5C0CE

1e6 tcr in complex with hla-a02 carrying rqfgpdwiva
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
b'MDAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
total genus 51
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cE02
1IAMA 3S96A 2ZNXA 3G5YA 2O5ZL 2E6JA 1YEKL 5IVXF 4EOWL 1R5IA 4XI5C 1GYAA 4PB9H 2W38A 1DQLL 5GRWA 5JHDA 2BNRD 3U4AA 3KLHD 1H8SA 2EYTA 3L1OH 2EDKA 1OGAA 3ALXA 4E5XB 1MRDL 4UT9L 4JHWL 4X83A 3BD3A 3I2CH 4KTDL 3D69B 3IT8D 4HX1A 5CBEA 3ZDZE 3HE7B 1JWUA 2PETA 3QO0A 5FHAL 5C3LD 3AU1A 3RKDC 1CVSC 2FRGP 4G7YL 3ES6A 5EIQA 1I8LC 5IB2B 2IPTH 2DQCH 5KW9L 2GI7A 2NR6C 3NIGE 2NXZD 4XCCL 5DHVA 4Q9BA 1YYLH 4JM2B 4YFEA 1TTUA 5CP7B 1FNGB 1VDGA 3BDBA 3EOAA 1UH4A 1GC1L 4JFOA 4ZFOB 1PBYA 4HJ0C 1K4DA 3DVFA 3Q5TA 4ZD3L 1F3DH 2V2WA 4DEPB 4LEXL 2NY0C 2BXZA 1A3QA 2ATPA 3PGCB 5AAWA 2X4NB 4NRXA 2CIIB 3HE7C 2NW3A 2LVEA 1FL3A 1UKQA 2L7JA 3WNLA 1HSAB 1FNEB 1OARL 1RPQA 2BSSB 2BK8A 4BJLA 4KVCL 4XPFL 2H2SD 5IVXB 4OZ4A 2M8XA 4AQOA 4BFIB 2OTPA 5CZKA 3EKCA 5IJKA 4KKAC 5IEHA 5L8LB 5GRJL 1L7TL 4RAUB 3S4SG 2DQEH 3STZB 4IOIB 3RWCA 3EJZD 1HK6A 5HGHB 4L3CA 1N2RA 2H32H 4POYA 2P5WA 3IFNH 3AMLA 3OPZL 2AABL 1JHTA 1BJ8A 3X12B 5T3XD 4JFPB 1WSST 5ADOL 3H7LA 2ZUVA 5DQ9A 4HK3J 3TF7C 4N0CD 2GSIB 1NGXB 4ZNEE 1JGLL 3VG9C 3VFWA 2J6EA 2VLLA 3CUPA 3RVUC 2PXYB 5D70L 4AJ0A 2AVGA 3GSVA 2HJFB 2RIKA 3ZSTA 5KAQF 1C5CL 3HI6L 4FQCH 5FB8B 3LSOB 1AXSB 4ELKA 5DLML 1KCRL 3FMGL 3PIQA 1A9EA 3MRGA 4XZUA 4X80H 1ZOXA 1VSCA 3DVIA 4YC2C 1I7UA 4JANB 2AS5M 2ZP0T 4HUNB 3OKMA 1T1ZA 4XRCB 4NPYA 1C5BL 3HC4H 1RK0B 2ICWI 1URLA 3K1KC 1A21A 1KN2H 2FBJH 2R4SL 3VXRA 5KG9B 4FQJH 4OUOA 3T8XA 3H3KA 2Y5EA 2CO6B 3P9LA 4LLUB 1QTYT 4WI3A 1FRGH 2K3TA 3GO1L 3PDDA 3CVHB 3QDHA 3LAFA 2A73A 1CCZA 2V5SA 1RK0A 5I8EA 2ZUYA 1RZ7H 4H20L 4H8WL 4GQ9H 3FFCB 4Z7NE 3HUJE 3HNTL 4Y5XC 1NCCH 1Y6NR 5EZIL 3QXDB 3V6BR 1HH9B 5INCA 4N5ED 4DZ8B 2P5WD 3E6FB 3L5WA 1MNUL 3DURB 3PXJA 3ZKQD 4JHAL 4F15B 3X3FH 4ZDHB 3D39B 1HE7A 3R1GL 4V1DE 5F6IB 2A6IB 1F3DJ 4F7EB 4XMLL 4KI5D 3T8XB 5JUEH 1HNFA 3D85B 2KUTA 1UH3A 4XC1L 1IKFL 1C1EH 1CI5A 3JZ7A 1B0RA 3VXSE 2AI0H 3C2AH 1RIHH 4Y2DA 3EOYG 4PD4K 5I18L 3KYKL 3MJ7B 4N5UA 3QUXD 3W82A 5DDHA 5IJVA 5DD5H 3RQ3A 1U2HA 2B8OT 3HAEG 3NN8A 3O81A 4YGVB 4F33A 3ZKSD 3DYOA 1MWAL 3LQZB 2ATKB 1RIVH 3MGTA 2DQIL 4LHJB 5FOBA 5JHLL 2YOCA 3T3MF 5K9KB 5LGJB 2V17L 3RU8L 3HG1E 3PL6B 1ZA6B 2CR3A 3DXAD 4GRLC 5L7XL 4ODBD 5TE4L 2H32A 4GAYA 3IAPA 3TV3L 1YMMA 1RUPH 1CFSB 1P6AB 1YEIH 3BRGC 1RU9L 4LPWA 3T1WA 4S0TD 3CDFA 3RX7A 2K1MA 2P8PA 3O0RL 1R5WA 3VW3L 4HKBA 1NQBA 1BM3H 1JWMB 2OJZH 1CLOH 3O4LB 3ARQA 3Q6GH 1HINL 3MCLL 1LD9B 4HWNA 3O6KL 4BKLB 3MR9B 4P2QB 5K9OA 3QDMD 4LSUL 2IH1A 5DJDA 2EDHA 5L6YH 3OJDB 2IQAA 4A6YB 3VRIB 1GVIA 4XCYA 4I13B 3MV8E 2W9LA 1Q9WB 1ZLVK 3TT3L 4MSWA 2VLJA 2XZCH 1K8IB 1I3RA 1KT2A 2NY2B 4HWUA 4PY7A 4PP1C 4XPBL 2QV2A 4NNYB 1MCRA 1MCOL 5LAXA 3FQRA 4HUWB 2VOTA 5C07E 3QFJA 2GY5A 4PYGA 1CFNB 4ZXBD 4P48A 2R0ZL 5BS0D 4Y1AE 3NFSL 4YHZL 4P9ML 3HG1B 3PUCA 5CP7A 1MHCB 4LSRH 2R39A 1FDLH 3VI3E 3P9MA 3QR2A 3F7QA 3P9LB 4LLUA 1Q0XH 3ESVF 1WCQA 4GQPH 1CT8A 1BFTA 3QXAA 4PLOB 4WJ5B 3LRGA 4P2OD 5DRNA 4U1JA 3L3IB 3WHE0 1T0NB 1GOGA 5F7UA 1AP2A 1INQA 3TJEH 4HPYH 4CU8A 3ZDXF 1D6VL 1ZTXH 1NSNH 5IHUH 3MLTB 3EZJB 2UZYB 3MRHB 1MH5A 3OTTA 4WNQB 2O93L 5K33A 3I2CL 4KTDH 1WISA 2YD7A 4GRWB 3CSGA 1QBMH 2VB5A 3B83A 1LDPL 3VFTA 1Z9MA 1J0KA 3DUHA 4D9QE 1L0XA 4KKBC 3D6GA 3UC0H 4XNZC 4G42A 1CT8B 2X1WL 1E4XH 3VWKA 2NY1D 2GIYA 4U1HB 5ACLA 2QL1A 4K9EL 1Z0NA 4JKPL 4ZUWA 4NN5B 5EO1B 35C8H 4GSDH 2PO6A 4M3JA 2OX5A 3MROB 3DUSB 3WBDA 4ZFGL 4HKJA 4X0KB 3HE6C 4P23A 3GUTA 1U92B 3GSOB 4YXKL 1N2RB 4PBVC 3T2QA 4D94A 1UXSB 3SN6N 2V5YA 4ONFH 4OM1L 2QR0A 3KPNB 5GZOD 1JPSL 4JGJA 4FFYH 4MZ3A 2VWEE 1I1RA 1RZ8B 3SOBH 1NC2D 2R2EA 2BHUA 2WANA 4LNRA 3QH3B 1A4KB 3PWUB 4WUUA 4NIKB 4FQJL 1HKLL 3GHBL 4NQTA 5BOZG 4NRXB 2IQ9H 4HZAA 3SKJL 3V0VB 1U3HC 1U8KB 3TBWA 1V05A 1MCKA 1G7LB 3IGAA 2APBA 1TMCB 4OZFH 4YZFF 4J2XA 3SKOB 3OR7A 5FM4A 4LFHD 5EUOB 4UAOB 4ZOAA 3VFUB 3U0PA 1PY9A 3O6LL 4NBZB 3HFML 2CJUL 3OAZH 3JWNC 1QBAA 2CQVA 2ZSWA 4QRTA 2EICA 1U8OA 3PWNB 4R4FL 5E8EA 1DVFA 3HE6D 4MJ5A 3QZWG 2ZPKL 1EHLL 4U1GC 2BERA 3P73B 3G08B 2FHCA 3O11B 2X4UA 1RMFL 3PNWA 3UTSA 1DQML 2XPGB 3OB8A 2FGWL 4L5FL 1KCRH 3FMGH 5T3XL 2BC4B 3SY0B 2W9EH 1UADC 3A6BH 3Q6FA 1Y6KR 5CJ5A 1VACA 4CMHC 1E4JA 3BEWB 3O45B 2F54D 4HJGA 3B9KD 1WWWX 4HKXB 4YDKL 1JZ2A 1H15A 1FP5A 5DA4A 4HJ0D 3FL7A 1LP9E 3L3DB 3SKNA 3MSPA 1A7NL 2ZNWA 1KULA 2AAVA 1QFHA 1FYHB 4P2YA 3QWRA 3BHBB 1GGBL 2FEEI 1LHZA 2AI0L 1AHWC 3M17B 3VGHA 3UTZB 4K3DH 4NKIH 2WAHA 3HNTH 5HDOA 1NCCL 4RFEA 1IAIH 3I75B 3FONB 4HH8A 4NKMA 3EYQD 3R06A 5IMMB 4C55A 2NXYB 4BH8A 5FUOH 1T03H 2ENYA 3JV4B 2VR9A 5I1KL 5L6YL 3V6OC 4BSJA 1AQKL 3HZVB 3VD5A 5E8NB 4CDGC 2OL3L 4WFFD 5C2UB 3GJFK 4G6JL 3ARGB 2R0LH 1BOYA 4GKSB 5ESAA 2BSED 4FFZL 4JRXE 2V6HA 3GBNL 4Y4KB 5D7IA 3LKPB 4PJGA 5CJOH 4AEHH 3EDFA 4N1HB 1AO7A 4W6WB 3U0TB 5SWZD 5TPWL 4D9LL 3GMOB 4OTXH 4M48L 3NCYS 1QSEA 3P4MA 3DRQA 4X9IA 3SKMA 2XACC 3LS5L 4BSVB 3GJEA 