PRNA 1I1YA 1VFAA 1ND0A 4JKPH 4G8GE 2H32B 3DGCR 4ZTPH 3IF1A 1L0QA 2FIRT 3VFNB 1DBKH 3BUYA 2ZJSL 4HLJA 3CH1B 5KJRH 4P5KB 1G9ML 4YEFA 5D70L 1T2QH 3D0VA 5JOPE 3EO9L 1FL3B 1GGIH 5DK0B 3S96A 5F7DB 3SJVA 1VGKB 1DN0A 2IH1A 4P4KA 4Y19D 4LCWA 1CFQB 1I3RA 4AT6B 3TZVA 4KJPC 5F7EH 2X4OB 2BHYA 3BO8A 2AV7A 3KR3H 2WV3A 4MQSB 3R8BB 2E9WA 4ZUWA 1MLBB 3DJ9A 4JDVA 3DUUA 4XZUB 4JRXA 2YA1A 4F33A 5EU3A 5AYUH 3L9RA 4LLMA 5J11B 1DQLH 1HZHH 4XAWL 2IQAB 3KPOB 4APQB 4ZOEA 5T3ZE 5HYJA 1G6RA 2ZZUT 3FT4B 3H9ZA 3WFDH 4QOKD 2ICEB 3MLSL 3UTZB 4CADA 5BXFB 4ACPA 1MVUB 5T3XE 1OAYL 4NJAL 4PJ7E 1EERB 3QIBC 2W0KA 4YGVA 4OIIH 5DEFA 4V2CB 4ORGA 3CUPB 1MRCL 1QEWA 3BYYA 1DDHB 5EZOH 4FMFA 4IBLT 3UDWA 3NCJH 1DQQB 2VQTA 4R6UA 5IB4B 1LP9F 4FS0A 5FB8B 1QBAA 2GJJA 1ERNA 1K4DA 1ETZB 4OM0H 4KPHL 2OXHA 5FHAL 3ARXA 4PGBB 1A6TA 5SX5K 1J1PH 2V7HA 3F7VB 4LPYA 1GGCH 1FZKB 1NCAH 2X4TA 1D9KC 2VDNL 5FYJH 3GGWB 4X6DB 3WFBH 2G5BA 3FRPA 3RNKB 4YFLF 5DQJB 4H1LG 1DVFD 3P9LB 1GCFA 5JW4R 3IFOA 2B1HL 4NFDA 4HUVA 5FUCC 5C0BD 5FUZH 3VH8A 4F3FB 4Z7QE 5DURD 1FRGL 2X4TB 1CDJA 1W72A 3HG1D 2J3SA 2D7OA 4XWGL 1KJVB 4GG6F 3L7EB 4PJ9C 5DT1L 3C5JA 1M05A 2DQUH 3DV4A 4JQVA 5HHOE 2YMXL 1YECL 3GSQB 2EYTB 1QSFD 2GT9B 5HHPA 4GOSA 1FZOB 5AZ2H 5I74C 3IFNH 1T3FA 2X89D 1KIRB 4KJQC 4U4BA 1N3NB 3SDAC 3PXHA 1GAFL 3KPSD 1AE6L 2VIRA 4N0CD 4JFDD 1W2KT 4YE4L 4NRXB 2DB8A 5TFSL 1TZHA 4LRNH 2DM7A 2P46B 5SWSE 1IM9D 3MGTA 1S7WB 5DHVB 2NYYD 1N0XL 5T1DL 5ESAA 3MROB 4RQQB 2DMCA 3R0MA 5SX4I 3ZHLA 1HINL 3TF7C 2EKJA 4APQA 1IFHL 4LQFL 3AMLA 5CKAA 4J3TA 3VXMA 4S1SL 4NRZA 3B9AA 3P73A 1V3MA 1YYMH 1KELH 3MV9D 4OZFB 4Y0GA 1S7VB 3WNOA 1A4KB 1ZHKB 1KBGL 5GRZA 4K71C 3RRQA 4LEXH 3I50H 1LP9A 5F9DC 2YA0A 5IEKA 2ARJB 3MLYH 4LLYB 4A6YB 4KXZH 3KLAB 1KCRL 1I3UA 5SWZA 1OPGL 1N0XH 2OCFD 4OCWL 3VFMB 3KPNA 1ETZA 4RGMB 2V9QA 4C54A 3QDME 4YNYA 1YPZA 4P4KD 5I1AB 3IDXH 2O93L 3JZ7A 3OXRB 3SDCD 2H3NB 3RVXD 4N1CA 1D5IH 5F96H 