5C0CE

1e6 tcr in complex with hla-a02 carrying rqfgpdwiva
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
MDAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0cE02
4M61A 3RI5K 1U8OA 1MIMH 1QRNA 1UXWB 1CDCA 4PGCA 3BKYL 3NCMA 4JM2C 4PJ7A 1JK8B 4N8PA 1GPOH 2ERJB 5SWZA 3ZTNH 5C0RH 5IEKA 1A3LH 1IGYB 4G43A 4C57C 3GSVB 3WN5B 3ZE0E 3T0ED 5I71B 3DSNA 2OZ4L 1VCAA 1QSZA 4NJ9H 2XA3A 3BWUC 3QEQA 4LLYB 3CX5J 5FGCB 2B5IC 3T3PE 4F33A 4APQD 4L8SA 3OPZH 3STLA 2F8XC 2ED7A 3O6KL 4UDTB 1EGJL 1RUKL 4TSCH 5I16A 2BZDA 1HHGB 4C56E 1GIGH 3GMQB 1J8HE 2ZUQC 4DKFL 2VDOL 1F4WL 3HI5H 3MZGB 3PIQB 1P5UA 1MY7A 2PTTA 5IVNA 1KTKE 2XG4A 4L9LB 5C0BE 3H0TA 2JJWA 1NUFA 4KY1L 3MLYH 1S78D 3RDTC 3O6FB 4GBXC 2EC9T 3PQYD 3RAJH 5C7XL 5K9JH 1F4YH 4G9DB 3QI9A 4X6EA 4BA8A 3Q6FB 1GGUA 4ZPTA 3RQ3A 3A67L 3F7VA 4TVPL 1I1AC 4MCYB 4OM0L 4ODSH 1HZHH 4TULH 5EO1A 3IAQA 3V5KB 4PJGA 5DTFB 1FGVH 1YEJH 3O3DB 4LP4A 3T0DA 1GGBH 3UTTB 3V9FA 4BQCA 5C0EB 2R2EB 4YLQT 1MJUL 5KN5A 1OGAA 2IG2L 3RIFF 2HFEA 4AH2A 3QPQD 4PS4H 5EFIB 5I0DA 4WFGD 3DRQA 3GK8L 4LVOB 1KFAL 2BVEA 3MA9L 4OFKA 3ZE1E 3L5HA 4NOFA 3UEZA 3N50A 3DO3A 5DMKA 1ZLSH 5JW3H 5DVLA 3KJ4C 4UV4L 2A1WH 4N8VB 3IJSB 2IJ0C 5L2KB 4X99A 3V4UL 2XG5A 5EBWA 5E95B 4KUCF 4L8SC 1MCEA 5JW4N 5KSBA 1F11A 3GEWB 2C3GA 3GJFK 3QA3B 5TDPB 4FXKA 5DO2D 4PRPD 4U1SA 3UTSA 2IANE 1RJZB 4RFNB 4ZS6D 4DTGL 2UZXB 3NVQA 2DDQH 3O45A 4TSAH 3BVNB 4OGYH 3RX8A 4GMTH 2HMID 5I19L 3O4LD 2P5WE 4RX4A 3VXPA 1N2RA 3H9SE 1OARH 2DQFA 4QRSB 1INDL 3CFDA 4KPHL 3Q1SH 1YJDL 3Q2CA 2HKFH 1T6WA 3QI9C 2RGSA 4KKBD 4HUWA 1TENA 1KACB 4NNPL 3MX0A 3C6SB 4JG1L 1ZVHA 5FIEA 2VWEE 4QEGA 5F96L 2ITDA 4XWOC 3N9GL 1C12B 5I9QC 3GSWA 1C16B 1Z6JT 3BDYH 3R0MA 5F7MC 4DEPC 4TUJB 3U2SA 4S1SH 1TJIL 2GCYA 5F3BA 1JPFA 3JUYA 2X4TA 4YDVB 4XC3L 1OCWH 2BSTA 4OZIF 4OCMC 3MLRL 5F3HB 4ENEC 3OAUL 3LIZL 5BQ7B 4CUCA 4K23L 1NKRA 3FONA 3RL2A 4I8DA 3RPIA 1ES0B 2K7PA 5A3ID 4NFDA 2DM2A 4Y4KA 1OHQA 3DVNA 3JTTB 4JPVL 2BMKB 3HZVA 3QCUL 4OZFA 3UMTA 3DBXB 4MHHG 3T1FA 3KLHC 1NDMB 3WKNA 1BVLA 3EFDH 5AYQA 1GOFA 5EULV 3SE8L 2R39A 4WEBL 3EFFA 5IFJA 1FCGA 4OLVL 3B3IA 2EH7H 1G7PA 3MRNA 4FFZL 4JLRA 3SDYH 2F53D 5CKGA 4MXVF 4FA8A 1ORSA 4E5XA 1UKQA 5CZXC 3SDAB 1F3JA 5D6CA 5GISH 1PGRB 4L8BA 5HJ3A 4Y0GA 4X6DB 1SYVB 2ZKHL 4TSBL 5I1GL 4MQ7A 3PWUB 3RWCA 3QDJD 4G8IB 4JRYD 5KSUA 3NOIA 3RWDB 5HHQA 4EI5B 4QNPE 1DZBA 2AV1A 5L88H 3SY0A 2QSQA 3WXWH 2A83B 3BJ91 3WLWC 2EE3A 3FQXA 4O58H 4JFHE 2VUOA 5C6PB 3W5MA 1X3DA 4K8RD 2Y72A 4QHMB 5JDSA 5T5NG 1U91B 3U0WL 4S1RL 5FA4A 15C8L 5B39G 2VXQL 4OD1H 4N5UA 1B0RB 4NN5C 1F8TH 4YXKH 3G6JA 3DO7A 2FWOA 3VFRB 5FO8B 4LAJH 4YHZL 2LU7A 3C60A 4W6WB 2RCSH 5CSZA 1CI5A 3MV9A 1OP3H 4R8WH 4M4PA 3MV8A 2XNAA 4KRNA 1ZHNB 4JR9H 5J11B 4HLJA 3M17B 3JTSA 3DARA 3QQ3B 1KCVL 1ZTXL 4P23D 4DFIA 4POZD 1IL1A 1S3KL 5EUOB 1S7RB 4LSRH 5J1AB 1DQJA 2OBGA 1EA9C 4WU7B 1B6DA 3QEQE 1MFCL 4JO3H 4ETYA 4JZNA 3D2UA 2YK1L 5F6IC 1ZVYA 3MRCB 4FZ8L 1NCUA 1JGEB 3FCTA 3KPOB 5CBEB 2OJZH 1AY1H 2F5AH 5GZOC 4C83A 3HFMH 3RZCA 1JZ3A 1BD2D 4POUB 4U6TA 2YRPA 3CLEH 4JKWA 5ADOL 4OIAA 3IGAA 1DQDL 3IFNL 2DWEA 1K8IB 1D5BB 1IGCH 1CD1A 1UJ3B 1X5YA 4NZTH 5GQBA 2ESVE 1I1YB 3MLXH 4GXUM 4P4RB 4JFYA 5GGQL 4XGZA 3TVMB 4NO2B 2QQLH 2YS4A 4GKZB 4MJ6B 2XKNB 3RGVC 4BQ6A 4LHUD 3P9MA 1D9KC 4OKDA 1CDGA 5F44A 5F7KC 5IW3A 2MCPL 2QQQA 5IHUH 3AS1A 5CCKH 3NA9H 3RWIA 3W5NA 3BIBX 3KJ6L 4KJYB 3V95A 1EHLL 1RULH 4UNUA 3O9WB 3G04B 2AV7B 1DLFL 4GMSL 2Y07L 3MJ7A 2X4NB 5DI8A 1QFHA 3MOAL 3KPNA 4I77H 1JHKH 3N06B 2FR4A 1KJ2B 4YPGB 1WWCA 3FQNA 1BQHB 2FZ3B 4JPKH 1BFTA 3MPCA 2XACC 1KXTB 4XP9L 5I30H 5D7IE 4QGTA 4HS3B 4F7TB 1Z5LB 3K80A 2AK1H 4PD4K 2AEWA 5HHOD 3ZTJH 5DQ9A 3UPCA 2R8SH 3UJJL 1TNMA 5IMKA 4FXGA 4TRPH 3ECBA 3BPNC 2VABB 3IJHA 3RZCC 4PRIE 1MQ8A 3T65A 3KPSE 3ZDYF 3QUMB 3WFHB 4JN1H 4NQCB 1HKLH 3HPLB 2HLAB 3TO2A 4P2CG 1WIPA 4X5XA 4DVRL 2V7HA 2CJUL 4KUZH 3WFZA 1ZGLA 2YUVA 2OI9B 2O26U 3DX9A 1KLGA 3T2NH 4F9PA 3IDXL 5IVZA 3NZ8B 1HDMA 5C0IB 5L2JB 5CINL 2Z4QB 2M1KA 4HK0A 5F89A 1EEZB 1JZ2A 3MRQB 2D0HA 2YHGA 3HE7D 1CGYA 4P59H 1Q1JL 5E08L 2DQGH 1IBGH 2CKBH 4KKLD 1FVEA 32C2B 3VDBA 3NMEA 3RJDA 2DMKA 4PB9H 3SJVD 4IRJD 5INDB 4HMDA 5BS0E 1S9WA 3P73B 5GS0C 3DX6A 1F4XL 3TWCL 3BEWA 2XY2A 3FTGB 2EIEA 2CO7B 1OVZA 1IEBB 3ET9F 3WE6A 3P0VH 3DRTB 5FYJL 1IC4L 5DD5H 3LEVH 4UQ3B 2CLVA 4N0UE 2IFFL 5IG7A 3AVEA 3PHOA 1CGTA 2X1QA 2WQ8A 1WZKA 3P30L 4JRXE 5HDBF 3SKUD 2MNUA 4YX2L 1CWVA 2V2WB 5E70A 4UV7H 2VAAA 3OZ9L 1A7RH 1NGWA 2R9HD 3H3PL 4Y16D 1GZPB 5INCB 4U1JA 5FDWA 2NMSA 3HTLX 4XP4L 4WWKC 3VG9C 1UC6A 5FYKL 2UY7A 1TITA 1CIUA 1CBVH 4JDTH 1DQMH 4YGVB 5IR1A 4XMLH 4DQOH 3ARFB 4R7NB 2IADA 3GMMB 2LE9A 4CVXB 3VDAA 5CUSL 1AO7A 2P49B 4F9PC 2EEBA 3P0GB 1TXKA 1EEYB 2D4FA 3WUZA 1T7VA 3F6LA 1KIRB 3N1FC 3NGBB 1MFEL 4J3TA 1YUHB 1JWUB 12E8L 1E6JH 2X4QB 4ZUSA 2NLJA 3NCJL 4U6XA 2IAMA 1FC1A 1OSPL 3ALPA 5T1KD 3D18A 1AR1D 1RUPH 1S5IL 4P9MH 1KC5H 3VFNA 4HEME 1KCLA 3BJLA 2E9WA 4WW1A 2CXGA 2JB6B 4NNXB 2R2BA 3BAEH 2RIKA 2HT3C 5IV2B 2V7NA 5DC4B 2LVEA 5LQBL 4OZIA 4G42A 4MHHI 4ZSOE 4HDIA 5C09D 5TF1H 