5C0CE

1e6 tcr in complex with hla-a02 carrying rqfgpdwiva
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
MDAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cE02
4NM8L 1A47A 2WP3O 2VQ1A 4ENEC 2ZWLT 4R90L 1A8JH 2WIIA 1BVKA 1JE6A 3DRQB 3SE9L 2NY0B 1E6OL 4XPGL 1YEGL 4PGEA 5T3ZH 4XPFL 3OKYA 1S5IL 1AFVL 1B2WL 1U8PB 2AXHA 3GMPB 2E8YA 3L3HB 4NZUL 3IFNH 1FO0A 3BUYB 3MBED 5D1QA 2HRLA 4L8CA 4O4YL 3AC0A 3QJFA 2GK0B 4CVZB 1S3KH 2O5ZL 1JWSB 1T0NA 3BDXA 4XMLH 5EO1B 1FG9C 5CEZL 3QNXB 1JHTA 1GL4B 3GB7B 4EIGB 2IC2A 1DFBH 1WT5A 3ZDZF 4U05A 5MENE 4QRTB 1FVEB 4JFFA 1XGPA 1Q9OB 2ZKHL 4PRID 4HGWA 5L7XL 3N1MC 1FVDA 2BSTA 2AW2A 2VLME 3B6SB 4ZNEA 4JM4H 2AJZA 4POUB 4ALAH 2CUHA 4JPIB 4WI4A 4QRPB 1EEQA 1P5UA 1FZOA 2NY2B 5E6ID 2AK4B 4PJXB 1B4JH 1JTOA 1CGTA 3MLTA 4FFZH 3I6LE 4N1CA 3TO4B 5DC9B 3MRBA 4GH7B 1CFTA 2R2EB 4NC1E 4KJQC 5I74C 5E2VH 2PO6B 1LP9A 3D6GA 2PYFA 5BVJB 1J18A 2L4OA 5I1EL 5GS1B 5MP6H 1P4IL 2CLZA 2E9WA 1BFOB 1EFXB 4WI6A 3WIFA 1IAOA 5ICXA 1U3JA 3UC0L 3K74B 1HZHH 3MRPA 3BDBA 4L4TE 1IGTA 3C87A 1J7VR 3F58L 2A0LD 4L3CA 4I0PC 4KK9D 3V5KA 3V8CA 5FV1L 3QCVL 4U2ZA 5T3ZL 4D0DA 4G80B 4K7FA 3RZWA 5GJTH 1CICB 4L4VE 4KTYA 1ZKAA 4AYFA 2OSLB 5HGDA 4F7TB 1MHHB 1H3VA 3BVNA 3MRFB 2PW1A 2F53D 1OCWH 3EYOB 1F97A 4OUOA 5JXED 2FBOJ 3KPSA 1DSFH 3OGCB 3BRDA 3RWIA 5IK3B 5FFLA 4XMLL 1BJMA 1DQLH 2NTFA 3EO1B 3NCMA 3LV3A 3PL6D 4RNRB 3QEUB 1J8HB 3MLWH 3WKNA 4RIRB 2PXYD 3MV8B 4H8WC 1NC4A 4QXTA 4ODWA 1NQBA 2IAMA 2NY1B 4JY5H 1M7XA 2V5YA 3L7FA 1D5XB 1PSKH 2BP3A 2J5LB 4AQOA 3FQNA 2VXSL 4LCWB 2CXGA 4RAVB 4NQVA 5DRZB 4XBGB 1XAUA 5F7NC 3W11C 2YKLH 2YUWA 4ALAL 5KSVB 1FNGB 3EHBD 1D5IH 4F3FB 4FQXD 1MVUB 4AIOA 1JPFA 1KIRB 4HIXH 4FQIH 2BNRE 4HKJA 3IS1X 2VR4A 4LNVA 5BZWA 1B4JL 1XF2A 4AEIH 5ESVA 1PAMA 1RJZB 3G6JE 1SEBA 1LE9B 4PJBA 3S36L 2LAGB 5E2VL 1BWWA 4PJEF 3UBXA 1XMWA 1HHGB 3IDNB 5DJAA 4K55A 2AXFB 5MP6L 4HIHA 3O4LE 1F4YH 1UC6A 3HE7C 1A0QH 4WUUA 5IVXE 2CDGA 5C3LD 2X4TB 5JW4Q 5AG9A 3FOLB 3S37H 4TVPH 3CXHJ 3LVEA 1YMHA 1DUZB 5JZ7C 2FO4A 4RAUA 2DM3A 3DBXB 5E8DH 2CGRL 3QQ3B 4LDLB 4NO5B 5IM7A 3BH8A 5GJTL 1XGQA 2PKDA 5FA3B 3TYGH 2HT3D 1CE6A 3MMEA 2O61A 3O6KH 4DKDC 4WUKL 3RHWF 1OCWL 1DSFL 2VDOH 3H7LA 3FRPG 4MMXC 3FB6B 5B8CA 1AGCA 4FXKA 4P5TC 4Y19A 2D2OA 2FNBA 4I18B 3MLWL 3S3SA 4M93B 4N0FB 3KXFB 1CI5A 1YPZE 4PJXF 4J12A 3EBAA 4Y2OA 3S35H 2C1OB 4XHQA 1HYSC 1SYSA 1M6OA 1PSKL 1XGYH 2FRGP 1ZV5A 4G9DA 4P99A 2GUOB 3DX8B 1C5DA 1FL6B 1S9XB 3PHQA 1D5IL 1BFVH 2W07A 4CAGA 4HGKC 5L8KB 5FUOH 1PG7L 4HIXL 3RVXD 4DOHE 1JWMB 4PJCF 3VI3F 2B39A 3CFDB 1FN4B 1J12A 2YD3A 4BQBA 5L6YH 1DTUA 4PJFF 3VXSA 5IVXA 3RGVC 1ZHLB 3QIWB 4LPXA 4PJGF 4K8RC 5FHBL 2DL9A 3H3KA 1SY6H 3GIZH 1W0VB 1F4YL 3OPZH 4K3DL 2FSEB 1A0QL 1DUYA 3VFNB 3JV4B 3ZE0F 2XZZA 4G43B 1KLUA 5CGMA 3S37L 1QZ1A 4TVPL 3RIFF 3RX7A 1H15A 2R1YA 4P2QA 3UYOD 4MQSB 4RFEB 4KUZH 4U1LA 3RAJL 2AS5M 4YBQD 2Z91A 2BVPA 4OZHA 2YWYA 2C7UB 5FO7A 1HINH 4ONFL 1OHQA 3IFPB 5IMOB 3TYGL 1AGEB 5CZVL 4JHBA 1A6AB 4N0CD 1X4XA 1ZGLA 2LTQC 4QGYA 3JWOH 3HE6B 5K59E 4GQPH 3QHFH 5C6TH 4EI5A 2Y72A 2N7BA 5E56A 5GGRY 5I1GH 4QRRA 3T0DA 3QIUC 3ARSA 4BK5A 4K9EL 3KLHD 3PHOA 4O9HH 1MLCB 1F4AA 1OAYH 1I3VA 2J7LA 4M7KH 1CL7H 4X8JA 2DQEH 4M61B 1ZGLM 4X8XA 3BWAA 3S35L 4J1UB 5ERWA 1FVCB 3VGBA 5T5FH 1IFHH 3LKNA 1XGYL 4WWKC 4LP5A 3T0AA 3DX7A 1A5FH 4X99B 3MRHB 1NSNH 1TVBA 1BFVL 2XYCA 1XF3B 2EH7H 3P4MB 3PWPE 5FUOL 3BPOC 1JPGB 5ENWA 5TGBA 2H3NB 4GXUN 4QCIA 4S2SB 3ZO0A 3GBMH 4WV1A 5I66B 1EERB 2D4FA 1CU4H 3CD4A 5DEFA 4PR5A 1TITA 2MCG1 3MNZA 4AG4L 3CUPA 4TSAH 5IROC 5J0BA 2KL6A 2ZSVA 5ANMA 2DTML 2CRMA 5DUBB 3HNVL 2FDBP 1OGAB 4U1SB 3T04D 5E08L 1WCBB 4JAMA 2EDOA 3ARTA 1C7SA 3U4EB 2D31A 1UQSB 2IQ9L 5ETUA 2C1PB 1VACA 1QSFA 4P46C 5CWSA 1IM9B 4WFFE 4PJ5A 4YFEA 1WEJH 3JV5A 2FLRT 1OOAA 3PV6A 1MCCA 2JB6B 3FO1A 3GMMA 4KUZL 4UNVA 1DN2A 4QRSA 1TTGA 1WSST 4UAOC 8FABA 4X5WA 4HBQA 3BP4B 4J3XA 5F9DC 3QG7H 5TDNA 1KYOJ 1UJ3C 1IEBB 4JM2D 4HC1A 3IFOB 2YPLA 3QHFL 5D7IF 5C6TL 4Y4KB 5I1GL 4FN0A 4Z7UA 5TQ0H 3ULUH 1X3DA 4G6AC 4N90E 5HI5C 2YA0A 4O9HL 2Q8BH 3EDEA 4R2GC 3GHEH 1OAYL 3MROB 2OZ4A 1U93A 2UV3A 2DQEL 2BVYA 1QR1A 2XWJA 5T5FL 1IFHL 3VD7A 5C0CB 2F19H 3CCHB 2RFXA 3PWLB 1JNHB 5D2LA 4GBXC 3T77A 1A5FL 1YMMB 4QOKE 5HYJE 3OSKA 3OKKB 4HV8B 3TF7C 3QG6B 1NSNL 4YQXH 2P5WB 4WEMB 2EH7L 3W0WA 2NMSA 1KC5H 4KV5E 4X98B 3BYTA 4J8RB 4PYHA 1X6NA 2Q6WA 2AV7B 3VXUE 3HNTH 3GBML 3EYUH 1CU4L 1HSAA 1AKJA 4Y8DC 4MJ6A 4K71C 4TSAL 4H0HB 4JFEB 5HVFB 2XZCH 1GGIH 2GK2A 4G8GE 2ZCLL 1QSEA 5HGBA 3UJJH 1TJGL 4I5BB 4X6CA 5DK2A 2JJVA 2DWDB 3KYOA 3LB6C 1QEWB 2F9BT 3AY4C 1ZXQA 4HFWB 2WWKT 2VXQH 1KBGH 2ITCA 3GUTA 3B9KB 3P77A 3Q5OA 3FO9A 2NY0D 4QRQB 4X6EA 5J1AB 2DQHH 1ZHKA 4M3JA 5IFHH 2IPTH 2VLRB 2E5EA 5ITBH 3QG7L 2WAHA 2LV4A 2OMBA 5FYLH 5F89B 2EXYC 3FFDB 1QA9B 1INDH 2ARJQ 5ISZB 3L7EA 5TDOA 1P6AB 4UIMA 5F7DA 3WS3B 1AR2A 1CDGA 5TQ0L 1A1MA 1OAZH 2GCYA 2W59A 3UPAA 3ULUL 3BIAX 3DUSB 1F2XK 2PCPA 1ZHNB 2Q8BL 4POYA 3GHEL 1S7TB 5IW6A 4FG6C 2PYED 4ZXBD 3QDJE 1KSRA 4X9GA 6CGTA 3BKCH 3GJFH 5BS0D 2EDEA 4RGNC 5GGTA 3TH3T 2FEDC 