4HUWA 3PV7A 4UUJB 5FK9A 4M7JL 4UNUA 1A6VL 3MZTA 3VRIA 4UDUA 1Y6MR 2AJSH 4PV9A 1EUTA 3I6GA 2EXYD 1D5ZA 3H9SE 1H15A 4WUUD 4X80H 3IDXL 5H35A 3PE9A 3RNQB 2CRZA 1TJIH 5HTSA 5BZWA 4RFOH 4O9HL 3MBEB 2VLLA 2HVJB 3QFDA 5EZIL 4TSAH 4L4VB 5EOCH 1R0AH 3RBGA 3DMMB 1AGDB 3WDHA 1Z3GH 3CDYA 3B9KA 5ALBL 1U8LB 2V5SA 3IS0X 5I8CA 3K4AA 1HHIB 1RZGA 2FATL 5MEPB 4GH7B 1BLNA 1KELL 2X10A 5MERB 4X6EA 4LAJH 43C9A 5DD6A 4MD4A 5F8RC 5IEHB 4WEBH 1JN6A 1HINH 2PXYC 1PKOA 3FB6A 1UM5H 1VADB 5L6YL 2HG5B 5EUKA 2ED7A 4W6YB 4Z0XB 3BKMH 4Z7UA 2P5EB 3NFSL 4PRHD 1IE5A 4PTUB 5HHPB 2F53B 4DZBB 4V1DA 4OD1H 3JXAA 3P4NA 4AIXA 1J5OL 5C0BA 3ILQC 1WAAE 1JF6A 5I1LA 2ITCA 4UZGA 2PUQT 2JF1A 4NHUB 3RGVC 4Y2DB 2BJMH 1YPZF 4ODWA 1YEGL 3EFFB 1CXEA 4PLKD 3G6AB 3IU4H 4CAGA 3BRFA 4RGND 3NZHL 1OW0A 5IJVA 2YPKB 2R0LL 4OKDA 2FLRT 3VFPA 4AQOA 4I2XA 1Y18A 5I0DA 1DSFL 4KKCC 3X3GH 5T33L 5IG7B 3MC0A 2H26A 4HFWA 3U7YH 1B4JL 4JHBA 4PRBA 3RDTC 4ZMAT 4QRQA 1KULA 4FP8L 4J6RL 4JM4L 4EQ3A 4RMRA 5J3HD 2R1XA 4KQ4L 3IU3A 3FQNA 2AEQH 4TSCH 4FQIH 3IKCA 4QRUB 3V5HA 1EGJL 3UC0H 1JUFA 2Z8VC 3PQYA 2WLYA 4G9FB 4AY0A 4L4TA 3BP4B 4KDTA 1FSKC 1BWMA 4K3JH 1R5IA 1BZ7A 4MSWB 2IPTL 4NO3B 3V79C 1C08B 4OTXH 2J8UB 3KPQA 3QHZL 4I0KA 5DRXA 3GSNL 4LIQH 3NACH 3MLSH 3RIAK 1OARH 1ED3B 5AAMA 2F15A 1TZIB 1T1WB 1L9NA 2PR4H 2AJUH 3TBTB 4IRJA 1AO7D 3M45A 3FB6B 3ZKSD 4M9PA 1BP3B 3QXTA 4OUUA 1EX0A 3OKLB 2FB4H 4F37K 1AXTH 2N7AA 3VXRE 1RK0A 4MNQD 1S9VB 2PR4L 3B2UC 1K6QL 3E6HA 5F7EL 1E6OH 4WENB 1K4DB 5IQ7L 1F4WH 2AJ3B 5IBUB 2X44D 4PJ7A 3WKMH 3BEVA 3GMOA 4EEEA 1AQDA 5ALCH 1ZT7B 4S1RL 4OFKA 2V2TB 3WO3B 5MENA 3U0WH 4G6FD 3MUGB 3TA3C 2GK0A 3RNQA 1I8IA 1RI8A 4OZGB 5GGUA 3W9DA 1NL0L 4MZ3A 4PJFE 1PYWA 4XPGH 5CMAA 5D7JC 1SVZA 4OM1H 5GS1C 5C09D 3ZKMD 5LKNA 1DR9A 3WFDL 3V4VL 3TJHD 1OW0C 3VH8B 5L88H 4NBYB 3O4LA 3MFFB 5HHOD 1BQUA 4PG9B 2YUWA 3CCHB 1M7XA 1WBZB 3FMGH 3MR9B 3Q2CA 2B4CC 4HEME 1HZHL 4XAWH 5B8CC 2MHAB 