5C0RH

Crystal structure of a generation 3 influenza hemagglutinin stabilized stem complexed with the broadly neutralizing antibody c179
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCGTSGFTLTDDYMTWVRQPPGKALEWLGFIRDRANGYTTEYSASVKGRFTISRDNSQSIVYLQMNTLRVEDSATYYCARPKGYFPYAMDYWGQGTSVIVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hemagglutinin-stem nanoparticles generate heterosubtypic influenza protection.
pubmed doi rcsb
source organism Influenza a virus, human immunodeficiency virus type 1 group m subtype b, entero
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin, Envelope glycoprotein, Fibritin fusion protei
total genus 32
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0rH01
5D9SA 3V6ZA 4WIQA 4L4VA 3MLYL 5E99L 1VEOA 4Y2DD 3FCTB 5DT1L 1BFVL 4ELKA 3D0VB 4RNRA 4LGRB 2GSGB 5D72H 3UAJD 2AXHA 2IQAB 1FZOB 2Q20A 1Z9SA 1VEMA 1C1EH 4M5YH 4BSWA 1A21A 3FT3B 4PJBE 4DOHB 4HT1L 4NC2B 1UQSA 4K7FB 4P2QD 3SPVA 2J8HA 3VXMB 2ID5A 3RJQB 2X4NB 5DD6B 1YPZA 2ERJC 1JRHI 3G6AA 4BJLA 2B8OT 3E6FB 4RFEA 1AGFB 1SY6H 3BPNC 2CKBB 2VLJB 4LSDA 2F53E 2L0DA 4PY7B 1F02I 3U82B 4R9HA 3V5KB 2VXQH 2V7NB 1WISA 2WLZA 4TPRH 4X4YA 1BVKA 2OK0H 4QRRE 3RNKA 1F6LL 3IDJA 4CDGC 5F6IC 3LN5A 4OZIB 1FG2B 1AQKL 4PJFB 4LKCB 1S5HA 4O58L 4WI8A 1U8MB 3VFRA 1CDIA 5KOVC 3BXNB 4IRSB 2X05A 3QXAA 5E94B 3FFCA 3SGEH 3MRIA 2V17L 2WBJB 4YFEA 3QXDA 4R90H 3SGDH 4NCC1 4Z7WE 3MO1B 1IAKA 1QPPA 3Q2CA 1A7PH 3O4OB 1FJ1A 3B4NA 2YC1A 3BYTA 3L95B 4ZNCD 4M62L 4OIAA 3W0WA 3SDAA 2NX5B 1DVFB 3OKYA 2FH8A 2ADJB 4IMKC 3QULB 4UV4H 1IM9B 3ARED 1MPAL 4F3FA 2YPVH 4NHUB 2XFXB 1JGEB 5DI8B 3QZWA 2XNAA 3QQ4A 2VTFA 5E70A 5F9OL 2PW1B 3SDDB 3BE1H 3DPBA 1NL0H 3NCYP 4IOSD 2DLGA 2X4SA 2VO5A 5C07B 1SBSL 3I6KA 4XNMB 1ZVSA 4P5TA 1NGQL 2DQDL 4QXTB 4N0FB 5IG7B 4L4VD 3GBNL 3RGVA 3V5DA 3ZKXC 2R15A 1IC5L 4KKCD 4U1NA 4M93C 5HD8D 3OHXB 4J23A 4W81A 4ODVL 3ZHLA 3M1BA 5IJKC 2XA3A 5CEZD 3O11A 5IWLA 3B43A 1KCRL 3MLXH 2V2TB 4OI9A 3UYRH 2E27H 2XICA 5L2KA 1JHLH 2WWMC 4M6AA 4XPBH 5EFIA 3U0TA 3QHZH 4IRJC 1U9KA 1A6AA 3M45A 3RWCA 4NZUL 2J1KA 2PNDA 2XACC 4U1KA 2YBRA 4MJIE 1W0VA 3C87A 5F1NB 5F1OB 1VGKA 3F58H 1TTUA 2YPLA 4YK4C 5T1LA 3X3FL 1NC2B 1Z0NA 1A0QL 3M8OL 