2HLFD 4NP4H 3X17A 2QR0B 5HHXH 1NUDA 1QVOA 1OARH 1VCAA 5E4EC 2XQYK 5E2WL 4QRPD 5J89A 4LVOC 1E27B 1R5VA 5I16A 1GZQB 1DVFB 1MCRA 3O8XB 3EYUL 3TO4D 1QO3B 1P6FA 5C7XH 3GRWH 1A7OH 1JTPA 4OIBA 1FFPA 2XZCL 3H3PH 4J3TA 1XF5A 3UJJL 3W9EB 2IH1A 4EDXA 2HLAA 3C6LB 4KC3B 4LLYA 5ILTL 3U0PA 3WBDA 4WFHD 3BP7A 1MCOL 4JO4H 4MD0B 3T1FB 3DETD 3LKOB 1EFXD 4HSQA 4Y2DA 3TBWB 5BOPA 1JYVA 2NYYC 4Q6IA 3FQXA 1T1WA 4NRZA 1KBGL 1KCKA 2FCBA 3HPLB 3MRQB 1NJ9A 4HHAA 5IFJB 1TFHA 4M9PA 1F3RB 2X70A 5FHAH 1PZ5A 4UV7H 1JK8B 4F2MB 1V7NH 2NY5H 2DQHL 4PS4H 5F1NB 5I75B 5IFHL 2IPTL 1AR1D 1A7QH 5ITBL 3V7MA 1CICD 4TQEH 25C8H 5FYLL 3RL1B 1INDL 3LEYH 1N2RB 1NPUA 3TPUA 3L5IA 4Z7QE 1E4XH 1FJ1A 5EO9A 4PRNA 1OAZL 3TH2T 1ZHBB 4IIQA 4WHYH 2VDQH 3SGEI 5D71H 4GUPB 4PJ7B 5J4MA 3KLDA 2GT9B 4X7FC 1V05A 2H26A 1ES0B 4XCNA 3C5ZD 1I9JH 2BNQA 1J8HD 4QT5A 5IBLC 3LD8C 3MV8D 1P53A 2P8PB 4MSWB 2NY1D 5AUMA 3RWEB 2FJHA 4V1DE 4G6KH 2FX9H 3BKCL 3DXAE 3D85B 3GM0A 5E6IA 2X4RB 4GKOA 4Z7NF 1LQSR 4HUNB 4M6NH 1FYTA 5HHXL 5EU7E 1OARL 3CLFL 5FF6B 4MDIA 4KMTH 4QYOA 2P45B 4YR6B 5I15H 1L0QA 1QG3A 1MHCA 4XI5C 3JBG7 5IJKA 4AENA 1D5MA 5ACZA 2C26A 3PV7A 2B4CL 2VERN 1OM3H 5KSUB 4LKCB 3RPKA 3GRWL 1A7OL 4FFWC 1AO7E 4JDTH 3I85A 4Z7VB 1ND0B 2C3GA 1IAKB 3LAFA 1ED3A 4X7DC 3QFDA 4JO4L 1HNGA 4HH9A 4KK5C 1V3KA 3LQZB 1BZ7B 3SPVA 4L4JA 3C8KA 3EJYC 3CPLA 3HRZA 1ZLSH 1CDBA 1CD9B 3B3IB 3RNQB 3MLXH 2VZOA 4PRBB 3RVTC 5FHAL 4UV7L 4YGAB 4ZUSA 1V7NL 4OZGA 3IJHA 5CGYC 4MAUH 3TGXA 3T0EB 4TQEL 1PFCA 1OTSC 3RY6C 1RURH 25C8L 4YXKL 3IJSB 3FFCA 2HTKC 1PQZA 4OM0H 3PL6A 3SDAB 4HUXB 4FOMA 5L2KA 4HX1B 4YBHA 1E4XL 4URTB 3MCG1 2DKSA 5EC2A 1Q72H 4ODUA 2VDQL 3T4YB 5D71L 1S9WA 1C16A 1H9VA 1T1YB 4O2EB 4KMQA 3TJEH 1B0GB 3HMWH 4XTRC 1I9JL 4I0KA 4WW2F 4JKMA 3KXFD 3P9WB 1TENA 5CMAA 3P9LA 5JQ6H 4GMTH 3P73A 2QKIA 1K5NA 2DQIH 2GSGA 4ZUWB 4EVNB 3IVKA 1VEOA 1T20A 4M6NL 4NYLA 3OR6B 1GGBL 1NGXA 5D1XC 4NGHL 1A9EA 3VXQB 1A3RH 1CFVL 5DJYB 4KMTL 3RWJB 3LCYA 4PB0H 5I15L 1T4KB 3LRGA 1ZMYA 3S97C 2EO1A 1ZSDA 1AO7A 4YDLC 1CGXA 3TBVA 4WHDA 3WUZA 2XY1A 4KFZC 1ORSA 1RFDH 2DLFH 2Q3AA 5JW4N 3S4SB 3WJLC 2YD5A 1FAKT 1OM3L 3WLWC 2R0WH 1P9MC 3BP5A 3MV7E 3RUGE 4MA8L 1ZS8B 3MJ8B 1NFIB 4JDTL 5FKPA 5H35B 1A2YB 3JSSA 4P2RE 5I8KL 2OR8A 1CLCA 4PPTA 3AFLA 4JFXB 5D6DA 2BERA 5DHVH 5EIIB 5D1QC 5JIPA 1E4KA 3OR7B 3D2UB 1ZLSL 4F9PA 4POZC 3X13A 4CKVX 2A6KA 4PLJC 5DUPH 5FYJH 5HVWA 3VI4F 5D9SB 4PJ7F 1GSMA 3O45A 1O5DT 3IETB 3WUWB 2R2CA 4M5YH 5F70A 4XAKD 3BN9C 4MAUL 3MCKB 3HA0A 5J6HB 3E3QC 1RURL 4NQXA 3BP6A 5LG1A 2CH8A 1UCBL 2O5YH 2D7TL 1U8QB 3HE6D 5MI0C 3MRMA 3HFMH 3DVFA 4OCWH 2RJMA 1B0RB 1Q94B 1Q72L 2DWEB 2PUQT 3DIFB 3TJEL 5J7CC 5I76A 2DMCA 5C0GA 4P4KD 3HPJA 3HMWL 2R15A 1N8ZB 4RGNE 3QUYA 5D7LA 3CDGA 3G5XA 5I8EA 4O58L 4ZG1A 3QDMB 3U2SA 4LEOB 2RCSL 1M05B 1EVUA 4R0LA 5JQ6L 4GMTL 5I71B 1WZ1H 4WU5A 2W60B 2DQIL 2LABA 4LDEB 1T0MB 1XT5A 2E6QA 4CJ0A 3P30H 5MERB 1PY4A 4YWGH 4W4NA 3GJFB 4XCFL 1A3RL 3RUGA 5C07E 2KUTA 4PB0L 3HZMB 4TRPH 5FK9A 1XF4B 2LU7A 3QUXD 1AC6A 1Y6KR 1S7XB 1IVLA 2BXZA 1JI2A 1RJYB 1R3HA 4WFEE 5FGBC 1VB9A 4OFYD 5GRZA 5SWZB 1RFDL 1JBJA 2MJWA 3TBYA 5C0BB 1Y0LA 1NMCC 4R4BA 4XVTH 2J6EL 4CDGC 4CUCA 4F7CB 1WF5A 4KJYA 2R0WL 3PQYE 4DKAA 2NZIA 4G6JL 3DV6B 5CZXC 2Z92B 1HXYA 1FL3A 3CZFA 3VCLA 4JN2A 2UYLA 1IGIH 2DLTA 1RZKL 1OGAD 3OB0H 2G2RA 5BOZG 2IG2L 1W0WA 4FZEH 4NHUA 4KHXL 4Z7OF 1ZWIA 2HFEA 1QSZA 3QDGB 3VFOA 5HBBA 1HXMB 2OK0H 1YN6A 2V2WA 1N5AB 4Y4FB 3VXPB 1CIUA 2V9RA 5I9QB 5IB2A 3H9YA 3SDCD 1P7KB 1MJ7L 2ICWA 3QQ9D 1EMTH 4M5YL 4E5XA 3BWUC 5D2NB 3DO7A 5BV7C 1RK1B 2P5EE 5DRNB 1TZIA 3SCMC 3OKMA 3MRJB 2O5YL 1I8IB 4QHMA 5INDB 2C3WA 4BFEA 5B38B 4OCWL 4Y4KD 1N6UA 5E8PB 1BZ9B 2R1XA 3HKFA 4IOIA 5F88A 3DX6B 5GIRA 4D0CB 3S98A 4MDJB 5GRWA 4LLUB 1CDHA 2A9NL 5E6ZA 1RU9H 4BFIA 1SJVA 3VFRA 3SEPA 3MXVL 5C0CD 1WZ1L 4RCAA 5HHOE 2P48B 1L4IA 1O7SA 1S78C 3S36X 3DX9A 5CEYA 4CJ1A 2PW2B 5D5MB 3ARYA 3U7YH 4YWGL 4APQB 3EYQC 4BSJA 3DMMD 3W39B 3PQYA 3RX5A 2P5WD 3MJGX 4TRPL 5DMIL 1JCKA 2G75A 1BFSA 1VFAB 5EO0B 4AM0B 3LDBC 1SMAA 5BJTA 1KPVB 4GKNB 3CC5B 1F4WH 3QXTA 1HEZB 2IPKB 3IKCB 3AU1B 4JFED 1KFAL 2XPGA 5D7SH 1P1ZA 1UXWA 1U8HB 3BPNB 4XBPA 3FQWB 2D7QA 5KG9B 4FZEL 5IMMA 5J3HD 3EGSB 2XA3A 3HG1E 5A2LH 2BVQB 2OK0L 4CVXB 5DT1L 5B8CC 3QNZB 5IQ9B 1I8KA 5TE7H 2EDJA 4JRYE 2NX5B 3S5LA 1M7IB 2AJUH 4L3ED 4TVPD 1EMTL 1J5OH 4PJEE 1TVHB 3ZYOA 1WBYB 2YN5A 4U31A 3KPRB 3V7AE 2VLRD 4XZUB 1X6LA 1FAIH 4I48A 1BM3H 3OHXA 3SE8H 1KV3A 3ARBB 1S7UB 1I8MB 1Q9WB 4MA7H 1K8DA 3STLA 1H5BA 5AG8A 1A21A 2R9HD 2XNAB 3CMOH 4R96A 4KRPC 5HHOA 3KPLA 4CRPA 4OV6F 1IGFH 1PEWA 3O9WC 4RMRA 5C09E 3BKYL 4PRAB 4YAQB 5IOPB 1PG7X 4LLDB 1TNMA 3G6DH 3HC0A 4ZDHB 4NO0B 3JTSB 4DGYH 1I75A 3K8LA 1MCIA 1MCWM 3LS5H 1KLGB 2ZCHH 3D25B 1GOFA 1RIUL 3UPRB 2DM2A 3S3JA 4PRDB 4RX4D 5T5NF 3C9NA 2QQNH 3U7YL 2GYSA 2BOBA 3HAEG 5FECB 3VXME 1QFPA 1INQB 2QHRL 2VXVH 4X7SL 5KTEH 4PUBH 5FYJU 1FLRL 1A14L 4PP1D 2GTWB 5J1SC 1DVFD 3S37X 3O8XD 4NT6A 3BH9B 1N6VA 3TJHC 1FGVH 4M8QB 2XN9A 3HG1A 1MAMH 3DRTA 1E6JH 1BF2A 3SBWA 4G8FB 3C6LD 1T3FB 1NUNB 1ZEAH 