3T77A 3FT2B 2DQIL 3V6OA 3PABB 1AI1L 4XP9L 2AERT 1JWUB 4QTHA 4R26H 43C9B 2C1OA 4U0QB 1QFOA 5D7SH 1YN6A 1K8IB 4JZJA 3E6FA 3WS3B 5KANI 5HI5C 1OQOA 4H26A 4PRPA 3QCUL 3RVVC 5I8KH 5FM8A 3OR7A 3BZEB 2W59A 3ECBA 3KYMA 1A7PH 3LZFH 4Z7WF 1B0RA 2FX8L 1NEZG 3P9MA 1X5IA 3BN9C 5DJZB 3CU1A 3MV01 4LVOB 1MAKA 1UFUA 2VLJE 1XGPB 3WIIH 2IALB 5FAAA 3MJ6A 5T3ZH 2OJEB 1TTUA 4ZTPL 3KPRB 1MHCA 4KRPB 3V7AE 4X6BB 4X99A 4NPYB 3VCLB 3CK0H 3WHE0 5FYKU 2ZCLL 1DLHA 1XR8B 1I4FB 1ZLUH 3NZ8A 3UC0L 3FKUS 2V7NA 1ZANL 4Q2ZB 4I3SH 1LHZA 4NSKA 4XHJD 2VZTA 4KQ4H 3QEQA 1I1AA 4QF1B 3SGJA 3NFSH 3FFCE 1HHJB 5GJTH 2XYCA 3UPCA 4JANA 1QSED 3MX0A 2ADIB 3QRGL 5D7LE 4PFEA 2CJUH 1RK1A 1JGEA 2I60L 3HMXL 4DVRH 4UOJA 1XGYL 4O02L 3KWWB 4E41A 2R69H 5EC1B 2WM0A 4G8IA 4PYHA 1FC1A 1RZ7L 1ZTXL 4MAUL 2BCKB 3GSWB 1PGRB 2VXQH 5C0AA 3PGCA 3SGEH 3D2UB 3D69B 4CJ0A 4KZDL 5KZCD 1GRWA 3EYOB 3VMOA 4RMTA 2BNQE 2NY0B 4L4TD 4Z76A 3DETC 1QBLH 4JB9H 1NCBH 1KCUH 1TDQA 4R2GB 4YFEA 4XB8A 4YO0A 1BAFL 5I2IB 1FVEA 1HQ4A 2CGRL 4TUOA 3L95B 2MCG1 4YHYB 2VOTA 3C08H 4M62L 4EI6A 4NKDB 2PO6B 3FQRB 4F15B 4F7CA 3RNKA 3W11D 3PNWA 4KROB 4XNXH 2BVTA 5KSBF 2LAAA 3BT2H 1K5NB 2YBRB 1UB5B 2CLRB 3V6ZB 3WXWL 1U8HB 5F96L 4JG1L 4BZ2L 1EVUA 1DVFC 1WFOA 2NY2C 3OKMA 1AHWC 2VITB 4D0DB 2VLRA 3H3PH 1WFTA 4QHNB 1MFEL 1EJOH 2ZCKL 5FFLA 4XCFH 4LSTH 1C7SA 3C6LA 2PXYA 4OF8A 4KTDL 3SDYL 4EIZC 1YZZA 2XZZA 4YXHH 3L3JB 1JYXA 2VXVH 1I7TA 1NCWL 1FG2B 3HNTH 4X9GA 5CHNA 3FO9A 2UV3A 3PWPB 5TPWL 6FABL 4WI2A 2Z31A 3QI9C 1DANT 3FB5A 5HYJE 1HHKB 2BXZA 4F9PC 4LPWA 1KPUB 3TCXA 3RWIB 3GI9L 3DYOA 1I9RL 1Z5LA 5IBLC 3UTSE 1A02N 4ZPTB 4KRPD 2AKRA 3TWCH 4QF1A 5D72H 2J6EL 4Z0BH 4KZEL 1KB5B 3CC5A 3QUML 1G84A 5CILL 4L9DA 4MXWL 3T1FB 1V8HA 4NNYB 5JHDD 4P2RA 4YUEL 3QDJA 4X9FA 1NLBH 1WIPA 5J8OA 1KLFA 4NO0B 5FA3B 5DRWA 1OTUC 3RX7A 1GAFH 3OKKB 3IS1X 4NDMB 1OWWA 3ULVD 5C07B 3BMWA 4HT1H 4F7MB 1AJ7H 1Y0LA 2Y4SA 5JHDA 4G6FB 3FQUA 