4HK0B 2OI9C 4U3CA 2BOCB 3TZVA 5DURD 2FIKA 1X5FA 3V4UH 2GY7B 3RWJA 4MJIB 3I6GA 1FH5L 5DVMA 3QQ9D 2XNAA 2Z93A 2ZJSH 5D1QC 5F88B 5SWQA 5IROA 5T3ZL 1ZKAA 2AK4E 3HAEA 4N8PA 1R0AL 2C9AA 2DI9A 3LKNA 2BY1A 3BQUD 1KFAL 4UBDD 4X7TA 3H7BA 4PRHE 3RWHB 1F4WH 3G5YB 2MCG1 1V5JA 3LN4A 5I1CL 5ETUA 2VAAB 4NO0B 3U9PL 4XMKH 2CDEA 2M2DA 3B9EA 4J4PC 1D5ZB 3U7YL 3ZYJA 3VXMD 5TDNA 4K3HA 4PTUB 4NKQB 5DMYA 3O4LD 4KAQH 2N1KA 1DFBL 2Y5TA 1NANI 2JLLA 1MCJA 2X1XR 4JANA 3WXWH 1FHGA 4PJ5D 1A22B 4HXBH 1RZJC 2KQMA 2OXGA 2VLKE 4JVWA 3QEUB 3I6KA 4QOKB 1JV5B 1T66D 3QCVL 5IB1B 1ZS8A 4F7PB 2ORBH 3H42L 3F7VB 4N0UB 4YHZH 3K2UH 3ZE1F 3WSQL 4FQXD 1EBPA 3IETB 2A83B 3SO3C 1L4IA 4NSKA 5ELIA 5INDB 1K5NB 4MJID 3C8KB 3Q3GB 5SV4A 4LCYB 5HHMD 2SEBA 5ACMA 2Q6WB 3UC0L 5DJAB 4J23A 1R3IL 3GSUA 4NQED 2P48B 3BAEH 4DFIA 3L5JA 1MHEA 1G6VK 4X4MA 2LV4A 4PGBB 3ARZA 3ZT7A 2DS4A 1K2DB 2Q8AH 5FEBA 1UB5B 3BZEA 4JQXA 1CZ8H 1J87A 3H3BC 4DQOH 2IAND 4KDVA 1GH7A 4OD3H 3TYGL 1S7QA 1RZ8A 4M7KL 5GGQL 3O6FD 2BMKB 4WV1C 1OGTB 4GRLA 3S96B 3OKDB 3IU3A 4QRUA 4X8JA 4ODVL 4GG6F 3SEPA 3G5XA 2F8OA 2HTLC 4KXZI 1IM9A 1UYWH 4YC2B 4E42A 4TTGA 1NCWH 3N85H 4F7TA 4LSQH 4CVZA 3DXAE 1N7ML 5D1QD 4OUUB 1SJHB 3BW9B 2AQ3A 2AXGA 3FQWA 1AGCA 5H2BA 4W6XB 2QHRL 1F3RB 3WFZA 1P7KA 2XG5A 3MXWH 1BX2A 2R1YB 2DKMA 3WIFA 4CU7A 2GJJA 3PP3K 2I07A 1I8MA 4OF7A 2ZUTA 2HJLA 2BMKA 2BNRA 3GBLA 3VD7A 1WWBX 4X9HA 4B0MM 5GS0L 5KVGL 5C0CD 2IPKA 3ULUC 3L95A 2LAGB 3OKEA 4KUCD 1NC2A 5I1HL 3MJ6A 4H26B 3O3AA 2YUXA 3Q5YA 1HEZA 3MRMA 3BKCL 3H9SA 4JFHD 5DHVH 1CXFA 2FX7H 1MOEA 2IBZY 3RNQB 1FAIH 3DX6B 3QPQD 4W68A 3TT1H 4GG6B 3X3GL 2VXTH 4IRJD 4HJGB 1T03L 4JFEA 4PRHB 4PJ9A 2BNRE 4E41B 3FO1B 3HFMH 3TGXA 1RURL 2W0FB 3KLDA 3Q48A 5IG7B 3BRDA 4Z0XB 4UDTB 4YDKH 3GI8L 4AENA 1ETZA 25C8L 5FYKL 4G6FD 2A0LD 3O3DA 1T3FB 1DQTA 3CVIH 3L7FA 2OR9L 1S3KL 5HHOB 2IADB 1U8OB 3MLRL 3PWNA 5DJAA 4UDTA 1TITA 5KOMC 1DLFH 1SY6L 2ZOLA 3CXDL 4KUCF 4CU6A 1A1NB 5EBWB 5IESH 2MQ3A 5EU3B 4PP1D 5DJZB 2NY4C 5HHPA 2WINA 1RZIB 2GK0B 4AH2B 5DD3L 5JNYB 3NGBB 5JHDD 2VR5A 1XR8A 4XPGH 5EDXA 1AQKH 1YEGH 2BCKA 4WU7B 1N6QH 1OAXH 4YH6A 1G7LA 1BD2E 5FA3B 2OSLA 2F9BT 1AXIB 4P3DA 1U8LA 4QHUA 4P23C 2ITCB 2DAVA 1CD9B 1T7ZA 4NO0D 4ZNEA 2YXMA 5CEXA 3ABZA 4YE4L 2H6PB 4OTXL 2F54E 1T1YA 4HV8B 1RZKC 4P3DB 5IMOB 1NMCC 1YNLH 4ZO7A 4JN2B 4HWEH 1NJ9A 5GHWL 3E2HB 3V4UL 4UOW1 1MRDH 4JHWH 4GKNB 1MQKH 5F7EL 5T3ZD 2BNQE 2R0LL 5CJ8A 1JTPA 3DGCR 1S9XA 4FFVC 1NC4D 4NKDA 1NCAL 3D39D 5FYLD 4ODWA 3GB7B 2EH7H 4QLRA 4OZIF 4G43B 2WM0A 1J1XL 4QOKE 5IB2A 5MEQB 5DJXB 2BXYA 3O6FC 4KKNA 5E70A 2HH0L 5JXAL 4EI5B 4PLJD 1BQLL 3UJJL 3MRIB 1D6EB 3UPCA 1LO5B 1QSZA 1Q0YH 4JZOB 1P4BH 4RFNB 3P11H 4I4WA 4XNUH 4KPHL 4EBQH 1R0AH 1WFOA 3F5WB 4WEMB 3QHFL 5C0EB 4G7YH 1SBBA 3PHOB 2DIBA 2E7BA 2YWZA 5HJ3B 2YBRB 1L9NA 2N56A 2Q8BL 2C3HA 4FQQA 1FZJA 1BZ9B 1UA6H 3MBED 4IRJA 1H3GA 5I1EL 1WVZA 3RWEA 5IIEB 3I9GL 1IJ9A 1NUNB 3EO0B 3ULSB 5D7KE 2ZSVB 4HKZA 2FZ3A 5MEOB 5K9QI 3TBYB 5DQDL 3DI2B 4XTRC 3P0GB 3QEQD 2JE8A 4AIOA 1H5BB 3G6DH 4O4YL 1RY7B 4LPVA 1CE6B 1KNOA 4JDTL 3ORJA 3LKSA 1IAKA 3V0WH 4W4NA 4GH7B 3VXUE 2I5YH 1FV1B 4NQCD 5TDOB 5GS1C 4HIIB 4OF5A 3LD8C 1HZHL 4KFZC 4HEME 5D7SH 4ZUUB 5I1DA 2DM4A 4XCYB 1KB9K 3KPQA 3K2UL 4KJYA 1KIUA 4M7LL 4OLWL 5EU3A 2CDGA 4EI6B 3UTTE 3FFCE 1OAZL 3JVGA 5IBUB 2VDML 4O51B 4DWHA 3FJTA 4I2XE 4RA3A 4YAQB 4ZAKD 1ZT1B 4QYOA 3ZKND 3WN5C 4YHNB 4X8JB 3EGSA 4KMQA 4EI5C 4LBEB 4P9HL 4WENB 5I1HH 3S35X 2P43B 2NZIA 2BRQA 3GBML 4OD1L 3O3EB 4MZ2A 1FFPB 1MI5A 3O2VL 5MP6H 5LXGH 1W72B 3KJ4B 4JO2H 4LCWB 4R3SA 4YHYB 5FGRA 1LO4H 3MOBH 5F3BA 1A1MA 4G80A 1GAFH 5E8OB 1ES0B 1FPTL 4AEFA 4CVWA 2YD9A 1GOHA 3GMOA 4HGMA 3N9GL 2X4SA 1PG7X 1B6DA 4LLYA 5B3NA 3MJ7A 2EXYD 5IGXH 1E6OL 2XFXA 3BZFA 1I1FA 4I0KA 3X3FL 2ZG2A 5TJWK 4OCMC 3NMEA 5IK3A 3H9YA 2NY0D 5HYSA 3MRMB 4WFED 3Q0HA 2BJML 3ALPA 4Z78B 5JORA 1XF5A 1NFDB 1HXMA 2NY4D 2JF1A 4MQ7B 4PJ5B 4OZGE 1XF3B 3QNZB 5FCSH 5I18H 1VPOL 3U36B 4JO3L 4HW6A 1HH9A 3DO3A 5EUKB 2PKDA 1I9IL 5DD5L 5T3XE 4RGND 1I7TA 1OAYH 1CGSL 4NNPH 5BV7H 5JORB 4ZFFB 2D31B 3JXAA 3TO4A 5EOTB 4QGYA 5J11B 1N0XL 3ULSA 3DHMA 3HKFA 3OKYA 4G8GD 4ORGB 2GK2A 2R0KH 5JPNB 4WW2B 1SBSL 2FD6L 4KQ3L 4PJ7A 5F9AC 4YE4H 2ID5A 3ZE1E 1BLNA 3VXPA 4H0HB 3IVKB 4P2OB 7CGTA 5CZXC 1ZEAL 2LFGA 3BIKA 4NNXB 5B39A 4TSBH 2H26A 3AY4C 4WI7A 3G6JA 3QFJD 5DD3H 1CE1H 2V17H 2D31A 4YDJB 3RU8H 3QFJB 4IM8A 2HJFA 1NCAH 1MCFA 3BMWA 4K8RC 4QXGH 1T6WA 4RX4D 3STBA 5ISZB 4PTTB 4R90L 4O2FA 4HDIB 4FQIL 4GKZB 3OJ2C 5D7LA 1CLOL 1X4YA 3H3PH 3Q6GL 4M43L 4MYWB 5D1XB 4YHKH 2N7BA 3L7EA 5HYSB 3WIHA 3WL9B 4Z7WB 2OLDA 3BXNA 1WIOA 5DJDB 5IEKB 4OQTA 1S78C 3LQAC 3D25B 2H45A 1CU4L 1N6QL 4BKLA 1U3HA 4Z18A 4HH9A 5BRZD 2VDNH 4F58L 3LEXB 2EDRA 5F9DC 1YJDL 2XKUA 1LWRA 4DW2H 4AT6A 2NY7H 3S3PA 1BVZA 4JPIA 4HJJH 3HB3C 3V8OA 4X6BA 1XIWB 4DN4L 4C56B 1BBJB 1D5XA 4S1RL 1A5FH 1XF2A 4P99A 5E8DL 4IRJB 1DUYA 1CR9H 4NJAH 5IEKA 4M6NH 1QSFE 1AJ7H 3DO7B 3ZO0A 5DD1L 1IC5L 5I6XB 5T1MA 2NR6D 2WINB 2WQRA 1QLRA 4PJ8A 2Y07H 4L9LA 5DUBA 4AIZB 1CFTA 4Y2DB 4LVEA 5CLTA 2OTWB 3HE7D 1ZT4A 1MSPA 