5C0OE

M1a58 trna methyltransferase mutant - y78a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
250
structure length
238
Chain Sequence
b'GPLLLKDRKGRAYLVFPKEGGVFVPHEALLEAGPGGVVELSVHRPTLEEYLLHMKRSATPTAPKDASAMVTLLDLAPGMRVLEAGTGSGGLTLFLARAVGEKGLVESYEARPHHLAQAERNVRAFWQVENVRFHLGKLEEAELEEAAYDGVALDLMEPWKVLEKAALALKPDRFLVAYLPNITQVLELVRAAEAHPFRLERVLEVGWREWEVRLPVAHPRFQQVGHTAFLVALRRWKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase TrmI
publication title The m1A58 modification in eubacterial tRNA: An overview of tRNA recognition and mechanism of catalysis by TrmI.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb27 / atcc baa-163 / dsm 7039)
molecule tags Transferase
total genus 58
structure length 238
sequence length 250
chains with identical sequence F, G, H
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5c0oE02
1KR5A 3G7UA 1VP3A 1RJGA 3SGLA 1VBFA 4GOOD 3B5IA 2IH4A 1L1EA 4XUDA 1KHHA 2AS0A 2OO3A 3DULA 2IDJA 3OU6A 5DTRA 3PT9A 5LQJA 4CKEA 3G89A 2HR1A 3SR4A 3UJAA 2CWWA 2AOXA 4DQ0A 3CGGA 2B2CA 4G56A 4GQBA 3FYCA 4MIKA 1PJZA 3KQOA 3Q7EA 2WA1A 3OU7A 5FA8A 2ZZNA 3EGIA 4PIMA 5JUWA 2YUIA 4HRAA 5P8WA 4HH4A 1WS6A 2NNWB 3HCBA 2GPYA 3T7TA 4ER5A 3ME5A 4QDKA 3PVCA 2AN5A 2YR0A 1SUIA 5E9QA 1X1DA 2AOTB 5GWXA 3PB3A 5E1DA 4FR0A 4WVLA 3V97A 8MHTA 2ZIEA 3LHDA 5CCXA 2LD4A 2Q41A 5EPEA 2R6ZA 1RI1A 3C6MA 3HEMA 3MB5A 3P71T 3I9FA 4F84A 1SKMA 4Z2YA 2ZSUA 3M70A 4YUWA 2FCAA 5CM2Z 2GAFA 4AX8A 4YUZA 5C9ZA 5LQRA 1NV8A 3EVCA 1YFJA 4RVGA 3TOSA 4BY9E 3R6TA 5FWAA 3QOWA 3PTAA 1L9KA 1N7JA 3FTDA 2AVDA 4GOMD 5FTWA 5K0JA 3WSTA 5K09A 3AXSA 1RI3A 4NECA 4X63A 2IH2A 1X19A 1XDZA 2ZBPA 2OY0A 1QAQA 5KQSA 1X1CA 3SM3A 2F8LA 3G2QA 3LCUA 5FQNA 4RVDA 4CTKA 2IBTA 2G72A 4GBED 4KDRA 5E8JA 3R24A 5DTMA 5B1SA 1NBIA 2PXCA 4UOEA 3P2IA 4QTTB 1EQAA 3AXTA 2HTEA 4FSXA 5FA5A 1WZNA 3PLAE 2I9KA 3SVZA 5K0BA 1ZHFA 2XYVA 5HEKA 1EG2A 3HVKA 5U4XA 3NMUF 4M38A 1N7IA 3UJBA 2XVMA 5H02A 5K8VA 2JG3A 3KHKA 4CKCA 2P7IA 2JJQA 1P1BA 4FGZA 4C08A 3CVOA 1L3CA 2Y1WA 3PS9A 4RTKA 2EJUA 4RTQA 5K05A 1ORHA 1JQEA 3ELDA 3IYLW 3X0DA 3GGDA 3KR0A 5ICFA 1Y8CA 1HNNA 3HA3A 4XCXA 2VZ9A 2ZULA 2PWPA 3DXYA 2G70A 3BWCA 3OFJA 5DXJA 5EG5A 4AZSA 3EPPA 5CVEA 1VIDA 4QVGA 5T64A 1G60A 2P3QA 1ZG3A 3ANXA 4FP9A 2NP6A 2YQZA 1AF7A 2ZBQA 2H11A 1ZKDA 4YUXA 1R00A 2R3SA 2ORED 5EIFA 3H2BA 3E7PA 3EVBA 1R8XA 2BR4A 3P2KA 4LECA 2ONYA 3EMDA 5F2NA 2PXAA 4PYIA 5E9JA 5K0EA 5HIIA 1JG3A 5DXAA 2OZVA 3EGEA 1FPQA 1P39A 2O57A 3G2PA 3K6RA 3NW9A 5M5BA 3G8BA 3M4XA 1SUSA 4HG2A 4CXMA 4GOND 1RI5A 2OKCA 3G5TA 4A6DA 3DXZA 1I4WA 4POOA 2AOTA 3P9IA 3E8SA 2OBFA 2P40A 2ZBRA 3REOA 2AVNA 3BWYA 4FZVA 1NBHA 4HGZA 1EAMA 5EKUA 1DL5A 3KQPA 5T6BA 5EHGA 1ORIA 3CJTA 4CWAA 3L8DA 3LDFA 4B17A 4OQEA 3ERCA 4IWNA 1O54A 1NW7A 1G8AA 4PWYA 4KDCA 3MTEA 5ERGB 1YFLA 5GP1A 4ISCA 4M37A 3BKWA 3LBFA 4Y30A 4C04A 2H1RA 4YUYA 2JHAA 5D1NA 4F86A 3EVAA 3HCAA 3G5LA 3FUTA 1XTPA 4AUKA 3DR5A 3IV6A 4GUAA 3PFHA 3KQTA 3MCZA 4M7RA 3RW9A 1B42A 1AV6A 5LQAA 4DM3A 4MTLA 2IH5A 4CKBA 5E2BA 1I1NA 3LGAA 4RSRA 2VDUE 1XCJA 1YB2A 5DT2A 5C0OE 2G1PA 3HA5A 4WXHA 4DCMA 3FUUA 3EGVA 4PYLA 3AJDA 5EEGA 2IFTA 1G6Q1 3SSOA 2DULA 2GA9A 5EVJA 3LL7A 1QYRA 2AOWA 3RODA 1VP9A 1BC5A 1NW5A 2VS1A 3FPJA 3FPFA 5E9WA 5DRTA 5HZMA 3QOXA 5DSTA 2PY6A 2IIPA 3P97A 5IKMA 7MHTA 3OFKA 3P2EA 2P7HA 4PNEA 1NT2A 1SQFA 2O07A 3O31A 2ZLBA 3BXOA 5EIWA 1NW3A 3UWPA 1VPTA 2NXEA 2FYTA 2IGTA 2JH8A 3LDUA 3P9NA 3HA7A 4EQZA 5D1HA 4HTFB 3ELYA 2EG5A 5CCBA 2PSSA 5FHQA 2QYOA 2FK8A 1FJXA 2PT6A 1JTFA 1VL5A 3CBGA 4IV8A 2YXDA 4IV0A 5EQJB 2NXNA 3B89A 3DMHA 3JWJA 4PONA 4DCGA 5DM2A 5LQKA 1HMYA 2ONZA 2C7PA 4P7FA 3A7EA 2YTZA 2DPMA 3I53A 5FULA 4PYMA 5C1IA 4DMGA 2CKDA 1G38A 3SSNA 10MHA 1BOOA 1KYWA 5EMJA 1WXWA 4RTRA 4V0QA 1NV9A 2ZWVA 5CVUA 3OPNA 2NP7A 3GRYA 4PINA 3I64A 4XUEA 4HC4A 4OA5A 2ZCJA 2ZWAA 3LCCA 3T7RA 1INLA 3KPYA 5ICCA 1YZ3A 2UYOA 3UJ8A 4ZTBA 3A7DA 4JXJA 5FADA 3D2LA 5F2OA 3B7PA 3HCFA 3ELWA 1T43A 1RI2A 3AWIA 2WK1A 2ZVJA 4FT2A 3TKAA 1XXLA 2ZIFA 3UA3A 1Q0SA 3HVHA 4LG1A 1NKVA 3KR1A 4GF5A 1VLMA 5DWQA 3GIWA 2OYRA 5EMMA 2V7EA 5CD1A 4GC5A 5K03A 1QAMA 1RJFA 1XJ5A 3P8ZA 5BP7A 3HNRA 5DTQA 3EVZA 4PYNA 4RTMA 3LSTA 4QPNA 2H00A 2ERCA 4PGHA 3G2OA 3FUXA 1TPYA 4R8SA 2QRVB 3DLIA 1YUBA 1DUSA 4OQDA 3GRRA 3OZRA 4KRGA 3BT7A 4KVZA 3HTXA 3VC1A 2I6GA 1M6EX 1BKYA 1YZHA 3BUSA 1U2ZA 4MHTA 1WXXA 2PT9A 2ZW9A 5CUQA 1KP9A 3M6UA 2UYCA 3KQSA 1KPIA 5G02A 2PX8A 1N2XA 2BM8A 3R3HA 4BP3A 3S68A 3EEOA 3JWIA 1ZQ9A 3FPEA 3KKZA 4LWOA 4E2ZA 1X1BA 3HCDA 3UA4A 3FTEA 3HCEA 4OBWA 4EKIA 3JWGA 5EGSA 2YX1A 3DP7A 5GINE 1FP1D 2XYQA 2ZTHA 4HTFA 1R18A 1O9HA 2PX2A 2NXCA 2VDWA 3CKKA 3PX2A 2CMGA 3C6KA 5GOZA 3KPVA 2QY6A 2HMYB 5T67A 1OR8A 5K01A 2XYRA 1O9GA 3Q87B 4BLUA 4RTSA 4R8RA 4HGYA 2KW5A 5HIJA 4X60A 9MHTA 2JHPA 1KYZA 4FT4A 1JQDA 5KS2A 4BP1A 1KPHA 4YV2A 1SVUA 4YMHA 1M6YA 2OXTA 4DKJA 3OZTA 3GRZA 3GWZA 2AN3A 2OPBA 2PKWA 4K6MA 3THSA 1G55A 3FRIA 5HOQA 2FHPA 2C7OA 2PWYA 1Z3CA 1IM8A 5JR3A 3DUWA 3PFGA 3NTVA 4E31A 3GRUA 2IBSA 3GO4A 3GRVA 1X1AA 3NDJA 1VE3A 4LWPA 4ATNA 1SQGA 3MCTA 2Z6AA 1D2HA 3LX6A 5HFJA 4P7JA 3M6VA 2AOUB 4PYOA 5EKXA 1JG4A 5BW5A 1WY7A 2O06A 2BZGA 1M0EA 