4G9FD 3K8LA 1G0YR 4XVTH 3DGGA 4KUZH 2DL2A 4F8TA 3QG6A 4ZS6C 1HEZA 1YN6B 3HR5B 4R97B 1T21B 1BZ9B 1DBAL 5JOFB 5IWLC 3QXDB 2CDEA 1EAPA 2SEBA 2YRZA 3ZKNC 4AIZA 1WK0A 4JY4B 4I0PC 2YXMA 5DEGB 3U7WH 1DQDH 4QOKB 1J8HA 3W39A 3U9PH 1AR1D 5HYQB 1T89A 2YPLA 3V0VB 3C8DA 3GSNB 2A38A 2EYSA 3BYTA 4FFZL 2WLZA 3I6GB 4U1IB 3VH8G 1QFWM 4PTTB 1TPXB 1DN0B 3V7AG 3NPSB 5GRXG 4NYLA 3LN5A 4IIQA 4Q6IC 4YHIA 3MRHA 1YMHA 1S9YA 1A6UH 3F7YA 3QB7C 4JHZA 1MCHA 2EO1A 4JFYA 4IIQC 4PRIA 3TPKA 4Q6IB 5HGBB 3ULUE 2B5IC 5E4IA 2D7TH 4WJ5B 4NNPL 4QHMA 4LGSB 2APWA 5F7YC 4YHZH 1UB5A 3UTTA 3ARDB 3CZJA 3D85B 4GW1B 3L6FB 1RU9L 3O8XC 4HUNB 4LPVA 4QEGA 4MA8L 3WXVL 4BFIB 4R7NA 2E6JA 2IGFH 1U3JA 2CR6A 4G6JH 5BRZE 1KCSH 1JGDA 3QWOA 5FUZL 2DWDA 3PG2A 2VLRE 1DE4A 3U4EB 1KB5A 2VR4A 1AQDB 1NMCC 3JV4A 4NKOB 3UYRH 1N0LA 2YEZA 4JM2B 5H37H 1A7BA 4TSBL 2Y36L 5C0CA 2HWZL 2EDHA 5CIPH 2ZUQC 3RDTA 1MVFA 3KXFB 3MXVH 5DMGC 4G42B 3TZVD 4N5ED 2PW1B 4YDJB 4M5YL 1TVDA 3VXUE 1G7LA 3QHFH 3VWKA 4S1DD 1CICC 3A6BL 5FKPB 3O45A 5DSCA 1RMFL 2IAMD 2XXCB 3VFSA 5DZNA 1FYTB 4G6JL 1WITA 1HWGB 4OD3H 1CICA 2VITA 4D0DA 1IBGH 2X4PA 3QFDB 5ITFA 4G7YH 1DLFH 3VWKD 4CGTA 5GXBB 2VN7A 4OIIL 3L3OB 4PUBH 1HHHA 1QP1A 3ARFA 1D9KA 3B2VL 4Y4HD 4BZ1L 5JPNA 2A6JA 3DYPA 2P24A 4KI5F 2XRAL 3D85D 1OGAE 3RGVD 5FUCE 4YWGL 4MWFA 3RZCC 4PRBB 4OI7A 1MCLA 1W72B 4ONOA 1NMCB 3BDYH 3CDGB 5C0EB 3QI9B 4M6NL 1GZPB 4U31A 3BPOB 4KI5D 4EDXA 5L2KD 3U48A 1YY8B 3H42H 1P7HL 5K9OA 2EDBA 4OF7A 2R1XB 5HD8C 4U1GB 1KN4L 3ET9F 3NFPB 1A4JB 1RJCA 4WW2C 2P43B 4L1DA 5DJ8A 1Q38A 3OWEA 4KHXH 3I9GH 2AQ2A 3GIZH 4PBVC 3VFRA 5KVDL 4PJIA 1T0NB 4IRSB 4Q74A 3ZE0E 5I1DB 1FO0B 5MI0C 1AHWA 3B9KC 3HC0B 1SY6L 5FV2A 2CH8A 1YMMA 1X7QA 3KLDA 1U6AL 1E4WH 2EYSB 5DJAB 1YJDC 4K9EC 4Y4FB 3D48R 1TPXC 3CSGA 4YXLL 4I4WA 3K8KA 1P69B 4BZYA 2GFBB 1VERA 1ZGLA 1B90A 4KROC 1MCPH 4ODBD 2WANA 1AH1A 3WLBA 1CFTA 3AAZB 5A2JH 1NAKL 3P40A 4UINH 1A9EA 4ZAKB 1FL6A 