3DRQA 5EBGA 1BQLH 3ABZA 1KN4H 4MA1C 1P84J 5EULV 1Q0YH 1YY9C 1ZA6A 4PG2A 4X0KB 3ZE2E 1NUGA 4PJCE 3VI3E 3LY6A 1U8PA 4GRMA 3ZKQD 3BGFC 1UVQA 3UTQB 3GMPA 4L8SB 5DHVB 4PJFE 3L3HA 2JCCF 5TE7L 4P59H 3OJVC 5DDHB 4PJGE 3BUYA 2AJUL 1J5OL 4PJ8A 4D3CH 2QQQA 5GGVH 4YHZH 1BX2A 1PKOA 1CWVA 3A6OA 3ROLA 4CVZA 1FAIL 4UU9B 5T3XH 1BM3L 2F54B 3EDDA 3SE8L 1UB6A 3QNXA 1QOKA 3GB7A 3RJQB 1K6QH 4JFQA 1JGVH 4NRXA 4OBSA 1V5JA 1YZZA 1FVEA 1P7QD 4JRXD 4BQCA 3OBAA 1FH5H 1S5HB 1Q9OA 1N59B 4JVUA 1KT2A 3G6DL 3B6SA 1P69B 3RWFA 1WC7B 1KPRA 4JPIA 3LS5L 3MV9A 1BEYL 2GJ6E 4QRPA 4B5EA 4NQUA 1EUTA 4JQVA 2AK4A 5C08E 3QDAA 4AH2B 4PJXA 3EZ8A 4I3GA 4XB7A 3B43A 2QQNL 1BD2E 4YX2H 4YNYA 1DANT 1H8SA 2BJMH 1G6RA 5CLTA 1OD9A 1A1NA 2R2EA 1ERNA 1EUUA 1QFWI 2PO6A 2VXVL 3WDHA 4AK1A 5KTEL 5BVJA 3VFMB 5ITFB 3QWOB 1AY1H 3VMPA 3SO3C 1BFOA 1EFXA 4NC0B 2ZCKH 4F37K 1FGVL 1CD0A 2HG5B 1KEMH 1MAML 1E6JL 1U8KB 3VXRE 5I1AB 1J8KA 1BQLL 3SDXE 1KN4L 2VLJA 4PJ9C 1Q0YL 4KDTA 3LH2H 1MFCH 4QXWA 3UJIH 4G80A 3IAPA 5EUOF 1K8IB 2YSSB 3JV0A 2VLKE 3M1BB 1IEAB 3D0LA 2ESVB 4EZMA 5DVMA 2OL3H 3K0WA 4P59L 3QHZH 4LQ1A 2YD6A 4LSQH 4FTVB 3EYOA 5GGVL 4YHZL 4OLVL 3UP1A 3T0ED 2FYYA 1R3JB 3KR3L 5IK3A 1HCFX 5T3XL 5HYEA 4NBYB 3KPMA 3U30B 2NY7H 1AXTH 1JWUB 2B2XH 3CDYA 3EO1A 4N1EA 4RNRA 3CXDH 3QEUA 1BOGB 4XT1C 1K6QL 4G42A 4ZFGH 5HGHB 3FQUA 2DLIA 3JWDC 1D5XA 5LJYH 5GGUB 3B9EA 3VXNB 5C08A 2R2BB 4LCWA 3TWCH 3MUZ1 5DRZA 4XBGA 2DM7A 3DVNB 1T2QH 1X5AA 4X5LA 5KSVA 1FNGA 3PWNB 5GHWH 2YA2A 3O3AA 4HIEB 4YHPA 3V5HB 1MVUA 3U7WL 1KIRA 4ZFOL 1IJ9A 5L88L 3I2CL 3EYSL 2WMPA 4YX2L 1TJIH 3E8UL 4DVBB 3RFZC 4LARH 2APTA 4LRIA 5KSAA 3M07A 2BJML 4J2XA 12E8H 1N3NA 3IAQA 1RJZA 3VXTB 4PIRF 4PJAB 3OX8B 3IDNA 5DO2C 3N50A 3BYYA 5C0FA 4L9LA 1PW3A 2ADIB 1FGNH 4P3WA 5BRZD 3L3OB 3BMVA 3ALXA 5DS8B 2ZCKL 3GMOB 1KTDB 3MNVA 1JN6A 3CX2A 3G5VA 3NABH 2EYTA 4HK0B 2VLKA 3T0VA 1TETH 1DUZA 3IU4H 3NMEA 4C54A 3LH2L 1MFCL 3QQ3A 3SE4A 3UJIL 4NO5A 3JVGC 2R23A 3BIBX 2ED7A 1ZANL 1DANU 3GGWB 3QEQE 3ECBB 2K7PA 4M7JL 3K8MA 5SWQA 3U48A 3WFEH 4U1JB 3QHZL 3MRGA 2W9DH 1A6VH 4LSQL 1HWHB 3ARFC 3CXHK 2YRZA 3SKNA 4KK6D 3FHQA 3FB6A 2ZG3A 1AXTL 4I18A 3CXDL 3EJZD 2JIXB 4N0FA 1MFNA 3TC9A 1QSVA 2N1KA 3F12B 3OKLB 2C1OA 3MRIB 3C09C 4JVPA 5HJ3B 3NVQA 4GRLD 4TUKH 1JYWA 5D7IA 2GUOA 3TWCL 4CL7A 4A2MA 4MGXA 5IEHB 4D8PB 3DX8A 5T1LB 1Y18A 3QDMD 2CSPA 1S9XA 2ICWI 1T2QL 3R06B 4LSDA 4RMTA 5GS0H 4R4FH 3IS0X 5K9OA 2OQJB 5CD3A 4MNQB 1IKFH 1ZA3B 2OI9C 4M4RA 3NCFB 4CVWA 1NGQH 1DQJB 1JWMA 5HHME 2XKSA 4OT1H 1FFQA 1MJUH 1CDUA 2WINB 3CK0L 2E6PA 1ZHLA 3QIWA 1PYWB 4KU1A 4LHUD 4Y2DC 2YUXA 3QFJE 4Q6IC 1RY7B 3FKUS 1YEKL 1W0VA 1FGNL 5C0BD 1KELH 4OGYH 3JV4A 4ELMB 4G43A 1I85A 2P8LB 1TETL 4NPYB 1G7LB 3QWQB 4JFYB 4RFEA 2IANE 4I3SH 3IU4L 4WW1B 2FECI 4KKCC 3S34L 5DJDB 4IOSD 2C7UA 3VXOB 1KIQB 2PF6A 2I60H 3ZL4H 4Y4FD 4DAGH 5HPMB 1AGEA 3VW3L 2XACC 2OMNA 4UINH 5ESAB 4DFIA 1A6AA 2OJEA 3BPLB 2ENYA 2JLLA 2W9DL 3K4DA 3OV6A 3MFFA 2VABB 5FEBA 2WWMD 3IYLW 2FJGB 5E9DE 2BSRB 4U1IB 2HKFL 4MD4B 5DZLA 1OAUH 3J7HA 1JZ7A 5E6IC 1MLCA 1RZJH 4H88H 4M61A 3QXUA 4J1UA 3GJFK 1WTGT 2VDRH 4TUKL 1FE8H 3ARXA 1EHNA 1JUFB 1EHAA 2B5IB 5IJKC 2V5RA 4KJWD 3I02B 4R4FL 5LBSL 2YUZA 4X99A 3MZGB 5CBEB 3MRHA 5JNYB 1Q1JH 4GSDL 1XF3A 2ZJSH 1V7MH 1NGQL 4PRPD 5F7FA 4KAQH 1BJ1J 2H3NA 1MJUL 4LSUH 4S2SA 4APQD 2A0LC 32C2A 2EDBA 2KZWA 4KK9C 4TN9A 3BEWB 2XTJC 1ODAA 5H2BA 4ZFOB 2F8XC 3SKUD 5SWSB 4I9WD 3G5YB 1C12B 2YK1L 2H9GA 3QUMH 3P11H 1MVFA 3IDIA 2YD1A 2V5MA 2VITA 4W6WB 4E0RA 3BIKA 1G7PA 4U1SA 1GOGA 1WCBA 2FIKA 3K2UH 4OCLC 4OGYL 3VD9A 5JHDB 3U4EA 1UQSA 2C1PA 4FQHA 5JXEC 1IM9A 3LPWA 4Z7NE 4LPCA 3IGAB 4XNMA 3KYKH 4MWFB 3CH1B 2DIBA 4I3SL 1HKFA 3SDDB 3PL6C 1FG2B 2W1NA 1FZMB 4TPRH 2XTLA 4W70A 3WSQH 2PXYC 5GGSA 5DVOA 4MNGE 1XF1A 4R6UA 5E9DA 2ADFH 2I60L 2ZZUT 4ZAKD 2VXTH 3ZL4L 5CIPH 3U6RB 4ONGL 1IEBA 4GAYB 2VMFA 2NX5D 5DQJB 2NZ9C 4Y4KA 2M8XA 4XVJH 3UAJD 5TE4H 4MZ2A 3ZKXC 3EHBC 3KPRD 4FQXC 2GY5A 3V5DB 1ACYH 1RZJL 5FYKH 3LRHA 3PWJB 2BRRH 4JZJC 1YNLH 4EI6B 3MROA 4NZDA 5DEZA 4IRJB 1H3WM 4JDVB 1KYOK 4UQ2B 5GRVL 3PJSB 2VDRL 2ADGB 1OTUD 4NNXB 4ENED 3AB0B 4Y7MA 3L6FB 3PWLA 4DZBB 4PGCB 1I7ZA 4NDMB 1YMMA 2EKJA 4B53A 1U58B 5HYQA 3ULVH 1AXSB 3OKKA 1OSZA 3QG6A 1IGML 3UTPD 2P5WA 4PGJA 2ZJSL 1AE6H 3C60A 2AVGA 1V7ML 4LSVH 4ZQKB 2YEZB 3SKJH 4X98A 4KAQL 1F8TH 4ELMF 2Q86B 4PYGA 2AGJL 4LSUL 2AV7A 3WDIA 3NBNA 3EJJX 3DGGA 4Q2ZB 5F7UA 5JOFA 3UTTB 1NAMH 3WN5B 1LVEA 1E4KC 3OL2A 4F9PC 3QUML 3P11L 3QUZB 5A16B 4I5BA 2CK2A 2DWDA 2HT3C 4HFWA 2XFXB 3K4AA 1FFRA 3B9KA 3KYKL 2AI0H 4NQED 4IOFD 4Y5VB 3SKOB 1HHJB 3RL2B 3CSPA 5GRXG 3FCTB 4QRQA 5J1AA 5GSRA 4TPRL 3WSQL 1JRHI 3V95A 2ADFL 3UTSE 2A1WH 4G8EA 1JV5B 4N0UE 3QSKB 5F89A 1ZLWH 4JFHE 5ISZA 1NDMA 2YC1B 3GKZA 4KPHH 3HTLX 3QUYC 4U7SA 5DJ8A 4XVJL 3WS3A 5TE4L 1BQUA 3EDFA 3IKKA 4KJQD 4NQTA 1BQHA 1OB1A 4PRHB 5F6IB 2GFBB 2ZSWB 3DUSA 1A6ZB 4QF1B 1MFDL 1ACYL 3RVXC 1ZHNA 5ID1B 3KGRA 5DQ9A 5FYKL 1GGCH 1YNLL 1IC7H 3SJVB 5J9PB 5ABDE 1HQRB 4HLZG 4Q7DA 2FL5A 4HUKB 4U4BA 1G7MB 1LO0H 5J12C 3DURA 3VFSA 1NFDB 3BDYH 3JWNC 3C8DA 