5DSXA 2BM9A 3KPJA 5LSAA 3DLCA 3GNLA 4KW7A 3IEIA 1F38A 2FRXA 3HP7A 1RI4A 3FZGA 2N47A 3HVIA 4C06A 5GM2A 2B3TA 2FK7A 2HNKA 4KIFA 3CJQA 4PCLA 2PVCA 3EVDA 5DPMA 5EC8A 1UWVA 5GM1A 4R6XA 4YUVA 3I5UA 3FPHA 3NWBA 2VDVE 5E8RA 3EMBA 4EMSA 2I62A 1D2CA 4ER6A 4OA8A 1QAOA 3ID6C 3K0BA 3B3GA 3V8VA 1UFKA 2AOVA 5KQRA 5HIMA 1FBNA 1L3IA 2EFJA 3LPMA 2YXEA 5EZQA 3TLJA 3SSMA 2QRVA 2C7RA 3RIEA 1QZZA 5GIPE 2AN4A 2P8JA 5K0LA 3FPGA 1NE2A 3KQMA 5CIYA 3GCZA 1G8SA 4C05A 5LQUA 1BHJA 1JG1A 4QDJA 4PYJA 5KYGA 3NWEA 3M6XA 3DMFA 3T0IA 3R0QA 2CMHA 2IP2A 2Y1XA 3VC2A 4EK9A 2CL5A 3EVFA 3KQYA 5DLYA 4RVFA 2EJTA 3VSEA 1AQJA 4RTPA 1EJ0A 2V74B 1P1CA 2XVAA 4YMGA 3MHTA 3UJ6A 2NYUA 2ESRA 3UJDA 2OB2A 5DX0A 5HIKA 2BH2A 4RWZA 5GIOE 3B3JA 4FSDA 4QPPA 3C0KA 1DCTA 3F4KA 3LBYA 4C07A 2K4MA 2VP3A 3ELUA 3HVJA 4H0NA 3C3PA 2WA2A 1UIRA 3EVGA 3PX3A 4KIGA 4PYKA 1KXZA 3P9CA 3M33A 3UJCA 5E1MA 5CVDA 4YV0A 3MQ2A 1PRYA 3A27A 1Q0TA 2O0LA 4GOLD 2UYQA 4XUCA 5CVVA 3C3YA 1IXKA 1V39A 2YXLA 2GLUA 3TR6A 4QVKA 5DM4A 4GC9A 3TFWA 1EIZA 5KVAA 3G2MA 4KWCA 5EHIA 3OE4A 3CCFA 3TM5A 4EKGA 1TW2A 2P41A 3ER9A 2PX4A 2PXXA 4RTOA 4PIPA 2G8NA 2HV9A 3LECA 4C4AA 2E5WA 2B9EA 4RTNA 2XBMA 3MTIA 2PLWA 1R74A 2ZZKA 3KPUA 3NVMB 3G88A 3E23A 4E33A 3UJ9A 1RJDA 2QM3A 3GDHA 4R6WA 4RVHA 2PGXA 3NJRA 2AZTA 5LQNA 4X61A 3EVEA 2Z6UA 3LCVB 3KQQA 2UYHA 1QANA 2AOUA 2P35A 2ZFUA 2YVLA 3EEYA 3LDGA 1EJ6A 5FCDA 1VQ1A 2JH9A 3KU1A 3FYDA 3U81A 1NW8A 5HILA 2P3OA 5E1BA 3GXOA 3FRHA 4AZWA 5CVJA 1JQ3A 5ICGA 3AY0A 1XCLA 1XVAA 4PCAA 4PGGA 4QTUB 3VYWA 4BLWA 4E2XA 3B3FA 3DMGA 3LKDA 5FWDA 4HSGA 4BLVA 1NW6A 3LKZA 5K0CA 1D2GA 2QE6A 3GU3A 3I58A 1P91A 2GS9A 3BZBA 4P7GA 4ER7A 3ORHA 5LQCA 2HWKA 1MHTA 4O29A 2O05A 4CTJA 3O4FA 3DH0A 1H1DA 4V0RA 3DTNA 5K0NA 3SX0A 3FTFA 2A14A 3TRKA 4AZTA 1TW3A 3UJ7A 4RTLA 3UFBA 3T7SA 3OE5A 2OB1A 1ZGAA 1IY9A 1F3LA 2G71A 2PV0A 4DZRA 3P9KA 1ZGJA 4R05A 4YV1A 5IH3A 1SG9A 2FPOA 1RJEA 5EMKA 4QQNA 5DM1A 3CC8A 3FUWA 3OU2A 5K0FA 4A6EA 1XDSA 4E30A 3E05A 4Y2HA 3BWMA 3IHTA 3KQVA 5EEHA 5BXYA 2UZ4A 4U7TB 3OCJA 4GEKA 3BKXA 2GB4A 3FTCA 3M6WA 3TKYA 1AQIA 3KQWA 3QV2A 5DX8A 3HCCA 2C7QA 3JWHA 5EZSA 5BW4A 4DA4A 2PBFA 2PJDA 5LR6A 3SMQA 5DRYA 1L3BA 3SXJA 3BGVA 1YF3A 1FP2A 3OZSA 3MERA 4IKPA 3TPZA 3MAGA 1JSZA 4E2WA 1WG8A 3BGIA 2EX4A 2P3LA 1R8YA 4L7VA 4RV9A 3BWBA 3A25A 4X1OA 1KIAA 1I9GA 3FUVA 5E2AA 4MQ4A 3KR2A 5FUBA 4QQKA 5K0GA 3A4TA 3DOUA 3NVKI 3GJYA 3TMAA 3TM4A 3KPWA 4DF3A 5MHTA 5DM0A 4E32A 3A26A 2ZIGA 2AR0A 5DX1A 3ER8A 1XDUA 3UZUA 3UBTA 1JR4A 4RTJA 4EVIA 2PX5A 3G8AA 2IDKA 1JG2A 2Z6QA 2BR5A 2JHCA 5EOVA 4AZVA 3TQSA 3DXXA 3HM2A 2NXJA 5E1OA 5EMLA 2BR3A 2I7CA 2P1DA 2ZZMA 2IPXA 4P58A 3R9XB 1KPGA 4ER3A 3KR9A 3O7WA 4FS8A 1JSXA 2B25A 4M36A 4OX9Y 4MWZA 3BGDA 4RYLA 4F85A 5F2KA 5ICEA 4P7KA 1MJFA 4RX1A 4E2YA 2ADMA 4PYQA 3CJRA 5FHRA 3MGGA 4U7PB 4X41A 5FQOA 4OBXA 2GH1A 4ER0A 1R6AA 2B78A 1JTEA 4E70A 3NDIA 3THRA 4C03A
chains in the Genus database with same CATH superfamily
2VCYA 4H9GA 2ALJA 2A0YA 1GTVA 5FWYA 3H9QA 1SCBA 1GPUA 4I9UA 4UNSA 5H59A 3TXAA 3HY4A 3AV0B 4PPFA 2IOFK 4LMRA 5FOSA 1HUQA 1G4UR 1Q3TA 1XZGA 5FPPA 5I7EA 4S05A 1QNFA 3HDYA 2Z95A 1MOPA 5AKZA 2AOXA 1XIVA 2QM7A 2B2CA 1HEYA 3DUFA 4G5FA 4NCHA 3KZKA 4FE4A 2WU4A 2BM1A 1GKYA 3D8NA 4R2KA 4F5WA 3U4AA 1RWOA 1EB8A 2FOXA 3HJHA 4IBOA 4ZMRA 4HRAA 4OXIA 2QMUA 4D9HA 4JX9A 3UK0A 3WG9A 3ZX4A 4QDKA 1YHZA 4KPUB 1WY5A 4EHDA 2AI3A 5CH3A 3PVCA 3ETNA 4BLOA 1QHHB 4AJHA 4Y7DA 1ESZA 2R68A 1UBRS 3HWX1 4H08A 4BQSA 2R4UA 1IZ9A 1SXJC 4WVLA 3UB2A 3L6BA 3V97A 1Z47A 7YASA 5KYKA 2MR6A 2O2CA 2R8RA 2V54A 2PRIA 4GICA 3O1JC 4XSHA 4RTRA 1KI3A 4ZQFA 5LQRA 2ODNA 3JVDA 4PPYA 3VHLB 3ZWVA 5BRNA 5IU6A 1V5WA 2W83A 5C7OO 2CVPA 5FWAA 3F97A 2IIQA 3SJBA 3N1UA 3BHIA 5FUMA 1UMDB 3UHOA 2B94A 3FZNA 5A5DA 2VCHA 2B1RA 1T5SA 3WLJA 4LS3A 2RHOA 1FP4B 2B30A 1G291 2IEYA 2IYWA 3BE5A 3DSRA 4TT8A 4QGSA 4YRIA 5BURA 5JJCA 1GCAA 2AFRA 3B1WA 2XR1A 3EZYA 3H8SA 3NJ4A 4FFOA 4PLGA 4WW0A 4YS6A 3U3RA 2I34A 1PZNA 1K8ZB 3T41A 3R7AA 3UPDA 1NBIA 3W5DA 3U44A 3K5PA 1XRPA 3GZ4A 3TVTA 4OI0A 1KI6A 3TZCA 4C4ZA 5AK0A 4DR1B 4XGQA 2XA1A 4HKTA 1UKEA 2I9KA 3SVZA 1TZBA 4REQA 3HGQA 2CLFB 3RC3A 2BGWA 2YW9A 4D9KA 4ZEVA 3BIWA 3A1UA 5AIBA 2WIAA 2XCTB 1LPPA 1B1CA 5HK9A 4Q1EA 4MQ6A 2XVMA 3LDHA 3IAUA 4OI4A 3FFXA 1X39A 3WP0A 1GUFA 3LWZA 1O03A 1AGXA 1L4UA 4WFQA 1AA9A 1CUDA 1M9NA 2OQRA 2W43A 4FOTA 3SX2A 3B1JA 3VPHA 4C08A 3U80A 1KK3A 1AMOA 1BE0A 3RS0A 4CLRA 4RTKA 4P0TA 1LH0A 1L1RA 1EJ2A 1FFXA 1IUNA 3P2OA 3H3FA 4IOMA 4O5AA 4RVUA 4EHFA 1RZRD 1RRVA 3SZLA 1CR6A 1W4ZA 3OUZA 1BU5A 1YCFA 4QU9A 2FEAA 4EH1A 3CX4A 4O4IF 5E6UA 5HGXA 4IZIA 5ALZA 2XMSA 3C6BA 2A2ZA 2WUEA 1AQNA 1Z18A 3ANXA 1GCOA 4FYVA 1V1MB 3M1YA 3V4SA 3X2SA 3ZHYA 5KQLA 5CFPA 5EIFA 3ROQA 4CMKA 3AEQA 2V6JA 3FNHA 3EPLA 1U2QA 4FE7A 3EMDA 5T8KC 3NV9A 1X94A 1JG3A 3Q3IA 3QFFA 4YV7A 3S27A 1YBFA 2BEUB 2ISCA 4J76A 1L8XA 2OHIA 4C0BA 3OKPA 4X6UA 1JH8A 5CLLA 1CF4A 4LZAA 4JV5B 3QBEA 1PT6A 4D8UA 1USIA 1AQLA 2VR1A 2VBFA 4V39A 3LOQA 3ROPA 3TUZC 3ELBA 2XT9A 3G79A 1DL5A 3ABIA 5PNTA 4DIEA 2OLKA 4X24A 1MB9A 2I4TA 2WBLC 4KITB 3EXEB 3K2EA 2EW2A 4RPCA 3RIHA 1G2QA 4HJXA 3FHJA 5IKXA 1IAQA 3QEMB 4EG4A 3ERCA 1R37A 2PBLA 