1JWUB 3QO0B 3PHSA 4DAGH 2VLJE 4O9HH 2C3GA 4LAJH 3H2WA 5E1AA 4LCUA 5CZVL 3RBGA 1HILA 3U46B 2JJSC 1FGVL 3MGTB 1MH5B 1DVFB 5MENB 2LTQB 1TZGH 3P30L 2XICA 4N8VG 1WZMA 4QHMB 1I3UA 1AO7B 4CNIB 4LKXB 2AJ3B 2Z9TA 5I75B 1Z9SA 3NIGF 3MLPA 3JUZA 2XZQH 1AIFB 5HVHC 1A2YB 1UCTA 3NCEB 2W9DH 4LGPB 4U2YA 3V79C 4FQ2L 1GGIH 1FQ9C 3SHSA 1A6ZB 2YPLB 4M61A 4NZRH 1CXHA 1RJZB 1S5IL 1D5MA 2CLZB 1D5BB 3ZLQC 5C09A 4AL8H 3O3BB 1I9RH 1I8IB 1SJEA 1AQDB 1TTGA 4JCLA 3CMGA 3MRBB 4LFHG 5HYJD 2RHEA 5FKAB 3KXFE 3UYRH 2G2RA 4QRSB 4JKKA 3U48A 4KHTL 3UPAA 3MRGB 5CJQL 3KPSD 3PL6C 1TETL 3BP4A 2HG5B 2R23B 3WIFB 2BSRB 3MODL 3UYOD 3FFDA 5I19L 4AEIL 4ELMF 4D9QD 1XR9B 3CX2A 4KTYA 1DANU 5GS3A 2HLFC 4CVZB 5C0CE 4ZS7H 1C12A 4HWBA 3MACL 5E56A 5HI5D 1XGQB 4UDUB 2F8XC 3GB7A 5AEAA 1MUJB 2XA8L 4I18A 3LY6A 4LPCA 4PJBB 3SCMB 5FGSA 5FKPB 1G7PA 5KN5A 2J1KA 3ESUF 4JG0L 5CBAA 4HEPG 1C5DA 1JN6B 2DI8A 4NUJA 3S3JA 5TGBA 4M6MH 3QI9D 1DSFL 2YPLD 5FXCH 1DBML 2ZCLH 2XXMB 1RJYA 4WWKC 3ULUL 3WNMA 5FYLH 3RVVC 1RIUL 1XCTB 3PGDA 2GJZB 1DR9A 1NEUA 2YD8A 1CFTB 2WBJC 1TZIA 4YDIL 3OBAA 1EPFA 3FHQA 4U2ZA 1T22A 4OAWB 4WJ5A 4YXLH 1PKQB 2VZSA 5FUOL 3CFEA 4JJ5A 4TQEH 12E8H 1KF9B 3T09A 4Z7OE 5E03A 1ONQB 3R4DA 2R29H 5DI8B 1WQVT 2LU3A 2DJSA 1RUKH 4FXKA 3AVEA 1F11A 4PJCA 2B1AH 5DHVB 3NVQA 2V9RA 2ADJB 5TE6H 3P3YA 4UILL 5HDQL 2VSDA 5LCVH 4UUJB 4XBGB 4R90H 5D6CA 1FVDA 2WBJD 1KNOB 4LRNL 5JMRA 3C09B 4MD5A 1ADQL 3RWGB 2DLHA 1H5BA 2VR4A 5HTSA 1FIEA 1D9KA 2Q1EA 3MQIA 4LLWA 4MLSA 4N8CH 5DJCA 4F7CB 2QQNL 5DXWA 5EZLB 5L9DH 2R9HD 3T08A 3IDJB 3ARBB 3GUTB 2CLZA 2JCCB 4P5TA 3QI9C 4TNVF 4H1LB 4QF1B 2J8UA 1DBAL 4PLKD 5IFHL 3BO8A 4G6JH 2W65A 5GS1A 5F8QC 3TZVC 4KRMB 2R15A 1IC4L 5ITFB 5DGRA 4J7RA 1EEYA 4NFCA 3QDMA 5IMLB 2HRPH 4OF6A 5J1AB 4D9LH 3WFDH 1KACB 3SE8H 4ODHH 4XCCH 5I1CH 4GG8B 1U91A 4S1RH 4C4KT 4AM0B 3ARDC 4OZFA 2X4OA 3NCMA 3MNVB 3IJSA 4JLRA 2FR4B 2Z8VC 3LH2H 2J8UE 2WP3O 1S8DB 4P2OA 3IDXL 4Z7UA 5T3ZH 3FRPA 1W8NA 3BIAX 3RUGF 1XEDA 3MRCB 5FO7A 3TBTA 4N0CC 4HC1L 5E4IA 2QSCL 5D5MB 2X5PA 4ZS6D 5CHNB 3VFMB 3GSQB 1KFAH 4MQ7A 4R2GD 1SEBB 3QIUB 1LE5B 3IETA 2B2XH 2OI9B 1EEQA 1PW3A 4ODWB 4V2CB 2F54B 5T1MB 3DBXA 4HT1H 4G7VH 1MJ8H 1MJ7L 3HCVA 4M1CC 5I16A 3ARDB 2DMCA 2EC8A 3KXFD 4N0UA 1D5IL 3QG7H 1KXQE 1T21A 2ZG3A 1YDPB 3W0WE 1NUGA 5KANI 2P49B 3EO9H 2Z0BA 4UQ2B 4FA8A 2L4OA 2OS7A 1ZLSL 4DTGL 4WV1B 1BD2D 2VDRL 3S37H 4P5TD 1SVZA 4HUKB 4LKCA 3GMLA 3EYUH 1N6UA 4ISVA 4S2SB 3V6FA 1GOFA 2WWMD 4DKFH 2PR4H 2VDLL 5E8DH 1H3UA 2CPCA 2Z31B 1CDBA 1PKQA 5HHOE 1RAMA 4MAYD 1EZVX 1VCAA 1TZGL 4NBXB 4GXVH 5FDWB 3I84A 3S5LB 4Y5YA 5BO1L 4CADB 4L8SA 3FQTB 1SM3L 4NWTH 3OZ9L 1PLGH 4KJYB 3TH4T 4LPTA 4TVPE 1GGCL 1MY5A 1NCWL 1ZA6A 3CH1A 3LVEA 1IQWL 3FN0L 3QQ3B 5C07D 3T1FA 1KGCE 4OJFL 3FN9A 3WUWA 4G9FE 3RZCD 1F13A 2BY0A 5L2JB 4ZUSB 4M9PA 2DTSA 2HTKC 3DRQB 4HWBL 5KJRL 3P30H 4J3WA 4XBEL 4IMLB 5JHDB 4PJ7F 1BGXL 4M7KH 3OXRA 2NX5A 4J3XA 3QPXH 4PJBE 3UZQA 4PJGB 5KSBF 4OV5B 4CADA 5IJKC 2CDGB 4EI6A 5CD5D 2FBJL 4NFDA 3WO4C 1AKJB 1TTFA 3PWVA 3FO9A 5C0DB 2AJXL 1GGIL 3QZWB 4FNLH 2VAAA 3IAGC 1AY1L 4JFED 3JV5A 4XC1H 5EUOE 4RAVB 4KK8D 4ALAH 3FHAA 3S97C 1BJ1H 3V5KA 3KDMB 2NYYD 5LBSL 4QXWA 1LO2H 3C6LC 5SX4I 5HHXL 1I1AD 1F58H 3OGCB 1X3DA 3QNXA 5BVJA 1D5BA 4I0PD 3KG5A 2AJUH 4RMVA 1NBYB 4PJBF 3QJHA 1LO3H 4PJ5A 5BVPL 1JNHB 1G1CA 3L6FA 3RWJB 1BX2B 2VJXA 3QP3A 3CX5K 4K94L 1AR1C 1GGYA 4LLMB 5M7QA 1J18A 4MCYA 3S4SA 4TSCH 1VHPA 5DJXA 3CVIL 5HDQH 1FYTA 4RGOL 5BMFH 3K46A 1KTDB 3MACH 4BSWB 3D2UB 5EPMA 3NACL 3C6LB 3QNYA 1J8HD 3AU1B 3UO1H 2JJUA 1Q9LB 1ZA3A 3RPKA 4NN5C 3CFKA 1NCDH 5HI3D 1YJDC 2QQKL 4TSAH 4HQQL 5IFHH 3HC3L 2ESVD 1A0QH 3DSFL 1DL7L 1BP3B 1XGTA 5DJYA 4OFYD 1RJCA 3FQTA 4CUCA 4LHUB 1YEFH 1WLHA 5HYIA 1U8JB 2RQ8A 5BXFA 1NC4A 1I1AC 4FXLA 3CH8A 4N1CA 1OTUD 3Q3GA 3LQMA 1HI6A 2NZ9D 2UYLB 4QNPE 4LP5A 4G8EB 1OSPL 3DUUB 2HVJB 3GSWB 4N8CL 4MXWL 5ICXB 1MJJB 3AROA 5IVNA 1DLHA 4XPGL 1OTTD 3CPLB 2PN5A 1VFOA 3QDGD 1KB9J 5D8JH 2HKHH 4YHIB 4XP6H 5DJZA 2AJVL 1P4LA 5IVXA 3QEHA 3QDGA 3DNKA 1P9MC 1P2CA 1ZS8B 3F58H 3LEVH 5F96H 1IC4H 3AM8C 3PL6D 2C7UA 1GSMA 4FMFA 3VH8A 4K8RD 3WDJA 4U1MA 1HCFX 5IW3A 2ADJA 3SE8L 4NQVA 5GGUB 3BKYL 5F7MC 3REWB 3U4EB 5AD0A 2HFEA 4P9MH 2F53E 4UTAL 2P5EA 3E1F1 2Y72A 4LP4A 3SDDC 3VXSD 4OFKA 1ACYH 1ZHBB 5I1LB 1E0OB 1M4KA 5J3HC 1BWWA 3RA7L 1A14L 5F7DA 5EBMB 3CFEB 4JJ5B 2FJFB 3O4LA 2PYFB 4JPWH 2YN3A 3IFOB 4F37K 4OT1L 4I3SL 5I8KH 4HX1B 1W0YT 4U1KB 5CBEB 1A4JA 1ZT7A 3TJEL 1R5VB 4IOFC 3BN9D 2PR4L 4OFVA 3TZVD 5F3BB 2X70B 4LIQE 1CK0L 4Z0XA 3MRIA 3EDKA 5F9WC 4PJ5E 1B4RA 2VIRB 2VMFA 3SE9L 5LJYH 3B5HA 5FKPA 3UYPA 1G7JB 3OZ9H 2UWEB 3MGAA 2XY1A 3TIDA 3RY6A 5AYQA 4JRWA 2V2XB 3S37L 4YWGH 5JDSA 2EKSA 4NCC2 5DQJB 5C08B 1BIIB 3CDCA 1MJ7H 1MJ8L 3HC0B 2P8MA 4PRAA 4S0SD 5J1TC 4MX7B 1JMXA 5DFWH 3IDMA 3D85A 4N0FA 2F53B 3LS4L 5GS0C 4YNYA 1CFNA 3B4NA 4K7PY 4U31A 3IDIA 1I7ZA 1YMHA 4U33A 1Y0LB 5F3HA 5J89A 3VWKB 5L0QB 2BVEA 4X7SH 4DZBA 4Z7OF 3V7AG 4FFYL 5I8OL 4GXVL 3O4OC 5INCB 1I9JL 3ARRA 4DZ8A 1FBIH 4JDTH 1C7TA 5TDPB 3D0VB 4KKLD 1M7XA 1IGCL 1MVUA 2CJUH 2KZWA 4X5XA 