1G7QB 1L0YA 5FAAA 5AWNH 1TTFA 1FNLA 5E99H 2QR0A 2NCMA 1REIA 2WM0A 4MLSA 1X5GA 1JF1B 3F8UB 3QEHB 4LSVL 3SKJL 3UZQA 1DL7L 3ILQC 3LSOB 3IB4A 1IM3A 1GZQA 3MRKA 1HQ4B 2ADJB 1MQ8A 5EC1B 4YBQC 2LVCA 3VGAC 2EECA 4MQTB 3C6LA 1CDIA 3L95B 5B22A 5D7JA 3NIFF 3K4ZA 3LZFH 4N0CC 3T1FA 3LKOA 1SY6A 3F7PC 3JV6B 3AAZA 4PJIF 4U6VH 1AGBB 2D0HA 3BJLA 4BSWB 3UTSA 1WZKA 4EDWH 1R6VA 3KLHC 4PRIE 4OGZA 3W11D 3U1SH 5DJ2B 5F1NA 4BQ8A 4JG1H 4PJDF 3VFTA 3H9SB 3T08A 1JF6A 2CPCA 3RL1A 2ESVD 1N2RA 2DAVA 4YXHH 2GJZB 4KPHL 2UY6A 1DCLA 3OXSB 4NC2B 1EIBA 3D3VB 4D9QD 1ZHBA 3MREB 4GUPA 5F97E 4PJ7A 1UFUA 4Z7OE 3TA3B 1ES0A 3K1KC 5ALBH 4GG6B 2BY2A 3L5WB 3HE7D 1CXEA 1IC7L 1MRCH 4MSWA 1DN0B 3RWEA 5CZKA 3OKEA 3WIIL 4G7YL 3D85A 3WFCH 2P43B 5KN5B 3DHMA 3E2HB 5AWNL 4RFNB 4J3SA 4N8PA 1UEMA 5FF6A 4YR6A 1CGWA 2X4UB 1CDCA 2HP4A 1II4E 4TSBL 2X4NA 4K07A 5C0IB 4OZIB 1P4LA 2LVEA 3QULB 4LKCA 2F53E 3H7BB 4NN7C 2Y1VA 2W9EH 5F9WB 1AHWB 5IB3A 1FFNB 1ND0A 1G9NC 1UH2A 4PJHB 1IAKA 2J8UB 2I9TB 4XPAL 3H42H 3LZFL 2ID5A 4JM2C 3QUMB 1KF9B 4MJ5B 1D9KD 5CBAA 1BZ7A 1G0XA 4AQ1B 1WIUA 2BCKB 4U6VL 1XGUB 4EDWL 4JZNB 1WFOA 1TZHB 1C08A 3RNQA 1X44A 3KNBB 5FYKU 3HAEH 2Z31B 4JJ5B 1V3MA 2R56H 3U1SL 1IQDB 4M1CD 2GIYA 3MACH 1TQCC 1CZ8H 1LEKB 1RZ7L 2N4IA 4JG1L 2NW2A 2I25N 1UB5B 2BFVL 4L1HA 3SDAA 4HUXA 2H45A 2AK1H 4HX1A 5CIPB 1MCWW 3T4YA 4ZUUB 4K8RD 4WHTA 3P0GB 4BZYA 4JR9H 1ZLVH 4FXGA 1T1YA 4YGVB 1MEXL 1AP2A 5ALBL 3WEXB 1T6VN 3LEXA 3Q1SH 2WQ8A 1NBZB 3WNKA 3UJTH 4C56D 4RGMC 2YHGA 4IRSB 3R8QA 2WLYA 3WFCL 2JB5H 3TBTA 1PLGH 1T0NB 4LIQE 1GRWA 2X6MA 3OR6A 4I0CC 4W4OA 3SGKA 4FS0A 1J05A 4NQCA 3VXQA 3BQUB 2DLHA 3RWJA 1T4KA 4WI8A 5EIQA 3SBWC 1GGYA 3RU8H 3SE3A 1TPXB 3TVMB 3GO1H 1XGPB 3S4SA 4ONHB 2VYRE 3FHAA 3MLYH 2NY0C 2PETA 1GC1H 3QIUD 5E2JA 1F58H 3V7AG 4WTZA 2W9EL 1NFIA 5H35A 5FB8A 4NWTH 1FZOB 5IEKA 1U8NB 2IFGA 2VL5A 3WIHH 4JFXA 5KS9F 3MLTB 3BGMB 2VAJA 3OWEA 5EIIA 1MRFH 3D2UA 4X6BA 1CFTB 3CLEL 4DUXA 4G7VH 4AT6A 4TUJB 2I5YH 4TYUA 5GGRB 1U92B 5A2IH 1RJCA 2R39A 2R56L 1WFUA 3IETA 3MACL 4G8IA 4UB0H 5ICXB 3DARA 3MCKA 3O2DH 5J6HA 3MRPB 1A6WH 5JMOC 1IGTB 4JREB 2JJTC 4L3CB 3V5KB 2HLFC 2HA1A 4FNLH 1B0RA 3GDBA 1Q94A 2DWEA 1KG0A 2OX5A 4K7FB 4AL8H 4XVUC 4OCXH 5HGDB 4DCQA 3Q1SL 2DQCL 5T3XD 2YZ1A 2PW1B 3TO4C 5MENB 1QNZH 4UDUB 1M05A 3UJTL 2JCCE 2W60A 4KKNA 1T0MA 1HE7A 3RKPA 2OZ4H 2RQ8A 3RWIB 2JB5L 4WDIB 1MJ8H 1DBBH 5MERA 5GS1C 4LPVA 1VFOA 3GJFA 5ICZB 3VWKB 3DETC 3LKQB 5EZLA 3ET9F 5F8RC 3HZMA 2IAMB 1XF4A 2IH3B 3WV0A 3RU8L 3FQNB 5SWZA 2ZNXA 2BNUB 4F7CA 3MLYL 2R0LL 1G9MC 1T5XB 1GC1L 5SWSD 3DV6A 1JPFB 2Z92A 1CICC 4MCYB 5HI5D 4J23A 2Q7YA 4HKJB 3GRWA 1Q38A 3WIHL 5E94B 5BZWB 3KG5A 1OWWA 3C5SB 4YC2B 5KSBE 1CE1H 1HSBB 1WFTA 4HMCA 3QIBA 3QDGA 5ESVB 1MPAH 1MRFL 3EYVB 3C08H 1SEBB 3WFDH 1HXMA 2YZ8A 4PJBB 4L4TB 2LFGA 3VXPA 4S0SD 4S11A 2I5YL 4KI5C 5I6XC 4GBXD 1P7KA 5M95B 1OLZA 5EOTB 1S7WA 3WS6A 4HIHB 3SN6N 3SDDD 1O0VA 4F58H 3MRRA 5L9DL 4WUUB 2CDGB 1RK1A 2NY1C 3O2DL 5DRNA 4GXUM 4L4VB 1A6WL 2J5LC 2OP4H 4H8WH 2I9LA 4LLMA 5INDA 2VZ3A 2FO4B 4RAUB 5B38A 4K3EH 4FNLL 1OY3B 5I8CB 5DEGB 3TESA 4IRZH 3CFEA 1CVSC 3ZDYE 1EXUB 2J2ZA 4P2OB 4FQJH 1CF8L 5D8JH 1XGQB 3VGHA 5HGGS 3ULVF 3LB6D 4HWUA 2BRQA 3IF1B 3VRLF 3FT3A 2O61B 5EUOE 4LRIC 1BVLB 1QNZL 4JG0L 3S88H 3CIQA 5HXMA 2OZ4L 3PIQB 4W68A 4OD2A 1MJ8L 4U33A 4Y19B 2YPKA 3DO3A 5D5MA 1GCFA 4APQA 1K4CA 1YEEH 4LCCC 3W39A 4NO2B 3IRZA 5KJRH 3HI5H 4X5XA 1SYSB 1BREA 1VFAA 2W0LA 4ORGA 4NWUH 5EO0A 4AM0A 2EH8H 1ZT1A 2DQTL 1KPVA 4GKNA 4CBPA 1C5DB 3ARRA 3CC5A 2BOCB 1MJJB 2M1KA 3UTTD 1UWEH 1HEZA 4UTBL 2X1PA 1S9VA 3FB5B 4M62H 3V8OA 5AD0A 4YHNB 4KZDL 3U7AA 3O4LB 1CE1L 3JUZA 5TDPB 3FO2A 3CNKA 5ID0B 1MPAL 3L3JB 4ZFZB 3VXSB 2AJ3B 3C08L 3WFDL 4HFUH 5IVXB 2BVQA 2IBGA 3HZVB 4ERSH 4OGXH 4CVXA 1NEZG 4M48H 4HJGB 5IQ9A 3BUTA 2FEDD 5DSCB 1M7IA 4F58L 4I18C 1AD0A 3FOMB 2R4SL 4H1LG 4M93C 3SHSA 5TE6H 4YEFA 1WBYA 3HAEB 3PP3H 2PTTA 4XZUA 2JE8A 1KLUB 5C2BH 3O6FA 2OP4L 3ARBA 1I8MA 1Q9WA 1H15B 2R1YB 4P2QB 5E2TL 1MCFA 5FYJE 4K3EL 4U1LB 3I3EA 2XNAA 4FABH 4IRZL 4PRHD 2Z91B 2BVPB 5FO7B 1U8LA 3WMSA 5D8JL 1DLFL 3C2AH 4YAQA 3MCLH 3MV11 5IOPA 4LLDA 4EN3A 2BVOB 5A2FA 3PDGA 1ZGLB 3TT3H 3SJVD 3E1F1 4NO0A 4YHKH 3JTSA 1T7YA 2DIAA 4OIIH 5DYOB 1GPOL 1NCAL 4Y5XA 4EI5B 4QRRB 3S88L 3QIWC 1DLHB 1I7TB 1F00I 3CSYB 2VDML 1JVKA 3T65B 3FO0H 2O26U 4O51B 5FECA 1NCTA 3CGTA 5KJRL 2A38A 3RBGA 3HI5L 1UEYA 4Y1AE 1EK3A 1EEZA 3BWAB 4NKOA 3W9DB 1INQA 4WVRA 5GGTL 5HD8C 2P42B 1I85C 4DKEH 4DOHB 4NWUL 1U8IA 4P3CH 4MX7A 2EH8L 1NCWH 3VFUA 5DXWA 4ZD3H 3BH9A 4M8QA 2CR6A 1RUKH 4LHQB 2DQGL 3RI5K 4U0RB 2OR9H 1CL7I 5DD3H 1DBJH 4M62L 3V6FA 4I1NB 3G04B 1D6VH 4KY1H 4O02L 4UMGA 1Q8MA 4UIKH 5TGBB 4QCIB 3DUUA 4I3RH 4WV1B 3HE6C 4ODSL 1X5ZA 2FD6H 5DEFB 2G9HB 4HFUL 4PR5B 2PYEE 1X7QB 2EE3A 3MNZB 3CUPB 4ERSL 3IFLH 4OZFA 2V2XA 2ZSVB 5DHVA 5BS0E 3D39E 4M48L 3NCEB 4LOUD 5LAXA 5HHNA 5DDHA 4HG4J 4XPTL 3V4PL 3QI9D 2AXGA 5TE6L 3Q48A 5ETUB 1QSFB 4Y16B 2AQ1A 1LGVA 4UU9A 2F54A 1P84K 5C2BL 2UWEF 4ZO8A 3ARVA 2ZUYA 1EEYA 3FO1B 1QYGH 2VE6B 3C8HA 2UZIH 4QRSB 4FABL 8FABB 