4PWYA 3MTEA 5CJ2A 3AEUB 1H3NA 2CKMA 1DQSA 3CKLA 3I3OA 3R23A 3I61A 2H48A 4R1QA 3V4OA 1NE7A 3HCAA 4E3ZA 4FSHA 4ASUA 3IMCA 2JD1A 4FHGA 4TYQA 5AP9A 3WK9A 4B6RA 5LN1A 4GYWA 1AV6A 4D74A 5AW4A 1JEYB 2IHYA 3HWSA 5E2BA 4C0WA 4B6PA 2A5YB 1F2DA 1U28A 4WNAB 3LDAA 5DF1A 2G1PA 3HA5A 5F7OA 3WDLA 3FUUA 2PA3A 3AF4A 3MUNA 3L0ZA 3Q9LA 4KOAA 1V16A 3V4PB 3VPFA 4QJ4A 3U16A 1MG0A 2GRUA 3O0DA 4MUKA 1R15A 4BX9A 1QHXA 5DI3B 4BN5A 4JLVA 1E3QA 1OT3A 1Y3BE 1Z4MA 2BEWA 4LY3A 1DV2A 1KDRA 2DFPA 3THWB 1H3EA 3RC1A 2GHRA 2WEKA 3NKLA 1CUCA 5DSTA 4C7JA 5HZMA 2G63A 5T3YA 3TW8B 2RGRA 3GR6A 1ULAA 1MCZA 3ZC3A 4KH1A 4CMIA 1Y6JA 4OUKX 1ODSA 1G8PA 3WLMA 2CNKA 2ZLBA 4TXNA 5THQA 3ROKA 1P17A 3BJRA 4EG7A 2B99A 2KYRA 3MWFA 3U3DA 1NRIA 4BIMA 2ISSD 3VMFA 4BFLA 1QPBA 1M2OA 1UFOA 4X1IA 3SFVA 3LO8A 1YU6A 2NZ2A 4XM1A 1N6KA 1B23P 2ZPTX 3TINA 3CBGA 1QVRA 4FGKA 2QX7A 5B36A 1H2AS 4ENUA 2YMPA 3DG9A 4JJFA 2C1XA 1VMIA 4OSEA 4IDDA 3H7AA 3KKKA 1U0SY 4BNVA 2BMJA 1VL2A 1WHSB 1WZIA 3FRJA 3AUXA 2WWFA 1JIVA 3HJCA 2UUAB 3PQ8A 2B1JA 3IUEA 4P3PA 1UC4B 1L5FA 1EQUA 5LBUA 4GPD1 2NP7A 2YN2A 4UDOA 1RHMA 2NT4A 5B58C 1UDWA 5SZIA 4F1WA 5A4MS 1TUIA 4HNAA 1D0IA 3ZHBA 2FVYA 1YC5A 4JT2A 3V4LA 2KHZA 1NU6A 2W2MA 3WL7A 5BR1A 2BV3A 5ERYA 3STWA 3ZGXA 3MBIA 4D46A 1PYDA 4DBVO 4IILA 1OWOA 3I37X 1Q20A 4Z8XA 5BN3A 1PN3A 2NPOA 2QLLA 4LUCA 4YECA 2GZ2A 2WTAA 3GHYA 1OROA 3Q7PA 5FIUA 1N0HA 3VR6H 4LYAA 2GN4A 1TFRA 2J7KA 1ZOLA 4BNWA 2OFXA 3NH9A 1U0BB 2EBFX 5TPZA 5FF9A 2V8BA 3CRQA 1R8SA 3K0CA 4L02A 5DNDA 5EMMA 2F3RA 4IZOA 3UAGA 4ZN6A 5EHNA 2VJCA 1HE8B 2BWJA 2VDKB 1K98A 1LBEA 1OXXK 4QXPA 2HL6A 2RD2A 1DZ3A 4XB6B 3LSTA 1Z0FA 2FLVA 2ZCVA 3NC4A 4LXIA 2E85A 4BU0A 4DABA 2YMMA 3MA0A 1L4LA 3OZRA 1IDN1 1Z6TA 2QRKA 3QX7A 4KRGA 1MHPA 4XA8A 3GUUA 5JSZA 4FDTA 1S6YA 4FB5A 5K2OA 4K9DA 1T2UA 4KLAA 1EINA 1CUVA 4V2IA 4AJNA 1MOQA 4N0EA 3L1KA 2HEGA 2PD3A 4AG3A 4J1SA 5G02A 1GUAA 1NBME 1WOMA 3L7MA 2PNJA 2JEYA 2RE8A 4BP3A 4E4RA 3JWIA 3O1LA 5JNSA 1C1XB 1E0KA 3EVTA 4UM9D 3O8RA 1SHJA 3JWGA 3L49A 3NIBA 7REQA 3VR5A 1TZKA 3OEEA 3T7CA 2OGSA 4ZCLA 1H4QA 2XVYA 1X2BA 4QLOA 2GTHA 3ANLA 5KDOA 2VYND 4OYYA 4J4HA 2I76A 5GOZA 2O2XA 5A71A 1J5XA 3GDOA 2CUNA 4R8LA 1E1DA 4NBSA 4K9RA 1B6GA 1Z15A 2TSYB 3EEQA 3M3PA 2A5GA 4BMZA 4BU1A 4OPMA 1DAOA 5F3DA 5EWJA 4Q3CA 5JATA 3ZS8A 1I1QB 5KS2A 1E1QA 2C7BA 1IUOA 2ZUUA 3TJMA 3UK1A 2EQBA 2JRLA 3EZNA 1QO7A 4V0ME 2NUBA 3H17A 2Z6VA 2R48A 2JLVA 1W87A 3V7UA 5EUCA 1Z3CA 1NN1A 4L9AA 2ZUEA 5EXPA 3JPWA 1P60A 3IBFA 1XN1A 3GRUA 1UKZA 1BA3A 4LZJA 3ZJUA 5G2OA 5A5FA 1SQGA 3MCTA 4NARA 5HFJA 3A1SA 1QGDA 4J29A 1J2YA 4EATA 2ZBUA 4UEQA 5A6SB 1KBQA 3ZD9A 4CIWA 2OP1A 1PDWA 1MKYA 2QPAA 1J8VA 4IR7A 4LV5B 1NRJB 3E35A 4FYIA 4K6CA 1N5OX 3AT1A 4E7OA 4Q4HB 5ALFA 3SBOA 3EMVA 1OZFA 2H2FA 3U37A 4CE6A 2QVZX 3WWYA 3FTQA 2OAEA 3U1TA 1HSOA 3PUHA 3QMMA 4G23A 2R6GA 4TRRA 4EFNA 3A6GA 3IMEA 5L4SA 4L85A 3DBLB 2FR8A 2BF4A 2P91A 3LPMA 3UUFA 4B75A 1G4HA 4CMEC 3FI0A 2WIDA 2QRVA 4YA6A 3IP3A 1J22A 4D9GA 4PZCA 4TZTA 4WZZA 1MGPA 4HV4A 1CZKA 4PW0A 1A69A 3QLUC 4MOWA 4PS0A 1V7ZA 4UDNA 3PPXA 4OAQA 5AW7A 1XTKA 2H1WA 3GJ4A 1ECJA 1Y9ZA 2ETVA 1FYDA 3H2IA 1JB1A 1ZNYA 3L0DA 4M8KA 4BV2A 5DLYA 5I5GA 1YKSA 3R0JA 3UMMA 3PZBA 1JA0A 2AEMA 3AR7A 1FX0A 4QE3A 1N2HA 4IIYA 3WHKA 3ZIDA 4P98A 2BH2A 3HBMA 2YZ2A 5TVGA 3QSYA 2C3OA 1ECBA 2WM2A 3FXAA 3WZMA 1MN6A 4AN0A 1NXTA 5DNUA 2VAWA 1D7AA 3F4KA 4M53A 1ITZA 4DCCA 3VGPA 3E9EA 4MVJF 3C3PA 4BJ5A 4C0AC 3EK2A 2P67A 1TTTA 3GMTA 3EGXA 1NYTA 3C7DB 5FOUA 3KFLA 3E2IA 4HN9A 4AYWA 2VBGA 2G4CA 1OXUA 2QW1A 4ZU6X 4XUCA 1IN7A 2A58A 3QLJA 3H5RA 4EELA 1Z17A 1J42A 1EGAA 3P26A 5FPHA 1BEUB 1IN8A 3EJWA 3W77A 5BSGA 5GONA 1YCDA 4GW3A 1VPVA 3LHIA 4PO1A 3VU1A 1MA0A 2BGIA 3HBAA 2CNWA 2X6QA 3KOZA 4D0RA 1OLXB 1CUFA 1X15A 1V3TA 4L08A 2ZB4A 1NJFA 4LRWA 2OVFA 1XWFA 3KPUA 3HPRA 3QPDA 4M9UA 2XMDA 1XK7A 1EXMA 3L8EA 5CA0B 2EVWX 4OXYA 1M2HA 4JI7B 3CU5A 2OCYC 3AP1A 3GWGA 4INPA 5CA1F 3W4IA 3FOAA 1SUWA 2UYHA 1UODA 4W1SA 4II3A 5FPSA 5IVDA 4BNGA 1Y6RA 4Q9NA 5IEBA 5LL6P 3JD3A 1J0XO 4IS2A 4R68A 4C89A 2VUTA 4QDUA 4D81A 4DRZA 3GXOA 3H1GA 1V7PC 1XVAA 2DBYA 4UUNA 2HSZA 2WG1A 3DMGA 2RCNA 2RHMA 4Q66C 3BSFA 5CTAA 4W5OA 3QF4A 5AH0A 4I9NA 1OA0A 1CUBA 1W73A 2IE0A 3WLTA 1UJ4A 1LJ8A 2Z09A 4YLGA 2BGLA 2DQ4A 2YNMA 5E38A 1UUFA 1DAIA 1ZI6A 1YJ8A 2IX9A 3NBMA 2DQZA 4LZPA 4RPGA 1J8DA 4PHHA 3TSYA 3ZJTA 2DJIA 3TX2A 3ZDEA 3ABZA 3T12A 1TZCA 7AT1A 1GPAA 1M1NA 2HSWA 3RCBA 4NNJA 4TS3A 3AR5A 1S2DA 3GLSA 2O8NA 1SG9A 4NV3A 4DGSA 2CNOA 4KK3A 1H6DA 5CH8A 4KK4A 1MFZA 1DAMA 1NNLA 3PDWA 1IJKA 4IXWA 1A2QA 3F9RA 4PQRA 4UD6A 3ZZNA 2C3UA 1ECCA 2UUCB 1MPXA 3DE1X 2GB4A 2QRQA 3UQZA 3OQIA 3KQWA 1U3DA 3D0KA 1U8CB 1TUEA 4O4JB 2XCSB 1U3VA 3Q5DA 2C9CA 1B15A 3IP6A 5TMBA 3LRXA 1XCOA 3WHIA 3B60A 3PQ6A 3VGJA 3LUDA 2IOQA 4TWJA 1ZA2A 4AT1A 4GKKB 1EX6A 1OLUB 2ZYRA 2GCGA 3X1KA 1JXOA 2Q6VA 2IT1A 2V65A 1K4KA 3EY9A 3QPVA 3R44A 5FL3A 3LIPA 3F3YA 3CX6A 4EG6A 4UQPA 5FUBA 3DOUA 3E9ZA 2FWIA 4AJ9A 4YALA 2AV6A 1IPFA 3RSOA 1KDVA 4UCFA 1JEQA 4ECEA 4RY0A 1NWHA 1ZRSA 2OSBA 3EULA 3M2PA 2JI4A 4KRYA 3ZHQA 4DTIA 4RJTA 4RD0A 1AU9A 1FXWA 3VBCA 1ZIXA 2JGFA 2FN3A 1SXGA 5TJHA 3I9KA 4B87A 4BTVA 4C14A 1FW6A 1D2NA 