3OKOA 1C7SA 43CAB 1OF2B 4FHBD 2ZJSH 5DJ6B 5DVOA 3C2AL 4OGAC 1JTOA 2F54B 2ICEB 3IDYC 2F8VA 2VDKH 4X7CC 3VRIA 3D25B 1HILA 1J1PL 2CKBA 3AFLA 2X4PA 3EOBA 2WBJA 1PY9A 3MJ9L 2AJZA 2PF6A 1VEOA 4Q58C 1ERNA 4MCZB 1K4CB 2Z92B 4PJHF 5E9DA 3BGFC 2K3TA 4UUJB 5AG9A 2NY5H 4YAQA 1S5HB 3PV6B 3QUZC 4LSTL 5KSAD 2Y6SC 4G5ZH 4K8RL 4WV1A 5EU6A 6FABL 3UPAA 1LE5A 1A6ZA 3HMXL 4PJCE 3FB7A 4UBDC 1Q9OB 4PJ9D 1CFQA 4WHYH 2IAMC 2HJFB 4N5ED 1QNZH 2D7TL 2FIKB 5IF0A 1Y6NR 5HHMD 3DMMD 3VFMA 2IGFL 5JOFB 4GAJL 4PJEE 2DIAA 2GW5A 4JCMA 1DQLL 3A6BH 3RX7A 3P77A 1EJOH 2C1OA 4NO0A 2QHRL 5F1NA 4Q0XL 2W38A 4UOW0 4LHQB 5DJDB 3SGEH 3E6FB 2BSRB 1V3JA 1H3XA 2VL5B 3LKOA 1B90A 2P4AB 1NUGA 2YRZA 3SDDB 3ULUE 4DVBA 4H88L 1WBYA 2NY3C 3GSNH 4B7IA 1XH3A 2FJHB 5E6IB 1MJ7H 4G8EB 1TVBA 3HAEG 4PJBF 3BRGC 3IKCB 1YN7A 4CDHA 3SDXF 3TO4B 2WBJC 3G6AA 4HUMB 3TZVA 1FFOA 4IS6B 4YWGL 2FIRT 3KHOA 3MTRA 1H15A 3CFCL 5MENA 1A0QL 2J12B 3EBAA 4YXHH 3MGOA 1ED3B 1ZXQA 3D39B 4L3CB 1MNUH 2P5EA 3VXSB 5A16A 3RI5F 4U0QB 3EO1A 4N90D 4AG4L 2E8YA 3HNSL 3UC0L 4WV1C 1N0XL 3C5JB 1FNSH 1B4RA 4MJIB 1RHFA 4OI9A 5KS9B 1AJ7L 3VU2A 4GRLD 3P4NB 2Z31B 4KI5D 4ZOCA 3DHJA 1E4WH 4JHBA 1BZ7B 1G0YR 1NCAL 2J1KA 5F70A 4DUWA 2ZSVB 2YSSB 1SHMA 4MB5A 5KAQF 5E2WH 4LSUL 5GHWH 3MRBA 5ERWB 3AAZA 4K7FA 3N85H 4U1HA 3U0TB 1V7NH 5C0JA 1BZ9A 5HHOB 1J8KA 5E2TL 1YEFL 3HB3C 5FECA 3OF6A 1U3HA 4YHYB 3TPUB 1K8DB 1CTOA 4V2BA 5D1XC 4GG6F 1RV6X 4KRPC 4ZDHA 4MXWH 5EH1A 2AP2A 5D5MF 4J3XA 2NY0D 3O3EB 5ID1A 4ZUTA 1P5VA 4I0PD 2JK5B 4FP8H 3O6MH 5EOTB 3IDNA 2WUCL 5F1KC 4GRMB 4F7EA 1I4FA 3BZFB 1HHKA 3O3UN 1UENA 3D0VB 2WZPD 3V6OA 3FRPG 2EKSB 2D03L 2AABH 4U33A 5BZWA 5C3TA 4R26L 2NY7L 5DD6B 3HC3L 5EO9A 2DKSA 1HN1A 4KKCC 1WCBB 2FLRT 2APTA 3GSNA 4M3KB 3TCXA 4JB9L 3W39A 2CKNA 1E4XL 4ODHH 1F3DJ 5SX4I 1WICA 3GMPA 1XCTA 3OGCA 4NUGL 2ZZUT 4KC3B 5I76B 1E4XI 1YN6A 3Q5YA 5I18H 1WZ1H 4CADA 1GGYA 1WQVT 2PKDA 4HJGA 1RFDH 3T0WA 3I6LD 2VSCA 4X4XA 3N1GC 5ILTL 1OTSD 4LSPL 4LMQE 3ZDXF 35C8L 2NY5C 2VXTH 1AO7E 1SEQH 2WP3T 1EEQA 1WISA 3P9WB 3TNNA 5CEZE 4O9HH 4BKLB 5DEFB 1A3RH 3EDFA 1U3HC 2Q3AA 5E8DL 1IAMA 5CBAA 4E42A 1DBMH 1EFXD 2BVYA 4ZUVB 3VGEA 3VFSA 5FCSH 3L5XL 1LE9A 4HQQL 3MXVH 4GLRI 1NEZG 1ZK9A 5DUMH 3MBEA 1FNEA 1S7UB 5E6YA 1DQQA 2DLFL 3JV5A 2VDPH 1FZJA 3LS4L 4JN2B 3L1OL 2ICWI 5I8OH 1Q9WA 1ZV5A 2ADIA 3KPLA 1I9JL 5JIKA 4OZ4B 5KANG 5JPNA 1D5ZB 3E8UL 4XAKD 4DZBB 1OAKL 1YNKL 1RZKL 4LFHG 4P5TD 4BUGA 4EDXB 1XGTA 3O6LL 2HFGL 4OZGB 1PDKA 2QJDA 1TLKA 5I75B 4BZ2H 3ZSSA 3NH7H 3BXNB 4WRLA 3S5LB 3TT3H 4R7DA 5GRXG 1NSNL 3QBTB 5E03A 1T21A 2BRQA 2PO6B 1YEIL 5KVEL 4PJDF 5HDQH 1JF5A 3WFBH 3EYVB 3QWRD 1UB6A 5DURB 4NDMB 4K3HA 4RRPA 1KEML 3JV6B 4P2OB 3CZFA 4LLVB 4R96B 3BGMA 4ONOA 4ZYKA 4MXVE 3LRSA 4JM4H 2BNRB 2NXZD 5B38A 3PL6A 1FFPA 4MD4B 2P8PB 3Q3GA 3JBG7 4XP5L 2VN7A 3S3JA 3PWNA 3EKCA 2BVPB 3SGDI 2X10A 3SGJA 2H6PA 3ES6B 3VXMA 4FQQA 3MJ8A 3TV3H 3BZ4A 3MBEC 1WAAE 1VFAA 1YEDA 3I02B 5IJKA 3RTQD 2XWTB 1A47A 3BFOA 1NLBH 1X5IA 3BWAB 4ZOEA 1U8LA 2VQTA 3I6KA 3FOLA 1HQ4A 2EYRB 4L3AA 4JKMA 3HR5A 1R3KB 3ELAT 1HI6B 4DGYL 1PX4A 3VXQB 5JIIA 3UO1H 2EIBA 3LKNA 2VTFA 3FAWA 3RNKB 4PGBA 5GZNC 5F1OB 3NIDF 4HC1L 2CGRH 1P9MA 5IP4A 4KJPD 4C54A 4JO2H 2ZUVA 5BVPH 4M48L 2IF7A 5HHMB 3DMMB 3E3QC 3HLAA 4UT9L 5IEHA 1L6XA 5IOPB 5JOPD 5DT1H 4QRQA 1QFOA 4EI6A 5FEBA 5SWSB 1A3QA 1KLFA 1OP5K 5C0FA 3QPXH 2ZPKH 2P5EE 3EJYC 4PJHA 3FHAA 4EOWH 2KDGA 1QA9B 4WTXA 1PZUB 4HUKB 4WUUB 1AQDB 4XNXL 4PJ5B 4N8VG 1VFBA 2XWJB 1V5JA 3V4VH 1FNGA 1T0PB 3G5VA 3PL6C 1NGXB 2ZWLT 1K6QH 2GJZA 2UVFA 2BC4B 3S37H 1XGYL 3QUXA 2EDDA 3DXAD 5JUEL 3BESR 1YPZB 2A2QT 3SGJC 3KLAB 4JEGB 2JIXB 5FYLH 5F9WB 1QSEB 5IM7A 4HBQA 5LGJB 1A9BB 1EO5A 3IJYB 5D9SA 3WNPA 1FV1B 2X1XR 1BGXH 1DANT 5D1QA 2CLZA 4XP6H 3L9RB 3NCBB 2WINB 4XBGA 3X11A 1OW0C 3F5WA 2NY1C 3TBSB 1QSFE 5DJ8B 5CHNB 3VXUD 3HKFA 5I17A 1KYOJ 2VISA 1PLGH 2NXYD 3D3VB 1M05B 3E6HA 4ALAH 4OTXH 3K74B 4J3WA 1P9MC 4H8WH 2Q6WA 3B9EA 5L8JB 4ODVL 4NQDB 1JWMB 3CDYA 3QXWA 4HAFA 1MLCA 2HWZH 3ZT7A 5K9QG 4PJBA 3R0NA 3DIFB 5I1EL 4L29A 3RNQB 1FPTH 3RPKA 2MMXA 1DUZA 1DN2A 3V0VB 1ZT1B 1J1OL 3OKKA 5EUKB 4LVNB 1EPFA 2JF1A 2HKHH 1BQLH 2NPLX 5HGDA 3GJFH 1XR9A 5D7LA 4KGLA 1K4DB 2HT2C 1JTPA 3HUJB 4XC1L 1XGUB 2M2DA 3MOBL 4Y2DD 3BP4A 3PWLB 3UAJD 3QHZL 4X4YA 1FLRL 1EZVX 1P4LB 3QUXC 3HE6A 4HLZG 2E7LC 1UH3A 4P4KD 4WHTA 1CFNA 1AGFA 1R5IB 3CXHJ 3INUH 1BBJB 4QF1A 3LSOB 2RBLA 2CDFA 3RP1A 5GS1A 5JR1H 2WMPA 1CTNA 2YEZA 5D1QC 2WWMC 4MAYC 4V2CB 5FHAL 5D7JA 4BSWB 3IXAB 4NPYA 3SE9L 4U6YB 1CICB 3CPLB 1NFIA 4PJAF 1P2CA 3H7BA 1P84K 3FRUB 3U7WH 5IBLD 1SJHB 1Q94A 4QRRB 5DQJA 5ECJE 4AEHH 4C56D 3HHRB 1FL5B 3DROA 1J0HA 1OLZA 3HZKA 5H94A 1YY9C 4XCNB 5HDOA 3MLZH 4KK9D 4ODWA 4GG6A 1EZVY 3UJIL 4Z7VE 3Q0HA 2G2RA 4RBPK 5C0BD 5JO5B 4R0LB 4L4TE 2HLFD 5D5MA 5EOCJ 4JGMA 4RGNC 4UI2A 1EAPA 4PGJA 2L4OA 3LQMA 5C9JA 1I8KA 3GSOB 4KXZH 1EMTH 2V9QA 3ARDD 2JCCF 3MLPA 2G9HA 2A6IA 3QDMA 4M8VA 3WXVH 4BSJA 1FNLA 2IBZX 1MCCA 1UWXK 2FJFB 2H8PB 3DVIA 3IYLW 1MFAL 2XZCL 1NCCH 1KULA 3ARGD 5DJXA 4LLMA 1ONQB 5IESL 3O2WL 1ADQH 2OSLA 4O2FB 5HHPA 