4XMPH 4OZ4A 3E2HB 4KAQH 2EIEA 3DX8A 1BGXH 2X9WA 3OF6A 1I4FA 3S37L 4F8QA 3OKEA 4NZJA 3CU1A 4AENB 4F9LC 4TUJA 3RX5A 3LN9A 1GGBL 1EDQA 2C7UB 4L3EA 4OFVA 3C5ZD 5DRNB 5H37H 4PP1C 1T2QH 3JWOH 3QDGB 2X4TB 5E8DL 1AC6A 3SDXF 1J05A 2VLJE 4LCWB 1PYWB 4Y5YA 1FL3B 4HQQL 3T3ME 1MHPH 2ZJSL 4OZFH 2EEBA 3L7EB 1CQYA 1WT5C 2Y6SC 3IDGB 1A7OH 4LEXL 1J86A 4L4TB 3G6JA 4F7CB 3PWVA 4NZRH 4OJFL 3V8OA 2Z8RA 5EULV 3WEXB 5TE4H 25C8L 4JQVA 4ZUVB 1ZA6A 2NXZC 2I9TB 5KN5A 5M94B 3V6BR 4OCSL 4WO4C 5J9PA 1JYWA 4FQLH 2DAVA 5DURB 1HDMA 3MFGB 3NAAH 3NIGF 2XQYG 1KIPA 3ZE0E 3LKRA 1JPSH 1U8HA 3BVNB 4AT6A 1ACYL 5DUPH 1QSFB 4RMVA 4PRIA 3MUY1 2X4RB 4H1LA 5JUEL 1S7VB 4PRHD 3QDJB 3LKQA 1QSEB 1UM5L 5EIVA 4XWGH 1R3KB 4ZAKC 4ZAKD 5CEYB 1N64L 3EYQD 4GKSA 1SVCP 2FGWL 3L3JB 2XKNB 5JMRA 5T1KB 3QIUC 1Q9WB 1QNZH 4TVPL 1FBIL 4X6BB 3NCJH 1PLGH 4D0DB 1EHXA 1IGJA 3P77A 2A9MH 3D3VD 2VB5A 3VI3F 2NY1B 3FAWA 4DZ8B 1FQ9C 3KLAB 5J89A 3C09C 1XF3B 2X4TA 4RQQB 3QUMA 2JJVA 1DQLL 1WFTA 3EYVA 2ILLA 2YRZA 3QO1B 2ZUXA 4H5SB 3SDXB 3NVQA 3CLEH 1OARH 3P0GB 2VOTA 4P2OD 3PG2A 3GIVA 4NCDA 3ZE1F 3QPQD 5KTEL 4GRLA 2F74B 3VG9B 3LZFH 3U9PH 3GMQA 3L1OH 3DX6B 4LLUB 5BV7C 3F6IA 1D6VL 1G7QB 3ILQD 2VH5L 4HDIB 2PXYA 1BM3H 4J4PA 5EZIL 3IFLL 4YHYC 1P53A 4D9QD 2J88L 4E0RB 1G84A 1WCQA 2GQHA 3QDJE 4JZJB 5E7BA 5KSBB 3RL1A 5JW3H 4ZPVA 4K3HA 3I6GB 3VD7A 3WE6A 4Y4HC 3N1QC 1JF5A 4E5XA 3V5HA 5JXED 3NIDE 3QUYC 3UTZA 2JB5H 2W0FB 5CEXB 5ESQB 1G6VK 4JRYD 1I9IL 5GS1A 4I18C 3JV4A 3ARGA 3TVMB 4KGLA 1DR9A 4I3GA 2DQJH 3CXHJ 2X1OA 4R8WH 1WTGT 3SOBL 2BOBA 4H88H 2EE3A 3MACL 1QYGL 3O8XC 5J11C 3HAEH 5F96L 5IBLC 1MCFA 3ELAT 4M1GL 3Q5YA 4OFIA 5C0NC 1KCUL 2FJGA 4Z7OE 5F3BA 4Q9QL 4X7SL 4P2QB 4L4TD 3EJJX 1MFDL 3TESA 3GGWA 4HXBL 5GZND 1W72B 3QUXC 5E95B 3MX0A 5C0BA 3CC5A 4BH8A 3VXRD 5FECB 5DR5H 3QNXA 1IC7L 2FCBA 3O6LH 1CE1H 1YY8A 2BY2A 2IQ9H 2ICCA 3CX5K 4UILL 1RMFL 2LFGA 1U8HB 2HA1A 2XQBH 5J6GB 3ARGD 2VDLL 12E8H 1GC1H 4NHUA 4F3FB 3NFSH 1NC4B 3TZVC 1YJDC 3P11H 3I3BA 3FRUA 4M9PA 3QUXA 2MNUA 1R5IA 4JY5H 5SV3A 5GGRB 1NPUA 5F9JB 4PGEA 4FTVA 3G5XB 4L3AA 3V7AG 3VRJA 3FB7A 5IW3A 1IAIH 1X44A 1TETL 3ROLB 1GIGL 3MNVB 4PV9B 1NGQH 3AU1B 3TP4A 1PX3A 2NY4D 3BE1L 5D1QC 4XPFL 1T7ZA 1IL1A 3P9MB 4JHAH 4Y4KB 