2Y0CA 2HSJA 4DV0B 5EOVA 1NJ8A 2ZB8A 3PWZA 2IP1A 2A3NA 1KI8A 2HV8A 3M7IA 1JX6A 3C7KA 4P3KA 3H1TA 1Z5WA 2FWNA 4HFNA 3RH0A 3CINA 4R98A 6ADHA 3OM1A 1BW9B 4FYHA 1BKSB 5DHRA 2WYOA 2JAOA 2WAAA 2H1IA 3RUEA 4IVPA 1P7VA 1NNSA 1ZA1A 4G1FA 4ZI7A 4Y1EA 3RIGA 2CCKA 4Q3LA 3R41A 4H4CA 4J1TC 1JSRA 3TSOA 4BBJA 1B1AA 1NZJA 1OZAA 3EG5A 3KJEA 4C03A 3P0FA 2GSDA 5J23A 4DCTA 2P9BA 3R5KA 2C96A 2I6TA 1IBRA 4NPCA 1M1YB 1WF3A 3ONFA 3B3QA 2QI9F 5JQGF 1DJLA 1P7WA 1LQUA 5EJ6A 3ZXIA 1Q11A 2XUDA 3EIQA 5EKSA 1CJTC 4BN0A 4KYUA 1U99A 3HI6A 1XQ9A 2Z0MA 3PV0A 4LWZA 3ENNA 5JXGA 1RVDA 5REQB 1KFKB 2XOXA 4MHOA 1P45A 1SA0B 4G56A 5BORA 1PIWA 4MLPA 3RG2A 2DUJA 1QCCA 4ZOCA 3N2KA 2HLDD 3FVQA 3EFEA 2CN1A 1WWKA 2X40A 1XVVA 3GLHA 3JTEA 4K3UA 5P8WA 3VPBA 5BMVA 4IDHA 4BWVA 1BH2A 4J9UE 5LA6F 1ZK2A 2GRJA 3CEPB 1YR3A 3BGSA 4QAJA 1NQXA 1W2HA 1CY0A 3RI3A 1BOFA 3KSRA 4E09A 4KWEA 1E2HA 1XMSA 3C6MA 3JQDA 4Y2TA 5IKOA 1GDDA 1BO6A 3D6FA 3RC9A 4YCJA 3CLHA 4DBLE 2A5JA 2QN3A 4NFYA 3WQRA 4CF6A 2KPOA 3TOSA 2PLRA 4RGQA 2F43B 3SN6A 2C59A 3SIWA 1MXFA 1WULS 1ZUNB 3AGQA 4J0CA 3TMYA 2KMLA 1ZJ6A 1QPZA 3G0OA 1O4WA 1YA8A 4RAOA 4ZO6A 2VIIA 2B36A 3L8YA 3LCUA 1PUIA 2LCQA 5CEEA 3QEOA 1I7NA 1TLLA 1MC8A 1ORWA 2OC9A 3ORFA 2VSXA 3T6KA 2AEEA 4CKBB 4YRZA 2P5UA 3IQWA 1G5TA 3CUEF 2DCUA 4EFDA 1E63A 3DL2A 4HO1X 1P1JA 5F78A 4KR3A 2RGAA 3AETA 2G8LA 4ZREA 1PWHA 1PZGA 3LUAA 2WVAA 4J7UA 4BWYA 1Q92A 1EH5A 1EM8B 1RW4A 4R31A 5BQ5A 1VMEA 2VHCA 2F3QA 3ANTA 1TIKA 5G0SA 1EBBA 4MIOA 5D3KA 2QRJA 2FPUA 1TA0A 1H8HA 1ZO8A 2PQ2A 3HN2A 1AQ6A 3T3EA 3Q88A 4PC1A 4ZDJA 4YWJA 1Q77A 1J25A 4LV6A 3GGDA 5ICFA 4KQEA 1YTLA 2PDAA 4V0MA 4XQEA 4DMHA 2CF6A 3PZRA 3RFUA 3LC1O 2I54A 3TKLA 2XE4A 2XB4A 3OFJA 2OAQ1 3Q3HA 2GN2A 2VDMB 2X8AA 3AJEA 4LXUA 5JISA 1IHPA 4DJ5X 2FW0A 3PYMA 5IRCD 2C20A 1LF5A 1ZG3A 3AKDA 3JQBC 3CUSA 3QKWA 1MF7A 1K8QA 2AUTA 1E58A 4LQ4A 1CFZA 1Y1LA 4Y2VA 3AGPA 4RJJA 3EFHA 3IQDB 3BREA 2PXAA 1B0ZA 3ASVA 1N78A 1TE2A 4F56A 1FPQA 4KPUA 5M5BA 4DMKA 2V9ZA 4HG2A 1IZZA 1SUSA 4I4IA 2R2AA 1QHHA 2I33A 1TNDA 2AXPA 4KTTE 3USES 3WLKX 4V0OA 1Q7CA 3OCXA 4UAGA 4DYDA 1ST2A 1D03A 4B3DA 2DYKA 3LW8A 3HY6A 3QKTA 1ZD9A 2GJAA 2WHYA 521PA 2QN9A 1LRLA 2XMGA 3KQPA 4FLFA 4R1UA 1GT6A 1NI3A 2ZRIA 1IATA 2C4TA 4QUKA 3K0FB 1E96A 2XLBA 4RQTA 3CLSC 3IP1A 5A0TA 1UMDA 2HWUA 4L8GA 1WKCA 2CZGA 3E5MA 3W6ZA 1WDWB 1B3BA 1FS5A 3MGAA 1FTWA 4IDAA 1KQPA 4M1OA 4XI9A 1NP6A 1ONOA 1PR4A 3BG5A 4X7BA 1RIFA 3RVMA 4JEUA 5CEJA 4PO9A 3REQA 4TMYA 4Z9BA 4U39A 3KQTA 2AD5A 1AK9A 1R9GA 3SF8B 5E0KB 3PUYA 4PZUA 2GN1A 3ZE7A 2QZJA 1IBLB 1DC3A 1LBTA 1M6WA 1V96A 1O96B 3ICPA 4DMRA 1V3QE 4RETA 4ZALA 3FHTA 4W6ZA 1K06A 3BRCA 4HQNA 2HSEA 1Z5UA 4J90A 2P6MA 1PR3A 4PAGA 3S8EA 1G3RA 3MSCA 2VSNA 3VPAA 2Q0QA 5B2ZA 5HSGA 4W1PA 3K3PA 1QRDA 2BOVA 4KZKA 1XTJA 2F1OA 2IIPA 2PL5A 2PZMA 2VHXA 2ZQZA 1Z7YA 3P2EA 5AK3A 5E0OA 5F9MA 2ZUTA 2ZRFA 4K2AA 3DQQA 4HX5A 4LJ6A 1O6CA 2YS6A 3QXCA 2BHRA 4GX5A 4M9QA 4ASUD 2OPHA 2QTNA 1FDTA 3A1NA 2QLFA 1IRIA 3HMKA 4YQYA 3RTBA 4UULA 3T1YB 5JDIC 1PEDA 3ELYA 3A06A 2JJ2A 2Q3MA 3D7KA 5IHXA 1DC5A 1V1MA 1RJWA 1G0OA 1Q7BA 1GA6A 3P4UA 4L22A 2BP7B 4PONA 2A5FA 1DAPA 4F8JA 5JYDA 4QQ8A 1Z74A 3JSAA 3PUZA 1XZIA 4Q15A 3F49S 4PYMA 2GF2A 4QEKA 3W9YA 2Q3FA 1K5GA 1V26A 5FI5A 1G38A 5KZMB 2BEUA 1MX5A 1IG0A 1HTWA 4JN6B 5IDVA 1ETUA 3ZHRA 1QJCA 1B14A 1IXYA 3V6MA 3MS7A 2ZE5A 4E7PA 4M8LA 3CSDA 4GPAA 1OBHA 1R5JA 5ECGC 1QZTA 3M4YA 3T7RA 4CM9A 2CLOB 2ZM5A 1KR2A 3BSSA 3FJOA 3NTRA 4P31A 4P7BA 2M98A 3EXEA 5JS2A 4XQ0A 5H3HA 4LXYA 3RVJA 3A2KA 3QEMA 4JXJA 3D2LA 1TJNA 5FUYA 4DR3B 5DULA 1Y7IA 2CB9A 1ENOA 3L7AA 1QQ6A 4IDNA 1I7SB 4L50A 3EIWA 3OD1A 4QT0A 5IYZB 4CEIB 4MR9B 5TS2A 3UA3A 4NNPA 1YR2A 2AE2A 1KMNA 2YXBA 4X3CA 4G3XA 2UUBB 4GC5A 1GKIA 5I7WA 5IT0A 3WAJA 4ARIA 1KBOA 3GRKA 4PYNA 5AOAA 2EKQA 1U9IA 4QPNA 3OPYI 4MJ7A 2A67A 3HZRA 4WNAA 3FBTA 1PWXA 3E82A 2XZTA 3RSLA 1E77A 3GRRA 1ISFA 3PQ2A 2C2YA 1LK0A 1RQXA 3NDRA 1ORTA 1L7RA 3QSGA 2GARA 5IJXA 4MHTA 2G06A 3CVYA 1TGYA 1W47A 1CZNA 1XF1A 1Z68A 2UYCA 1YAJA 5A9TA 1O6BA 1Z0IA 3UKOA 2ONKA 1E8NA 3C3AA 4MARA 5K4AA 4OGFA 3TW8A 1G8KA 2OESA 3AF0A 5D3MB 1E69A 1ULUA 5TIIA 2Q28A 4FBLA 3HCDA 4I50F 1L5OA 2X0DA 3UWMA 5AVTA 3FTEA 3CV3A 3R74A 4YAUA 2DT5A 2HMUA 3MMNA 5M3BA 5TPZD 1ZZEA 2GLXA 1WX1A 1O94D 3HXPA 1YJ5A 1OGIA 2WYVA 4ZYWA 1K3FA 1IHXA 1DTSA 2QTZA 4V0SA 1A8SA 3G0DA 1A9XB 4UE6A 1JU3A 3WFZA 4B34A 2H7YA 4CNQA 3MT8A 4PZPA 1A50B 2LCFA 3GK3A 1E59A 2JHPA 1Z35A 2C5EA 2PXHA 1CZHA 3E1GA 3IOYA 2CXTA 5COAA 2X0FA 1C1YA 2JI9A 1KPHA 3VVLA 2SICE 3QV1A 1L7AA 4C20A 3CF4A 3GVIA 3OZTA 2QNBA 3KYCB 4OJNA 1F20A 3UJ3X 1YE8A 2AT1A 2X6RA 5HOQA 2C7OA 4ABYA 1OVMA 3CB4A 4MQLA 2HW8A 1GZDA 3O6VA 1RRGA 1X1AA 3CVXA 4CTNA 1EWRA 2ZTLA 1GTJ1 2H1SA 3I45A 3WQSB 4PYRA 1MVOA 2PU5A 4IX9A 4M7WA 5AICA 4Y6GB 2ERXA 2FDCA 1LLDA 3OEED 2QEQA 3VR5D 3CMCO 1Z6GA 4MGYR 3ZBUA 5KVVA 4TUYA 1IYZA 4DCJA 3DDWA 3NC1C 1DMSA 1FNNA 1F17A 1F38A 3HP7A 1RI4A 4JP5A 3ESZA 4NX2A 2WF5A 1Z0AA 2B3TA 1Z29A 4IIDA 4EAQA 2BL4A 5AVSA 2PVCA 3EVDA 5CDSA 3AVTA 2R6AA 2FEMA 4KV9A 2WY2D 8ATCA 5LKAA 3BMCA 4I4TF 3KFVA 2XA2A 5TQVA 2V9CA 3B3GA 1KTVA 3HM9A 1A5AB 5JY1A 1E1QD 3TTXA 1FBNA 1K0FA 1UDRA 4B8YA 1RP7A 1YJAA 