2CO7B 5D72L 3MJ8B 1U8LB 4U7SA 2C3VA 2IQ9L 3RVTD 1EK3A 3SKJH 3OKOA 1RJZA 5ICXA 4XP5H 5HDBF 3TFKC 5D7SL 3A67L 2YR3A 1REIA 2VABA 4EQ3A 1CLYL 4JN2A 5HXMA 5KTEL 3WKML 3P0YH 4QRPA 3VWKC 5J8OA 5KJRH 3V7AE 2PYFA 3D3VD 5DJ6B 4OM0L 4S1DD 1ES0A 3ZSSA 4P3CL 1CICB 1IGML 1N8ZB 1OWWA 1SM3H 3L9RA 1PJ9A 3T77B 4M9OA 4KZEL 5K59E 5IBTL 1EHXA 3D3VE 1HHKA 1H3VA 2P5EB 2YZ8A 3QUZC 4XAKD 3T4AA 1GGCH 2YPVL 3NCFB 4OD1H 3CAFA 4ODUA 2IPUG 1MJUH 1EFQA 1AGFB 1A7NH 2AJXH 3MV8B 3QA3A 2VUOA 4XGZB 4M8VA 5DEFB 3IFOA 2MHAA 4AH2A 1GAFL 1PX4A 3S9DB 1I1YB 2EIBA 2X05A 4WVRA 5DWUH 3VWKD 3G9AB 4BA8A 3CSBA 3CXHJ 4R8WH 5EU7E 1FFOA 1TNNA 2OBGA 4KI5E 3UP1A 2MHAB 5JIKA 1JHLL 1TCRA 4JFDA 2KQNA 2R2HB 3L7FB 3TFKD 3HR6A 3RIAK 1MIEL 5DMGC 2XIDA 1RUQH 3F62A 1CFQB 4RMSA 3IFNL 4GS7B 2AV1A 1AGFA 2EE6A 3P77A 4XMPL 1J9CT 1FNFA 1T0MA 5MERB 3VCLB 5EBGA 4LSDA 4XB8A 5D71L 4PR5B 4MA8H 3GSNH 1GC1C 5TDPA 5H35B 3FFCA 3G6AA 3IJHB 4ZO9A 3WXVL 4LIQH 5I73C 5L8KB 1E27B 4L3EE 4WTZA 1GHFH 5IIEA 4KJPD 1I7ZB 1CDUA 4U49A 3F12A 1AHWA 4J4PD 4X4XA 3ZHKA 2H8PA 1MFCL 3P4OA 4HFWB 3V6ZA 3U79A 4F33B 3HB3D 3L7EB 4MHHG 4JM2A 3VMOA 1OHQA 5FYJU 5ITBH 4PGEA 3WS6C 4OQ1A 5JQHC 4KKCD 1JZ5A 4IMLA 3RVVD 1F4WL 5DRXB 4FOMA 2YEZA 1CIUA 2BY3A 3FT2B 3H6JA 1YY9D 1A6PA 1M7DA 4N0UE 1RHHB 4X9FA 5IB5B 4IRSC 5F7HA 3ECBA 1PZ5B 5E9DB 2DJ4A 5D8JL 2CKBA 1CXLA 5SWZA 4Q6IA 4GG8A 1U3ZA 4JPVL 1NGQH 1UM5H 4YDLC 3O9WB 4OFYA 4KQ4L 4MNHA 4P4RA 3QIWC 1RD6A 3HI5H 3H3PL 2NW2A 3RP1A 1GPOL 4RGMB 2QBWA 5DHYB 2GSGB 4O2CB 4KROD 1CK0H 3RPIA 4IBLT 5GGVH 4MQSB 5GRUL 3GIVB 1B6UA 4PJDA 2EDYA 1EEZA 2IGFH 4Q9CA 4U6HA 1LNUB 3OKEB 5F96L 3AS1A 2APVA 2GJ6B 1NL0L 5IVOA 3CSPA 4PJFE 1MF2H 4NNYA 5F1SA 5EO0B 1ZWIA 2FEDC 5I1IH 3RWIB 3ISWA 3BQUA 1P2CB 1CFQA 4JY4B 4EN3C 4JFXA 4IIQA 1CLZH 4OZFG 3HMWL 4F57L 4JZJC 4A6YA 3SDXA 2AJYL 4CN4A 2F54A 5BV7C 1P4IL 1KPVA 4DKEH 4WFHE 4DCQA 2YD3A 1NLDH 2RB8A 4KHXL 1CN4A 4DQOL 4L8BB 1EH9A 1KJ2A 1UVQB 4R4BA 5DT1H 2JIXB 3UTPD 4S1SL 2XWJB 3WIIL 4LARH 1TPXC 1J88A 3MO1B 2YA2A 4M8QA 2NPLX 2Z31A 1U8JA 2R1WA 5ICZA 3D69A 3OJMB 5EO9B 3BAEL 4OLVL 5JQ6H 3BKJH 4A6YL 4AG4L 3MRNA 3DLQR 3QEHB 1EA9C 1JPTH 3W2DL 2W9DL 3ME0A 2BVOA 4DUXA 1FO0H 3WLBB 3QRGH 4CMHB 4EN3B 1DQQA 2ADIB 1M05B 4PGBA 2H26B 1J8HE 1JRHL 5KBNC 3IVKA 5C6PB 3AUVA 3NA4A 4R7DB 5EO9A 4PJAF 4K55A 1CDJA 4LSVL 4M1DL 2BNUA 1G7IA 2QJDA 3B9KB 3MV11 4X7SL 4Y2DC 4TUOB 1IBGH 4PBWD 3F8UB 2JIXA 4KHTH 1C5BH 4NZTH 2V7HB 1MY7A 3SGKC 1MAMH 2QKIB 2F5BL 1CGYA 5J6HA 2VLKD 5ENWB 3MLWL 3TO4B 2BRRH 1E4KA 2FNBA 4WTXA 5IFAH 5I17B 1A7PH 4IRSB 3I6GB 1A1OB 1IGTA 3B3IB 4XNXL 4XI5D 3NCCB 3S35H 5FCUH 5DS8A 3I85A 2Q7YB 1JNNL 4F7MB 4ZAKC 3FQXB 1KC5H 2AJZB 4G8FA 1YUHB 4LHQB 1MCPH 1MCHA 2XG4A 5E24E 2WUCH 3ZE2E 3IU4H 5FUZL 3QDJD 1QD0A 3SCMD 4MD4B 5KVDL 4PRID 25C8H 4MJIE 3M1BB 5D7KD 5J06A 2HWZL 4WGWB 4K23H 4RMWA 2NY6C 5JW5A 1RIHL 3G5XB 4ZS7L 1SJXA 4X6FA 3MA7A 3P0YL 4ZPVB 4M5ZH 1YQVH 3QUKA 1ZGLB 1LDSA 4HMDA 5FV1L 2DI7A 1E28B 3RGVD 1FLRH 2BSTA 2VIRA 1HNGA 3K74B 2YMXL 15C8L 1A1MB 1TVDA 3P9MB 4UMGA 1MWAH 4K3EH 1JRHI 5AWNL 2F8VA 4G9DB 3MRHA 3DVGB 3QQ4B 5FYKH 5EIIA 3HPJA 1VEPA 4WCYH 1BQUA 5L2KE 3P73A 3MBEC 5K93A 4YHOL 1OAXL 3VXME 4MJ5B 5BW7C 5DUPH 2EE9A 1RIUH 1AC6A 4JZJB 3MLRH 4BZ1H 1ACZA 5H37G 5BV7B 1H15B 1VKXB 1MPAL 1UZ8A 1HH6B 2VLKA 4L8SB 3QG6A 4XXDB 1J1OL 3Q6FB 4R97C 1J5OL 3VXUB 4JY5H 4YXLL 4G6AD 3SY0A 3ZTNH 4MQTB 4UV7H 3TM6A 5C0FB 3ARTA 3SPVA 3B9VA 2DQHL 4ONHB 3WS3A 2OQJA 1DUYB 4XWGH 5GHWH 3TO2A 2IPUK 5CS7A 3STZA 1YNKL 3PE9A 3GKZA 3LRSA 4X5WB 1OGAD 4OQTH 2CDFB 1FVDB 1QFOA 4KQ4H 3QEQE 1QR1A 5E2UH 1ZVSB 3WHE1 2V2TB 1U3YA 3GMQB 1D5MB 1XCQB 2FH6A 4LCCB 5HDBE 4N0YH 1UJ3B 5DFVC 5D6DC 4L8CA 5GQBA 3A6CL 1DE4A 2XN9B 4HWEL 3NOIA 3DUUA 3GSWA 3OR7B 3U6RB 4YR6A 3KHQA 4MDIA 4WI9A 3UJJH 1MCIA 2DLGA 4OGXH 5C0BA 3FQNB 3QUYA 5DRZB 3V0VA 2PXYC 1UH2A 4HFUL 4JQXC 4X9BA 2DQDL 3U30C 5ESVA 3ZYIA 5D2LB 4Y4KC 3GSQA 1R3JA 1T20B 4G42B 3SGJA 1MAJA 5E94B 3T2PA 5DR5H 2XNAB 1G9MH 4GUPA 1AD0B 1X6LA 1AGDA 4Y16A 4ZFOL 1CLZL 1CD1A 4PG2C 3S88L 3F7RA 3WCYA 1JIBA 1BQLH 5DK3A 1N26A 3LZFH 4UNTA 2BOCA 4NUJB 3TZVB 1UXWB 1OF2B 3U2SA 1Q0YL 2PF6A 1GGBH 4AM0A 3U83A 5DT1L 2VXQL 3VXTA 4I18B 3SDCB 5FM8A 3FOLB 4MAUL 1AE6L 1E28A 4MWFA 1E4XL 4J3SA 4MJ4A 4OIBA 2DICA 1OW0A 5HHQB 1P7HL 3IB4A 5EU7C 3MA7B 2VZOA 1ORSA 1F90L 1M71B 2H8PB 1T04A 5MI0C 1NMBL 5KSBE 3VG0H 3BZ4A 3ARVA 3RTQD 4YHMH 4RWYH 5IW6B 3BPLB 3IFPA 4KKAD 4KWUA 1D5IH 2X40A 5GISL 5T1LD 1LP9A 2EIZA 3QNXB 1EFXD 1QPPA 4OF3A 4JZNB 1NH6A 1NC2B 1FIGL 3QDJE 4AEHL 5F71A 4X6DA 5TQ0L 3U4BL 3QIBA 4LLDB 1WV7T 3VXQB 4HGWA 1MLCB 2YC1B 2R8SH 1S9KC 5JW3H 3U36A 3JVGC 1T4KB 3C5JA 4WEUD 2ESVA 3TO2B 3C8DA 3LMJH 4NQUA 5AUMA 4L1DA 1HZHH 1G7MA 4PBXA 3TP4A 4HULB 2PTTB 4XPAL 4BK5A 4MQXD 4MX7A 1A6WH 1KJ2H 5DI8A 1MI5E 4QHNB 5MEPB 1BAFL 2BDNL 1BIIA 4O58L 4IOFD 4M7JH 5J6HB 2W0PA 5D2NA 1HHJA 3TBSB 4LLWB 5I66B 1QFUL 4RFOL 1EZVY 4P4KB 2YK1H 1JTTA 2UY6A 4DN3L 4LARL 3BESR 2UWEE 3T4YB 1ZLUH 1F45A 5FUZH 3RAJL 1T5WB 5EU4B 3TN0B 5C0NC 1AXSA 3GKWH 4XMKL 2KKQA 3BKJL 4A6YH 3WLWC 4WU5A 4OCLC 4Y4FA 1FO0L 4FXKB 4JO2L 4MB5A 