3D3VD 4RMUA 3IDUA 2DOCA 2J4WH 1S5HA 3QUXC 1N59A 4KQ3L 3MV01 5TDNB 3MCLL 4WFHE 5E4IA 3ZHDA 3TT3L 3S96A 4YHKL 5KANI 4OIIL 3B2VH 1QFWH 1QRNE 5ICYB 5HHVH 4NQDD 5D70H 2OYPA 1LILA 3A0OA 1RZFH 3F6LA 3JXAA 4AH2A 1EV2E 3ZKMC 3G6JF 3FO0L 3QWRD 4M7LT 1Q9KB 3LQAH 5JDSB 1I7RB 1QR1B 4S1SH 3QXAB 1OTSD 3E6FB 3PWPB 1A4KA 3VFMA 3QISA 5HHPB 4DKEL 1G1YA 3TH4T 3IDXH 4YFDB 3PWUB 3S7GA 4GKSB 3T77B 3TCXA 3NIDF 1GVIA 3BSZL 3QQ9C 5E8NB 1RUKL 2ORBH 3CSBA 2OR9L 1FCCA 4IS6A 4C58B 5I1AA 3HB3C 1D6VL 4XTRD 4XWOC 2Q6WB 1SQ2N 4I3RL 1J8HE 4QHNA 1WZMA 1HSAB 1AKJB 1WV7T 4Y4KC 3P40A 5FUCC 5SV4A 1K8IA 4MJ6B 1UGNA 1JF5A 2Y6SD 5EU6A 2DYPA 1QSEB 2ESVA 1QD0A 2GQHA 2O93L 3KYOB 4FTVA 4OLUH 3CFKB 3OKNB 4OZ4B 1YPZF 2Y9RT 2FGWH 3GUTB 1UZ6F 3FO9B 2YRLA 5HVGB 1EHLH 5CSGA 5B4MC 1QYGL 4OCYH 2UZIL 4G6FB 4PD4K 1QRNA 5E8EA 3RVWC 5HGHA 4ZS7H 3B9DA 1ACZA 1VERA 5GGUA 3VXNA 2HFGL 5F21B 3VDBA 1U95A 2NW3A 1RI8A 4OKDA 5HVHB 2VDNH 5FXCH 1MI5A 2MSPA 1QFWL 5SV3A 4HIEA 5F7DB 5HHVL 5D70L 1XGRA 3V5HA 4POZD 5D4QA 1A1MB 3N0PB 4BYHA 1RZFL 4Z7WF 4IRSD 1QBMH 2GEEA 4J4PA 4MVBC 1PY9A 4U1KA 4DJMA 5IP4A 4DVBA 5F6HI 4KROB 3X3GH 3LQAL 4QOKB 5HYJB 4HUWB 5DD6B 3LEVL 3OGOE 3VXTA 3FT4B 1ZT7B 5IW6B 2GKIA 4U7KA 1PG7W 2MNUA 1WK0A 3OX8A 4JFFD 4K7PL 2ARWA 5EN2B 3TVMD 3IDXL 3B9KC 2L7JA 3BRGC 2X40A 3L3OA 4OD3H 1OSPH 1DZBA 3VXUB 5DS8A 1UM4H 4N8CL 1KTDA 5IHZA 2ORBL 4OFDA 3R4DA 4CU6A 1EGJH 4HK0A 5IB5A 4P4RA 1LO3H 4NN6B 3NOIA 4G8GB 3VFWB 4E41E 2A73A 4WI7A 1N6QL 3QCUL 4Z78B 2A77H 1DBMH 5E03A 5I16B 4U1MB 5C0JA 3T0XA 1CQKA 1BQHG 5DZOA 2QJDA 3AGVA 3GGWA 2QL1A 3ECBA 1BHGA 4EUPH 4EDXB 4LLYB 4NBXB 4Y5YC 2VUOA 3GI9H 2JJSC 1Q0XH 1XGTA 2VDPH 4GO6B 3C2SA 4NKIH 4K9EC 2HKHL 4IJ3B 1T1WB 3ARDB 1JGLL 1CT8B 5JW4M 1NJ9B 4LF3A 1EHLL 3T2QA 1U8OB 1MHPH 2B8OT 2JIXA 4YH6A 4DQOH 2H8PB 1OP3K 4OCYL 4HEME 3VD4A 3F12A 1KJMB 4LAQH 5HJ3A 1T04A 4ZS7L 5CZXD 4UZGA 1AGFA 5GZNC 3OQ3B 4N9OB 5IEHA 3U36B 3N06B 4GLRI 5T1LA 2VDNL 4PP1C 1EJOH 1JZ2A 1DVFC 3O8XC 1WQVT 2OQJA 1FJ1B 2DDQH 2Y5TB 4MNQA 5EO9B 1ZTXH 15C8H 3QDJB 4IIQB 1QBML 4GW1B 1IILE 4JKPH 2H26B 3C6LC 5JMRA 2FZ3B 2WINA 3X3GL 3GMRB 3VWKD 1PYWA 4UQ3A 1NC4D 3RGVB 4XAKE 2IAMD 5AUMB 2FJHB 4D9LH 1E4XI 2H2SD 1U9KA 4E41A 4WY7H 2NXYB 2QSVA 1HILA 4OD3L 1ZVSB 1OSPL 3HLAA 1UM4L 2FX7L 3I6LD 1B3JA 1NBYA 4ELMA 1NBQA 5I75C 3KYMB 1LO3L 3RKDD 1MHCB 3DGCR 1G7LA 4NPYA 5CHNB 4JFYA 4AENB 4GS7B 3CDCA 3KVQA 2CKBH 3VXOA 1KIQA 1ZLWK 5EFIB 1U0QA 5EU5A 1ED3B 1Q0XL 1YEJH 2VDPL 4YBLB 1YEHH 2LTQB 4HH9B 4NKIL 1MRDH 4WUUD 3SPVB 3C8KB 2FJGA 3QH3B 3NIFE 2OLDA 5E1AB 3HUJF 3OG4B 1MNUH 5GRJH 3MUGB 4OB5L 4F8QA 1OPGL 2EDRA 4PJIE 4ZUSB 4LAQL 3IJHB 1XR9B 3EOAA 3VGGA 4WWKB 4Y88A 5D72H 1JUFA 5IJVA 2VZTA 1OGAE 3I02A 2VDLL 4PJDE 5CBEA 5EOCJ 2DDQL 1ZTXL 2CK0H 2J88H 1T66D 3QO0A 4ODUB 4V1DB 3TNMB 1ORQA 5DF0A 3BPOB 3DXAB 4Y19D 3B4NA 3LIZH 4FMKA 3IXAB 3TCLB 4ZFOA 1ZVHA 5CMAB 1C12A 2G60H 1BOYA 1H3PL 2YN3A 3SKMB 2BSSB 2QKIB 2XKNA 4WY7L 2FECL 2HH0H 2DTSA 4DKFH 2D7NA 3BFOA 2AABH 2HMID 1NGXB 5JHDA 3EFDH 4KRPD 4OGAD 43CAB 3CZJA 5I17A 1HKLH 3PP4H 3IGAA 1RIHH 3T0EC 3X12B 1ZSDB 1AO7B 3VA2C 4GRWF 1MCJA 2LU3A 1ORSB 3KLSA 3SDAC 1CG9B 1FZMA 4M4PA 3DHJA 3VXSD 4LLWA 2LU4A 2EE2A 3R0NA 5E2UL 1KJ2H 2VRAA 5FKPB 1T03L 4GAYA 4HUMB 4ZNCD 3ULUC 1YEJL 1YEHL 5DQJA 1CXHA 2OL3A 1NLBH 4X7CC 5TJWK 4KRMB 3X13B 5FM8A 1MNUL 5GRJL 3OJDB 4OUUB 3PWJA 4P2QD 2KQNA 4IRJA 3M17A 4W4OC 1T89A 2AXJA 3MO1A 4JDVA 3U0WH 3VRJA 1LE5B 3PJSA 3RRQA 1Z9MA 1IZJA 4NNXA 4YUEH 2MHAB 4TUOA 4ETQA 4UNTA 4DZBA 4NQXB 3BP6B 1J0YA 4NDMA 2GY7B 1U58A 1YY9D 3NH7H 4EI5D 2CJUH 4QRRD 4WTZG 3GZKA 5FCUH 4X4ME 2Q86A 4AEFA 1LK2B 5C0GB 3ALWA 3LIZL 1FP5A 4M6AA 4Q2ZA 1DBAH 4L3EE 3WN5A 1M71A 1T83A 4R0LB 3QUZA 1U3HA 2HH0L 4KZEH 4MYWB 4DKFL 4TTGA 1S7VA 2AABL 4Q9QL 2XFXA 3MV7B 3RUGB 1HKLL 3PP4L 3RTQB 4EEEA 4KK8C 1RIHL 4KK6C 3EOBA 3U9UB 4BSVA 4Y5VA 3SKOA 1HHJA 1A7BA 3RL2A 1I1AB 1EVTC 1L0XA 3RIAK 1EO7A 4KJYB 1QBLL 1KJ3H 2AERT 4BH8B 1NDGA 5I30H 3L3GA 4WI5A 3MXWL 1JV5A 1CTNA 1KJ2L 2IJ0C 1HXYB 1TQBB 1FL3B 4IDLA 4K2UL 2UYLB 2YC1A 3BGAA 3N1FC 1W0WB 3IAGC 4JO3H 2HFEB 1F90L 3NFPB 1ZLVK 5F96L 5I0ZA 3B5TA 1QSFD 2VTFA 2GFBA 4NHCH 4HWZB 5I71C 5KS9E 4PJ5D 4NNYB 1YN6B 2V2WB 2BK8A 4MZ3A 5ID1A 2LQRA 4JANA 3G6AA 5K9JH 3FMGL 3SJVA 3KPQB 1IGCH 1YNKH 4JCLA 4LPUA 4E5XB 4HWEH 4YUEL 1D7FA 3DO7B 5JW5B 1NFDA 4OLZH 4HULB 4X4MA 2VC2H 2WBKA 1G7QA 3I6GA 2X41A 3KHOA 4HLJA 3QCTH 3T1WA 3NH7L 2YPLD 1CLYH 2XRAH 2H1PH 1NCUA 1KB5H 4FA8A 5T5NG 2CJUL 4KKBD 1MCKA 2HFFB 4FQ2H 2B4CC 3DSFH 1YA5A 3LSOA 2C3VA 3X11B 1CXLA 3GMQB 1S7RB 2MQCA 2ADJA 4NRYB 3UDWA 4L3AA 5EC1A 5DWUH 1SJEB 3BT2H 2D03H 4BJLA 5C07B 1MCHA 1A22B 3L95A 4Y4FC 1G6RL 1MSPA 4KZEL 5I9QC 3DX9B 5CEYB 4NZTH 5EOCH 5HI3D 3DSNA 3BZFB 3H9ZA 3PQYB 3I50L 1RUPH 1AGBA 2GI7A 2WWMC 4JRXE 5D2NC 4BSWA 1KTKE 3DYPA 2G75B 4P2CG 5JORB 5DJ2A 3ARPA 4HAFA 1AKJD 1KJ3L 2VJXA 3NZHH 4UDTA 3H9SA 1FV1B 4WFFD 3WHE1 1P1ZB 1I8LC 1QSED 2BZDA 2EKSA 3M8OL 5HSFA 4WHYG 2GJZA 1TDQA 4XNUH 2EIDA 3OXSA 4JO3L 4XX1E 3BZEB 5EA0L 2BC4B 3TN0B 3MREA 1K9TA 2C5DC 1ZE3C 4Q6YA 4P57B 5GZOD 4NHCL 1A4JA 2EXWD 