2F54D 2P1YA 3HR5A 3G6AA 5CP7B 2BVPA 3JWNC 4KI5E 5GGTL 1XGRA 5TDPA 3H0TB 4NZRH 3FO2B 5J6HA 4HWNA 2FHFA 3QEQE 5JHLH 1OAKH 4M61B 4QHKJ 1P6FA 3VI3F 5T5NG 1SEQH 1G1YA 1UCBL 4D9QD 3L95A 1ZHLA 5TDNB 2AJ3A 3T2QA 2VAAB 1HQ4B 4QTIH 1VB9A 1QLEL 4L8BA 5I18L 1IGFL 4B41A 4OZIF 3PWJA 4EN3C 4NKOA 3SDCC 1CG9A 4P48A 3QH3A 4NP4H 1INQB 5DD3L 1FGNH 4LP4A 1ORQB 3EFDL 3EOAA 4QXUL 2H1PL 4MDIA 4PLJD 1NCBL 4D9QE 4OLUH 4KAQH 4KKAD 1XZ0B 2FL5B 1R24B 4JR9L 5EU6E 32C2A 3QH3B 3MLZH 4HPOH 7FABL 4X7FC 3SDYH 5HPMA 4L4VA 1QA9B 1CDYA 3LVEA 5HGGS 3HE7C 3MJ9L 5DRXB 4Z8FL 1ZSDB 5IESL 2F54E 3PWNB 4JY6A 1HN1A 2BOBA 5GS2D 5F6HI 2MWCA 4P5TB 5K59E 2IADA 4N9OB 5L2JA 1FG2A 3MRCA 3MV9B 2BNUA 5IGXL 4CMHB 4DW2H 1G7HA 4Z8FH 4LHUG 4JLRA 4JHAH 3SKNA 4IHOB 2CRYA 1A6ZB 1T4KA 3O3EA 4KHTL 1HQRB 2H2PD 4G5ZH 4PJCA 5GIRA 2XWBB 1UG9A 3OF6D 2NNAB 4YK4B 2PNDA 4I48A 1LEKB 3B8YA 3MMEA 3TH3T 2C9AA 5D7KE 3M07A 5JPMA 2NTFB 2X05A 1OLLA 2BX5A 3MROA 4RQQA 5I73B 1VDGA 3ARWA 4PJ9D 1TVBA 1G9MC 1N5AA 1QRKA 3DUHA 3TV3H 1A5FL 2AV1A 4XGZA 1FO0A 3TN0C 5ISZA 3DX8B 5FYJE 1AP2A 4X9IA 5JHDB 2AP2A 4GS7C 3O2WL 2CUIA 5CBEA 5IB1B 3RZCD 5D7JB 5LCVH 4HDIB 2DBLH 3F5WA 4HIXL 3G5XB 1JFQH 1C12A 4Z7NF 5EA0L 1LP9B 1ZV5A 4Y4HC 3OZ9L 3EAKA 1EAPB 4G8IB 1RIHL 4HH9B 2Y25A 1BFOA 4GW5A 2ZUSA 2QL1A 3SO5A 2APTA 5JOPD 1F4YH 4ODUA 2UZXB 1GGUA 2FYYB 3KPMB 5BO1L 3K8MA 2AEPH 1ES0A 3DSFH 1OM3H 2WAHA 3N06B 1AQKL 2BSTB 1NFIA 4CVXB 4EKXA 4OF6A 1YMMD 3GSXA 1IGIH 1ZA3A 4UQ3A 3RY6C 1RZKH 5D7IF 3WIHH 3DVGA 5EORL 1GHFH 4K23H 5GISL 4QRRD 1JWMA 2X7LA 4FN0A 4FABH 3WDJA 5JR1L 3H9HB 4LU5L 3MTRA 1A6TB 3EHBD 3T65A 4X6BA 2B0SH 4YHIB 2WZPD 3O8XA 2VN4A 4O51B 4JG0H 1LQSR 4U0RC 4H25B 1AXIB 5J13B 4XMPL 4FOMA 5GS0C 2FB4L 4XPBH 2HRPL 4P2RE 2DJUA 5GJSH 1SJXA 3R4DA 3WCYA 1XCTA 1A3LH 3VWJC 1W8OA 2YD3A 2JK5B 1AGEA 1IAMA 2R23A 2W60B 5ESQB 2EDLA 1IGYA 1VEMA 5L8JB 5L88L 3BDBA 3I2CL 4ZD3H 1C16B 1EZVX 3RWJB 2GSIA 3RY6A 2DWEB 4M7LT