1B9ZA 3GMMA 4NRYA 4QXUH 4EDWH 4WI5A 1U8IB 3LV3B 3IDUA 1N8ZA 4JFFB 2GITB 4WUUE 2DQGL 4OCSH 3EDDA 1JMZA 4KDTC 1Z6JT 2P8PB 1NCBL 1B2WH 4Q9RH 4EVNB 1CGSH 2XYCA 2OJEA 3H9ZA 3LV3A 3DSNA 4IOIA 3RWCB 4TTDC 4WFHD 4WUKL 5E08H 4MD0B 5KSBA 4HIEA 1QEWB 3F65A 1KTKE 5DFVD 2F53D 1G9NC 5IF0B 1K8DB 1IEBA 1BVKA 3BN3B 1A4KA 3PP4L 4CVUA 3MRRB 4K23L 4XHJC 2EKJA 4MMZC 1I1AB 2D03H 4FFWD 1VPOH 5JPMA 4S1DC 5AZEH 4M5ZL 1MIML 3A6OA 4FG6C 4DK3A 1HHIB 2C1PA 1TVHA 3CC5A 3FAWA 1QO3A 1N64H 2Y5TB 2GW5A 5I1KH 5J7CC 4JJHA 3F7YB 2DQEL 3SGEI 3SO5A 5C0FA 1X7QA 1IGYB 1SEQL 1XR9A 4Q7DA 3MUY1 5FO9A 4LVHB 4S11A 1HH6A 3NAAL 3V5HA 4RCAA 2VZ3A 4YBQD 2OP4H 4YIQA 3PHOA 1JGLH 5FF6A 3HC4L 2GTWB 3X11A 2YMXH 1YA5A 1Q9KB 2QADB 2Z8RA 2AEQL 1FL6A 1UT9A 1A7OH 5D4QA 1IC1A 2VLJD 2QSQA 1B4JH 4LF3A 4MDJB 5TF1L 4HUXA 4NT6A 1WBZA 4XWGL 1WWCA 3HNVH 5K9KA 1GGUA 3T0BA 3X11B 4PJEA 3EOBB 5I1JL 3WJLA 2MKWA 3WO3B 5DRNB 4Y4HC 1JZ4A 3QEQA 1JPST 5GSRA 3V5HB 5D2LE 4OFPA 5DVNA 3MRLB 1CYGA 5LGKA 3UBXG 5JOFB 4HAFA 2DDQH 5CIPH 2NX5B 4JHAH 2LVCA 1ZLWK 5HBBA 1JPFB 5C0JB 5KANG 5CD3A 2CIKA 1I8KA 2AEIT 3LPGA 3LZFL 4Y5VC 3KJ4C 1CIDA 4ZFFA 3JV6A 3T1FB 3NTCL 3OV6A 1QUNA 5E1HB 4PRDB 5JPMB 4HXBL 1ZVYA 2EC9T 3TVMA 4RGNE 3PQYE 5J11C 5F7YC 4AT6B 2XKNA 1CL7H 2BHZA 1NMBH 1MFBL 3V5KB 4Z78A 3HZYA 3UTQB 5DR5L 1G9ML 3BD4A 1C08A 4Y1AA 2X4PA 5BRZA 1U95A 3BZFB 1A5FL 3D25A 5DYOB 4EVNA 4NJAL 3TCLA 3QFJE 1YEHH 5GRVK 4JO4H 4HF5L 4P2RB 4CN1A 3MLSL 4KTEL 1X4ZA 2WUBH 4Z7NF 1GIGL 3T2NH 1FZMB 1AGBB 4GAGH 2Q76B 3RZWA 5C70A 1HINH 1R3IH 3O6KH 1OM3L 1HXYA 1JGUL 3IF1B 1NANH 4JZOA 4J3OC 4XX1E 3SJVB 3N06B 2BOBA 1HKFA 4I5BA 2BVQA 1YEGL 4JDVA 2ZKHL 5EU6B 1K4DB 2G5RA 3NZHH 3DX9B 5H94B 2HAZA 4KRLB 4R96A 1C5DB 5KSAA 2JB6A 4HXAH 2B20A 3SE4C 3HCVB 1RQ5A 4ONGH 5D1XC 2F74A 3D2UA 1N6VA 4KKBD 4G6AC 1KJ2B 4FQLL 3TBSA 1A7RH 2FGZA 4MAUH 4MXVF 4IS6B 2HLAA 2DL9A 1II4E 2VLKB 3MLUH 1INDH 1H8OA 1B0RB 5FDWA 1VKXA 4QRPB 4GG6A 5HD8D 3LB6D 4HIXH 1TJIL 1CGTA 5DMJB 1H3PL 1UWXK 5FM5M 3NIDE 3GMPB 4G9FB 4LCWE 3DV4A 4NT6B 4L4VB 1FV1A 5GISH 5DEGA 1I8LA 1KJ2L 3OR6B 4ISVB 3BT2L 2AK1L 5C92A 4UU9A 2OYPA 4MB3A 1OAUH 3MCKA 3CSYB 1I7TB 3D0VA 4GT7A 3HI1A 3KPSE 3OX8A 2VE6B 1IILE 2UZXB 4P46A 1PEWA 5DEGB 4JKMA 1IM9D 4X6CE 5FA3A 4WW2C 2YPLA 3I50H 1IARB 1LEIB 3ULVC 1YMHB 1A1OA 1IGTB 4KV5F 1NGPL 1AXTL 1EX0A 2W65B 5GS1B 32C2B 3JTSA 4ZXBC 3GSOA 3JWDH 1P4BL 4LASH 4HD9A 4TTDD 4OIIL 4Y89A 3ILPA 5ENWA 1R6VA 4MLIA 5EZLA 2DD8H 3EYSL 4OZGB 1BQSA 3C5ZB 3L5IA 3JWOH 1RK1A 3PXHA 5F1NA 3R0MA 4XHJD 5C71A 5BZDA 3BH8A 3FQXA 2P4AB 1BIHA 5DMKA 2B0SH 1I1AA 3PF2A 4R8WL 4PJXB 2ZWLT 5I1EH 3RRQA 5FUCC 1IRAY 1CD1B 1I85A 2P5WE 1PG7H 1AGEB 3KPPA 1FVCA 3O8XD 2CK2A 3T0XA 4DJMA 4DGYH 2LE9A 1KTLB 4OM1H 3VFVB 5EC2B 1NGXA 1EAPA 1KPUB 1I1FB 1U91B 3M8OL 1O5DT 1R5VA 3BEVA 4WWID 4JR9L 4ZNCD 1UM4L 1AGBA 2KL6A 5BQ7B 3UTTD 3V0WL 4M6OL 4YXHL 2AEPL 1TXKA 3WXVH 5IM7A 3H8NA 1UB6B 4Q9RL 1KN4L 4JFFA 3MTRA 5C6TL 1T2JA 1KTRL 4PJ8D 1JHLH 3IGAB 2HFGH 4XVTL 2GJZA 5I1GH 2J5LB 1MCSA 4XAWL 5IMOA 2VL5B 4JM2C 1RULH 2MQCA 3W39B 5E08L 4Z77B 1LEKA 4CKVX 4FTVB 1JGVL 2P24A 2KBGA 4XMPH 3BP7B 2MJWA 4B5EA 5FUCE 3HG1D 3RWIA 1FGNH 2IFFL 3UDWA 3QUXC 1JZ8A 5HYJB 5AZEL 2VXUL 3O2DH 1N4XH 3CMOL 1YDPA 3IDIB 3HR5B 1J0HA 1PX3A 2J8OA 1EDQA 2XTJC 5F7KC 1T7XA 1FG2A 3CFIC 4JRXD 1B4JL 2A6DB 3NTCH 5IG7A 4Y4HA 1DQMH 5HHME 1T80A 4JFXB 3FO1A 2QQLL 4GW5A 5EBWA 5JHDE 1NAMH 1Q94A 4K3JH 1HSBA 3VFNB 3GSNB 1J1XH 5HI5C 4HS6A 4TUJA 3W9DB 1KJMA 2FEEL 1CVRA 1WT5C 2NLJA 4E0RB 2JK5A 1ND0B 4N0RA 1CFVH 1HN1A 3VXUD 1RMFH 3GIVA 3ECBB 5L2KD 3S8WA 3QG7L 1K4CB 5GGTL 4DGIH 1X5GA 4JEGB 1GIGH 3T2NL 1RUMH 4S1QL 4D0DB 2SEBB 4JE4B 1F4XL 3PABB 3BSZL 3QHFH 5MEQA 4LSPH 5JOPD 1NL0H 1MUJA 4L9DA 3MRDB 3JTTB 5D7JB 3VXMA 3MUZ1 5BV7L 1OOAA 2D7OA 4IIQC 4UINH 2BFVH 3HPLB 4YEFA 3AB0B 3FQWB 1GPOH 3ZKMC 2E9WA 1OGAE 4OUUA 2ICEB 4UB0H 4Z7VB 4H26A 1ITBB 5IFJB 3EAKA 4P9HC 1QSFB 4MNGE 4I5BB 1QFWL 2E9JA 4HUWA 3IU3B 1T1YB 4HV8A 3MLVH 4ZXBA 4MHHI 1QHOA 4LSTH 4G8IA 4PJGE 3GRWL 1BOGA 3OG4B 5JA8B 1KEML 4GAGL 4EOWH 4JRXA 2VN7A 3KPLA 4HBQA 2COQA 3BZEB 3KDMA 4NWTL 1PSKL 3GMNB 4P5KA 4U1LB 4GRWH 4K2UH 2AXGB 3VRLF 3D9AH 4LL9A 4EUPG 1JPTL 2NY3C 3TPUA 5L2KB 1VGEH 2YPLE 3RHWK 5JDSB 4QOKD 3TA3B 2ITDA 1UJ3C 3MUJA 1JRHH 4KKCC 3MJ9A 1E27A 2CRMA 4XBEH 2WUBL 2VDMH 1ORQB 1QRND 5E8OA 3SQOH 5J13C 5CWSB 4QHKJ 3DHJA 1A7RL 2YRZA 1CFSA 5C0AA 3L3KB 4P4KC 4Y1AD 1K3ZA 1DUZA 3MREB 4OZIB 1WWAX 2CDFA 2V7NB 2IANE 3DX9A 3MRNB 1KB5A 1WZ1L 3RDTC 5IB1A 2ZKHH 3QQ3A 4ZD3H 4H0GA 2NY3B 4TNWK 2MMXA 1FORH 2IFGA 1Q9LA 1G6RL 1JK8B 4NUGH 2FECI 1WJ3A 1YYMH 1FFOB 2D7NA 4N5EC 1OAQL 5DA0B 3FT3A 3T77A 1FPTH 2AJSH 3WJJA 4L9LB 3MRLA 5I74C 4R7NA 3ILPB 2HKFL 2Y36H 4FFVD 1DDHA 3H0TB 5I75C 2E27L 2ORBL 2OZ4H 2DTML 3QAZC 3T3PF 3MBEB 1H3PH 2P5WB 1WBZB 1XGRA 3DROA 1PYWB 3ARWA 3KPRE 4ZYKA 1U8QB 2VITB 5ERWB 3V6FB 4LASL 4AYFA 4G9DA 3BT2H 3MRFB 4N9GB 4NDMB 3J8F7 1QRNB 3VFSB 1F3JB 3PV6B 2EH8L 2Z31C 5FKAA 5LBSH 1M1SA 3MXVL 2AEPH 4QCIB 2FYYB 3F6IA 4PRDA 1EEZB 4JQVA 4ZPTA 2IG2L 2IH3A 2AJUL 5C0GB 3UTOA 1QOKA 3H42H 5DJ2B 3I3DA 1SJVA 