4U3XA 2P5EB 1VPOH 2B20A 3TA3A 1HHHB 2NNAB 2XWTA 3GSRA 4HS6A 3WNOA 5I8OH 5K9JL 1IGCL 4APQC 4G6FD 1ZOXA 4HWEL 3NPSB 2VL4A 4OLZL 1FHGA 5JHLH 4N90D 4I48B 4H1LH 5KN5A 2EIZB 4OBRA 1CLYL 2H1PL 1K8DB 3STLB 1H5BB 4PREA 3NCBB 2X4UA 4FQ2L 3DSFL 5HHOB 5IT2H 1L7TH 4MQ7A 5FUZH 5C0IA 5JPMB 4OZIA 4DZ8B 3BPNC 5F8QC 4KROD 1JFQH 1WITA 1EJ6A 3HC0B 1B0WA 3MJ6A 3MBXH 3H7BA 5DWUL 1RD6A 2DI8A 3DV4A 4OCNC 3U9PL 4PY8J 4RZCB 3VRLE 1FFNA 2J8UA 1ZLUH 3WE6B 4M43H 4NZTL 3QUMA 4MJ5A 1GOHA 4ODHL 1HNFA 5EOCL 3RZCA 1JGUL 2BOBB 4K3JH 3UAJC 1RUPL 3VG0H 1XGUA 4JZNA 4Z18A 1J86A 1N5YH 3KNBA 2Z31A 4JJ5A 3C6SB 2HTLD 3ARBC 3RDTA 1IQDA 1LNUA 2Z35B 1OWRM 1PX4A 2EEAA 4NT6B 1LEKA 4PTTB 1NCBH 2OCFD 3HG1B 3KHQA 1OTUC 1UB5A 4PY7A 3CFBB 2IBZX 4JRYB 3I6KA 1KJ2B 1KXVC 4XNUL 5CIPA 4A2LA 4DN3H 5T1KB 1EA9C 1IKNC 1ZA6B 4Y2DD 4PJEB 1GXEA 1WIPA 4ZUUA 3ARDD 4GRMB 1VPOL 3KYAA 4YGVA 1E4WH 1UVQB 2Y36L 2DQDH 3UYPA 3WEXA 5I8OL 3SQOH 5BRZE 1FRGH 3TBSA 4PJ8B 1NBZA 4OFKA 1WAAA 4NUJA 1F6LL 1BX2B 4IRSA 3Q0HA 4UUJA 2APVA 5JHLL 5K9KB 3ROLB 3V6OC 5C09B 1UB6B 2E27H 3NAAH 4KGLA 3RA7H 3FONA 4J3UA 4KKCD 4Q0XH 2A83A 4JFQB 3IU3A 4JKLA 4TULL 3BQUA 4NRXB 7FABL 4GAJH 4WRLA 1L7TL 4XP9L 4YDLB 3TVMA 5FGCE 4IOFC 1A64A 1JFQL 4ONHA 1KT2B 2BNQD 3RWFB 3MBXL 4JGUA 1KPRB 2E9BA 5LGHH 1RZKC 3MV9B 3VXMB 3V79C 5HI4C 4CNIA 1IT9H 4HH8A 4OZFG 1NAMA 5CD5D 4L8SC 1U8NA 1WGOA 4M43L 1BAFL 1XH3A 4LVHC 3BGMA 2B0SH 4RMQA 1JNLH 4YNYB 4F7MB 3NTCH 1FYTD 1G6RB 4UILH 1A1NB 1N4XH 4X4YB 2Y7QA 5I1JH 1N5YL 4TUJA 5C9KA 5GGRA 1U92A 1IC5H 3MRCB 4ZOAA 1IAIH 1PKQE 1N0LA 4BQ6A 3QDME 3PP3K 4QNPF 4KMLB 2X2YA 1NCBL 4IHOB 4XXDB 4PJCB 5ELIA 1M4KA 2XZAH 1BP3B 3X3FH 3PG2A 4PJFB 1J0ZA 5FIEA 2VLJB 2XTJD 4PJGB 3WCYA 5DVNA 2N56A 9CGTA 1UT9A 5DURD 1XIWA 2OTUB 3E6HB 1FCGA 4PB9H 5I1HH 4RSVA 3D0LB 3IFNL 3VU2A 1S7SA 3MOAH 4JQIH 3SQOL 5C0BE 3T3PF 1UG9A 4UDUA 5MENA 1GAFH 3TZVA 4X4ZA 2VNCA 1YN7B 2FYYB 1S3KL 1I3RA 4WDIA 4FQPA 5DK3A 2E27L 3KPMB 3FFCD 3NAAL 3RA7L 1DFBL 1VESA 5ICZA 4Q0XL 3VWKA 5L2KD 1KB9J 3FN0H 3LKQA 4GAJL 2UWEE 3BO8B 4G42B 2GJ6B 3FQUB 1CD1B 2IH3A 1CFNB 5TFSH 1KB5B 5C08B 2BNUA 5I1DB 2XQBH 4V2CB 1V8HA 3QQNA 4UNUA 2NZ9D 2V5SA 4UT6H 4JM4L 4B0MM 5KZCD 1T5XA 1XZ0B 1RK0B 3O3AB 5LGHL 4YHPB 1IT9L 4MCYA 1HI6B 2XG4A 1CDJA 4GW4B 5E94A 3C5SA 4FFZL 1HSBA 1JNLL 3Q5YA 3O41B 5KSAB 3NTCL 2CQVA 1N3NB 4UILL 1F6AA 3EYVA 4F9LC 1N4XL 4M6MH 2DJSA 2XXCB 1FFOA 5BZDB 3O0RH 4L4TA 4QHUB 1S9KC 4LEXH 1AO7D 3P3YA 4Z6AT 3OAYH 4MAYA 1IC5L 5EOTA 3U30C 5C0FB 4L9LB 1T6WA 5TF0A 3H8NA 4HWBH 3SDXB 3LKRB 2EC9T 4K23H 3MNVB 1BPVA 1JN6B 1EH9A 3G5VB 5L0QB 1HZHL 2EYTB 2XZAL 5M94B 4L4VA 2VLKB 4PRPE 3NIDE 3X3FL 1MLBB 5GPRA 2CRIA 3SCMB 3MGTB 3V2AR 1GH7A 3L3IA 5IHUH 4EBQH 5I8CA 5DEGA 3CU7A 2R23B 1EXUA 4P2OA 5GRUH 3MUY1 4DTGH 1H3UA 4PB9L 5I1HL 3IF1A 3RVVD 5SWQB 4JQIL 3MOAL 2Z8VC 3MRGB 4JPWH 4WCYH 4Q74A 4S10A 1TMCB 1BVLA 3HZYA 2ENSA 3SOBH 1H0DB 2DQFB 5GJSH 3SKNB 2HT4C 3V0VB 3PIQA 1UM5H 1NEZB 2VZVA 1DQLL 4ZOBA 4K7PX 4R26H 1JTTA 1ADQH 3GNMH 2VAAA 3FN0L 1D9KC 3HC3H 4NO2A 3GHBH 4H1LB 2WP3T 4PBXA 3ARZA 3FQTB 4TOYH 4JY5L 1UZ6E 5C0AE 5EIVA 3VWJA 3AXLA 1KCLA 4ZMAT 2BNRA 5D7IB 3T4AA 2XQBL 3QUYD 5D7LD 4UT6L 3LDBB 1Y18B 2BOCA 1MJJA 2YKLL 4M1CC 4YPJA 1SBBA 2DB8A 3DI2B 4LK4A 5K9OB 3K46A 3G6JA 1D6EB 5CD3B 3MLPA 3KPRE 3ZE2F 1U91A 2QSTA 3FB5A 4FQIL 4MXQC 4JHZA 1FNHA 4YHNA 2WUCH 2GAZB 4MB4A 3O4LA 5TDPA 3ZTNH 3B9AA 1N7MH 4AEIL 5ID0A 1FNAA 4Z7WE 2ILLA 3L3JA 4ZFZA 3L3DB 2AJ3A 2QADD 3D48R 2MQ0A 4TNWF 4YFLF 3HZVA 3OKDB 4YHOH 1AXIB 4LEXL 4HJGA 5F6HJ 5DSCA 1OAQH 4R97B 2APWA 1QFHA 4D2NA 3FOMA 4ZS6C 1HN1A 4K23L 2D0GA 3MPCA 3HAEA 1YYMH 1A6TB 3GSQA 3EKCA 2HJKB 3ILQD 2ZG2A 1U8JB 3QEQB 1N64H 4EQ3A 2B7DT 1AGDA 2AV1A 5IHUL 4EBQL 5E8DL 1LP9F 1YJDC 4YHMH 4WHCA 2APXA 5GRUL 3V6OE 3O9WB 4DTGL 2BVOA 3DNKA 4BM7A 4L29A 3O6KL 3TV3H 2OJEB 5DYOA 4WCYL 1YPZA 4DW2H 1M7DB 3QB7C 3MFFB 3SOBL 5GJSL 4GAGH 5C0AA 2PTVA 2VDOL 1DLHA 1I7TA 2EC9U 3CSYA 1UM5L 5AZ2H 4NQEE 4UOW1 3T65A 1OW0A 1YNTB 2R29H 1SYVB 4R26L 4O51A 1ADQL 3GNML 3U46B 1DQDH 3HC3L 4LSTH 3GHBL 5HPOA 1Y6NR 4TOYL 3ALPA 4RMWA 3W9DA 3GSWA 4M7ZB 5ECJE 1B6UA 4JQXC 4EXPX 3V0AC 5HHMB 3ZHLA 3RJDA 4D0BA 3MOQA 4Z7WA 4QY8B 3AREB 4H0GA 3SDXF 2XA8H 5MEPA 3QFJB 3G04A 3WFBH 2WUCL 2KBGA 5L6YL 3BPLC 1N7ML 4I2XE 32C2B 1MHEA 3O3BA 4XC1H 1DDHA 3P4OB 5H2BB 3WIHA 4GQ9H 3PQYD 2G9HA 3DWTA 4XNZB 1X7QA 1QLRB 3QAZB 4OCSH 5DTFB 5C86A 4AEHH 2H9GB 4HIJA 4X9BA 2VOTA 4J7RA 1SY6L 3IDIB 2VITB 4E0RB 3BIKB 1G7PB 3GIZL 1CGSH 2IADB 3OPZL 2IANB 4JO1H 2FIKB 4U1NB 1NKRA 5B3NA 1CN4A 5GISH 1YYML 3O81A 3MUJA 4FQHB 4Y16A 1HIMH 1YY8B 3AMLA 4XNMB 1N64L 3O2DA 1CLZH 1G7HB 5KVDH 2B5IC 2VE6A 2MTPA 4MCZA 4YHML 1T0PB 2FHBA 5GGSB 1HINL 1YC8A 1JIBA 2HN7A 5E9DB 1SVZA 4HG4K 1QPXA 5CP3H 3TV3L 1SVCP 3JWOL 4F15B 4DW2L 3IJYB 5ICYA 1YEDA 4GAGL 5GGQH 4X6FA 1Q9KA 5HDBF 4MHHI 5DA4A 4ZO6A 4NNPH 1DQDL 4LSTL 5JDSA 4M7KL 1CL7L 3MYJA 3HUJE 1I7RA 5CEXB 3QO1B 5J13C 3QXAA 2RAMA 3E6FA 3PWPA 4M6OH 5DVLA 5HHOD 4OQ1A 3WLBB 5HHPA 4JEGB 3PWUA 1X5JA 4GKSA 4X7TB 1I7ZB 2E7MA 4G9FE 3FRUB 1BZQK 5HYQB 3SDDC 1X4ZA 5E8NA 3MFGB 