2R8EA 3O73A 1G63A 1OPRA 3LVQE 1BJTA 1E66A 1F1BA 2QN7A 4R41A 3RNLA 3RIEA 5CT8A 1U5BB 2H2IA 1FSGA 1V37A 5CK4A 3DQZA 1EVIA 4NEQA 4FMPA 2CL5A 1VZ3A 3NGXA 2H4JA 4Q7MB 1VHJA 1ZD2P 3L7NA 5BSUA 3MHTA 1C1XA 1MORA 3U9LA 3BSYA 4MYSA 4QUDA 1XQYA 3LMKA 3PXBA 4PCUA 5K4GA 3BHMA 1J6UA 1OU0A 2RFLA 3C4VA 5HS6A 5A3QA 3IB3A 5C8YB 3HYRA 3MELA 1OTYA 4RU1A 2JJYA 2DFLA 3ROGA 4BO5A 3RAJA 2ZRJA 1EE9A 4JYBA 4P86A 1T3LA 3NBAA 1Q0UA 4NOJA 4XIIA 5K0SA 3CCFA 5TARA 1DKMA 3HJTA 1LI7A 1NMZA 1TFUA 1K3UB 4UBKA 1I3NA 5BYKA 2LW7A 4PIPA 2BYTA 1G59A 2O7RA 4JK3A 3VJLA 3PGVA 4U00A 1NFRA 4B2LA 1P4HA 5HZHA 2VNIA 1X3LA 5L7WA 4A9AA 1FUYB 1VZ2A 1C4XA 4Y2SA 1KO7A 1XRLA 3QMWA 2PGXA 5LQNA 1C14A 3P45A 3VKWA 3PWKA 2Q2VA 1CUHA 4TM7A 4Z9YA 4YVFA 3ZX5A 2REXB 3CONA 1FXUA 3RRMA 4HAYA 5FCDA 5A6SA 3V3KA 1IY8A 3JASB 3KZMA 5DM70 4CIYA 1R0SA 1JLRA 2AEFA 3WMXA 5E1BA 4EPWA 1QKIA 4FD3A 1LBHA 1USGA 1RHKA 5FNVF 5G41A 5LYYA 3PFFA 4BLWA 4Q4HA 3MLAA 4TSFA 3LLSA 1JT9A 4H3HB 1WPGA 3EQZA 2CDBA 2OXIA 3SHOA 3WMFA 3OC6A 4B32A 4P7GA 4BVEA 1BQEA 3CF2A 2X4IA 3CPHA 3DBLA 3ODGA 3PTLA 4KE9A 4W6QA 3RK0A 3OE1A 2CNWD 3UHFA 1H4SA 3AQ4A 3JD1A 1NBAA 3PD0A 3PHBE 3ZNOA 4Z2AA 4LBZA 1P2TA 2QF7A 2QRZA 2FDXA 2VKTA 5FR2A 3WIVA 4BRSA 4WOPA 3IT3A 3VAZA 2WKQA 3QK7A 1PWZA 5I7RA 2HK7A 1X7WB 4L6CA 3QTLA 4B6JA 1MVNA 3DNMA 5IVHA 1GDTA 2NO7A 3K4PA 4X7MA 4ENSA 4Y2HA 1UQRA 1T2NA 3KQVA 4DMMA 4ZAGA 1RZ3A 2ADOA 3ECAA 1L6RA 3OCJA 2Q5OA 1VMAA 4FN5A 3ZGVA 2BELA 4GM4A 2VJQA 2YOHA 3NIDB 1GZHB 4N5DA 2OFPA 4WH0A 3W2FA 3SZMA 1PJQA 2PMEA 4BVAA 4BX0A 1JIJA 3VPGA 3HE3A 3CZQA 3DAPA 5FFMA 4DXHA 4RWEA 1EWKA 4CI9A 2BN4A 4HDNB 1BG6A 5DRYA 1T8PA 3SMQA 2HEIA 2YZMA 3PHHA 2FCRA 2JA2A 2YNMD 2XNDA 3PJGA 4L7VA 3PC4A 4KGZA 4DLNA 5M2QA 4JJGA 4CLEA 2ASEA 4GS5A 5HVNA 4EVSA 1J7KA 1E9DA 4JQSA 4WLUA 1CY4A 4EJSC 4BV3A 1W49A 1SULA 3KPWA 1EUDB 1OLXA 2Q49A 3LCMA 4UTOA 1RRPA 3JRXA 2Q6LA 5A3RA 1WUKS 2AZ4A 2FG7C 4MV3A 5DM0A 2XXAB 1UMBB 3L41A 3UAZA 3WTBA 3IAM1 3AVWA 5CA0A 2ZAIA 2JIPA 1RXSA 5D5QA 3N2IA 1MW9X 4H16A 2BJHA 5A9SB 1S2NA 4J91A 4AJJA 4RTJA 1NI4B 4LC0A 2A8YA 1IN4A 2IOFA 4NWIA 5COQA 1XL0A 1B93A 3DKPA 5DU2A 1HMPA 3C5HA 1PHPA 4JKIA 4QECA 3UMCA 2DP4E 2XIJA 3ND8A 2C2XA 2PSJA 1NNI1 1YL5A 1RAFA 5CYGA 2IPXA 2AB0A 3R9XB 1KPGA 4BNUA 4RF4A 3RLFA 4DLAA 2ZRGA 4KHZA 2DPLA 2E87A 1T1EA 2GVDC 2QL9A 2W6CX 2WW8A 2XUAA 4F85A 4HEJA 3C1UA 3GA0A 2CHFA 2VG8A 4FINA 1PFGA 4KFCA 2Q6TA 2GBIA 4C88A 5B4VA 4JLNA 2HPZA 4XIFA 3CH7A 1KQGA 3TDKA 4MYRA 2J0SA 2I2BA 1PL6A 1YQUA 3EXIB 1O08A 1PO7A 2FXVA 1Y34E 2N3ZA 5JPIA 3ZU5A 4ZI3A 2IS2A 2ODEA 1VBFA 1SKBA 3P96A 1C9EA 3B5IA 2OO3A 3KO8A 3H6KA 1JV2B 1V4NA 3G23A 4PSKA 1X9GA 2F4VB 2FSFA 5KAPA 3PGLA 1VKJA 3MRSA 1TTPB 4DG8A 1WXFA 3KV3O 5FB3A 5DHUA 3U39A 3KQOA 3OU7A 3VDMA 4HT3B 3PHIA 4O4JA 4O63O 2G25A 4BVJA 2WIJA 4MW5A 4P32A 1UK7A 2VK4A 1F0KA 3R09A 4I4CA 2B6NA 1L4GA 3NHBA 1TMKA 1IN6A 1SWVA 3DONA 3GJ7A 5EWLA 3RWBA 2FGJA 1OLUA 2HU5A 4E5DA 3IEMA 4XWTA 1J2UA 2AOTB 1RPZA 3KJHA 3PJEA 3SQNA 4BO3A 3PXUA 4Z9XA 3LHDA 3RJ9A 4ARBA 5JZBA 3LT0A 1BN6A 3I9FA 4KUGA 4LI0A 4LYYA 1P73A 2J09A 2DSNA 2FCAA 3IUNA 3LY9A 5IM4F 2HF2A 5B12A 4KB5A 4C01A 2OM6A 1M1XB 3PTAA 1BNCA 4YFVA 3GBSA 3NKFA 2QTAA 3S7TA 5DCUA 1A76A 1P33A 5DK6A 1B41A 3IKMB 4O3MA 1NURA 4NK4A 5CDGA 2IX3A 3G2QA 3QVLA 3LCJA 1XNJA 1EX7A 4NJOA 1I5RA 3SVTA 3VTZA 2VF2A 3O38A 5E8JA 4ENVA 2FW7A 4U3JB 4N5LA 1QFSA 2F4NA 4RA6B 1U9YA 3ANMA 4LYDA 3CX8A 2XRYA 1QTRA 3GNSA 3OCWA 4YJ3B 3ZCVA 1CUYA 4W5QA 1WPQA 2ZDGA 4QREA 4RGVA 3NYQA 3RE1A 4DNPA 1Z37A 3A3KA 1GGEA 1U2TA 2PJRA 2O8DB 2WTNA 3A6DA 1NZDA 1V95A 1Y80A 1JEAA 2XMRA 5U4XA 3PQ7A 3GLIB 2XDYA 4OHVA 1AKNA 3V80A 2PCLA 1YQEA 3M5CA 4H6XA 4URYR 2F3SA 4N8EA 5L4LA 1UPBA 1FVOA 1EVKA 2ZIAA 1F8XA 2H4ZA 1L3CA 1FTNA 1W93A 2Y1WA 1V0JA 3F6EX 4N3AA 2J7PA 1HRDA 2FFQA 4ILEA 1XRRA 1BFKA 1NF8A 4RF5A 4I3FA 1M1YA 1GWNA 1NN3A 3MAAC 2I87A 4ZODA 4BLRA 1QQ7A 4YCLA 3I04M 2EHDA 5JBQA 2CVFA 2ZULA 4M1EA 1K6MA 2DPGA 3PNLA 3UMFA 1HETA 1T9HA 5REQA 3EE6A 1SA0A 4FWTA 4KJZA 3NFRA 3QQ5A 4R7GA 1NVVR 1F5SA 5B3AA 1CDZA 3VRHA 4Z5XA 2ST1A 2Q3BA 4QICA 6Q21A 3K6RA 3EGEA 4HQOA 2O57A 2JLBA 3G2PA 5JAHA 5ER9A 6LDHA 2FE1A 2IQ5A 3V4RA 3E58A 4D4JA 3A6PC 3U1BA 3FPLA 1G8FA 1Y8QB 2JNWA 4NH0A 2ZBRA 3T3IA 4ESVA 2PGJA 1FRNA 3P32A 4EKDA 5EKUA 4IIUA 4RJLA 5CB4F 2BCJQ 1AKRA 4RK0A 4A6PA 3K71B 2G6BA 3CJTA 3N70A 4M1TA 3UWKA 3VZQA 3LDFA 4OV6B 5DOZA 2WF8A 3PTZA 2F43A 4IWNA 4JBLA 3JQAB 1BIFA 1ZUNA 4KWTA 2GZHA 4IQ4A 2VP2A 3RSFA 3DOFA 4R4JA 3TR5A 4DV5B 3VO1A 4DEVA 2XE8A 3DE4X 1O5IA 1N3BA 4YMUA 2WYWA 5JZOA 2JGNA 4ZCRA 1JEOA 4LJLA 4H18A 2ZRLA 3HKBB 1BXZA 1F0PA 1S2MA 3GQBB 3OTIA 5DCYA 4B0PA 3R9IA 2GBCA 4RYDA 4CKBA 3DAFA 1OWLA 3KWLA 4WIAA 2O2IA 3IHWA 3STVA 4P33A 3K1ZA 1X87A 3GJRA 3ZJYA 1GN8A 4M0KA 4V02A 4BPRA 2GZSA 4OSOA 4YDHB 3F46A 2GLTA 3HUDA 2XXJA 1SCJA 3AJDA 1CQIB 1UADA 3HLYA 5EEGA 1EM8A 3N8NA 4GSLA 4BDTA 4YONB 1SC4A 5C4IA 3F1LA 4CODB 4GNRA 5E9WA 2O8BA 1XN4A 4JVNA 5I3ZA 3KUUA 1VLQA 1E7QA 1XQWA 1KKMA 3LU1A 5AVJA 2VOJA 3H4VA 1BEZA 4Q3DA 4TWIA 3CSUA 4M88A 4BMXA 3CO5A 1C3JA 4P4NA 2WZBA 3W5HA 4C0QC 4YUAA 4UTZA 4ZTUB 2QTTA 2BMFA 1VSQA 5DOVA 1V1RB 2P9QA 2Q2WA 1R6TA 4YAFA 4QGHA 4JA0A 1DO2A 3E5HA 