4ZG1A 5HDBE 4G6KH 2VLMD 3HE6C 1ZLVK 4RWYL 3RKDD 3S96B 3ZL4H 3CFIC 4ONFL 1T4KB 5F1SA 1HCVA 5DK2B 1LP9E 2AEIT 1OD9A 3TN0D 4ORZC 4NWTL 1JP5A 1JPTH 2IPTL 2VQUA 2YUXA 4YDKH 1EAJA 3TA3A 1N3NA 5GS1C 3D9AH 1YYLH 3U0PB 4QXGH 5C07B 3O3BA 2BSSB 3LEXB 4KTDH 4PLNC 1A7QL 1B0GA 5D7JC 3BE1L 3HZYA 3GJFA 2IBZY 5D93C 3MLUH 1CS6A 3G5ZB 2ATKA 3ROOB 5C71A 4FQIH 3GGWA 3WIHL 2BOCB 3LQAH 4GAYA 3TYFA 5ICYA 4LCUB 4DFHA 1ETZB 1W2KT 3H3KA 1BAFL 1AD0A 2J8UF 4G3YH 1OAUH 4X4ZA 4YNYB 2P5WD 4Z0BH 5KANI 1KLUB 3LKRB 5FB8B 3QIWD 1BZQK 1AXSA 1GGCH 1AKJD 2AEQH 2PTVA 3OR7A 3VFOA 3FL7A 4J4PC 5HPOA 3GSRA 1I3VA 1A7PL 3HNVH 3PV7A 4E41D 5I73B 5BCAA 3VMPA 1MREH 2NNAA 4XBPA 1NGYA 4DCQA 1GVIA 4J7RA 1FZOA 1FGNL 5ADPL 2OL3L 1FO0H 4Z7UB 4XX1G 5BJTA 2C5DC 3OWEA 5BV7L 4H8WC 1QLFA 1GSMA 5HYFA 2VXVH 2A77H 4G9FA 5EC1B 2BDNH 3H9YA 2ITCB 5E5RB 2XN9D 1DFBH 1FL3A 3BPCA 1PZ5A 3WLBB 3IU4H 2NYYD 5DK3A 2DQDH 3TA3C 2YN5A 1EGJH 4U6HB 4JZOA 1U8HB 2Q86A 4PJDA 5FM5M 5IB2A 5E99L 4KMTL 5IIEB 1Q0XL 5HVHC 4PRDB 4RNRB 1F4WH 2QBWA 5D8JL 1UCTA 1GZQB 1KJVB 1MPAL 3LS5L 4R9HA 2BY2A 4KVCH 4Y1AB 1ADQA 4N9OB 3UBXB 5F7YC 3T0BA 4NKDA 4YHOH 5HYJE 4GXUN 3QO0A 4NKIH 4J3SA 3BP5B 1G7MA 4AEIH 4H0HB 4HJJL 5I8CB 4TVPH 5EUOF 4U3HA 4OM0H 2X40A 1JMXA 3FQUB 1YEHH 4M6NL 4IJ3C 5T3ZH 2IBGA 1WIUA 2VZSA 4OIBA 4GW1B 4WHDA 2Z35A 1MJUH 1Y6MR 5GS2H 3I9GH 1KIUA 1W72B 4PGZA 3REVA 1JZ5A 3VDCA 4Y19B 1KN4L 5SV4A 4M7ZC 1NAKL 4QRPA 3T2OA 1TZGH 3VCLA 1JZ4A 4HZLA 1UJTA 1KEGL 5EO0A 2YD6A 3KGRA 3P4OA 3W9EB 4MNQB 4PUBH 4RGNE 1DEEB 1VENA 5I1IL 3F7PC 4JFHD 4FFWD 3SDXE 1BIIB 3MRHA 4KVNL 2CIKB 3RVUD 1BOYA 1WC7A 1D5MA 4UZGA 3HI1A 4HV8A 1QKZH 1R3HB 5DJZB 4L8CB 4L5FH 5GGRA 5J6HB 4HF5H 2GAZA 4HH9B 1JPSL 2XOTA 4AJ0A 2DQIH 3BDXA 4Q6IA 1RQ5A 2NY6B 3DX8B 2NXYB 4M6ML 1FO0A 1AR2A 1CE6A 3FOMA 3IFOB 2GSGA 2VLLA 2X09A 4NKMB 3AUVA 5DR5H 5K59E 3HMWH 43C9A 1YJDH 1UXWA 1R5VB 2PETA 4YC2B 1NGPH 2IPKB 5HGAA 4LARH 5T1LA 3BPOC 2D7PA 4X9BA 4D2NA 4FTVB 4OBSA 3DNKA 1CZ8H 1UWEH 1A6TB 3BYTA 4KQ4L 3Q5OA 2W0PA 2E6JA 4MA8L 3L6FB 1C08B 3N9GH 4LLYA 4MQSB 1G7HA 1I7UB 3GDBA 1S9YB 3LOWA 1IC1A 5DUBA 1S9VB 4Z78B 1H3GA 1MCWM 3NFPB 5K9QI 1KELL 3CFBB 2Y4SA 5DC0A 3LQAC 1A4KA 2V5RA 1IKFL 1HHGA 3GMQA 1DSFH 1HH9B 2VZOA 1JF1B 2VLKD 3IT8D 1EDQA 3W0WE 1MHCB 2HTKC 3GSQB 3LIZH 4FOMA 4R2GC 2D3VA 4L9LA 3ZT5A 3BH9B 5J4MA 2O5ZH 3QDAA 4NC0B 5J6GB 1LO0L 5C2BL 3O6FA 5ID0A 4A2MA 2X6MA 2YPLE 4JFDE 4G9DA 4CN1A 4OLEA 2X1PA 1XEDA 3Q6FA 3VJ6B 3BD3A 4Q2ZB 5HHVH 3RY4A 4Q6IC 2FD6L 2IFGA 3ZKXC 1NCWH 4NRYA 3V5KA 4N1EA 5DTFA 4LVHC 2DL9A 1CDBA 3IDJB 3UTTA 1J8HB 3DPBA 4Y4FA 3SCMC 5GGSB 1MH5A 5A1AA 4XPFL 5C0EA 4J12A 4KROC 1FC2D 1FE8L 1HSBA 1YEKH 4RAUB 4TUKL 4PLJC 1OTUD 5F7DB 5IQ7L 2W9EL 4N0YL 3CSPA 4MB4A 2J7LA 3P9LB 4LCWE 3OKEB 4Z76B 1ZT7B 2ZNXA 4K2UL 3SKJL 1PFCA 5JHLL 4OGXL 3FQWB 4NYLA 2O5YH 1PSKL 3KS0J 1YYML 2VERN 4X6FA 3LRHA 3OL2A 4JQIL 1T2QH 3W11C 5I1LA 1U42A 5M7QA 3U6RB 2HH0H 1S7TB 5GGRY 4PJAA 3QAZC 5TDPA 4PRID 5EWIL 3GRWL 1TJHH 1A22B 1P4IL 5CGYD 1JJUA 4YE4L 5D7SL 3AXLB 5TF0A 2MSPA 4ONHB 1RJZA 3NABH 3AS0A 4I2XE 1T7YA 3EDDA 4I4WA 3U4EA 4S10A 4M62L 1J12A 4N8CL 3S34L 3TT1L 5MEQA 3OSKA 4YHZH 1XMWA 3MRKA 4X7EC 1LQSR 3K2MC 4NWUL 1HXYB 3TFKD 2CUIA 1CL7L 4AM0B 1RZFL 2XWBB 1IM9A 2CLRB 3X13B 3S3PA 1J0YA 1CR9L 1U8JA 5EU3B 4MSWA 3C6SA 4JFEE 1CL7I 1A4JA 2IANB 4Y4FC 1ZTXH 5TFSH 4BFIB 1P7QB 1ACYL 1VGKA 3VD3A 4WO4A 3CK0L 1QFUL 1C16A 4B50A 3QXUA 1JVKA 1IGFH 3H9SB 1MFCH 3MMEB 3QIWB 2YKLH 1LHZA 4LRNH 5BS0D 2YK1H 3EYUL 2I9LB 4YK4C 3QIUD 4MWFB 5ALCL 3EOAA 1I9EA 2ZOLB 1J9CT 5F3HA 3D1MC 1XGQA 3WHXB 1FZKB 1SM3L 4C58B 1ZE3C 2AS5M 4WNQB 2VZTA 3IFPB 4R6UA 5LBSH 5IMLA 5KSVB 4RCAA 1HYSD 2E6QA 4JRXD 5T1DL 4D9RD 1ES0A 3K0WA 5FFLA 3F6IA 1H3PL 2EH8H 3GZKA 1IGTB 3L3KB 3KYAA 2VDRH 2XTJD 4QHLB 1QYGL 3CVHB 2BMKA 5CILL 1YJDC 2Y06H 3QH3B 3RVVC 5LJYH 2LTQB 3ZDZE 4RFNC 5DJCB 4IMLB 1RZ7L 3VWKB 3THMH 4ODUB 3WJLA 4UAOB 5LGHL 2VLRE 1J0IA 3WCYA 4ODTL 4G8GE 5GRUH 1SYSA 3G6DL 1FIGH 5DJ2B 2AK4B 2YA2A 4JY6A 3TPKA 4XPGL 2P8LA 5IBUB 2CK0L 4DOHB 4ZQKA 4PRBA 5FUCE 3WKMH 4XPTH 2OLDA 2Q8AL 1U8KB 3CFKB 3SE4A 3UXFA 4GMSH 1ZANL 4JO4L 2FGWL 4QRPE 3BIKB 5F72S 1WFOA 4K3EL 4PB0L 2D7QA 1F58H 3PWUA 5EA0L 2O93L 2KZWA 3D85A 4JM2B 4P2RA 4WO4C 3RWDA 4EI5A 4U4BA 1FYTE 4NIKB 1MLBA 1DVFD 4LIQL 2DTSA 5EB9A 5BXFA 3QP3A 1IAIH 1J05B 4QHMA 2B5IB 4YHIB 4F7MA 4WI6A 1JNNH 3A6OA 2OP4L 4MS8C 5DJ0A 2HRPH 4IOIB 4UINH 1NAMB 4D9LH 1MWAB 3QUML 3GNMH 4OF8A 1B0RA 1SY6A 3GHEH 4OD3L 5E2UL 2R0ZL 5JHDD 3S88H 2R0LH 5ENWB 3U1SH 4JKPH 1KCSH 2ZUQB 3K2UL 1IVLA 1U9KA 4PP1C 4OLZH 4ZMAT 3ILPB 1ZHNA 4OM1L 3BH8B 3RDTB 4EUPH 5HI5C 1WGOA 4NCC2 2W60B 3K3QA 4GBXB 3WJLC 1H3VA 5CINH 4KK5C 1S7VA 3FAXA 2XI9A 1Z2KA 5EUOA 4MX7B 1S7RA 5IB5B 1DBBH 5J1AA 3OKNA 1WWWX 4WU7A 1D5IH 5JDJA 3WSQH 1G6RB 4PJ8A 1T89A 5FK9B 3QFJD 5KG9B 1OY3B 2J88L 4M61B 4JANA 1U8OB 4Y4HA 3SE4C 1JGEA 3KPOA 1QRNB 3ISWA 5CBEA 1G7QB 1TFHA 1F4XH 1CGXA 5DD1L 5SWZB 2I26N 5IEKB 4JY4A 4G43B 2FO4A 3RIAK 4TVPE 1D5BA 1T1YA 2Z8RA 3KJ4B 1I1YA 3T0EA 4JFQB 3QEQB 1R0AL 5AZEL 3QQ9C 4KTEH 4NO2A 4F33B 2ENSA 4GKZA 3RU8H 