1OSZB 4XRCA 4OAWB 2BVEA 1JZ3A 1F11A 2XA8L 1FNEB 2MKLC 2JKXA 3C60B 4PGDA 1FC2D 3AS1A 4BUGA 2W65A 2H2PD 4I0PA 3WNLA 2HJFA 5F9JA 2F5AH 4PJ9B 2R0ZH 2C3HA 3DGGB 4XC1L 4GQ9L 4XAWH 5JOFB 4OCSL 3ORJA 4H5SA 2FX8H 1JGEB 3U82B 2ZOKA 1FDLH 4GXVH 2HFTA 1CGSL 4KKLD 4P9MH 2DMBA 4JO1L 1XEDA 3MLVH 4IRJC 3AM8C 3CFKA 5GISL 4P23B 2X89A 3OKNA 2XN9D 4OZ4A 4MNGB 3HG1D 3QXDA 1HIML 1F2QA 1WEJL 1C1EH 3AB0C 4DWHA 3BPCA 1CLZL 5KOVC 3Q6FB 5KVDL 2F58H 4JRYD 5GSRB 5BQ7B 1J0KA 2FBJH 4GRWE 4PFEA 4PJAE 4NCC2 5FO8B 4G8EB 2CO7B 2GITB 4H0IA 1NDMB 1VA9A 1HK6A 1KCSH 5DJ8B 3D9AH 4PJ8D 4WTXA 3WN5C 1BQHB 1OB1B 5GGQL 1T83C 4LIQH 1HCVA 4QTIH 2FHFA 2WNGA 5C09D 5DQ9B 4U6HA 5JUEH 1WISA 4OZHF 4Y4HB 1WBXB 1IARB 4G9FA 4QOKA 4HUWA 5DD6A 5HYJA 5HYFA 3FT4A 1OQOA 1ZT7A 4ISVB 2FL5B 4P0DA 5D1ZB 4M6OL 2VUYA 3DURB 3VFSB 5AAWA 5DI8A 5EN2A 2F19L 3KAAA 1R3IH 3UO1H 1I3UA 3MUHL 5AYUH 2YD2A 3VXUA 2ICES 2X9YA 4AY0A 1AH1A 4X6DF 4YQXL 5TPWH 3MV9D 3IDMB 3VXMD 4LNRA 1KC5L 4XVUD 3VFWA 4G8GA 1DEEA 4KDWA 4WW2B 2NY2D 4Z78A 2AK4D 2FHCA 1IM3B 3MRKB 3HNTL 5J11B 3SGDI 4U1MA 2R0ZL 5LQBH 1FNSH 1WICA 4TNVF 1I9IH 4C56E 2FX8L 1GGIL 2PO6D 3WFZA 1FDLL 4GXVL 1MCPH 2X4SA 4K94H 4ZOEA 3GMLB 5D7JB 5JTWA 4P9ML 3LPFA 3P0YH 2IFFH 2ITDB 4X80H 1MELA 2XWBA 2OXGA 5CJXA 1OAKH 3ARFB 2VXQL 3AAZB 3ARDA 5ESQA 4GLRH 1CT8A 3UTSB 1C1EL 4HKBA 4N0UB 4HCRH 1U8OA 1NAKH 4QKXB 2H8PA 2F58L 5HGAB 2VLJD 4M1GH 1KJMA 2FBJL 2N7AA 3VFTB 1U2HA 1UJTA 3U36A 1TZGH 3AS3A 3RHWK 3O6LH 2AJXH 1KCSL 2K1MA 2W91A 3D9AL 4CMHB 2Y5TA 4C4KO 1TCRA 3LN9A 3QDJA 1UXSB 4LIQL 4GW1A 2DIJA 4KI5D 1S8DB 1K3IA 3NFNB 4XBEH 2FZ3A 4WJ5B 3GMRA 4LFHD 3MJ9H 2BHYA 2X4OB 3RGVA 5F71A 1J87A 3ZT7A 3OKEB 4OKVB 5C08D 1R3IL 3UO1L 4LCWD 4Z7UF 1ZVSA 5ACLA 5AYUL 4LOUC 4NP4L 4WWID 1KULA 3I3BA 3QI9C 4Z95H 3WO4B 3MBEB 5TPWL 3KYMA 4F33A 1JYNA 1QQDA 2Z4QB 4JKKA 1YEFH 5CHNA 1CYGA 2WZPD 1KACB 2W0PA 2X4NB 3RWHB 4OJFH 1P4LB 3KJ4B 2X5PA 5KSAD 3TFKD 5LQBL 1FNSL 2RGSA 1I9IL 5C7XL 3GSUA 5D2LF 3GBLA 2NLJA 5EFIA 3H3PL 4MD5B 3V6BR 2NQCA 2BY0A 5IB3B 4K94L 3TA3C 3DVGB 3P0YL 4PRIB 1AIFB 4HJJH 4X80L 1S7QA 5CBAB 1UH3A 1OAKL 3QH3A 1LD9B 1QHOA 1RZJC 5E1AA 2VLKD 5A40E 4HCRL 3RIFK 1C08B 1FQ9C 2YXFA 3MUGA 1NAKL 2VDKH 3TIEA 3E2HC 4RFNC 5DHXB 2NY5L 4M1GL 4PS4L 5CCKH 2H41A 1XR9A 2NY4B 1A7QL 5SWSE 2EDXA 5DFVC 3GSXB 2NW2B 4WWKA 3BKJH 5IB4B 4Q9BA 1TZGL 3LQMA 4UT7H 3LEYL 3BRFA 2VR5A 4LGRB 1EAPB 3O6LL 1T7WA 1UZ8B 4KI1A 4M02A 3PUCA 3TNMA 4V1DA 1J0HA 4WHTB 5FDWA 3DXAA 4FXGB 5F9WC 1AHWC 1AP2B 4XBEL 3HI1A 4MNHB 2J8HA 5F3HB 5JQHC 3OJMB 2J12B 4S1QH 3IXAA 3TCLA 4GG8B 3LEXB 1PBYA 2WANA 2WW8A 2Y06H 5CEZD 1ROWA 1IZKA 2FX9L 3DECA 4G6KL 3SKMA 2BSSA 5EG6C 2Y6SC 1SMOA 4RAHA 4L8BB 1NLDH 3MSPA 3TBTB 2UVEA 3REWA 1QFWM 2Z31C 1RIVH 1J05B 1TIUA 4NQCB 5C0EA 4Z95L 2XICA 1HH6A 2F53B 1I1FB 43CAA 5EU3A 3V4VH 4WEBH 4JN1H 3X12A 1YEFL 1RZGB 4JJHA 2Q76B 2EDHA 3PDDA 4XH2B 5EUKA 1CG9A 4OJFL 3HR6A 4PLOB 4MHHG 4Y89A 3QIWD 4I77H 4AZ8A 3WKMH 5FB8B 1CBVH 1UJ3A 4MJIE 5IEKB 2VL5B 3BD5A 1MFBH 4HJJL 4TTDD 4WGVB 2WK2A 4OZFH 3BEVB 3VE0A 4X6BB 4D9RD 5HD8D 1RVFH 5MEOB 4IRSC 3OJDA 5E5UB 4AT6B 4KRLB 4OUUA 3MLXL 2VDKL 4Y0GA 4U1HB 5DJZB 2ZUSA 5IVZB 2P47B 2FATH 2WLZA 1LE5A 4G8IB 1WT5C 4G5ZH 5CCKL 1SBSH 5DC4B 3BQUC 2W0FA 3UTTE 2MHAA 1WZLA 1OAXH 1EAJA 3BKJL 1IC4H 5T3ZD 4UT7L 1TPXC 3MRLA 2YA1A 3TVMC 4OM0L 5I1CH 3T0WA 3OJ2C 2V2TA 1LDPH 2C9AA 1KG0B 2P24A 1CK0H 4Z77B 4HS3A 1JZ6A 1LK2A 3MQIA 4ZSOE 1RZIB 5JW3H 1EDQA 3FQRB 4S1QL 4DCQB 2EZ0D 4WENB 2Y06L 1TNNA 2P8MA 2FWOB 1RUQH 5A1AA 4Z8FH 4YPGA 3AS2A 3TIDB 4OFVA 3AY4A 1G84A 1K4DB 3MV7A 5EZLB 4UT9H 4WEBL 3KWWA 3RTQA 3VG9B 4JN1L 2YD8A 4LKXA 5F1KC 3U9UA 5EBMB 1B9ZA 4P2RA 1UYWH 1VGKB 1EGJA 4MJIA 1I1AA 1Z0NA 2Q7NA 2DLFL 2KQMA 1M1SA 4BH8A 4JKWA 2L7UA 4ZUTB 4I77L 5GXBB 3WKML 1H8OA 3ZKMD 3KJ6H 4NOFA 4FQQB 2Q7YB 2IQAB 2EE6A 4EUPA 4NKMB 3QIBB 3NFPA 5JPNB 4IDJH 3D18A 1KNOB 1VDGA 3H0TA 3X14B 4HWZA 1JZ8A 1IM9D 1RVFL 4NNYA 4NQSA 1NCCH 5FYJL 5DUPL 4XGZB 4XP4H 4HF5H 1R24B 3KPQA 1VENA 4O2CA 1S7WB 3RX8A 2FATL 3MRRB 4NSKB 4G5ZL 3VWKC 1SBSL 2EDDA 5JW5A 2IAMC 5E9DD 3HB3D 1A3LH 1IC4L 2H2SC 4QNPE 5I1CL 1WWWX 4XWOD 2I9LB 4LLMB 4RQQA 3HFML 1VGEH 2YXMA 2VQUA 1LDPL 3P9MA 5FDYA 3CFEB 2HFFA 2JCCB 1CK0L 4WFGD 5A3IC 3ME0A 3RKDC 2YD9A 3X11A 3GMQA 1S7RA 4PBWD 1G9MH 4MQXC 4RWHA 3FT3B 4ZTPH 4YC2C 1D5BB 4NRYA 4LPYA 3AUVA 5M7QA 1SJEA 5C07A 3R1GH 1IE5A 2C4FU 1RUQL 4Z8FL 1MUJB 3MRNB 3T3PE 4FP8H 2FO1A 3GI8H 4OD2B 5B4MD 3P30L 5INCB 2YPKB 1YMMD 2UZXB 2SEBB 1K4CB 4XCYB 3W81A 2MFNA 3BZFA 3RVWD 5HY9A 4LHUG 4UT9L 4X5XB 3C60D 3HC4H 2AEIT 4LMQE 4GG6E 4ORGB 1U6AH 5JORA 4WI2A 1ZT1B 4XVTL 5KSBB 5MEQB 4HBCH 4ONOA 4TNVK 5F7KC 4Q97A 2R8SH 2CKBA 4NQDE 3PGFH 1FV1A 1SJHB 4MVBD 4P2OC 3KJ6L 1S9VB 2GHWB 5AD0B 4DUVA 1IGIL 1WWBX 1AJ7H 3EAKA 4AMKH 4QHLA 4LVNB 3FO2B 3BZEA 2BC4A 5E7BA 4IDJL 3TN0A 5D93B 1HH9A 4P57A 1BJ8A 1D5ZB 1XR8A 1T66C 2P5EA 3ZE1E 4BH7B 5FO9B 1NCCL 1JPSH 1XCQB 1HHHA 2NNAA 3B9KD 4XP4L 4HF5L 5IMKB 4XNYH 4XPBH 1AD0B 4LBEB 4DEPB 1RMFH 2PTTB 2YMXH 1A3LL 4N8VA 5JLZB 4PJHE 1CLOH 2EIZA 3O6FB 5ISZD 4HT1H 4HZAA 1CFSB 1W0YT 