3UOAB 4ALKA 2J6CA 1NTRA 3O03A 3OCVA 1DIGA 2CBXA 3CRNA 5C8DA 2NXNA 2X13A 2YJZA 3ZWNA 4B79A 2OOSA 2FQWA 3DL0A 1AHHA 1COWA 4R8VA 2P69A 2RH8A 4JA2A 1LEHA 2YW2A 1Q0ZA 4Q3NA 1ZWKA 3EXAA 5JJKA 2PRKA 1PTKA 5JAUA 3C16C 4ZMBA 1XK6A 3RTCA 3DC7A 3GRYA 5EP4A 1XKXA 5CD9A 1UAAA 3A9CA 2W6PA 5HWSA 4MAAA 3M3DA 2JZCA 1QZ3A 2E82A 1DP4A 3FLBA 2E2WA 3K0FA 2FSVC 5EL0A 1WLYA 5I4BA 1F7UA 1EFUA 2WJZB 1RI2A 2GA8A 4YHBA 1Z8DA 4F72A 2YHSA 2CNBA 3TKAA 4AU1A 3MG9A 3D5TA 4EECA 3DBIA 5TMPA 2I2CA 4UMVA 3A2LA 3MYYA 1EUZA 3KR1A 4LQLA 5G0WA 2XUHA 2R0QC 4UU8A 1L8LA 4MPDA 2HRZA 1T2DA 1W88B 1LSUA 1EVEA 4LCBA 3KB6A 3SF8A 4B3HA 3E9NA 4HQRA 5EZ6B 3RWOA 4E5PA 3L6DA 2TMDA 3L04A 1CLEA 4CEHB 4AY6A 1MPTA 2VK1A 2CZQA 3AHDA 1O96A 3HYNA 5IC6A 2PZ8A 4HFRA 5TGTA 5JAQA 3DLIA 2YRXA 4OQDA 3A11A 4PS1A 4E13A 3ZW9A 3UMRA 3DBRB 2WT4A 3ED1A 4GLJA 1YULA 1OC4A 4NTZA 1PKXA 1YZHA 4QUHA 4LIPD 4CM9D 4S35A 2PT9A 1OKKA 4S3MA 3PR2B 2RBGA 2P5TB 1YZNA 4LOHA 4BNNA 4O2BF 3TNDA 2LCIA 3ZXYA 2Q1YA 3I1IA 3NTUA 3S5UA 5LXTB 1ZONA 3FNFA 1F60A 3ESXA 3UVEA 3N5CA 3HO6A 4B0OA 4FMBB 3WGYA 1U0EA 2B8JA 2FSIA 1E7SA 2FPWA 4NOMA 1FYFA 4LY9A 4NAVA 4QNRA 5DFAA 3IIMA 4ED9A 1DEHA 3HO1A 3IVXA 3CKKA 1Z2DA 4KUEA 2CMGA 5IX8A 4I8DA 4WUVA 3O9VA 1E8DA 1H2HA 2XYRA 3SHQA 2A92A 1KH2A 2BP7A 1SXJB 3VO2A 4B73A 1FY2A 4HGYA 2NYVA 3NG1A 4NC9A 5HZGA 1ZD1A 2XD9A 1C29B 1K7FB 3OJFA 3QIAA 7ADHA 1R64A 2QD2A 4F3KA 1AT1A 1BX0A 1FJHA 1KEUA 2C61A 2F3UA 4HK4A 4IUCS 1LW6E 5DGIA 5HE9A 5KNDA 1JR6A 3P0JA 3DW1X 5LD2B 1Q19A 3ZI7A 4ZYLA 1S9HA 1LS6A 3SCZA 3MHPA 3FRIA 4M9ZA 5I47A 3CWZA 2ATIA 1YZFA 1SZJG 5JYBA 2JJ1A 2W2KB 4H7KA 4I1SA 3WYAA 4ZGWA 5EXXA 2ZR9A 1MNQA 2ZYHA 5DBHX 4XGRA 4QU5A 3E3AA 2EG9A 1TCAA 3DC2A 4DTCA 3ZCUA 2AOUB 4PLPA 2QVBA 2X9NA 4CM6A 1MVLA 4D8YA 4Q3EA 4ZO4A 1M0EA 4OX9B 4YT8A 4LHSA 3R9WA 3ZJVA 4C6HA 4CEIA 3NIGB 1EVJA 2RGXA 4MR9A 2FRXA 4CW7A 5IYZA 3PA6A 2ILVA 2GAOA 4KIFA 5AW8A 5DPMA 4JUIA 4DLZA 4ZHQB 2ON6A 2WQ6A 4DIFA 2ZT5A 5KYWA 4ZQGA 1WZUA 1SH7A 1ZBDA 4QYIA 1PL0A 3JVUA 4NMMA 4AMBA 4EO4A 5B7PA 4L28A 4EHLA 1RR6A 4LJRA 4BRZA 1Z0KA 4Y9TA 5JWOA 3V9PA 4CLDA 1RJ9B 1HNZB 2HJVA 3C5CA 5GIPE 3IMFA 1VJ0A 5AW9A 4IL5A 1SVSA 4ZWNA 1IQPA 1PR9A 4R7ZA 1XKTA 1X74A 2JGRA 4UNRA 5DO9A 5LQUA 1N8TA 4G89A 3HB9A 2P6OA 1NF3A 2IYSA 3VC2A 3EVFA 2J0QA 5EE1A 4X45A 1UEIA 3A1CA 3K0HA 1N0WA 5D3MA 5JADA 1ZCBA 4OYHA 4EDFA 2B6HA 4CGZA 3Q3EA 1S4QA 5FI3A 4C29A 2QMOA 4IF6A 2F8SA 4R69A 4FJ2A 5BSMA 2RJNA 3F5DA 1U9JA 1UIRA 3KLOA 1ZM7A 3FOZA 4PFKA 3GLIE 5AJWA 4GR5A 1XMIA 2O0LA 2H9AA 1T8RA 1JHPA 3JSXA 3HEAA 1HT3A 3EB9A 1A9XA 1Y5NA 4U2DA 3NO4A 4QQFA 3AY7A 5AI6A 1PS9A 1DBPA 5EHIA 4E11A 3ZV7A 4G6ZA 3IJEB 1JA9A 1L8QA 3H18A 3GN1A 4TV8F 1UK8A 5P21A 1ZMRA 2GBLA 2VLIA 3RSGA 4IFEA 3HJNA 1KI9A 3S55A 1UKVY 5KVQA 5LMZA 1OFHA 4LJ7A 3QELB 1PFQA 2CMKA 3RFFA 4JU9A 1ZH4A 5FO0A 4C22A 3FMFA 2GGSA 4YT4A 5EJ2A 4O3FA 2ZKLA 1UJ6A 5DISB 1XTZA 2NTYC 1JDPA 1T13A 1SC6A 1TDJA 3UK7A 3D7RA 1R88A 1YD7A 2EQAA 2YVLA 3I9JA 3LXUX 5T6MA 3CNHA 2XRMA 3TXYA 1FYVA 3L0SA 1EP3B 4KAJA 5AM0A 3FRHA 4KUHA 1NGSA 1XCLA 5JJBA 3LUPA 4PGGA 4ZT5A 1AKQA 2H3EA 4DR6B 1MJNA 3JR3A 4BLVA 1CIJA 4YRPA 3QY0A 4JBNA 1Y7PA 3D8RA 2FOIA 3NT4A 4WBSA 5DP1A 4ER7A 3D1VA 3CUTA 4ZOEA 3ORHA 5CM9C 1SOUA 2I7DA 3GT0A 3OEYA 4N5HX 3MRTA 3C3JA 3E7DA 3O4FA 4N47A 2D6FA 4D3YA 4V0RA 1U5BA 3VX4A 3SX0A 5DVZA 4AZTA 4HAIA 4B40A 2WPNA 4J0GA 4CVNA 4NJMB 4B3GA 3P5SA 4QU8A 3D6TB 4OXKA 3B6IA 4AL4A 1IY9A 2CHUA 1ZGJA 3JATA 4MW9A 2C94A 2XAAA 4DY6A 5AUNB 3C4QA 2W93A 4I2VA 4KO1S 3KQKA 4F97A 2UZ4A 4C21A 3K5HA 4RGYA 1T5OA 1LLFA 3KZXA 3E4DA 2JGMA 4GO1A 1HX7A 1PQWA 2XLCA 3S2FA 5E4TA 1L7MA 3HEBA 5JCOA 3AUAA 1RRKA 4TSFD 5C8YA 5CRIA 1CRWG 2RKOA 2HBQA 3BMNB 2O3UA 4RK7A 4YLYA 1EFLA 1O5TA 1V5IA 2Y6UA 3BWEA 5IBCA 4X94A 1KEEB 3V8NA 4C6SA 1GNTA 5EZYB 1B8NA 3DKVA 2VP6A 1XEXA 1YAHA 4NS1A 4BB6A 1XP5A 1XZEA 3QXXA 2O7QA 1OFUA 1EM6A 4TKVB 4DF3A 3HB0A 1L7VC 2F90A 3PKZA 4WEOA 4R2JA 1DKLA 5JPDA 4WN9B 1TAQA 1XDUA 4A0QA 2QPLA 4DIUA 4IDEA 1TMGE 1JR4A 1D2AA 1KYTA 1G8HA 4QGAA 2G4LA 3E70C 4L0DA 4HYTA 1MAUA 3G8AA 4O4IA 2BR5A 5HBRA 4HQKA 3M2TA 4XGIA 2W6QA 4QL3A 3JRWA 4B6QA 1Z8NA 2X2PA 3IDOA 3JASA 3AEYA 4J2OA 3RTGA 4FIDA 1E9VA 3ZE6A 4PBSA 3CXUA 5FBQB 2D5AA 4RE5A 1YGPA 2HRRA 3CW2A 1NVMB 4D44A 1X7XB 3DF7A 1FRZA 1BHQ1 4FS8A 4KGDA 1MC5A 2WMYA 2XNDD 1Y3HA 4B4KA 5JS1A 3VU3A 1ULBA 4P7KA 4DADA 4QGGA 3OOSA 5CLGA 1TKBA 1U6KA 3EVNA 3NBFA 1XA3A 2IYUA 2R65A 1XV5A 2NZYA 3DGFC 2XNJA 4S1NA 4UAJA 4FB4A 4UPDA 4CG1A 2NZUG 2I03A 1X1RA 5H4HA 1KF0A 4YRMA 1QFXA 4HNHA 1QSGA 3EGOA 3L0IB 1X7WA 1JDTA 3X1XA 2NT3A 5JCZA 2P0AA 4H7DA 4BUZA 4NBVA 4NI5A 4I1RA 2ANBA 2H18A 3OJ0A 1PV2A 1TM2A 4MPRA 4DHWA 5HRUA 2HDHA 1SVIA 2RBKA 4YT2A 5LQJA 5LMNB 4WXRA 2XNHA 3B1XA 4JR0A 3CKMA 5DYNA 1JXMA 3K9GA 4NCAA 4Z4EA 4B8ZA 3R7BA 5JC8A 2AXNA 5HKOA 3KQHA 2Q5HA 4IIGA 4KO8A 2RI1A 4A8JB 3Q2OA 1LDMA 1CX9B 1M73E 3GGOA 1U2GA 3NNSA 4G5OA 1UDAA 5AM1A 5KNDH 1NVXQ 3UHJA 4LX0A 2DFVA 3ZCSA 4XWGA 4INJA 2HRQA 2ZYUX 4HDNA 4DHEA 5DNYB 3BM5A 3H13A 3HRKA 3EPRA 3Q6NA 2IY7A 4G67A 3UC5A 1O3YA 1XHEA 2JARA 3BH6A 3K32A 4Y9DA 5BPFA 3TZLA 4XQ9A 1X1DA 5ILGA 3L1IA 5AKKA 5EPEA 4BGDA 3MB5A 3DMTC 3NXSA 4UEOA 4XIYA 1K97A 