4YX2H 1AC0A 4L8SB 5EDXA 4MJ6A 2R56H 5C0CE 2APVA 4APQA 3PABB 1KPRA 3DUUB 3DLQR 1QPXA 3ULUD 5I16B 4YEEA 4ZFGL 4XWGL 4NNYA 1UXSB 4RDQG 4H5SA 4FZEL 5EU7C 2XICA 4HK3N 3BGAA 1KJMB 2ESVB 3G04A 5CUSH 5J11C 3ZKNC 3ARED 2DQJH 4S0TD 5DA0B 5I0ZA 5JXAH 3T0VA 3PQYA 3QI9B 4X6EB 1EBPA 1KJ2A 2FCBA 1MFEH 4YPGA 4ZPTB 1BQHA 2FZ3A 3F7VB 4I3SH 3S8WA 4PJGB 3MRDB 1CGSH 4F7TA 4PJ8C 3S7GA 1Z5LA 3PDDA 2ZOKA 5EZOL 3FB5B 4Y4HC 1AI1H 1ULVA 5IB3A 2OYPA 5KN5B 2CRIA 4AH2B 1KIPA 4NO5A 4H1LH 4PY8J 4OIIL 3QCVH 3DRQB 2ZUTA 4E0RB 2Q7NA 3DGGA 4FG6D 1JNLL 4HT1L 4LHJB 4GSDL 4IRSD 4TUOB 5F9DC 3SQOL 4U1KB 4KFZC 2Z91A 4EUPA 2R1YA 3RGHA 5GRJH 3O2DL 3PHQA 1UM4L 4PBXA 4P2QE 3T0EC 1MAKA 4OLYH 3V5HB 1F4AA 4X99B 2JCCE 5EBWB 4M1DL 2FECL 1DDHB 4NZDA 2VC2H 5KSBB 3MLVL 2HJLA 4APQC 1T7WA 3I50L 5L2JA 1E6OL 1HH6B 4FXKB 4M5ZL 2Z4QA 4JG0H 1X5ZA 2FECI 1EEZA 3MUGA 3MO1A 2XZZA 4PRPA 5J06A 1A7NH 1IGIH 3PP4L 3VW3L 3KPSB 1D6EA 3O45B 3S35H 3C9NA 2R29H 3CU1A 3VXPB 32C2A 3O4LA 1NPUA 1C5BH 1Y18A 2IALB 2VLJE 2R1WB 1C1EL 3F8UB 1S78C 4LSVH 1PEWA 3BHBA 1TTGA 4L4VE 4RAVA 3FTGA 3P4MA 5MI0C 4AK1A 3OJDB 3QJHA 1RK1B 4RWHA 1AGEA 5GRVL 4R3SB 4XZUA 4HKZA 2YN3A 1QG3A 4WFFE 3PGDB 5T1MA 1NBYA 3LY6A 1QO3A 1BVKB 3QPQC 5I6XC 5GJTH 1G1YA 4X4ME 2LU4A 2GCYB 5FCUL 5F3BB 2BSTB 3IRZA 2J8UE 2PYFA 3QIUB 1CN4A 3KG5A 5DUPH 5AD0A 2ATPA 2ORBH 4YGVA 4PJFF 4DGVL 3PP3K 3ARFA 2BNQE 4IDLA 3LD8C 4N0UB 3FQTB 4NN5B 4AQ1B 4CVXA 1RIHH 3RL2B 2WAHA 3RPIB 3ARBD 1NDGB 1XAUA 4F9LA 2XA8L 1MQKH 1EEYA 4PJIE 4IM8A 2FX8H 5DO2C 4H1LA 1TJGH 4OF3A 1JPST 4ZS6C 3U48A 4BJLA 1ZA6A 3MXWL 1DBJH 2HMIC 3EFFB 5ELIA 3B3IB 5DEGA 1OP5H 4WUKL 3MRNB 1JGLL 4JLRB 3UC0H 3V7AG 3V5DB 4A6YB 4NNXA 1ORSB 2F53A 4PRHE 3VFGL 3DV4A 5IV2A 4E5XB 5F6IB 3MV7E 4NC1C 4L3EE 3GMOA 3LQZB 2C26A 1BFVH 4KKBC 4OJFH 1A5FL 3IKKA 3H2WA 4FMKA 4HBCL 4L8BB 5HJ3B 1KB5H 3AS2A 3WBDA 1PEZA 2VH5H 4G8FB 1RUAL 43CAA 1GAFH 2H32H 3ZYOA 1HXMB 1OF2A 2VKXA 4LCYA 3VH8G 4JZJC 2X9WA 5KSUB 2ICEA 1AE6H 4FQLH 3IETA 4XCFL 1NMBL 5HHQB 3D25A 2AV1B 3SY0B 3VFVA 4OSUL 4ZTPL 3VRLE 3P11H 1RK0A 2CR3A 5EOCH 4NM8L 1IC5H 1JI2A 5E2TH 1YEFH 4MNHA 4AYFA 4UT6H 5C1MB 2AXFA 5FA4B 4MCZA 1K4CA 4I5BA 3RGVB 1PQZA 2Z92A 5C6WH 1D9KB 4GJTB 1OLLA 4YBQD 1IGMH 2X2YA 5CGTA 4CU7A 4M6AA 4MLSA 3JWNC 3DO7B 1CXIA 1S5HA 2FWOB 4FQXD 4F9LC 4ELME 4QOKE 3KPRE 4D3CH 5A3IC 4CMHC 1J7VR 4TOYH 3VFTB 2MFNA 5CJOH 2XNAB 1XR8B 2Y25A 5E5UB 1UYWH 5JOEA 3MRRB 2GJ6E 4OUUA 2OMBA 2XQBL 1Q9OA 3JTSB 4PLKC 2DQHL 4GAGL 4D0BA 5M94B 1RZGB 2HJFA 1IL1B 1ZLUK 2QHLA 1P4BL 4P23A 4MA7H 1DQJB 3BIAX 3HC3H 3MACH 4EDWL 3QFDA 5SX4H 4X6CE 2NZ9D 4Z7WF 4RFEA 5J0BA 4JZNB 4NJAL 1I9RL 5L7XH 5K93A 3FCTB 3EYFA 2BSRA 4KAQL 4C83B 3C5ZD 3RZCB 3ARZA 2G75A 3R4DA 4KI5F 4OCYH 2XPGB 4O4YH 5E2JA 2FJHA 1BD2A 5ANME 4RISL 2D2OA 4S1DD 4G8EA 4W6XB 5IWLA 3FO0H 4PRNB 3L7FB 35C8H 4PJEB 4QRTB 3S35X 4JFYB 3TO4A 2L7UA 2AEPH 5FUOL 5H37G 4Z7OE 4OBRA 3SPVA 4K8RC 3TIDB 4WW2C 1N4XH 2W91A 1U8NB 4CNIA 3LMJL 5E8DH 1ED3A 1NLDH 5AYUL 4LHUA 2NZIA 1KB5A 3VXSA 3S36H 4GLRH 5FM4A 5IVOA 2RQ8A 3QDGD 2H32A 3L5XH 3QISA 3OAZK 4HQQH 3I2CL 3LZFL 5TE6L 1N5YH 3ZKMD 3C5JA 4MJIA 3WL9A 4V1DE 5KS9A 4Q9BA 2WNGA 3RBGA 4RBPH 1ZGLP 3LS4H 3MJ7B 3PWPE 3L1OH 2XFXB 4WFGE 4WEUD 5E24E 4NHCL 5DI8B 1IEHA 2FHCA 2A74A 3FQNB 4P23C 4POZC 4RGMC 5KVDH 5LXGH 1UWXH 1OAKH 4F80A 5J1TC 3CH1A 2HFGH 1RVFH 3U0TA 2AJYH 1QSFD 5EU5B 5HHOA 1K9TA 4FXGB 3OKMB 3ECBB 3IJHB 2OK0L 2CRZA 1ZLVH 1K8DA 3T65B 4WWKB 3VG9B 2H41A 3MUJA 5ACZB 5JW5A 1QOKA 4IDJL 5FYJE 4YUEH 3O4LE 1MCBA 1KEMH 3TO2B 3VXRD 4X5XB 3ARRA 3CUPA 2JK5A 2B0SL 5EIIA 1ZGLB 4GRMA 1VKXA 1NBZB 5IVZB 4NC1E 4NQED 1MFDH 4PY7A 1MUJB 5H35B 4GXVL 1ND0B 5C0AD 2VXUL 4HK0B 4TNWK 5F89B 5I8EA 5FYKE 5GGVL 3IRPX 1WCBA 3LH2L 4XAWH 4P3DA 3FFCD 3UTOA 4D0CB 3HE7A 3LEYH 4UT7L 2QSTA 4OLXL 4M8QB 3U7YL 1BREA 1FHGA 2NY4D 4IRJA 1NFDE 1XIWD 3DX6B 1KTRL 4YHPA 5L8LB 1FYHB 4UU9B 3WE6B 4G7YH 1Q9LB 4FFVD 2OR9H 1PG7L 5IG7B 3PHOB 2PUQT 1T2XA 4HC1H 5DEZA 3UP1A 1OOAA 3IDYB 1NMAH 2NX5E 3H7LA 3KYMB 3L5JA 4HH8A 5EPMA 3QCTL 4UT9H 3C87A 4M7JH 4U1JB 1YMHB 1TCRA 4XNUL 4Y16A 5EN2A 5FDWB 2CMRL 4NC2B 5IHLB 1S9KC 4U3CA 1I7ZB 4L4TD 5IR1B 1BX2A 2W65A 2IADB 1RUQH 3MBXL 2QKIB 4HXBL 4Y89A 4XNXH 1S7UA 4LSSL 1AO7B 4X83A 1UWGL 3QUZB 2OJEA 4MDIA 1D7FA 3ARBB 1L0YA 3FT2A 3IDIA 3B4NA 1RIUH 3SBWA 3V8OA 4OB5L 2VDNL 1D5ZA 4O5LL 4QHNA 1IJ9A 1R3IL 4ZUSB 3R1GH 3QDJE 2NLJB 4ZO9A 4BSVA 3HE7C 1CF8L 3WUWG 4U6XB 1L0QA 4JRYE 2IAMB 4EDXA 3D18B 4S1QL 3HAEH 5HI4D 3VFNB 2APBA 4KKLC 4KJQD 5ESAB 4WW1B 3B9AA 3BXNA 1UACL 4B41A 4IRJC 3S5LA 1QZ1A 2R2BB 2DKUA 3V6FB 2V7NB 2YUZA 4OZIB 3RVTD 2PO6A 2AJVL 3HG1D 4G42B 4HDIB 4OT1L 1NGQL 3NTCL 3OKOB 2NY3B 4K9EL 4F7CA 1T03H 2BRRH 5IMMB 4Q9QL 1NC2D 3VRIB 3S36X 4MD4A 3SKOA 2P8PA 2CKBB 5I1EH 4Y16C 4HWBH 1AXIB 2R9HC 3Q6GL 2R15A 1E4KA 2BVPA 3UX9B 5IVXF 2AJZB 3NN8B 1J1OH 3JV4A 2B1HL 1JZ8A 4XVTH 4OCXL 3FJTA 5E9DB 1BJMA 1QFWH 1G9NL 3I02A 1T1XB 3DVGB 1F6LL 2A6KA 1X5HA 4DGIH 2GYSA 3SBWC 5KSAA 4WV1B 5EU6B 3OKLA 1LE5B 1A6PA 2R4RH 1OL0A 1R3KA 2D7MA 1HI6A 1X5FA 3UROR 1HK6A 1T7ZA 3VXQA 5IBTH 1CFQB 4NSKB 