5EUOB 4QO1A 2RIKA 2HMIC 1VGEL 4P5MB 3QA3B 4JZOB 4OGAC 1FIEA 2ED9A 1U8LB 4RBPH 5JPMA 5EPMB 4DZ8A 1FC1A 5T33H 4EN3B 4ZTPL 1RU9L 4Y5XB 4JDZB 4RZCA 4XPGH 3R1GL 2M26A 1AFVH 1B2WH 3P0VH 3WE6A 4FP8L 5IB1B 3GI8L 2I07B 1BLNA 3HZKA 4JM2B 5AAMA 5D96B 5IQ7H 1T7VA 4N1HB 4O4YH 1EEZB 4NKOB 3OAYK 4N0RA 3HC4L 5GZND 1SM3H 4U3HA 4U49A 3BN3B 1PD6A 1QLEH 1U6AL 1U8IB 3C6SA 4MX7B 2Z35A 1T22B 3DTXB 1I9RH 1WVZA 3VFUB 4JHAH 4PTTA 1VSCA 1F4WL 2OTPA 2R8SL 5D7SL 3RY6A 3V6FB 1AJ7L 3CFBA 5D7JD 3BZDA 5L7XH 5C70A 4JRYA 1KJ2A 4IM8A 4AMKL 5T1KA 3DUUB 4PJEA 1B4RA 4EI5C 4RRPA 2AAVA 4HAGA 1NKOA 3E3QE 3F65A 4JFFE 3UTSD 4OZFB 2V2XB 4GW5B 3MGOA 1JL8A 4XNYL 5LAXB 1OW0C 2CRYA 5HHNB 4ZNEE 2AXGB 3ZT5A 1UADC 4OTXH 1AC0A 2I26N 1RMFL 4YIQA 2YMXL 5K9KA 3FZUD 3S35X 5C09A 3RVUD 3KPNA 5CJQH 3B5HA 1EEYB 4MA7L 5D1XA 4ZPTB 3QNYB 3CMOL 3ZYIA 2I27N 4U0RC 4KJPD 4ELKA 3SGJA 1IGFL 1LP9E 3VDAA 2COQA 1GC1C 3QRFM 2JELH 5T33L 3F58H 1ZAGA 3WJLA 5E6YA 3S96B 4JGMA 3NGBB 4DGYL 4WV1C 1P9MA 2HVKA 5BXFA 3I84A 3QCVH 2ZCHL 3VXMA 5KSBF 4BZ1H 4Y1AB 1NGZA 4XCCH 3P0VL 1AD9B 3D85D 3RWGB 4LPTA 1FZJA 2ERJB 4F7MA 2DL2A 5IQ7L 1F5WA 4X4YA 5DGRA 1UCTA 2QV2A 4Y16C 4PUBL 2NXZB 1A4KB 1SM3L 3BZ4A 3MRCA 1QLEL 4P3DA 1A6UH 2QLVB 4R8WH 1I9RL 4YHIB 3MX0A 4JHAL 1UENA 4P9HH 4IHOA 4XXDA 4PJCA 1MQKH 4KKAD 2PYEB 4ZXBB 1ONQA 3KPSE 4IS6B 1JNJA 4WIQA 4PJFA 5BS0B 3D39B 2VXSH 3VDCA 3ZDYF 1NC2A 1ZEAL 4PJGA 4NZJA 5C92A 4QHNB 1A7RH 1Z5LA 1OP5H 2OTUA 4HK3J 3E6HA 1BQSA 4KKBC 2D7OA 5IESH 5EU6B 2DYPB 2WBWB 4GAFB 1A7PH 4JLRA 1Q9LB 4JFPB 1I1CA 3UTOA 1CQYA 4D3CL 2NY4D 4YLQT 4OTXL 2J8OA 4HK3N 1YN7A 3S36H 2UUDH 3OKOB 5CJQL 4B7IA 3SDAD 3STZA 2W9LA 1G7JB 2FIRT 4ZYKB 1IMHC 1JGVL 5HI3C 4MB3A 2YBRB 3BO8A 1QRNB 1MY7A 5E8EB 4JM2F 2GJ6A 1CD1A 3GIVB 1CFNA 2FEEI 4PJBE 1FH5L 1KB5A 1R3KB 4BA8A 5FGBA 5I1DA 1U95B 2NW3B 3ULUD 2BY3A 2JELL 1BD2A 3EZJB 1IEHA 3MJ7A 1MI5B 1XZ0A 1RK0A 4DGIH 2H6PB 4WUUE 2CGRH 1FL5B 3KLAA 1XGRB 4BZ1L 4XCCL 5H94A 1HI6A 2ICCA 4GW4A 1KB9K 4U1KB 4OLXH 1KUMA 4WNQB 1FSKB 3O41A 2QBWA 1VKXB 4NQCD 4WUKH 4G6MH 5BZDA 2XI9A 4QHUA 2DICA 5HDBE 3VXRA 5GZOC 2EXWC 3GSNH 5E8OA 1E28A 3DLQR 2YD7A 1A6UL 1J1OH 5I6XB 1GYAA 1KXQE 4R8WL 1AY1L 2HJLA 3SDXA 3LKRA 3C5ZB 3QT2A 3LKPA 4JFDE 4P9HL 5IHZB 5L8LB 1KEML 1MQKL 5T1MB 4LLQB 5IB5B 4P4RB 1EBPA 1MLBA 2A73B 3SCMA 3MGTA 4Y19E 3H2WA 5HVHC 2P7TB 3GMNA 3T3ME 1MCNA 1CFBA 4ODTH 5C0JB 1OF2B 1A7RL 3HMXA 3D2UD 4WI3A 5IESL 1PG7H 4RA3A 2OXHA 2OL3L 1LEIB 1A7PL 4HPOH 4KROC 1RUAH 1XGTB 2DKUA 1OLLA 5GS3A 4LCUA 4NFDA 1H0DA 2DQFA 2FH6A 5HTSA 4KK8D 5HYSG 1H3TA 4U6YA 3V0VA 1UKTA 5FHBH 3R8BB 1NEZA 2NY7L 4LF3B 4O2FA 2B2XL 2K3TA 2ZUQC 4LCCB 4K3DH 4H1LA 5FYLD 3FQTA 2R1WA 3LRSB 3VXSE 4ZFGL 3IDYB 1G1CA 2JF1A 1T04B 3OG6B 1UM6H 5JO5B 1EO5A 1NUFA 1AGFB 4NN6C 3QZWB 5KVGH 2HTLC 1JP5A 4DGIL 5GHWL 3RAJH 4I8DA 1D6EA 1QHPA 2Z0BA 1R5WA 4ONFH 4LSSH 2GAZA 4OLXL 1TJIL 3NN8B 4LARL 4P2QE 4OQTH 5CZVH 2EYRA 12E8L 3L3DA 4GFTB 1DBKH 2YUVA 4JFDA 1QFUH 4WO4B 4JY4A 4UQ3B 4G6ML 5CJXC 3OKDA 1ZGLP 4OZHE 4IJ3C 2VO5A 3ARDC 3GSNL 4E41B 1J1OL 5SWZD 3MLUH 1HILB 4K9EH 5LGJB 4ODVH 3GJEB 3HLAB 3JTTA 2DQUH 5DFWH 1WTLA 1NBYB 1A6TA 3NABL 4QRRE 3FB8B 2HJKA 2DKMA 4XPHH 1U8JA 3QEQA 4U1GB 2UZYB 1A9BA 5IKCA 2WWKO 4X6DE 4GOSA 2C4XA 4X7EC 4ODTL 4ZODA 3QIBD 3QDGD 3B8SA 5LCVH 3NCCB 3T09A 4IIQC 3NFSH 3O9WA 3WFEL 4UBDD 4BFBD 35C8H 5EU5B 4HPOL 2LE9A 1A6VL 1RUAL 3WJJA 1X9QA 1M7DA 3VD3A 1IAMA 5DQDH 2EIBA 5IF0B 4AG4H 1G6VK 1AI1H 1MFAH 2DTMH 1J88A 5CD5C 1YNTA 5IWLA 1SYVA 2NXYC 3HNVH 5E08H 3U46A 4FRWA 4R3SA 1LO5A 1NEUA 4Z9KB 3P2TA 2IQ9H 3PWVA 1UM6L 2LAAA 3EOAB 3W82A 4Z0XB 4PV8B 3OF6A 5ANME 3F5WB 1QRKA 5KVGL 4GS7C 5GS0L 4JCMA 4KI5F 5D7KD 3EOYG 4AIZA 4QY8A 3AREA 1IKFL 3FAWA 3PNWA 1R0AH 3QFJA 1QSFE 3QO0B 3RQ3A 2VSDA 1ORQB 4PJ5E 4OT1L 4LSSL 3UPCA 3IXTA 3EFFB 3F7VB 4OQTL 5DD1H 4YBLC 2FGZA 2AJYH 1DBKL 3P4OA 1QFUL 2AQ3A 1QLRA 3GSOB 5DTFA 1MF2H 4YE4H 2NY6B 2PR4H 1Z9OA 2XKNB 5DJCA 3MLUL 2IADA 4P2YA 4X6DA 2IANA 1BBJB 4P4KB 4ODVL 1KELL 4U1NA 2DQUL 3VGEA 1KJVB 2YPLE 3P4NB 3PF2A 3U4BH 5DMYA 5I17B 4Z7UE 1YY8A 1GZPB 4XPHL 4MXVF 2HAZA 4LMQI 3H9HB 4MXWH 1G7HA 1IL1B 1E4JA 3K3QA 4LCYB 2IPUG 3V6ZA 4LLWB 5LCVL 2DD8H 5KW9H 1HDMA 2ZOLB 5DD0H 2QEJA 3NFSL 4DAGL 1IAIM 3QUXB 4OI8A 4UINL 35C8L 5D2LE 4PJIB 4RMSA 5FM4A 3IJYA 3KS0J 5EU7C 2OL3B 5DQDL 1KPUB 3WYRA 4Z76A 1EZVX 3LQAC 3W0WE 1AI1L 1OAUL 3T2PA 1MFAL 2ZCLH 4XP5H 3O6FD 3ARBD 2EIEA 2R4RH 1TJGH 4H88L 2OTWB 4U6XA 3M17B 2BDNH 4PJDB 3MO1B 5CEXA 3QO1A 5DRXA 3VRJB 2Q87A 3GBNH 5I2IA 5IIEA 3IDJA 3RNKB 4TUOB 4ETQB 3WLBA 1QACA 4FQCH 3GM8A 1FE8L 4JHWH 1QSEE 3ZZ1A 4X7TA 1KGCD 3PGCB 4EN3D 4X6CE 3FRUA 4IEFB 1Z0MA 3SDCB 1QFOA 4OCRH 6FABH 4NO0D 4QXUH 2E9JA 4OAWA 1Q1JL 1R0AL 2CIIB 1FNEA 1XCTB 4HZLA 3Q6GH 2OM5A 5DD1L 4PJ9A 5KVMC 3ZT6A 1QBAA 2AJYL 3MR9B 1IGJB 5D6DC 1WWCA 2F74B 5JW4R 3CSGA 1M71B 1MF2L 4YE4L 5EU4B 3WNNA 5EZOH 5JIHA 1JGEA 5HHQB 2PR4L 5IG7A 1MWAH 1U3HB 3RVVC 1WIOA 3J8F7 3GSNB 3K2UL 3RWDB 1S7VB 1NL0H 4P23A 2G5RA 2IALB 3LKSA 3AS0A 3U4BL 4MNGA 4HWBA 1OD7A 4BK4A 3EOBB 3NZ8B 4BSVB 4MXWL 3Q6FA 3F7YB 3ROOB 2DI7A 5H37G