2ZSUA 1YMVA 4KO3S 3WWZA 2GAFA 5C9ZA 2QYHA 2IXDA 1EUDA 3T9AA 2PS9A 1Z12A 1VM6A 4D3XA 4ZQHA 3DE7X 1P2FA 2XXAA 2P4UA 1UMBA 2VPZA 4BEWA 1HZJA 3FVVA 4JQOA 5AJZA 4EZBA 1RI3A 2JIQA 4EZEA 4ENQA 1HL7A 1KRWA 5A9SA 3OHMA 2BBWA 4FEEA 1N5DA 1NI4A 4BZZA 4GZMA 2P8SA 3SM3A 1SB8A 2QRPA 1SXJE 1N25A 5TEVA 3TXXA 3SZUA 1E5TA 2YHIB 2W6NA 1ADJA 3DFFA 1P7PA 1NJGA 2EDAA 3NZEA 5CT6A 2V96A 1JAZA 4GAEA 5H81A 2OHXA 1C5KA 2QTCA 3ONWA 3EQ9A 5FWXB 5FUQA 4JL8A 1I9CA 3CBQA 3R9XA 1TEHA 1EWQA 2PQMA 1C3LA 1I4LD 1F8UA 1MRZA 4L5BA 4FWIB 1YU9A 5CFZA 2EJCA 3EA5A 3FCEA 5K3DA 3WLPA 2NSLA 1YE3A 3IQGX 2H0QA 5D6NA 2IXAA 4C5AA 5K8VA 4R1LA 5A3VA 5DHFA 2J9RA 2XQFA 3GEIA 3GUZA 3NGMA 3OLWA 1ENPA 3EEIA 4KXXA 4NZYA 1YDWA 2IZZA 2J32A 4IXNA 3V1LA 1T5TA 3EXIA 3W5SA 3MWJA 5JY6A 3OT5A 3PFWO 2Y67A 1RLMA 2NQTA 1NT4A 1M2NA 1YJBA 2EJUA 1V9CA 3VZCA 5LM3A 4N3BA 4PX5A 1W34A 2W8BA 4XDHA 4WINA 1SOAA 2BHNA 4O4LB 4D3DA 9LDBA 1NVEA 5I7OA 5EG5A 4GI3A 5ALYA 3N2EA 2CVOA 2EZ9A 3PDCA 4H15A 2PK3A 4LRTB 4RZSA 1CUZA 3EC7A 5FR1A 1Z2NX 1J5PA 2ZRAA 1PYOA 4HY3A 3C97A 2FFRA 4MUBA 3SIPA 1AF7A 2I3ZA 1V9LA 2HPHA 3L79A 7ABPA 4AUEA 3RRFA 3WLAA 1J2EA 5F2NA 2ONYA 2WAXA 1BS1A 3TTVA 1M6VB 4M7PA 3ZHTA 4IHKA 1KEKA 1P4SA 2OZVA 3PEUA 1JG7A 3R3SA 4F11A 4B1FA 3FTPA 2CE2X 4FOSA 2QU7A 3Q9UA 3TEJA 1B2LA 1I51A 2R66A 4EDHA 2AOTA 2AH5A 2QMYA 4OKIA 3BWYA 1R50A 3NRBA 5IULC 4K9KA 5HTKA 3WKBA 2P9FA 1RACA 1BCRA 1U4OA 1QLJA 3QP9A 4ZEXA 3HMQA 4KRFA 3U4HA 1PR6A 1Z6XA 2VO1A 4LQCA 1RXYA 3CQ9A 3KEGA 5GJVC 3K8YA 2GZDA 3I92A 1XVIA 4OATA 3DKRA 4FGUA 2VP0A 1UBMS 3LBFA 5LPNA 4XFJA 4ALIA 1GNSA 5BSWA 4F9TA 4FFBB 1UL1X 3HDTA 1MRNA 1QBGA 2CJFA 1VSTA 1XTPA 3AHIA 3T5GA 3VOAA 1GXSB 1NHGA 3IV6A 3HJRA 3GLTA 3JYHA 3OJEA 4MUAA 4TQ9A 3O9MA 3AEKB 3L92A 2Y1GA 4U3JA 1Q1ZA 5M34A 2C8JA 2AQHA 5BSHA 4YJ3A 1QWOA 3UYLA 1JZTA 4B48A 4BVGA 4DCMA 4R54A 1LDNA 2O8DA 1IB6A 3DEYX 2H4XA 3PC6A 5ECWA 3IUJA 4JXXA 2QLTA 3D2AA 1FYWA 3GXBA 3B70A 2AOWA 5FBKA 1G8MA 5U9CA 4XSGA 3GLIA 2Q27A 3FA2A 1KVSA 3AINA 3PF8A 2YV4A 1KI7A 4FNMA 5B7QA 3R9KA 4O2LA 4KWHA 4LNAA 3UAWA 3FB4A 4C7BA 4J3JA 2FJ0A 3KWMA 1OBVA 1QMPA 3VZDA 4D82A 2P7HA 2OK7A 5KKAA 3X2EA 5J2UF 3IAHA 4AW9A 1NW3A 3BFPA 3MOIA 1VPTA 3NHZA 3T5BA 4TV9F 5D1HA 1U1FA 1MEOA 5FI1B 3KXLA 3MJVA 3MOGA 5HK8A 4QHYA 4UU0A 3AHFA 3FCYA 5EPOA 4MWDA 3M1IA 5F9HA 5KSZA 2I5PO 3PC2A 3TX6A 1VKNA 1C1HA 4Z0HO 4K86A 1GA1A 1RKVA 2XGGA 1J33A 4KZPA 3ZQ6A 2B5VA 2CLSA 4ZDIA 4BNXA 2E6KA 4HZGA 5F4ZA 4KP7A 5AI5A 5CVUA 1Y8QA 3SEAA 2FMHA 4O2AB 4A5OA 3SE0A 5M29A 3H5AA 4OM8A 2X5XA 2YHAA 1K88A 4CLOB 1ZEJA 1OFVA 1LDYA 4YP5A 2YJ6A 1FBTA 2KLHA 4BX3A 3JQAA 5HW0A 3EIUA 1T43A 5CR9A 1ADBA 2OR3A 4KYVA 3C70A 3RTEA 2WK1A 4XWKA 1PS8A 2XT6A 2J45A 3PGA1 3O4RA 1COZA 2BKVA 1RKXA 4IUBS 3S1LA 1TAUA 4G8JA 4H7PA 3OZDA 3GQBA 2TS1A 1QIGA 1G41A 1COWD 1ODLA 1L5RA 3TJRA 1SKQA 4EX6A 2Q4DA 1MABA 1W52X 1PU2A 4AXXA 5M04A 2ZDHA 3KSMA 4RJIA 2G08A 3CW9A 3NI2A 3VISA 4PLTA 4K88A 5CLIA 3Q8LA 5BSKA 2ANCA 2VHEA 1OJ7A 1A7UA 1CQIA 4J6FA 3K0CC 1FC0A 1X8XA 1O94C 3LC0A 5KOJB 5HKKA 3L4SO 3MTAA 2G1AA 2JCGA 3M6UA 1VE5A 4Q47A 3RDPA 1V6CA 4AS2A 1ZBQA 2ENWA 4JITA 1DHRA 1JEJA 1M2VB 2BBSA 3A28A 3C8UA 4O0MA 4B43A 1AKMA 3OZBA 2OBXA 1JHVA 2IU4A 1E3LA 2OM2A 3JQFC 3DA8A 2IS6A 1P2VA 3LCRA 2K7ZA 1ZIPA 3V1UA 3IE2A 2C03A 3HDHA 5DBOA 5EFZA 5TQ2B 2QL7A 2P2NA 3C6KA 4K46A 4TMVA 5A3JA 1VCHA 1G2PA 4LJAA 5KTRA 4W1RA 3ZZUA 1VB3A 4MROA 4ROSA 4LDAA 1JZQA 1LA2A 1N8KA 4HDRA 4HN2A 2WF9A 3OFVA 2FQQA 3K09C 1F2TB 5CK5A 3HKCB 1OKKD 1XMXA 1A88A 2AN3A 1IXZA 2GPSA 2L0XA 1SIUA 1YIAA 2XQJA 3GI1A 4X3OA 1Z07A 4B33A 4KQWA 4DYHA 1N5IA 4XFDA 5AHOA 1QHGA 3DE0X 3QTTA 2QS9A 3BF7A 3MUFA 2RGNC 3PD7A 3NM4A 4RH1A 3ETLA 2ZKIA 2HM7A 3N8DA 4J07A 3R3VA 1KDYA 1XZQA 2XDAA 1EWVA 3JQGB 3L8ZA 1O0BA 3RS3A 3K96A 3KPJA 3SQLA 3VX3A 4ARZB 1UJCA 1IK4A 2R5NA 2XMCA 1EB9A 4J2TA 1GM5A 3HXMA 1X92A 3HVIA 1L4FA 1TQHA 3PNSA 3GFTA 1QP7A 1Z0UA 5LU9A 1USKA 2CC2A 5EC8A 1JFRA 1FTSA 1W88A 2QL6A 4YUVA 4YCMA 4PTYA 4TLBA 2H29A 1FS4A 1R66A 4MKFA 4CEHA 3AL0C 4GZLA 2EFJA 5KNDD 5CB0A 4LSZA 1DADA 5JZMA 2RHGB 1VG1A 4CFSA 2WJGA 3DBRA 4G1UC 4LJKA 4JGGA 1QIEA 1R6BX 1Y8AA 2JJ1D 3CIOA 4MMXB 5DE3A 1UBFA 2EYUA 3U62A 5ADHA 2VF7A 1Y4ZA 3UJPA 3AM1A 3N7UA 5ED0A 4G86A 2CMHA 3VNBA 4BFYA 3KQYA 1G42A 4KXQA 4XLZA 3WICA 4PRLA 3HRHA 1B8VA 2QLBA 3SXUB 3V00A 1KC3A 2G04A 3HWWA 4I55F 3TL3A 4CQLB 4YRSA 2QB5A 3BCSA 2JW5A 1VPEA 4BGIA 4TTQA 3FMVA 3G59A 5JNWA 3EVGA 4ZEOA 4PYKA 3PVSA 2YICA 3D4BA 3UJCA 5CH5A 3RG8A 3BHNA 3KZVA 1UXKA 5F7JA 1JIKA 4ES6A 1Q0TA 4CIDA 2F3PA 4EJMA 1SXJA 2R6HA 3E9DA 1DIAA 2P90A 3EH2A 5AKLA 4KBYA 1ESCA 5IC5A 5J5VA 3CB2A 3MWGA 1UPXA 3ER9A 4GYYA 4HGNA 2DWPA 2OKGA 1BD3A 3UT5B 1YZVA 2REQB 1I7LA 4JLOA 3BXFA 5DHAA 5FV7A 2R5WA 2Q7XA 5KDDA 3CPJB 1GTRA 2XBMA 2YINC 1T9KA 2W2KA 3E23A 5CNIA 3CRW1 4LSGA 3EOAI 3VU8A 1N6RA 1LFDB 3H2KA 3KZOA 5BMOA 2J5BA 2X15A 2AOUA 1JECA 1VB5A 2G0AA 4HR7A 1EJ6A 3U4DA 4EENA 3KRTA 4KBGA 4ZCPA 2XUOA 1HF3A 1OXVA 2Q8PA 3HR8A 1TD1A 4B2YA 4G09A 2Y4NA 1UDXA 1E2GA 4ZHQA 1ZP6A 1NW6A 2JCXA 5DLPA 2C8LA 3DE6X 2AYXA 3BX1A 4MJLA 1Z7GA 4FI3F 1P91A 3KETA 1XDGA 1ZCZA 1QK4A 4H0CA 3VSCA 4QYSA 4CMJA 3SBXA 1PGOA 2ZUBA 5NLLA 3J81k 1RJ9A 2VXOA 