5I1KL 3T04D 5IF0B 2BOBB 4WI2A 4PJ9A 1SEBA 4HPYL 2EKJA 5I75C 5B4MD 1AR1C 3X3GH 3DMMA 2A9NL 3FMGL 3SE9H 3JWDH 1Z9LA 5TQ2H 4M9PA 4J1UA 4QHKI 2WQRA 4XPBH 1I3UA 5C8JB 3LKOB 5HYSA 3QXDB 1MRDH 4HIEB 1QA9A 1WBYB 4WUUA 5D1XB 4CU8A 1IARB 4PJ5A 5E8PA 3TM6A 2XWJA 4KRPB 3GHBH 2V6HA 3GBNL 3VWJD 1NGXA 1TVBB 4H20L 1XFPA 3E1F1 2BC4A 1LO4L 1E4KC 2Q3ZA 1ACZA 1FFOB 3WFEH 4OCSL 3F62A 3QG6A 5IMOA 2NY2D 2PYEE 4LPYA 5MENB 2FX9L 2OXHA 4LDLB 1MFAH 2XZCH 3NCFB 3S4SB 2JIXA 1EHXA 4CAGA 2P5EB 1JI1A 1A9BA 5A16B 1MAMH 5IESH 3EO1B 2VZVA 4Z7WA 1Q0YH 1ZVSB 3OR6A 1B9ZA 5KSAC 3TCLA 4G6MH 5FO9A 3U4BH 2APWA 4JHWH 3UPRA 3TBSA 5DJ8A 1AP2A 4QT5B 3O4OC 5CHNA 4DKEH 3O3AA 1O0VA 3RIAF 4HWBA 3FT4B 5DD3H 3RVWD 3UCRA 3OB0K 1RJLA 3P4LA 4KHXH 4PJ9C 4N5EC 4NQDA 1JWMA 3DMMC 3ZE0F 4BH8B 4LASH 4G6JL 4OLUL 2GTZB 5GS3A 3DIFA 3MYJA 3RNQA 4M7LH 5I8KH 4U1HB 4K7FB 3Q5TA 1QBLL 3KWWB 5C0JB 1BZ9B 1R24A 3RZWA 4UB0L 3AM8A 3WIHH 1ZT1A 4W81A 5EUKA 1EO8L 1U3HB 1GGIL 2R4SL 3NCEB 1BAFH 5D1ZB 1K4DA 3HUJA 4HKJB 4TQEH 1KBGH 4NT6B 1P4LA 5ID1B 1VERA 4ZUTB 1DBAL 1NGZA 3SJVE 3IDNB 1LNUB 2FB4H 1R5IA 2FATH 2JJTC 3ESVF 2L0DA 3QXVA 2X4RA 3IAPA 5F9WC 3KLDA 1X5LA 1IQWL 1HYRC 4HX1B 3L3OB 1GC1L 2OL3H 2C4FT 4HGMA 5BV7H 3GM8A 3VE0B 3GSNB 3IXAA 3W39B 5I1JL 5IBUG 3I3DA 4MXQD 3FRUA 5E1AA 3MRMA 3GMPB 1SJHA 1XCTB 3OGCB 2HTLD 4GRLC 2UWEE 4KI5C 4WCYL 2Z8SA 1YN6B 3W0WD 2Y5EA 4X7SL 5I1HL 1XIWB 4CADB 5E8NA 1EVTC 4OLWH 5DWUL 2BCKB 1EJ6A 3WNOA 2GQHA 1VPOL 5JO5A 4KMTH 4X4XB 2YXFA 1B0WA 2X70A 4LSQH 2VDML 1MPAH 3GSOA 2YPKA 3G5YB 4HUUA 3GIZH 3PWVA 4JFDD 5DJYB 1DBKH 3TNNB 3QSKB 4LVNC 5DZNA 5CZVL 1DE4A 1H5BC 4LLWA 4X80H 3HNTH 4E9LA 1OP9A 5KVMC 2W9DH 2MCG1 3GI9H 4E42B 1MHPH 1N6QH 5B8CA 5HYQB 4JFFD 4O2FA 3V79C 4I9WD 1LE9B 1EFXA 1KOAA 3V0WL 3J7HA 3ME0A 1I85A 2NY0C 3S96A 3MBEB 4LCWD 1FSKC 1T4KA 1DQQB 4HWEL 5K9OB 3JWDC 2C3WA 5KTEH 1VB9A 1S7XB 3KPLB 1WUNT 2ADIB 1NAKH 1QLRA 4PJFE 5E6ZA 4WI5A 5DVKA 5JPNB 2BSSA 4JFZH 3LEXA 1KCUL 5C09E 3KYKH 4HS8L 1N6VA 4QXUH 4HFUH 1XGTB 3WJJA 3G5ZA 4ZNEA 2EDKA 3ARWA 2JJUA 3EJJX 1IFHL 2R0WL 4BQ8A 5KJRH 3LV3A 2BK8A 3DV6A 3N1MC 2Q76A 3CFJA 2BOCA 4BZYA 1LP9B 1OQOA 4R7DB 1ETZA 2ZUYA 4Z95H 2E9IA 1DUYB 3QEHB 1MFBH 5FGRA 2P8MA 1T21B 2P24A 2XZAH 3UDWA 2N7AA 1MFNA 4YXLH 3DX7A 1UB6B 4U05A 4DW2H 1OAXH 1C5DB 2DQUH 1OTSC 3CZFB 4DN4H 3BGMB 4ZYKB 4JHAH 5CD3A 1UADC 5ACMA 1FFPB 5D2NE 3Q3GB 5D70L 1G9MH 5KW9L 4UTBH 2I60L 4YHMH 2D31A 4L8DA 2HG5A 3QRGH 4LP5A 1FLTX 3SOBH 5B8CC 1QHOA 4WY7H 1JGUH 3OXRB 1KCRL 3QG7L 3AGVA 1I85C 1K3ZA 3MJ8B 4FQQB 3T77B 4MA8H 3ZE2E 5EC1A 1IRAY 4RAHA 1F97A 2EEDA 1NL0L 1VFAB 1YEDB 3ARXA 2C3XA 4I18A 2CUMA 1IAKA 2YD9A 3EO9H 1U8LB 3RTQA 1JYVA 3WLBA 1HQ4B 1BFOB 4XRCA 3PF2A 2NY1B 4U6HA 3WDJA 2MHAB 2Q20A 4PRDA 1BLNB 4YJZL 4PGBB 4P5MB 3WJJC 2JELL 4RZCB 1KJVA 2D7OA 4ODXA 4DKDC 3E2HC 3FHQA 4P5TC 5J1SC 4QNPF 3KPPB 3UBXA 4MJ5A 5AG8A 4U0RB 4RQQA 5C2BH 1OGAD 3BKMH 3CMGA 2HVJA 3BKCL 4EI6B 2VN4A 4WTZA 4XPAH 1BEYH 5IVXA 5I8CA 3UDWC 5C0FB 3MV11 1OT2A 4G8GD 5LGKA 1NANI 1RMFH 3CZJA 4PG2A 5BV7C 2ZSWB 2GY7B 4Z7WE 1NCDL 1FE8H 1VFBB 1ZHLB 4N90E 4TUKH 3K8LA 1FNGB 3G5VB 4KV5E 5L0QC 4Q9RL 2NXZC 1W72A 1MCQA 2GJZB 3QUXB 5BMFL 5HYJB 2EZ0D 3GMLB 4QTIH 4M7KL 4U6VL 4D9QD 1K5NA 3UTSD 4K2UH 3L5IA 1WEJL 4IRZL 1CU4H 1YMMD 2NY2B 1FYTD 3QQNA 5IM7B 3SDCB 1PSKH 5GSRA 1YYMH 1KF9B 3W9EA 4MNQA 4TTGA 1DEEA 3OG4B 3RA7H 1SBBA 2WK2A 4I18C 5D9SB 5DXWA 5E8OB 5KVGH 3WNLA 5D1QB 3RTQC 4MAYB 3T0AA 4XBGB 2Q7YA 5JZ7D 1BP3B 5EOQH 5KOVC 2FO1A 3F5WB 5DJZA 5J6HA 5D7SH 4HH9A 4YE4H 3WIIH 5I17B 1BJ8A 2VISB 3MUHL 3PGFL 1L7TL 3E6HB 3EYSH 3VXUA 2K1MA 3D5OF 2RFXB 1YNLL 4X9FA 3DX8A 5CP7A 1E0OB 3GUTB 2A38A 1IAOB 3RUGE 3BP6A 1KB9K 1Z3GH 4KJPC 1FBIL 5CJ8A 1U6AH 2PXYD 2G60H 1MLCB 4RGNB 4KTYA 5CIPH 4PJBB 2ZCLL 4PV8A 1R5VA 4F2MB 2IPKA 3SDXB 2QQNH 5DSCA 2J6EH 5FGSA 4WI8A 1QFPA 1DUZB 4QTHB 5AZ2L 5FHBH 1VADB 4J6RL 4OZHE 3LKPA 1NCBL 1XR9B 4PG2C 3RFZC 2JE8A 3L6FA 1IE5A 1E27A 1RU9H 3BP4B 1J5OL 1EV2E 4X4YB 1S9VA 2E6PA 4Y2DA 3NFPA 4Z78A 3HE6B 4FQJH 1ZEAL 4Y4KD 4NHUA 4ERSH 4LLUB 1JE6A 1CFNB 4Z0XB 3C5SA 1AGFB 1EUUA 4OZFG 5L9DL 1AHWA 1T22A 1HH9A 4P4KA 3O8XD 1JF1A 1FN4A 4KQ3L 1MHCA 5EZLA 1SM3H 2CDFB 3WS3B 4FNLH 4CU6A 5GS1B 3BH9A 5D7IF 4P48A 5A2JH 5DRXB 5D7JB 4NPYB 2DYPB 3CVHL 5CD5D 3FN9A 4RFOL 5D93B 1QYGH 3BSZH 5C0CD 1P2CB 5CILH 3H7BB 5DQJB 1Q94B 1G9MC 3HC0B 4AL8L 3DROB 4C56A 2NXYC 4NKOA 1J8HA 7FABH 5GGSA 4G6FD 4ODWB 1C5CH 4GG6B 3MJ6A 4ODTH 4HIHB 4X8XA 1KG0A 3BMVA 1EAPB 5C0BA 5C86A 4YC2C 1I8KB 3P9LA 3PP3H 3X3FL 1FFRA 4Z76A 2G9HB 2A6IB 3QDMB 4TNWF 3ARDA 2YPLB 1ZANH 1GRWA 2FGWH 3EOTL 3VFPA 4JJ5A 1OGTB 4QGYA 5I1DB 3EAKA 3NIFE 5DJXB 4LLMB 1LGVA 3ARGA 3ZLQC 2DKMA 4XAKE 1A1OB 1A14H 2OSLB 4ZNEE 3U82B 2KKQA 1KUMA 4NRZA 4LEXH 4Y2DC 2YWYA 3U6RA 3UAJC 3LHPH 1S7TA 3GBMH 3C60D 4XNYL 1OWWA 1AFVH 1M4KA 3HA0A 2OTWB 3MV9D 5CIPA 1AHWC 4P4KC 3MV8D 1MJJB 1A1MA 3AXLA 5IW1B 3SEPA 4C59B 2OR8A 4KHTH 5EORH 1SQ2N 3LN9A 1MWAL 3U9UA 2O5XL 2J6EA 3TN0A 3TA3B 5CEXB 2LAGB 2R0ZH 4P2QD 2NTSP 3O3BB 4HMEA 4OD2B 1B0GB 1CXLA 1ZA3B 2P43B 3X17A 3HZYB 3GJFB 1A6VL 4J8RA 5HVHB 