4BQCA 5BRZE 5F6HI 5CZVH 3BJ91 2QQKH 5DD0H 5H2BB 3SKMB 3WSQH 2BNQD 1CDIA 1R3LA 1KOAA 3DTXB 3AMKA 3HMXH 4MNQB 5GRVL 4FP8H 1OQOA 1FC2D 4I48B 1A3RL 5EWIH 4LCCC 5EIVA 3NH7H 5CIPB 5ISZA 3UO1L 3ROLA 1UXWA 2R0WH 3U2SB 1EXUB 5FYJH 3T0VA 2HN7A 1IL1A 1OSPH 3FOMA 4EI5A 3VDBA 4MGXA 4WCYL 3QIUC 1KEGH 2CXKA 4NZRL 5DLMH 1MCCA 2DQJL 1EHNA 3Q2CA 4WUUD 1RJLB 4NJ9H 4RZCB 2FL5B 5GGQH 3C6LA 3QNYB 1I4FA 2CLVA 2AQ1A 2X89D 4G43A 4HGKC 3F58L 4KK9D 3CFJA 2XXCB 5SWZE 5FYJE 1BFVH 4OKDA 3BWAA 2V9QA 2AXJA 3TNNA 4OI9A 1JUFB 2DN7A 1WZLA 4Y4HB 2FATH 3STLB 5L88L 1JWSA 3KS0J 4D2NA 1IKFH 4JY6B 3WLBA 4EN3A 3ARFA 2A9NL 4PJHB 3X3GH 2VDNL 3PDGA 3HA0A 2X10A 5J12B 3QYCA 2DKUA 3MCKB 4GJTB 4V2BA 2NY5C 2YKLL 4R97B 2H41A 4QHUB 2EYRA 4J8RB 4JDZB 4YFLI 1ZT1A 1W0VA 3IJYB 4HJJL 4JRYD 2FCBA 5H37H 1R3HA 1XGRB 1HQRA 5DEZA 5HYFA 3MBEA 3W9EB 4KJQC 3A6CH 5CD3B 1C1EL 5CJBA 4Z76A 1L0YA 4U7MA 2GT9A 4U1HA 4O2FB 1A14H 4P2QA 4HZLB 3S36X 5GIRA 4BQBA 3FB5B 2HFFB 3GRWH 1KLUB 3U0PB 3VFUA 1TQCB 1CDHA 4KY1L 3GM0A 3HRPA 3RWHA 4D9RD 4BFGA 3C6SA 5L2JA 2CD0A 3MV8A 5CGYC 3WDHA 2FBOJ 3WFHB 2VC2L 3HZMA 1P4LB 2C26A 1U8KA 3LD8B 1QVOA 3TBWB 3S88H 1C16B 3P4NA 5IHZB 3THML 2DF3A 3SDYL 4JPKL 3EUUA 1IGJB 4PGCA 5GGTH 5DHYA 4DGIL 2XA3A 5HI4C 2VAJA 4NO0A 3ULVL 3SQOL 2UUDK 1EEYB 5HHQA 4JQIL 1RUAL 2O61B 4GLRI 4BSWA 5HGDB 1YY8B 1NGWB 2FECL 3F5WA 4WDIB 1HHJB 4XTRD 2BFVL 1CGWA 5EOQH 5CAYB 3WFCH 5HYSG 5ICYA 3HG1A 3DI3B 3KPRD 4U6YB 5JIIA 4NQSA 3ULVD 4Z5RB 4KJPC 2E8YA 2QTEA 2A6IA 1HHIA 2C1PB 3CC5B 2BDNH 5FA4A 1VESA 4Z8FL 3WKMH 4P59H 3QO1A 4FHBD 1G7HA 1HHGA 4M3KB 3KYMB 3QIBB 4LLDA 3VXQA 1RHFA 3QUML 4Z5RA 1J8HA 1FNLA 3W5MA 5F9OL 4YNYB 4PV8B 4ELMA 1MFEH 4K2UL 1I8KB 3L3JB 3QUMB 4MCYB 3INUL 1TFHA 4V1DA 5HD8C 5F89B 1TQCC 4LLYB 2QHLA 4GRWE 4L8DB 4OCXL 3KNBB 3FT4B 2D9CA 3OKDA 4P46B 5HPMA 3EO1A 1BREA 5SWSB 1QYGH 4OBSA 2WBKA 3GGWA 1NCBH 2JJTC 1XZ0B 3RUGA 5C08E 2ENSA 2VDKL 3FQUB 1QVOB 5ACZB 1U8QA 2YN5A 3I9GH 1E6JH 1RUQL 3LQZA 4U1KA 2VKXA 2VXSH 5JR1L 4OGZA 5B39G 5DHXB 4XPTL 1A7QH 5DVOA 4UIMA 1RV6X 3NH7L 2DQGH 4NQEE 1W0WB 4X6EA 3MNZB 1KG0A 1T89A 4MSWB 4JKPH 3VI3F 3MLYH 1MIMH 1LK3L 1UA6L 3MGOA 1KJ3L 2HP4A 3MRPB 4HS8H 1MHCA 4NP4H 1KXVC 3U4EA 3FFDB 1TJGL 1BFOB 4AQ1B 3UROR 1EUTA 3NA9H 4M7LH 4OLWH 5A1AA 5EO0A 4C56A 5C0CB 5E4EB 1XCQA 4LCCA 2C7UB 5A3ID 2BY2A 3RJDA 3E0GA 4MAYB 5C09D 3SDDB 3EYQC 2R2EB 1ZHKB 5LKNA 1OCWL 2MOVA 2PXYD 4OIAA 1TPXB 4LRNH 1HWHB 1KIQB 2OZ4A 2I5YL 5IF0A 3EYVB 4Z7UE 4RIRA 4GBXC 2XWTB 5I1AB 1RVFH 2VL5A 1I9EA 3SJVE 3ZHLA 1A6TB 5L9DL 1J86A 3NFNA 3LRSB 5DURB 4QHLA 1AI1H 1JUFA 1UACL 4I1NB 1SEQH 5HHNB 4OCRH 3EJYC 5D1ZC 5CMAB 4M4PA 2X4PB 5B3JF 4PJHE 1H3XA 3WNNA 1OL0A 4H88L 1S9WB 4LPUA 5F97E 1KCUH 4KDTA 3BGFC 5K59F 5GGRA 2E7MA 3O6FB 3VFMA 4I4WB 4AMKL 2DM3A 1RJYB 3QO1B 2GUOA 3IDGB 1E6OH 3AC0A 1HDMB 3LKOB 4PJ9C 5SWSD 4JB9L 5E1AB 2AERT 3QHZL 1JNLL 4P46D 4LDLB 1DBKL 1T6VN 2Q20A 3RTQC 3S37X 5DJ0B 5FECB 4APQC 2EYTB 2IGFL 1F6AA 3B2UD 4X4ZA 1MFAL 4JFYB 3AREC 4FQPA 4QTIL 5IV2B 5J0BA 1LP9F 5J1AA 3C60C 3QUYB 3FQNA 1GZQB 4HLJA 1NUFA 1VFBB 5AG9A 4YX2H 4C83A 5A3IC 5BS0E 3TVMC 4F9PC 3EOBA 4PP2B 1S9VA 3OB0H 4G8GE 1MQ8A 2CKBH 5CP3H 3C8HA 4G8GA 1DBBH 1FE8H 5BS0A 3VJ6B 3WFHA 1SBSH 1JGDA 4JO4L 3EHBC 3T3PE 3OF6D 1UCBH 2ARJB 3ELAT 2AGJL 2O5ZH 2K7QA 3GM8A 3WDIA 4S1SH 3WIIH 1ZEAH 5I6XC 5DS8B 2BX5A 3DXAB 2OL3H 1CXIA 3RL2A 3DIFB 3DGGA 4Y5VB 4U7KA 1MLBB 1VB9A 4HLZG 3HMWH 2ZJSL 4HCRL 4WO4B 1H9VA 4NYLB 2V9TA 5CJOL 1YEFL 3GJFB 1JL8A 2C4XA 4YGAB 1JHTB 2EZ0D 1WEJL 4N90D 1F42A 4DKAA 1DQLH 1YYLL 4YHKL 1K3IA 1U8IA 2BVQB 2DLTA 4PJHA 4GBXB 1JYNA 1YMMD 5FHBH 1IE5A 3PHQB 4LEXH 1KGCD 2WBWB 4O5LH 5C0AB 5ANMA 3LN5A 5FM5O 4LNVA 3WXWL 1VGKA 1VFAA 1P5VA 4KKLC 1BGXH 4UI2A 4ZG1A 2X4NA 4BUGA 3FT4A 3CZJA 4KVCH 43C9B 5DK0A 3C8KA 3MV9B 4LHUA 5GRJH 3RDTD 1QRKA 4Q0XH 1U8MA 3KPTA 2JCCE 4K7PL 5HI3C 5IQ7L 3EOTH 5L8JB 4F2MA 2X4RB 4UTAH 5IEHB 2BRRL 5HPOA 3N1QC 2J12B 3TBVB 5F1IA 1U6AH 3CLEL 3ARXA 3OPZH 3JWDL 4Z0BH 1DFBH 2AW2A 3SBWC 2ICWJ 3T0ED 4O2EB 4EZMA 3S35L 3HLAA 4JFFE 2AK1H 1RZKH 5SWSA 5C8JA 5FOJA 1J12A 3L5WB 3LQAH 4XBPB 4F7MA 1WZKA 1SYSA 4OLUL 1AD9A 3MX0A 5GGSA 3K8MA 2VDOH 3D3VB 4XXCA 5I66A 1LO3L 1L7TH 2ZUUA 1U92A 1TJGH 2B0SL 3O8XC 4V1DB 1RZJH 4DUWA 1A6VL 1GCFA 2PO6B 5CEZD 3C08L 3T0DA 3EFFA 4K07A 4NQXA 2WMPA 1J8HB 1NEZG 2JCCF 4Y7MA 3R8BB 3KYOA 4GBXD 4PTTA 5KG9A 2FEDD 3CFDA 2C1OB 4QRUB 3B8YA 4WI4A 5GGTA 1P5UA 1YC8A 3OGCA 4KI1A 3QJFB 4LMQI 4HWZA 1MCLA 4O9HL 1IC7H 1U2CA 4U6XB 5E9DD 4ODSL 5IQ9A 5BS0B 4YPGB 3SDCD 2R2BB 4QXTA 4NQDA 2D4DA 2X4OB 3DVGA 1FRGL 3HZMB 3QQ4A 1X5YA 3HC3H 2QLVB 5D7IF 1D6EA 5FFLA 2NCMA 2DJUA 3AXLA 3BPCA 1R5IB 5CD5C 5DC4B 3GSUB 3PWVB 2BSTB 5IKCA 4ORZC 4Y16B 3QDJB 3QDMB 1ZGLA 4ODVH 2E9IA 4G6FB 2PW2B 1MWAA 1UVQA 3VWJC 4XRCA 4GRMA 5C6WH 4EXPX 5KVGH 4J3VA 3KPSA 5IVXE 1J5OH 4Y19B 1EMTH 3MOAL 2E7HA 4CW1A 3S7GA 1SYVB 1L6ZA 1S9WA 4TULH 4NP4L 3W0WD 1KJVA 2DLIA 5HHNA 1IQDA 5JUEL 3PNWB 3UTSB 1JI1A 4IMKA 2GCYA 3NPSC 1R3KB 2VXTL 4GG6E 4KUZL 3AGVA 1DUZB 1F5WA 3B9KC 4M1GL 4OZIA 1NAML 4XWOC 5KVFL 2E6PA 5E5UB 1N59B 1NFIB 4LU5L 4LLQA 