2ZGVA 5K0JA 3DTTA 1U4NA 4HQLA 2CE7A 1TW3A 2CUKA 2PL9A 1T91A 3FCXA 3II6X 4I3GA 3QFCA 1OI2A 3R3YA 4QBGB 1NTOA 2OB1A 1W9HA 4JGIA 2FZCA 1ZESA 2ODQA 3EQ2A 4O33A 4YJGB 5IZCC 2AYYA 1T5HX 2I71A 1X13A 2JBHA 4IAOA 5JU6A 2WWIA 4J43A 4D9CA 2A0UA 2GEKA 4D92A 2VCEA 3H5LA 3IHTA 2W6JA 3PDJA 4DLSA 3NB0A 3COPA 2ZR0A 5HCNA 1JFTA 3F2VA 1XSEA 1W8IA 4NESA 1I6MA 3NAMA 4F2WA 5T8KA 1LW7A 4EGCB 1ZNXA 1TVKA 3A8TA 1RMQA 2V55B 3A05A 1QH8B 4CL3A 3O1HB 3ULKA 2R60A 1SBTA 1G4AE 3SS9X 4NXNB 3OF2A 4IKPA 4P2GA 3LQYA 4X0EA 4X20B 3UENA 1ZSNA 1GAWA 2DR0A 1B6TA 1ATZA 2G7MC 3MOSA 3SYRA 3DWIA 1IXSB 4MWOA 2J9XB 4L9RA 8GPBA 3G2NA 4NMXB 4U7WA 4R2HA 2NACA 3K1JA 1QGOA 4F4DA 4PM4A 1RSZA 1ZIDA 2NAPA 2P65A 3QELA 3PRKE 1CPYA 2ZIGA 4E51A 1CZLA 1DAGA 3THXA 2BGUA 3UZUA 3W9BA 1C0LA 1I6WA 3ZV4A 2BFDB 2JAQA 3L43A 2OHVA 1BAPA 3L4BC 2FSUA 2L18A 1QIIA 4K2HA 4MV6A 4V0KA 2C9MA 5K5EA 5D01A 5KWIA 2O59A 5KPDA 2IYOA 2POQX 4ZYZA 3WDSA 2RH9B 2B9VA 2OHGA 1D1TA 3QKSB 3MCUA 3K94A 2HHJA 2OD9A 3AFOA 3N9IA 2NXJA 1HPLA 4HS9A 5DTIA 1L4KA 1OV4A 3GEGA 2Z43A 1VKRA 3E9RA 3MAJA 3VI3B 5B1EA 1WVIA 5HKLA 5AUPB 4OTZA 3KVYA 3L8HA 2W70A 5TLSA 4M36A 4QDZA 5JVDF 1G21B 2WM9B 2EZ8A 3CS3A 3WGZA 4OCZA 4IMIB 5F2KA 2C29D 5HGJA 4R3WA 3UMJA 2VL7A 3ADOA 5MN5A 1ICIA 4KU4A 1DT5A 4B81A 2G1UA 1GTZA 4XRRA 1R6AA 3JU3A 5CX1B 1K6EA 4X7RA 4ZZ2A 5MGNA 1JKJB 2J5RA 2FPMA 2C2ZA 4NBWA 3JQRA 1TOAA 2JEOA 3BJZA 4XVRA 3E0QA 2IH4A 2VQSA 3AL3A 3LK6A 3TTWA 3WGNA 2VK8A 1RLTA 1KKLA 3BWDD 2EIXA 2H07A 4GG1A 4MZDA 4S1PA 4EARA 1RC8A 3ZKAA 3KTFA 2WD7B 3JQCA 3MXOA 4G07A 1DRKA 4GPZA 4AY4A 5LDDC 1T9ZA 1JFLA 5CXSA 1ZUIA 4MIKA 3DDHA 1XQ6A 2BCGY 1M74A 4K1LA 3ESDA 3NHKA 4EB8A 1U0LA 4W99A 2GWRA 5DP2A 5DNEA 5KYUB 2CXNA 2V6GA 4HB4A 4CV3A 4ER5A 1JZSA 1SUCA 3ZVKA 4JNKA 1N7HA 4C1NA 5I5EA 3R7DA 1T8UA 4LJ5A 2FZLA 4DLLA 1G19A 1FCJA 4TS1A 3RC7A 2CT8A 1YRWA 4RVNA 2ATXA 1VG9B 2PSDA 4PY2A 1U7UA 2QDKA 4OHCA 4FR0A 5E1DA 3R7SA 3RFCA 3WLNA 5EZYA 3WLOA 4E46A 5JD6A 1Q16A 2BE9A 1Y48E 2A9VA 4QD3A 1C7QA 4F5EA 1HOXA 3M70A 1E8MA 4RV5A 4A27A 2JLRA 3VR0A 5AYVA 2D74A 3EVCA 4TKVA 3GHHA 4RVGA 2V3VA 2LWIA 1PP4A 4U7GA 2WWXA 5GADl 4BY9E 4I1PA 2D5IA 1S1CA 3OLZA 4WN9A 1YR9A 1GGVA 4JEHA 2D62A 3HJAA 3D59A 4JT9A 2PZGA 4OP2A 1GCUA 1QAQA 1Y4UA 2G9ZA 2VDJA 4FS3A 1R4MB 4Q18A 4QULA 4I66A 1S0UA 5HF6A 3FLEA 3MJRA 3OJOA 3WKDA 2QMQA 3K0AB 4A2CA 3AR4A 4GBED 2AK3A 1AKWA 3EPKA 4B7XA 2ZTUA 2IU6A 4O1HA 1S1MA 1VG0B 1TCUA 2CW5A 1X7XA 4U0JA 5BY2A 5K0BA 4N7JA 3F78A 2B83A 3TSAA 4TYNA 3H2HA 4H7FA 1G5IA 1JDBC 2PLAA 3UJBA 1YZYA 3NEJA 3RBZA 1EFPA 4QYMA 1O8BA 1IIRA 1RQRA 5F77A 1Z6YA 2NO5A 2FPKA 2PH5A 2VT3A 1PQ4A 2XHEA 3AR6A 1TI7A 1RWNA 3CVOA 5JD5A 1IIBA 2V6FA 3H5WA 2VUIB 4LN1A 4IGEA 3KE9A 4S1WA 4YP9A 1MQAA 1WB4A 1XTBA 2Z8YM 4C4TA 3MT0A 4B7ZA 1VYHA 2VAPA 4OHPA 4DR2B 3BWCA 1YL6A 4FZJA 3WTCA 4AZSA 4CR8A 1M66A 4ZOLB 1Z7EA 1IMOA 1OWPA 4UUQA 2C5AA 2CLHB 2Z58A 3G6KA 4A26A 1TU3A 4HFJA 4OLFA 1RYNA 2FWRA 3EVBA 3JX9A 4NCJA 4PHGA 3TIXB 2P9JA 4A15A 4TPKA 4Q1FA 1JHUA 1K68A 1Z8FA 3COYA 4GBGA 3O92A 2X2EA 1KQ3A 4Q3BA 4FNGA 4F3NA 1WV0A 1JDJA 2GYYA 3DEHA 4KMSA 4Q9AA 1ANKA 3GEMA 2B4TO 2J41A 1UWKA 4WJLA 2XZDA 1LVHA 3OETA 4FZVA 1EE1A 1K89A 3WNCA 3DBHB 5B5SA 3BB1A 3OZXA 5HPYB 3NP9A 3QPBA 1WA5A 2IBMA 3LF1A 5T6BA 1KK1A 1GG2A 5AKXA 2OCDA 3WMRA 3BIFA 4EB6B 2WJ3A 2F9FA 2ZWOA 4XR9A 5KVCA 2XV1A 2D2XA 4H60A 3LTEA 4UD2A 1Q1BA 4JMLA 4I50A 4KSCA 5FOXA 4C04A 4HNQA 2H1RA 3ECSA 3ZDXB 4F1JA 1NKSA 4AS1A 4YUYA 1B0AA 4ROTA 3VHQA 5ALKA 5SYAA 4OJMX 3OVMA 2J6HA 5DDIP 3OLVA 1XFAA 2YHIA 3SOPA 5JI3E 2GFHA 3L1VA 3RW9A 3B38A 4FFLA 2FUG6 5FWXA 1RBQA 3KZCA 3OZIA 1GDHA 1I1NA 1PG5A 1ZK3A 2PV7A 1I36A 1OYWA 2HWXA 3EZGA 4U6QA 1YB2A 4RFSB 4FKZA 4J49A 2I80A 4D0LB 3N7TA 4L4ZA 1DIBA 4PYLA 3DF9A 2Z4TA 1X8KA 3QLUA 1G6KA 1VBNA 2IFTA 3C1TA 1WR8A 5AI8A 1QYRA 2A0WA 1ODTC 1SG0A 1VRVA 1NUQA 2I4IA 2I65A 3IESA 4GL4A 5JMPA 3TSZA 3U7RA 5KSYA 2CVHA 3RASA 5ALPA 3ROEA 3VR3A 2CEAA 3EHDA 4DRXA 5BRAA 4XB2A 2CXUA 4HEQA 4EHBA 1S8OA 2R84A 3BERA 3O31A 2WT8A 3QUQA 1ZM9A 3EXHC 1NNUA 1FMCA 5I6DA 1TCVA 1KAEA 4O4LA 3K4HA 3LP8A 4RJKA 4N7BA 3VU0A 3FIUA 3FWNA 4OYRA 3V33A 3SJZA 1X70A 4ESEA 2ZT6A 1DBVO 3O75A 5CYFA 1ZZGA 1G2OA 1KZHA 1P3DA 3UV6A 3EPHA 3W06A 4AN4A 5KQPA 1S7CA 4J3NA 3WMGA 4MA4A 4C78A 1YDEA 4HAOA 1M6VA 2DPMA 4I4TA 5BN4B 5JH7B 3UFXB 4YO8A 3QMVA 2C88A 1Y1SA 3I9NA 4EJSB 1PD1A 1HDZA 1JPUA 4HBZA 3ZGYA 4LE0A 3G9UA 3TOXA 3IP5A 4YB8A 4N76A 2W4MA 1Z5OA 4JXZA 4YAJA 4JI4B 4QRHA 1NVUQ 2IHUA 3A6ZA 4BMYA 2Q2OA 1L5HB 1GR1A 4L15A 1JYEA 5EESA 3A36A 4MUFA 4OMFG 2VDLB 4PG5A 4R3NA 4RY8A 3KDAA 3OQBA 3W79A 2HDOA 2R7NA 2FMTA 2GCNA 4DZZA 3ELWA 1IDOA 1ZVMA 3AZOA 3K2QA 3AW9A 1JBEA 1Z5NA 1R0YA 3L05A 1XALA 3DZBA 4FR2A 4RKQA 5EP3A 2QT9A 2WUFA 1TEVA 1VE1A 4FFBA 3EARA 1GXSA 2GUGA 4I5IA 2IS1A 3J80A 1GQRA 2RIRA 2VJMB 3QTBA 3AEKA 4KN8A 4EW3A 1XLWA 2QXTA 2X23A 1SVWA 2HOQA 1EYZA 3ZOKA 5CYPA 3NTQA 2Z5GA 3ASUA 3MVEA 3LPLA 3GMIA 2RC6A 2CDNA 4YCBA 2JFOA 4HDKB 3U4CA 1J56A 1XJ0A 4YEDA 3FAZA 3SHFA 2EKLA 2R8OA 1YFKA 1F6DA 2W2VA 3FFBA 2JIDA 3DBVO 3BUSA 2HHAA 4FEYA 1GZ5A 3H9CA 3JQ7A 3UEOA 1A9PA 4M1WA 2NQ2C 5JWRA 2YBEA 1QP4A 3I9V1 2HA3A 4J4TA 2WQZA 4H17A 2BM8A 4BNDB 4EVQA 5K1ZA