5BVJB 3LN4B 1ODAA 3GO1H 1HXYA 2ATKB 1KJ3L 2F19L 3L3JA 3X13A 4OCLC 3GGWB 5FF6A 5IBLC 3MRPA 3PJSB 1A7OL 4GAYB 3TYFB 1QACA 4ZS7L 1GHFH 1UA6H 2IANA 4DWHA 4BFIA 4I2XB 1P7QA 2DQEH 3MJGX 4KK9C 4LRIA 4K3DH 5DD0H 5FA3A 3CFEB 1HQRA 4F3FB 3CX2A 2P5WA 1TMCB 2VLJD 1AXSB 4IJ3B 3H9SA 2VR5A 3QIWA 2WWKT 1VEPA 3OR7B 1AKJA 4L4VD 3GSRB 3ARDC 2I9LA 4MWFA 2PR4L 4XBPB 1AGDA 4QWWD 4M1CD 3SO5A 4N0RA 4UQ2A 1FZOB 4YFLF 4M7ZB 3ARGC 4YHKH 4WNQA 3IFPA 3O0RH 4JFEB 4R4ND 5KSVA 1P69B 4CRPA 5HY9B 1MIEH 1W0WA 2AJSH 2ADFL 2B4CH 2EE6A 4WFFD 2BVOB 5KZCB 2FJGA 4QHLA 5DQDL 5BZDB 1ZLUH 3RKDC 3QH3A 5F7EH 1A6AB 4X5WB 5GJSH 1N64L 2F5BL 4W4NA 4X98A 1FL3B 2XN9A 1PZ5B 3BPCB 4PJXE 2ED9A 3BQUB 3UYPA 1WBZA 5GGSY 4BZ1L 3TN0C 2ZUSA 1GOHA 1F3RB 4ZFGH 5LG1A 4JZOB 4PJDB 4XWGH 2Q86B 5IB2B 3LAFA 1CQKA 1A6UL 1DCLA 1Z9MA 3SGKC 1J0ZA 3QB7C 6CGTA 5CSBA 4HULB 4CKVX 5AWNH 2KPNA 1CGVA 5L2KE 1U8KA 3CFKA 3GB7B 3IXTA 4OI8A 4NKDB 3B5HA 1CXEA 3BIKA 3QO0B 1FFQA 3TESA 4AT6B 5T5FH 3DXAE 5CJ5A 3BPOB 4N1HB 4JM2A 1M7IB 4LRIC 2VLRB 2VDQL 5F8QC 2FX7L 4P46D 4D94A 3QIWC 5BO1H 5IFHH 2Q8BL 5C6TL 1JN6B 4PRHD 5I15L 2A9ML 3AS3A 1OPGL 4EBQH 3PNWB 4L3ED 1QLEL 3CVIH 1A6WL 3ARSA 3REVB 1EO7A 4ZAKD 4IOIA 3OAZH 1NAMA 1DL7L 1EXUB 1REIA 1ZT4A 3VGDA 4PJCF 2F58L 4QRPB 1JYXA 1RI8A 3VXUE 4CN6A 5JQHC 2VWEC 1FFNB 5ENWA 4WI4A 4HZLB 4OQTH 4HUVB 2L7JA 3O2DH 2BHZA 4CN4A 5EO0B 1OTTD 2V9RA 3TBYB 3P4OB 1FYTB 4HIJB 3TYGH 4KZEL 4ZTOH 4PJEF 3ILPA 3OTTA 3QZWB 1UB5A 2DN7A 1V7MH 1D5MB 3BH8A 2W60A 3HI1B 4HV8B 1MIML 2GAZB 2WANA 5JNYA 4PRAA 4Q6IB 3ZKXB 3RWFB 4YHNA 3ULUF 3VW3H 5F6HJ 2W07A 5D72H 2ARJA 1GPOL 4LVHB 1G6RA 2V17H 3ZTNL 5C0RL 5MP6L 1A3LL 1DTUA 1FO0B 4QOKD 3C6LD 3KPRD 3SCMB 4YEFA 4JO1L 5KG9A 2GSGB 2VLLB 2Z9TA 4KROB 3NFSH 43C9B 4NJ9L 1H3TA 4OCWH 2GJ6D 1G7QA 4Z8FL 2HAZA 5HGAB 3QQ4A 5T1LB 4XBEL 5E94A 2MQCA 3OPZL 1P7HL 2IBBA 4LPCA 1JNHB 1UG9A 2B7DT 2HA1A 1X4YA 4JFQA 4MZ3A 3HI5L 1G7HB 5ETUA 2X5PA 4ZFOA 2AJUH 5F93C 1JGVH 2FBJH 5DUBB 5CFHA 3MLYL 3PABA 1HOCA 3QAZB 3DUUA 1VFMA 3ZTJG 1A4KB 3RAJL 1UXSA 4EEEA 5K9JL 2X7LA 4WHCA 4X6DE 4F8TA 3WFCH 4ODSL 1HZHL 4TULL 1FGVL 1YEJL 1GGBL 1KJMA 1LD9A 2ESVA 1N6UA 5GRYA 4FFWC 1MCJA 2WLZA 3ARPA 2XA8H 5ID0B 4MD0A 3RVUC 5HGHB 3WHE0 2DTMH 3PXHA 4NRYB 3BW9A 2QADD 3MRDA 1W0VB 4Y4FB 2XRAH 1MH5B 3MXWH 2GITB 3FB5A 1ZLSL 5JW3L 1HSBB 4G6FB 1KT2B 2B4CC 3ARTA 4OQTA 2A1WL 4V1DD 4PGDA 4YR6B 1F2QA 2VLME 1UEYA 5DF0A 4HFWA 3PWPD 2OXGA 3VD4A 2MKLC 4ZFFB 3VFGH 1UH4A 2HFFA 4E0RA 2VZ1A 4YK4B 4TUOA 2WBJD 4U1KA 4JFOA 1UM6H 4NYLB 1RUAH 4U2YA 5D7IA 3B2VH 4A6YH 3V5HA 4X6FB 2DDQL 4TSAL 1PAMA 1X4XA 4GMTL 5I1LB 3BT2H 1HHHA 1DDHA 1MRFH 1OARL 4PJAB 1HH6A 2SEBB 3Q1SL 1YEEH 4NM8H 5LWYH 2NR6D 4PRIA 2HKFL 4OCNC 3MLWH 1MF2H 1EERB 1QEWA 3KPSA 4I4WB 5FYJD 5EZJA 2DQCH 3U4EB 4O51A 2IALA 2XZQH 2R1WA 5MEQB 3H9HA 3MRKB 2JCCB 5C08D 1BM3H 4NO0D 4LF3A 4E41E 1IM9B 3BDYL 1U8JB 3HCVA 3OJDA 4S1SL 1RK1A 3M8OH 4KRLB 5FYKD 4MSWB 5LAXB 1RJCA 4R3SA 1A4JB 1OCWL 4XX1E 2EC8A 2YC1A 1VGKB 2IEPA 4WO4B 5DFWH 2BY0A 3PGDA 1VHPA 1OTUC 1MCLA 1BVKA 4GKSB 3C8DA 2XN9E 5BS0A 1NEUA 3EOAB 3TZVD 2H1PH 4OF6A 4U1IB 3QIUA 4KAQH 2UUDK 1XGQB 3EFDL 4WI7A 4G6AD 4N0UA 3FQTA 3MROA 4YHLH 4RISH 3T2QA 2R23B 5IMLB 5F7LB 1P7KA 2NX5D 1NDGA 2VDLH 2GI7A 3MLTA 4JRXA 4AIZB 4HMCA 2BXZA 4LIQE 3SDYL 4NQSA 1KENH 5CGYC 4C55A 4FQ2H 3QR2A 1X44A 2W0LA 2X4OA 2J8UB 4EQ2A 3H42H 5IJVA 5AYUH 1KTLA 4WJ5A 2ZG3A 1CT8B 3JV0A 1SYSB 2BNQB 3GMNA 3WO3B 1ZHKA 3NPZB 1ZGLM 4JY6B 2P8LB 3V5DA 4A6YA 5TE6H 4ZQKB 4PRBB 5LCVH 5L88L 4QXWA 3TFKC 2EC9U 3WXWL 5DHVH 3LQZA 2GHWB 4O58L 3ULUH 3MA7B 2DS4A 4I0CC 3OF6D 4G8FA 3CCHA 1HXMA 3D85B 4P2RB 2KQNA 3OMZA 5TQ0H 4WI9A 4YO0B 4OD1L 1HE7A 1ZHBB 4YXKL 1F8TL 1BVZA 1WAAF 1MLBB 1XF4A 4WHYG 1BFSA 4Y8AA 1T0NB 4CW1B 5BXFB 1DVFA 5GS0H 2H2SD 4F7MB 3MV7B 3QIUC 4R8WL 5DMGD 4JKKA 5DJ0B 4JR9L 3RGVA 4ZSOA 3RWJB 1D9KA 1DLHA 3ALWA 1HYSC 4LSRL 4U1NB 3EGSB 3PDOB 4LKCA 5ICXA 3WFDH 5JLZA 5ESQA 4RGOH 3OB0H 3O2VL 3VFTA 2XTJC 2B0SH 4JO3L 1XR8A 1WTLA 4WFHD 3MRRA 4LBEA 5ESVB 3NCCB 4U1LA 1I8LA 4JFPB 1S7VB 1CFSA 1RZGA 2OJZL 3QUYD 4MNGE 1AGBA 1CE1L 1H0DA 3HFML 3IVKB 2YWZA 3OKNB 1BHGA 5GGVH 1S7WA 3CLEL 4PJ8B 2YR3A 1IGCL 3K1DA 4RMQA 1XZ0B 2VR9A 4QOKB 4JANB 4Y4HB 4NZTL 3U7YH 1PKQE 3MLXL 4WGVB 1ZMYA 4DKAA 3MCLH 3QHTC 2QQLL 5MHSE 4PJCA 2A0LD 2X41A 2Y23A 3ARUA 5T3XD 2XPGA 1H3UA 5HXMA 4JY4B 2VLKE 2FO4B 2LU3A 5AUMB 1T1YB 1PG7H 1WITA 4ZODA 3VXOB 2QLVB 2GFBA 3L7FA 4PRNA 1F90L 4PJEA 3T0EB 1VGEH 1TQCC 5IHUL 1DVFC 4QRTA 4Y88A 3NA9L 3NCYS 5CCKL 3OKYA 3QCTH 3TIDA 1RULL 1U8NA 3I6GA 1MHEA 4APQB 1KPRB 5DHVA 3ETBF 3B9DA 4NNYB 5CSGA 4I77L 1JHKL 3EYOA 5IW6A 4JPKL 2DAVA 4RMVA 5DJAA 3FO1A 4H5SB 4N0FB 5GGTH 3OXSA 5I30L 2GJJA 2F54E 1IKNC 2AK1L 4LPXA 4NQTA 1UWGH 3UTQB 1I8LC 1AGCB 1PG7W 3B6SA 4I0KA 2XFXA 2R8SL 2PYED 2YUWA 1NC4D 4HCRH 3IS1X 3PQYB 4TRPL 2VITA 5MI0B 4HKBA 4LQFH 5C0ND 2X4UB 4UILL 4F57H 2ZOKB 2Z8WC 2CQVA 2UZIH 4JN1L 4RRPG 5CEZH 1YEGH 1HKLL 1LDPH 1QBBA 5EU5A 5IB3B 1AXTL 3OKMA 1AIFB 3MUZ1 1UACH 2EIZA 4YDIH 1M1SA 1KIPB 4KUZL 4NO5B 1N59B 5B38G 1QUNA 3JWOH 4AIXA 3CDGA 5I6XB 3T2NL 