1OCWH 3VWJB 3RNKA 5ABDE 1F4AA 1IAOB 3O2DL 4D8PB 2CIIA 4KGLA 4P2RA 5I73B 3EO0A 5F7NC 1MJJA 3CXHK 1BQHA 3BKYH 2CDEB 1FNSH 4TOYH 5GRXG 1JFQL 4JB9H 4L3EA 3MV9A 3ULUH 1DBBL 2G60L 4CAGA 5F8RC 4OGXL 2EYRB 4J8RA 1PAMA 4S1QH 1NBZB 4R26L 1WAAE 5DWUL 3SDXF 5D9SA 4NO2A 4QRRE 1N59A 4NZUH 5M95B 2CKBB 5SWZB 1ZAGA 4HPOH 1NLBH 3QDAA 3ZZ1A 4X7FC 3NABL 4X5WA 4JGMA 3R1GH 5IOPA 1T3FA 4WTZG 3G9VA 3VD9A 4JFOB 3IFLH 3RWFA 3C6SB 3FQUA 4U6TA 1JPFA 3NCYP 1T0PB 4QYOB 5CEZH 3L3OA 1QPXA 2F19H 2YUVA 2GHWB 3MRDA 4OZGA 5D7JA 3KAAA 5D7IB 4KZDL 1W0WA 1U8HA 4UOJA 4GKSA 3WEXB 3S98A 1F90H 2A6KB 3KPQB 1MLBA 1NDGB 4NQCB 4F3FB 1QP1A 3RL2B 3BI9X 2BSRA 4RMQA 1JNHA 4O5LL 3IXTA 3VFGL 3TT3H 4DKDC 3P0VH 3VMPA 4JFHE 4OGYH 1F8TL 1SY6A 4IRZL 5HSFA 4XVUC 5LCVL 2CRIA 5KAQG 3GK8L 1UCBL 3PWLA 4OBRA 1EIBA 3L5HA 3ARPA 3GI9H 4YZFE 5FYKD 3NGBC 5CSZB 1RZFH 1R3LB 4CJ0A 4PLKC 3GMPA 1B0GA 3IDYB 4G9FA 4KI5F 5JW5B 3QZWA 5FO9B 3LMJL 4YJZL 2GSGA 4O2CA 4WIQA 3ZMRA 3ULVF 4U6YA 4LVNC 4HCRH 3V6OA 2YBRA 1ERNA 3QRFM 1LDPH 4I8DA 5K9JH 3MC0A 4MCZA 1QFUH 4RFOH 1F4YH 3O41A 5C0BD 1S7UA 3BKML 4XP9H 4W4OC 1G7JA 2F15A 4JDZA 4XCEB 5HHOA 2WLYA 3X13B 2Q3AA 5KSAB 3CU1A 1XGPA 35C8L 3MV9E 3GKWL 1TQBC 2Y25A 3MFGB 3SQBA 1F2QA 1NFDA 4LRIA 3C08H 2EDEA 1EXUA 2DMKA 1DQQB 2GUOB 3IDGA 3D0LA 4PJ8C 5F1OB 4PJ9D 3K2MC 4WI2A 4ONFL 5DRXA 1TNMA 4H5SA 1DN0A 2V5RA 4JCMA 5E5MA 1GL4B 1UB6A 2DMBA 4ZO8A 2GJ6E 2APXA 4P0DA 1OAQH 3P4LA 3QUZA 1HI6B 1A8JH 2XWJA 5HVFB 2NYYC 2FWOA 2VQ1B 4WFEE 1G7IB 1IC7L 3B9KA 4ODSH 4FRWA 1FO0A 4XP4H 5FAAA 5F7LB 1UJ3A 2R56H 3HRZB 5A16A 3RKPA 3REWA 3RWDB 3GMQA 2XKNB 4N8VB 2A9ML 1ZVSA 1W0VB 1LILA 4MA8L 2B1HH 4NHUA 1JGEB 2ICWA 3EGSB 1IKNC 1G7PB 3C09C 3T65A 2VITA 3GZKA 1QSFA 4NM8L 2ZUSA 5MI0B 1N64L 1JJUA 2VDOL 4UIKL 5DD6A 5AYUH 4B7LA 3GBMH 1H0DB 2WIIB 5FGCB 2X89A 2ED9A 1AGCB 2R4RL 4NQDE 1RZJL 2OL3B 3RVXC 4UV4H 1S78D 3E6HB 4P5KB 4UTBL 1G0XA 4QTHA 3VD3A 3DIFA 4Y5VA 8CGTA 1R24A 1FN4A 5I1JH 5DJ2A 5I2IB 5KVFH 1A9BA 3QDME 5ETUB 3BP4B 1JPSH 4QGTA 4X6DF 4PY8J 3TIEA 5FO7B 3RY5A 3N9GH 2VO5A 2WK2A 4ETQB 4OI8A 1PLGL 5ISZD 2FDBP 1ED3A 3T2OA 3BJLA 2O5XH 3SDAC 1AFVH 1EVUA 1MAML 2AEQH 3OGOE 2R0WL 3AS2A 3O2WH 3BDYL 4IHOB 5F88A 3ZYZA 5GSVB 1AY1H 1JWSB 5C0AD 1EFXB 2XQBH 3LB6C 3PWPB 4WEBL 2FB4L 1SMOA 2X9WA 3HNVL 2XTJD 4FTVE 1KV3A 4MS8C 1KLFA 3GSNA 4LCIH 5DZLA 1ORQA 1JNNH 1U0QA 4NC1E 4QHKI 1PVHA 1MRFL 4XP1H 2IAMB 2HT3D 2PO6D 3B2VH 1ULVA 2DDQL 3DX6A 2WUCL 3CX5J 1KTDA 4U0RB 3FT3B 3HI5L 2EEDA 2W60B 4TULL 4Q6IC 3OAUL 2JCCA 5F6HJ 2FATL 3LPWA 4M7ZC 1TZHB 4FQXB 5C9KA 4H1LH 5IOPB 3FRUA 4U1NB 4MD5B 4KRNA 1AH1A 3M45A 3VH8B 3QIWA 1BZQK 5HHVH 5CEZL 2FD6H 4HF5H 1ZGLP 3DV6A 2VXVL 1LQSR 3ZDYE 4XVSH 5C8JB 4YBQC 3R06B 5IMMA 4NN7B 1LO0H 4O2EA 5EU5B 1TVBA 4LU5H 4GW5B 1PY4A 2YD4A 2X41A 3TPKA 3BVNA 3UXFA 4E41D 5JIPA 5C0BB 4EKXA 2VC2H 1A3LH 5D7LD 3VGFA 3DROB 1IFHL 4JAMB 1XF4A 4YR6B 4FABL 1NGWA 2R1XB 1LD9A 1DE4B 4K7FA 2DIJA 3S34L 4BZ1L 2PCPB 4G3YL 5EU6D 6FABL 3NACH 4QCIA 5D96B 2WSKA 3HHRB 3ARUA 4XVUD 1K4CA 1XCTA 3PGDB 4X6CB 2ZUQB 1UZ6F 3KPPB 1NLBL 4PJGF 1INEH 2DOCA 4Y4FB 1C16A 3P4NB 4OF0A 2D4FA 5F9WB 4H1LG 5GJSL 4ACPA 1Z9OA 3UCRA 1CU4H 2F58L 3GSVB 2LU7A 4JPKH 1UENA 2IAMC 2P1YA 2AK4D 1LK2B 2VLLB 3CUPB 4ONGL 5E8PA 5I9QB 3K4DA 4HAGA 3DBXB 4PJBA 5JMOC 5FK9B 3U82B 1A7BA 4IJ3C 2DQCL 5KW9H 3GK8H 4Y4HD 5E99L 2WBJA 3V5DA 1YEKH 3ES6B 4PJXF 3BRFA 3L3HB 4F7EA 3WFCL 2YWYA 4IDLA 4WHTB 1Q1JL 3MBXL 3QA3B 1YN6A 4JM4L 4ZODA 3BPCB 3RVTC 3TVMD 3WNPA 4UT9H 1A7PL 1EGJL 1T4KA 4KAQL 1DBJH 5ILTH 6CGTA 1XFPA 1ZWIB 4U1LA 4IHOA 2G75A 3QISA 3T4AB 5FCUL 1CDCA 5IHBA 3TH3T 1OLZA 1CICD 2IPKB 1S7XB 4A2MA 1XH3B 5J9PA 4E41A 5FF6B 5I8KL 1LEKB 4YIQB 5TDNB 4L29A 4L3ED 2DWEB 1PGRB 3ETBF 3JBG7 3B9DA 3OL2A 1UQSB 4WWKD 3BZ4B 1I3GH 4G6MH 5L2KA 5CEYA 5E4EC 1PG7L 3BFOA 5DD1H 1KCVH 5FGBA 4OIIH 2HLAB 2IMMA 1O7SA 5F44A 4HLZH 3G6JF 4PRIB 5GGSB 5D5ME 4JR9H 4U1SB 4C4KO 4JO1H 4U6VH 1YEEL 2UWEF 5EUKA 4WHDA 5I76B 3DV6B 5LG1A 5B4MC 5DZNA 1PZ5A 2R4RH 1QLEL 3VG0L 1SQ2N 4RNRB 5EH1A 1M7DB 4C57C 4UTBH 2MSPA 5IW1A 4RQQB 1NDGA 5KOVC 2P8LA 5KS9A 1HCVA 3MLXH 5FDYA 1JF5A 1PEZA 4AL8L 1ZT4B 2ZCHH 5DUPL 4PLNC 2KZ1B 1QQDB 5JR1H 4LVOB 5JLZA 2YHGA 1ZHNA 2BVPB 3L3OB 1FBIL 2VISB 2MNUA 1EJOL 3O2WL 5ADPH 5JIHA 1ZGLM 1N7MH 3JTSB 3D39E 5FYLE 1IGFL 1U95B 1ZHBA 3BKCH 1UWGL 3NFNB 2KH2B 2A77H 3DARA 1X9QA 1AGEA 4YUEH 1XGUA 4X6BB 3QQNA 3T0AA 1CGUA 3B6SA 3HI6H 1ZLVH 5E2WL 3NA9L 3G6AB 3IJHA 4MA7L 3TESA 3KLAB 3AS3A 2DQTH 4MAYA 3ZDXE 4PRPA 3FO2B 2W0LA 1QG3A 4ETQA 4HHAB 3MFFB 1V7MH 3IYLW 1E4KC 2BNQA 3QIBD 3VXNA 2FJFA 4AMKH 4LQ1A 1UYWL 1I85C 4MJ2A 4UIKH 5AYUL 2VLJB 4APQD 5I16B 2A0LC 4QHNA 2H3NA 2NNAA 1D5ZA 3EBAA 3RUGE 1SYVA 4FQCL 4HKXA 4NCDA 5HHVL 1OLLA 2FB4H 4M00A 4OKVB 3MXWL 5CZXD 1H0DA 4F7PA 1SEBA 2B5IB 4LMQE 1RZ7L 4Z9KB 4H8WH 1AO7E 4OZHF 4UAOC 2F5AH 2UY7A 3UBXB 3HE7A 3OX8B 5H94A 1AFVL 4TQEL 3RIAF 2AKRB 5JHLH 4WNQA 4JZNA 3WFBL 1FL5A 2W92A 3TBYA 2P24B 4FTVA 4L4VD 4EQ2A 4ZUTA 5L7XH 4LHUD 4NO5B 1DBMH 4UB0L 2IF7A 1XZ0A 2VLRA 3IS0X 2OR9H 1FG9C 1V3LA 5J56B 3UDWC 1DLFL 3CXDH 2AP2A 4PJ7B 4Y16D 5HPMB 