3DGGB 4WWKA 1OM3H 4EUPB 1KN2H 2Z91B 2R1YB 5ACZA 1YECH 5L6YH 4PG9A 2AGJH 1N7MH 5FKAA 3PHQB 3OKDB 3VXMD 3DURB 3LD8B 1L7IL 4P59L 2YZ1A 4X9IA 3VI4E 4Q9QH 2EDEA 2DQGL 1IBGL 2CKBL 3C09C 1NBZA 2AJXH 2HJLB 2B2XH 1MUJA 5H35A 1ND0A 1YQ2A 4OFVA 4N9GB 3ULUC 3MUGB 3MO1B 4PRPB 1VDGA 1D6EB 4OCXH 5FOBB 3VI3F 4D0CA 3P0VL 4Z7VF 4X9GA 3C9NB 4EN3D 4C4KO 3LEVL 2NQCA 3O4LB 1Y18B 4M8QA 3VG0H 1WCQA 2BVQA 2VZ3A 3BHBB 4RAVB 1V3LA 3TJEL 3P4MB 1A7RL 4FQCL 4UU9A 1N8ZB 3QJHB 2EDHA 1Q9LA 1AGEB 4XZUB 5D2LF 1OAQH 4KKAD 4HKZB 4O02H 3D39E 3FO2A 1L9NA 4JDTL 1CBVL 3F12A 1DQML 4JZJB 4XMLL 4DQOL 4D9RE 2CH8A 3KYMA 1FQ9C 4HXAH 5GGTA 5T1MB 1NBYB 2FL5B 3FMGH 5DS8A 1QO3B 1WTGT 2XTJE 3DUSB 3WO4C 1YMHA 2XQYK 1LP9F 1MEXL 4MA3A 1NFDB 1JUFA 4FG6C 4HPOH 4M43H 2PYFB 4IRSC 4HCRA 1I7ZA 3HRZA 5AD0B 2ATPB 5EBLA 2EICA 2EDQA 1E6JL 2QKIA 2J3SA 4YH6A 4PD4J 1HINL 3QUZA 1CK0H 2P44B 4H20H 1RUPL 4P9ML 2R0KH 2NX5B 1EBAA 3ARBA 1T80A 5ITFB 1KSRA 4M5YH 4CMHB 2A6DA 2NW3A 3QNXB 2XIDA 3T8XB 3BAEL 3FKUS 4OCSH 4P99A 5A43C 4H1LB 3GSUA 3HI6H 5IKCB 3V0AC 4W6YB 1ZA6B 5AEAA 2IPUK 5F71A 2CPCA 5CWSA 2EDBA 1ZKAA 5DEGB 4OV5A 5ESAA 4H25B 1UVQB 1KPUA 4XNQB 5FOJA 4TTDD 5H37H 2VDKL 1NBVH 4U3XA 1PG7X 2F53B 3DV4B 3V6FA 4BK4A 25C8H 3D69B 3GMOB 5IGXH 5E4IA 5FV1L 2VMFA 3BUTA 1CLCA 2XYCA 2VL4A 1L4IA 2OM5A 1CLYH 1VACB 2E9JA 2IQAA 5GGVY 5JHDE 4LCYB 2GTWB 3QDJB 5D7LD 3IETB 3G5XA 5IMMA 4JRYB 2EEAA 2IWGA 3ZYJA 1MCPH 2NY5L 4P3WA 2EDNA 3VFVB 1RK0B 4G5ZL 4UIKH 1F45A 4XPHH 4XHJD 3NN8A 2DICA 4MNHB 4YFDB 5GGUA 2AXFB 4WW2B 4P57B 1F6AA 5TGBA 1EO8H 4I5BB 1PQZB 1TNNA 1GGIH 4HUNB 1U8QB 4X7TB 4WDIA 5GPRA 2B1AH 1T1XA 2J8OA 2UZYB 1QNZL 3DVGA 3ARBC 1R3LA 4ONGH 3QFJE 5B3JE 4FQXA 1R3JB 2V2TA 3BUYB 5D71H 3A6BL 1EJOL 4PTUB 4OUUB 3JWOC 2ILLA 5DRZB 1D6VH 5J3HD 4D0BB 4HJ0D 4NSKA 3X14A 2BOBA 2VAJA 4P23B 2BFVH 3SGEI 1RJYB 4ZNCD 4RGMB 1OSZB 1L6ZA 3GSNL 3QFDB 1WAAA 5J56B 1MJ7L 1FAKT 4RFEB 3WYRA 5I1JH 1A8JH 1CVRA 5SWQA 3EYFB 4P3CH 5C8JA 3QXDA 3CSYA 2NW2B 3H9ZA 4HIEA 4JREC 3C5ZA 4X7SH 2G75B 5I1HH 3ZSTA 1BD2B 5D1XA 4Y5XA 1MNUL 4ZPVA 2EIDA 1T83A 4OQ1A 2C4XA 4RSVA 3BKJH 1XGRB 3AB0C 1GYAA 3QRFM 1RURH 4OZGE 1FIEA 4XNMB 3SPVB 4X6BA 1FNSL 1U58A 5T3XL 4CNIB 3WIFA 1U2HA 3S4SA 1INQB 4LHUB 2ZG2A 1FH5H 4ZOAA 1KB5B 2BNUA 4YBQC 4YGAB 2YPVH 3UTZA 2EYSA 1NCTA 2H32B 3P40A 5F21B 1ZVSA 3V0WH 4FQXC 5I2IB 5C9KA 3T09A 3EDJA 5K59F 5J13C 5E2WL 3WL9B 5IHZA 4QT5A 2C3VA 4NZRH 2BNRE 3N85L 1V7NL 5J89A 3FT4A 4QHUB 4ZD3H 4NBXB 1TVHA 2WLYA 4NM4H 2A74B 4LOUD 3FN0L 4NP4H 4BH8A 2OR7A 4Z7QE 1YDPA 1HWGB 2LVCA 2GTZA 3CH1B 2NZ9C 1J86A 1IQDA 5KBNC 3KWWA 1S7QB 4GQ9H 3NFNA 4DK6A 1I9IL 1QSFA 4HWZA 4R4BA 3O6ML 1I3GH 1LK2A 3C5ZC 2EO1A 4MZ2A 5D1ZA 4HWNA 4W4OA 4Y5XC 5JW5B 2KL6A 4ZO6A 4HKJA 1T83C 4ACPA 2AABL 4NT6A 4S1DC 1MRCH 3T4AB 1J87A 1VA9A 1LO2H 3CUPB 4G9FD 2ZCKH 5EIIB 4JAMB 1LNUA 4XNZB 1VKXB 1D5XB 4ODHL 5D70H 1BOGA 3SKNB 4ZUUA 4PY7B 5KW9H 4HX1A 2B20A 2QQKL 3L3OA 4NQEA 4HG4K 2BVTA 5I8EB 3TNMA 5C0AA 4ZXBD 5I18L 3VE0A 3F7RA 3NAAH 4P3DB 4RIRA 3HE7B 1PVHA 3IDMA 2AI0H 3ZKMC 1SJEA 1M7DB 3LPGA 2VXTL 3CDCA 1SEQL 4DN3L 3SJVB 4IRJB 5MEOA 3NZHH 4O9HL 5IROC 4YHPB 1XIWA 4P9HH 2BCKA 5F6HI 5EZIH 1J10A 4PBWD 2VXSH 2JJSA 1DBML 1QSEE 5JORB 3RVXD 3ARQA 1CD8A 3G5YA 1T1ZB 4XP1H 1WZLA 5DJYA 2HT4D 3LKSA 5EPMB 4NQXA 5DUML 1CCZA 2ICWB 2EECA 1TCRB 4Y16B 5EN2B 2VDPL 5D1ZC 4W4OC 1SVCP 5I8OL 2UWEB 3KDMB 2AKRA 3KR3H 5HYQA 4BFEA 4PJ7F 1BX2B 5BRZD 2W65B 4Z7VA 3CJJA 4L4TA 2GEEA 4B5EA 3NACH 1NCDH 4R2GD 1H9VA 5TE4H 3F58H 5K9OA 1G84A 1VESA 3U79A 3V7AE 2OJEB 4MDIB 2DQTL 4GUPB 1K2DA 4BZ2L 1S7XA 3FT2B 3IDIB 2Z8VC 1X5JA 4M7KH 4X0KA 1TZIA 4LQ1A 3TT3L 4IRZH 4QHNB 5DRNB 5ISZD 3JZ7A 5D2LA 2DIJA 4LFHD 2LFGA 4BSVB 5HDQL 2E8ZA 4MVBD 3WFBL 1KIQB 2ZCHH 1FZMB 5T1KB 4WIQA 1OB1A 3LRGA 4DUVA 2DLIA 1LP9A 2NY4C 4JM4L 2AQ3A 1DUYA 3QEHA 1XIWC 3BEVB 3QXAA 5E2VL 4UIMA 4JQXC 4PLOB 1MY5A 4PJFB 3CXDH 4HG4J 2JJSC 2P47B 1YNLH 4M1GH 1C5DA 4FFVC 2OTPA 5C09B 4F7CB 4R4FH 2DI7A 1I1FA 3DTXB 1TVDA 3SKOB 3RL1B 1RY7B 3V2AR 1NLBL 1DR9A 2A73B 3V4PH 3ZDZF 4F58H 2W9LA 4QRRE 1RUMH 3JV4B 2QR0A 4UNVA 3OXRA 2YD8A 5TE7L 3T77A 3WS6A 1S7SB 3WNNA 1OD7A 2PW1A 4U1MB 5IK3A 3BOVA 5HI3D 2CGRL 4JO2L 2A6KB 5BVPL 4ELKA 1RIVL 5KSAB 3O6FD 1BFOA 1OW0A 1ZEAH 3OKLB 4RMTA 2MWCA 3R8QA 2EE2A 3H3BC 3O4OB 5GS2D 2MHAA 1RZIB 3U9PL 1CXFA 1BLNA 4HKXB 3L5WA 4P5MA 4RZCA 3BN9D 4PJ9B 1SEBB 4EOWL 1YQVH 1XF2B 3KPPA 5HI4C 3T2PA 4KJQC 4GW5B 1TZHB 1DP0A 3MGTA 4RMUA 1SBSL 4J1UB 1K6QL 2J5LC 1CVSC 3S37L 4NZUH 4K3JL 3RVTC 4U7MA 5HYSB 4XVSH 4JKLA 1JV5A 2PW2B 1WWBX 3KXFE 1J88A 4Z5RB 2ZSWA 4AENA 3A6CL 1QHPA 5E8PB 5C07E 3QDGE 1ZHLA 5FYLL 5HVWA 5L2KD 4XB8A 3VA2C 2FSEB 4KZDL 4CGTA 3HAEB 4F15C 1BGXL 5BW7A 5HYJA 3GMLA 4MQXD 4NFBA 4XP6L 2E7LA 3CMOH 1WSST 3QG6B 5IMOB 4KH2A 2DM7A 4GKNB 4P9HC 3WS6C 5JQ6H 3SDCA 5F7FA 1PLGL 3UZVB 1FORH 1F42A 4ALAL 4OTXL 1CDHA 1MI5E 1JRHH 5E8OA 4H8WL 4Z7WB 3OR6B 4MAYA 1JL8A 3TCLB 4XNYH 5FO9B 3UPRB 2HWZL 1CFVH 1X5XA 1AP2B 3WDHA 1FPTL 5EC2B 3O3AB 3W82A 2XTLA 4EKXA 4GRLB 2RFXA 1YNTA 5IFAH 3GUTA 1RJLB 1IAOA 4AMKL 2HKHL 4Z7UE 2APFA 3BI9X 3W2DL 3RWHA 4R97C 5B4MC 3UJTH 4U0RC 1XCQA 3REWA 3VXRE 1S9XB 1A2YA 4F2MA 5IUSA 3MYJB 3BP7A 2OCFD 3SDXA 4I3GA 1KJ3H 1UZ8A 3MRLA 3K1KC 4JPWH 2AJ3A 1R24B 5A40E 1LO3H 4QTHA 1BBDH 4NQEE 1X7QA 4ZS7H 3ZYIA 1T1WA 5C0AE 2I5YL 1H5BB 1VADA 1LEKA 1LMKA 3INUL 2P46B 1U8MA 4K55A 3HC4H 1FDLL 5EIQA 4KMLB 1J18A 3FFCE 3VWJC 2I9TA 3MODH 5BW7C 1JYNA 2NY0B 1NGZB 1FSKB 4LLUA 4Z0XA 4I0PB 2E27H 2DLTA 2NY2C 3U7WL 2X4RB 1LK3H 2WW8A 3SDCC 4AEHL 1INEH 2BERA 3WS3A 4O2CA 3QHFL 3EZ8A 1IC7H 4M00A 4O2EB 5DRXA 4PP2B 3ZT6A 1MCSA 2DYPA 1N0LA 5ITBH 1QBMH 3G6JF 3CX5K 3GKWH 4XMPH 5E1AB 3SDAD 2IH1A 3MRMB 3UYRH 3HC0A 1W0YT 1Q9KB 4Y19E 3FB6B 3WXVL 4BZ1H 4BYHA 5J7CC 3RVWC 5E8NB 4KXZI 3VI3E 4TN9A 1T5XA 3W0WA 3B8SA 4XCCL 1NCCL 1A6UH 4HIHA 3U83A 2QSCH 4EI5D 2X70B 2UUDH 1ADQL 1HWHB 2FH8A 2YPKB 4U1GC 5EU4A 4HUUB 3PWVB 1B2WH 4J4PA 3ZHLA 4Z9KB 2YPLA 3TJHD 4JFDA 3ZL4L 1I8MB 1U3JA 1DE4B 2GIYA 4LLWB 1HIML 1OGTA 2DBLH 5DMIH 5I1DA 5CAYB 5D2LE 1QR1A 1IT9H 5E1HB 4U7KA 1JPTL 5E5MA 5B8CB 1A1OA 4YDKL 4FMFA 2VO5A 1EFXB 1U93A 3PG2A 3M07A 4KTDL 4EXKA 2OTWA 3MRFB 1NEZB 2DOCA 2H2PD 1OPGH 4G7VH 1W8NA 3MLUL 1CGUA 4LCWA 4RMSA 4XMKH 1MJJA 5IW1A 4DZ8A 4FQIL 1V3MA 3MNZB 2AAVA 1MJ8H 2F58H 1QLRB 1U95B 4M9OA 5CEXA 3HG1E 4JGJA 1U8PA 2Y5TA 4OD2A 1ZA3A 1Q72H 4G3YL 1G7LA 1OAUL 2WIIA 4F7PA 5BVJA 2FBOJ 3LN4A 4Z0BL 3P0YH 5FUZH 3E2HB 4P5TB 4IOSD 1GGCL 4JPIA 2V9TA 2Y36H 3LV3B 4I48B 4W68A 3DV6B 4MXQC 2AEQL 2Q76B 3CFJB 3PJSA 5GRZA 1RZ8B 2HTLC 4JDZA 3HNVL 3QWOB 4S11A 1MREL 2MPAH 2P8MB 2P24B 4I2XA 2O61A 3DECA 5FYJU 2FDBP 3C2SA 3CFEA 3D87B 3DX7B 4F3FA 4JCLA 1FO0L 5MP6H 3GI8L 2OL3B 4JO1H 5CD3B 1G0DA 5BV7B 4XHQA 1WWAX 2VXVL 1NJ9A 2A77L 1QR4A 2W0KA 4NQVA 3TVMD 2BDNL 5L0QB 2YD5A 3M1BA 4PJIF 2NXZB 4Z8FH 1P84J 4XBEH 1DFBL 1O5DT 2D31B 3BKYH 5FYKU 2PN5A 4L8DB 4MD5A 2HG5B 1Q8MA 4JFEA 4K07A 3IU4L 5DC9B 2DQDL 5CJBA 2E3VA 2ICWJ 4LCIL 3S3SA 4HGWA 3V6ZA 3V6BR 5HY9A 3VRJB 3OHXB 3GMRA 2BVOA 2OZ4H 3WHE1 4BFBD 2FEEL 1V05A 3RWEA 5BZDA 3QNYB 1HHJB 5ALBL 1A6AA 4I18B 1IAKB 4X5WA 4KVCL 1T3FA 3O9WD 1J1XL 1VFOA 3RTQB 4WVRA 2FEEI 3ILQD 3MLSL 3D0LA 3BQUA 2YBRB 4XRCB 3O6KH 4YHOL 2DLEA 1RUKH 4NKIL 3HN3A 1QPPA 4HK3J 4AEIL 1BQHG 4DKFH 2VDOH 2XY1A 4ODXB 3LPWA 3QULA 1YEHL 5T3ZL 3B9KD 4KY1H 3GB7A 1D3CA 4MJ5B 4RQQB 3VRLF 4OZFH 5C7XH 2HVJB 4AT6A 1HHIA 3I9GL 5IVXB 4PJXB 1M7IA 5EG6C 3A67H 2VLRA 4EUPG 3HS0B 5ABDE 1TZGL 5F97E 4KKNA 4G8GA 4NQCD 1JN6A 3LDBC 3VXNB 4ELMF 1CIDA 3PNWA 2IG2H 4S2SA 4PUBL 4YZFE 2CR6A 2OX5A 1EXUA 3GK8H 5HPMA 1KFAH 3MA9H 4A2LA 1K5NB 3DXAB 4PREB 5LVEA 1FFNA 3PUCA 1QKZL 1BQSA 4L5FL 4HF5L 1T6VN 4HUVA 1YMMA 4NRXB 2DQIL 3ZYZA 4UV4H 5GSRB 2W0FB 4HIJA 1FYTA 3TBYA 1MCRA 4I3RL 3QZWA 4X6CF 3V4UH 2EDFA 3ZO0A 1U0QA 4CVWA 4UOJA 5DR5L 3BQUC 2Q7YB 5LKNA 5EBGA 1JGDA 3HMWL 1ZS8A 1CG9B 3VGAC 3OG6B 4YFEA 1N5AB 1BWWA 1NGPL 4LARL 3AMLA 3RWFA 4DTGH 3VXUB 5CP7B 1CZ8L 4P5KA 1UWEL 3G9AB 1KNOB 5I19H 3SCMA 5K9KB 1PYWB 1T2JA 3BP6B 1HCFX 1JFQL 1INDH 4KPHH 3N0PB 2OZ4A 4PV8B 2PXYA 5F88A 1XF1A 1V3KA 3JVGA 4Z7OF 1JWSA 5DSCB 2Y7QB 5C0DA 4GS7C 3BRFA 1JNHA 2ZG1A 2YD2A 4NNPH 4JG1H 2ZUUA 1EGJA 3MNWA 1DSFL 5F96H 3LKPB 2RAMA 3ARFD 1S8DB 1E27B 3MSPA 2AK4E 2BJML 4IMKA 5FUCC 4IOFD 2O5ZL 4Y2DB 5DDHA 1LO5A 4DOHE 5MHSD 1TJIH 4NHUB 1Z9OA 5D4QA 2EZ0C 3C5SB 4QKXB 5E8EA 3S97C 1LVEA 3G08B 4XC3H 1AHWB 1T22B 4P4KB 5JIHA 3MLRH 2EDRA 2HN7B 1FN4B 2V5YA 3OAUH 4H1LG 5EZLB 5HHVL 3O8XA 4PLKD 4K23H 1NCWL 4YDLC 3ARYA 4FABL 2GY5A 1CDYA 3OV6A 1KTDA 1YEKL 1F13A 5HGHA 5JZ7C 4OFYD 4JPVH 2LAAA 3QCUH 5C0CA 1JPGA 3R8BB 3PGCB 5C92A 2FYYA 4BQ9A 1W0VA 4C56B 4NKOB 2HVKA 4OF7A 3SE8H 4DAGL 1WFUA 5JXED 4WEBH 2GITA 4JFFE 2F54D 1KT2A 4OLVH 2O5YL 4I9WE 1KG0B 4YR6A 4FFZH 2PXYC 5C0BB 1QQDA 3JVGC 1T2QL 4ZFFA 2HH0L 3ARDB 8CGTA 2WM0A 3VFPB 1TJHL 2ZKHH 4JJ5B 4TSBH 4WEMB 5I1GH 3B5TA 3EUUA 4TVSa 3NABL 5D96C 3FZUC 3RY5A 3ARGB 2AQ1A 4IBLT 4IMKC 1KPVA 3FB8B 4NRZB 3RBSA 3O11A 4P2YA 3MREA 2D4DA 2SEBA 3DSFL 4Y4KC 5CIPB 2P48B 1G7IA 2DMBA 1A1MB 1QRNE 1NFDF 1AH1A 2DM3A 3U0WH 1JTTA 1XGPB 4S1RH 15C8H 3U9UB 3O8XC 2VXQH 1SY6L 3TN0B 4PJ7E 5EBMA 4EVNB 1G0XA 3DETD 5SWZE 3LVEA 5TFSL 4P2QA 3SHSA 3R06B 4WI3A 4J8RB 2EXWD 4D8PA 2JCCA 5CD5C 4FFYL 3O2VH 3L3JB 1IGFL 4FQ1L 4LRNL 2YKLL 5FF6B 3MRPB 2GK2A 4RA3A 5LAXA 1KCVH 2Y1VA 1S3KH 1CE1H 3SDDD 3TBVB 4OF5A 5FA3B 3MQIA 1HQRB 5DYOA 3W9DA 5E6ID 2P5WB 2WP3O 3JXAA 5LBSL 1I7TB 4HIIB 2VLJA 1TQBC 4GKSA 4N0CD 1AKJB 4HS6A 2EH8L 4FZ8H 1IAIM 4OFDA 3TO4D 2VDRL 2P1YA 2X9YA 4L4VA 4U1IA 1AGDB 4E41B 2Y06L 3DI3B 4UQ2B 1SJVA 3U4AA 1MSPA 4Q7DA 3SN6N 3D39D 5ADOH 3THML 4L4JA 1DQDH 3IFNH 2R23A 4LHUG 5DRWA 2J4WL 3VXSD 4PJGE 3K4ZA 1E28A 5I1CL 1W0WB 5GRUL 3AC0A 1FIGL 1F90H 2FJGB 1T66D 4AIZA 3C60C 1TETL 5GGQH 4GAFB 4MJID 1OGAE 5FKPB 4X4MA 4X98B 2XN9B 4XXCA 2Z31D 2NTFB 3WKML 4XPTL 1WBZB 5T5NF 4WW2F 4LAQL 4D0DA 2J8UA 3L3GA 5F1IB 4Z77A 3HRPA 1CT8A 2MCPH 4JE4B 1F58L 1GXEA 2BNQA 4Q97A 4FN0A 5DZLA 5CP3H 3KJ6H 1EHLH 2RJMA 7CGTA 3IXTB 1DLFH 4PJIA 3B9KB 2X4SB 2Y07H 5KSBE 3MA7A 5TDOA 3RWGA 1IAIL 5ICZA 1KJ2L 3P2TA 4D9QE 3MOAH 3TH4T 1JNNL 3UTSE 2HRPL 1YMME 4UINL 4YO0A 4D9LL 4XP9H