3GHEH 3MLVL 3QEQB 1T7WA 3PQYA 1MCEA 3KJ6H 1KEMH 1LO0L 4ORGA 2VABB 4X98A 4KK6D 4FQHA 1YNLL 5DJYB 1T83C 3DVNA 4H1LA 2VZVA 2C3VB 4PYHA 3D0LB 5EU6E 5IW1B 2YSSA 1S7TB 4P5MB 2Z91A 1U3HD 4PG2A 1RHHA 5TE6L 1QFWH 5IB5A 1AD9B 5D71H 3D39A 3TV3H 3AREB 3HS0B 3U30B 1RUPL 1E4WH 4G8FB 3QB7C 2OP4L 4TPRL 5E94A 4ZXBB 1L0QA 5LQBH 4GW4B 4JG1H 4HIJB 5FGBC 1I3RB 1KT2B 1NCNA 3FRUB 1K8DA 3QWQB 2EDQA 3L5XH 3EFFB 2NY6B 3RY6C 1X7QB 2DM7A 1DBAH 1NFDF 3VFPA 1EGJH 1MQKL 5F7EH 4EEEA 5MEND 4PB0L 1NJ9B 5DC9B 3U1SH 4RRPG 4OLYH 4K71C 2E5EA 3UTTB 2YD5A 2MPAH 1JGEA 4UZGA 5E2TH 3MV8D 5IT2H 4HIHB 1OGTA 3ULUF 5BVJB 1KIQA 4NOFA 3WFDL 1L6XA 4HPYL 2W0KA 4ENEC 4YBHA 1OP9A 3CFBA 4G7VL 4J4PA 3HUJF 1Q72L 1NMAH 3HTLX 4WY7L 3K0WA 5T5NG 3MA9L 4JREB 2BZDA 2H9GA 2Y6SC 4K7PH 1TIUA 5T33H 3WIHH 3ZL4H 5C9JA 1YC7A 4ONHA 4CVXA 4HS6B 1U6AL 5EB9A 2X7LB 4NFBA 1TCRB 3ARBD 3UBXA 5E7BA 3CK0L 1ZSDA 4DEPC 2OTWA 4QEGA 1JP5A 4PRNA 4OKVA 1T5XA 1YPZB 1QLRB 1VADB 4PJ8B 2UVFA 2Q8BH 5D2LF 1W8OA 1LK2A 5E8PB 4PJIB 4ZFGH 3QUXB 4LLVB 3ZE0F 5GGVL 4R4NC 5IQ7H 4X99A 3UZEA 4PV9B 4C56D 5DVLA 4JDVB 4ZDHA 3DYPA 4U1MB 1UM6L 1P4IH 2X4TB 4NGHH 5DC0A 4UNVA 1KBGH 2H2PD 2GKIA 3ARYA 3DX8A 2EH8H 1BLNB 4Z7QF 4ZFZB 3VXPB 4Q9QH 2VH5H 3RWDA 1G1YA 4JHZA 5EFIB 4WW2F 2YRLA 2DBLH 1U58A 5CGMA 3LHPL 2PNDA 2HVJA 1BWMA 2PYEE 5K9OB 1A2YA 4JAMA 5KZCB 1LO4L 4YXKH 4MA7H 5A2KH 2DQJH 2Y4SA 3MLXL 4ZOCA 1CG9A 3GMLB 1ADQA 3NAAH 4TVSa 3D3VA 3QPXL 4WUUB 5AAMA 5SX4H 1K6QH 1KTLA 3VFVA 4G8IB 1MCWW 4P57B 4MJ6B 1YNTA 5C07B 3MZGB 1NMCB 2F5BH 2D0GA 5D2NE 5FB8A 3W2DH 2ZPKH 1S9VB 1BVKB 2XQYK 4I0PA 2NTFA 1UXSA 2W1NA 4HIEB 5TF1H 2RAMA 1YEJH 4KK6C 2ICEA 1M71A 1ORSB 4P57A 5C07A 4HS3B 1BQHG 3F6LA 4LSVH 3KR3L 3MROA 5ESVB 3O41B 3JTTA 3KPSB 3AFLA 2VN4A 3SDCA 4G9FD 5HGDA 2Z31D 4KDWA 4BYHA 5IMLA 1MWAB 1WAAA 1S7RA 5T1DH 4Y0GA 3WFEL 1JYXA 1BD2A 1QNZH 2EEBA 4HBCH 4X6DE 5CEYB 1RFDL 3QDJA 5JPNA 1XF2B 4RISL 4FNLL 4QRQB 2GEEA 5GZND 1IGYA 4YBLB 4U0RC 2CR6A 3EJJX 4ZUTB 2J5LC 4R4ND 3VE0B 4EXKA 3GHEL 2DD8L 3EYSH 1OPGH 3HI1B 4PJ7E 5JTWA 2XZZA 3VU2A 2J3SA 5DVKA 3TEUA 1FVEA 1A4JB 2DL2A 3RHWF 2R1WB 4ZOEA 2WW8A 5HYQB 5M94B 3M17A 1UJTA 4KY1H 2G75B 2DLFH 4PRPE 5C7XH 1MFBH 3VXOA 4HPOL 5TH2B 5IW6A 1NCDL 5DJ8B 1N0XH 5MEPA 2VERN 3QIUD 3WEXA 2HFTA 1ONQA 4PLJC 3VA2C 3NPSB 3CVHL 4GMSH 4J1UA 3VWJA 1J7VR 4RGNC 1BF8A 3IJYA 3SO3B 1KCSL 1FLRL 4M48H 4BM7A 4J6RH 1U93B 2B4CC 1DTUA 2DRUA 1BBDH 3ZKXC 2VDQL 4XBPA 2A2QT 5HYQA 4NZUL 5ID1B 1MREL 2J4WL 2X4TA 3G04A 1HILB 2JJSA 4OSUL 4I3RL 3RL1A 1KUMA 5B21A 3NABH 5CINL 4P2QD 1IEHA 1FJ1A 4GUPB 5JDJA 3U1SL 3SDCC 4OZHB 1V7NH 4XC3H 3MRQA 4OQTL 3RVUD 2ZUQC 4RAHA 5D9SB 2Z8SA 5HGAB 5A43C 3DJ9A 3GBNH 3T4YA 4P59L 2PCPA 3KYAA 4PJFB 3MV7E 5BJTA 5IWLA 2PTVA 2CRYA 4L1HA 3TNMB 1JTOA 3RBSA 3U9PH 2DQUH 4D0CA 3BZDA 2XZAL 3VFPB 4JFZH 1C08B 5BRZB 4HS3A 3BPNB 4WW1B 5SWQB 1J1PL 4OCNC 4KMTL 4MD4A 4IJ3B 5EA0H 3HZYB 3VXRE 1FH5H 1BZ7A 4JRXB 1CTNA 1F8TH 2Z92B 4FFZH 3V95A 1S7VA 5E2UL 1JN6A 4A2LA 2P7TA 2CH8A 4TPRH 1U8PA 4URTB 5LQBL 4ZPVA 1B90A 2GCYB 3GI9L 3CDGB 3OHXA 5TPWH 4NN6C 1TDQA 5GZOC 1MCQA 3LS5H 5TFSH 5E6ZA 3I50L 3W5NA 3D48R 5DMIH 3L3JA 4EIGB 3BYYA 3VGAB 1UM6H 1WBXB 4MQXC 5I0DA 2EKSB 5DQJA 4FZ8L 2JB5L 3LKQB 3VXUA 1G7MB 2M1KA 3CDYA 2V2XA 4FQQB 3L6FB 2A1WH 5I15H 5KZCD 4HFUH 3VD4A 3TA3C 4F58H 3I3EA 2XWBA 4XP9L 1S7VB 4G6KH 4HGWB 3B2UC 3UTPE 2IPTL 4LKXA 5H35A 4PJEB 2FX9L 3AXLB 3MLYL 4X6DB 3HE6A 5IVZA 4PR5A 1AQDA 4NO3B 5ANME 5MERA 4Z95L 5E7FA 2CMRL 5GS2H 1ODAA 4XNZB 3DV4B 4PV9A 3WIHL 2OQJB 5T33L 4TUJB 3W9DA 4LAQH 4PGZA 3BUYB 4ERSL 2Z35A 3RGVA 3H9SD 3LN9A 2EXYC 5FYKE 3OXSA 2HT3C 3DECA 1UEMA 3BOVA 4HG4J 1AE6H 2ILLA 1K6QL 4P2OC 1TLKA 4PPTA 4RGNB 5KSAC 3FRPG 4L8BA 2GSIA 2Y07L 3KYOB 4TRPH 3BWUC 4X6EB 1OARH 2UVEA 4CNIA 4CL7A 3PDOB 3UPRB 1HQ4B 3ZKXB 1F6AB 3K4ZA 2IADA 4ZTOL 4P5TB 2NY4B 4XAWH 1C5CH 2HMIC 1IEAB 2XN9A 1BAFH 3C5ZC 3H9HB 5D5MF 2C4FU 3WD5L 4L8CB 2NMSA 1AD0A 1H3TA 2WNGA 4NHUB 3KPMA 3MYZA 4BFIA 5IROC 2XA8H 5GS2D 4DN3H 4NO2B 3MRRA 5GIRB 3VXRD 4Y19E 4DCQB 3HN3A 4WO4A 3TWCL 4M6ML 1JNJA 3QQ9C 4AEIH 4JRYB 1WZ1H 2VLRE 3TA3A 2QKIA 3IDNB 5DYOA 4QHLB 4LPXA 2Y06H 5FYLL 4Z7WA 3H9SB 2Q8AL 2BNQB 4NUGL 4HKBB 1BBJA 3O3AB 4OM0H 4PV8A 3TYGH 4ELMB 3MJ8A 1WICA 2YK1L 2QADC 2XV6B 1IAOA 1NUDA 3LKNB 5L0QC 3VDAA 3QG6B 4XXDA 5KSAD 5T5FH 3KWWA 5EZIH 5EC2A 3CU7A 2FL5A 3KPOA 3VE0A 2G5BA 5T1DL 3WFEH 2HKFH 4C54A 2OR8A 4MJIA 5IB3A 4IRSD 5IWLC 4RISH 3QHZH 4CMMB 4MA3B 1OD7A 3BWAB 2XQBL 3X13A 5E2JA 1HHHB 1FNAA 1X5ZA 3OSKA 3N1FC 3SCMA 4HC1A 5EPMB 1S7UB 2O5YL 4XNYL 5FO8A 5DZOA 1YY8A 1OQXA 1B2WL 4KGJA 1MREH 2J4WH 5DK2B 1CICC 3P4OB 2IG2H 2Q86A 2XTJB 4YX2L 4WFGD 2QQNH 5D1QA 4M93B 4LVNB 1N5AB 1J0YA 2DQIH 1AHWB 2E7CA 5IBLD 4B50A 1HOCB 3I6LE 3NIFF 2FLBT 5IB3B 4BFEA 3MNWA 5T1KA 2B1AL 5HY9A 2FX7L 3C5JB 3FT2A 4RMTA 1GZPB 4LOUC 5EIIB 1DANT 5DO2C 3LKSB 4J3TA 3O6FA 1Z5LA 5B38G 5TF0A 2FH8A 3FAXA 4I9WD 4XVSL 6FABH 2GJ6D 3BGMA 1SY6H 3EIFA 4PGEB 2ITCA 1ADQH 2JIXD 3D85D 1G9NH 2Q6WA 4J6RL 4FFWC 1GZPA 4OLZL 5ERWA 3QXAB 1WEJH 3P77B 1PSKH 4X6FB 2ERJC 1BF2A 2WV3A 3SKUD 2GT9B 4LSUH 2HJKA<