2C3VA 3DROA 2ICWJ 4M6OH 1SYSB 4BUGA 1N2RB 2F8XC 2APXA 2AK4D 3QCTL 4PLNC 3DXAB 4PJHE 2YD8A 4OD2A 1NBZB 1RULL 3LKOA 1X5KA 4AJ0A 1RU9L 1N2RA 1V7NH 3VI4F 5TH2A 3GRWH 4N8VB 1P9MC 1LP9A 2FDBP 4JFEB 4Y5VC 4P3CH 2H9GB 3OKEB 3U0PA 3W2DH 4WFHE 3GGWB 1UQSB 2VZ3A 4K7FA 5IQ9B 4RMWA 2W92A 3GHBL 3WJLC 3I75B 1U91B 3N9GH 1FORL 2YHGA 3T8XA 2DQHL 3KWWA 3MLTB 2APBA 1S7WA 1FVDA 5AYUL 4H0IA 1UH2A 4FTVB 3HHRB 3NPZB 5EU5B 2ZP0T 4AQ1B 3T4AB 4AMKL 4RWYH 2P5WD 3RWFA 5B22A 2YZ8A 4NZTL 4TYUA 3SO3B 4OF8A 4G6ML 5E8EA 3C6LB 4WI4A 1NCUA 1JGEA 5DI8A 3SCMD 4OI7A 4X6DF 1DE4A 2CH8A 1IM9A 3GMLB 2Z35A 1CFSB 3QIUA 1INQA 4NQSB 3F12A 4PRIE 1S9KC 3MUGA 3WE6B 4P9HH 3T1WA 3BPOC 3PL6A 3G5ZB 5A16B 1T1WB 4BQBA 3RZWA 4V1DB 5KSBA 4EOWL 4JQXC 4JRXA 2DM2A 1HZHL 4PYGA 1RJYB 5EUOB 1XCQB 4XC3L 4U1GB 4J3UA 1GC1L 2XWJA 2NY6B 3VXUD 4KI5E 1GAFH 1W0WB 1PGRB 3OHXA 1YYML 3BEWA 4L8DB 5GJTL 5T33H 2DWDA 2X4OA 1RJCA 4NKOA 4MDJA 5ANMA 1HHKA 1RIHL 5I8CB 5HHME 5HYQA 3SGEI 1BVKB 2PW1A 2OCFD 5IM7B 1KACB 2J2ZA 2XNAB 3RAJL 3DSNA 2ZPKL 4ZFOB 4I0CC 1JK8B 3MROB 4OLYH 3PXJA 3KPSE 2QADD 2R4RL 1A7QH 3U7YL 2R1XA 3HMXA 1MCJA 2CGRH 2MKWA 2A77L 4R2GD 4RFEB 5CMAA 5BMFH 5ADOH 1HKLH 3CFCH 4KVNH 4BA8A 5DD6A 3WL9B 3P4NA 4KH2A 1MRFH 3ZE1E 1NMBH 1XGRB 2A0LD 1RURL 4WI2A 4DKFH 4Q7DA 4PJBB 1EFXD 4FQQA 1UWGH 4F33A 1W2KT 2PO6D 4NBYB 3SDDD 4J1UB 2HFGL 3GSUA 5E2UL 1OGTA 4UQ2A 1HOCA 5E0QA 2E8YA 3JSSA 3BGMB 4WW2A 4HF5H 3C60B 2G5BA 4BQ8A 4RMUA 1QRNA 3RI5F 1A1NB 5DMIL 1I7TA 3RNKB 1MHCA 1P2CB 2EYRB 2Z31C 1N6VA 2XWTA 4HG4J 5ALBH 3KPPB 3QAZB 1M6OA 4UT6L 3PWJB 3NACH 3O9WC 3PGDA 2IG2H 5I30L 5GISH 1IGJB 1I7TB 1I1AC 5CHNA 2AGJH 3L3HB 1D5XB 1J18A 2EDXA 2JIXD 3L7FA 5C0EA 2E27L 3CVHH 1UA6L 3CDGB 2P24B 3MODH 1QLRB 5EZJB 4XMKL 3HI6L 1EIBA 5IF0B 5J57B 1I8IA 1D9KC 4HWBL 3V0VB 1R3JB 4CVXB 1A02N 2E7CA 1AKJD 4NQDE 4QOKB 4ZO8A 4Y16C 4P23A 2EZ0D 3LKNA 4LCYA 2DB8A 2X1QA 1P84J 4HIXL 5E5MA 5FYJU 4HHAB 1WAAF 1ZVYA 4X6DA 2XTJB 4XAWL 2H32B 5BRZA 3RWGB 1JK8A 2CGRL 5I1EH 5L8KB 4HPYH 4CL7A 3GSRA 4EI5C 3BFOA 1YNKH 4DW2H 3ARTA 3LQZB 3HUJE 2CD0A 3TH4T 1AGCB 2OTUA 1XGQA 1JPFB 4GT7A 1NFDA 3GSNA 4NQCA 4KROD 5I16A 3IDYB 5C08D 1NGWA 4WY7H 4QRSA 3C8HA 1QFPA 4XNXL 4JPWL 5IK3A 1CFNB 1FNEA 4BFBD 3FFCD 5FO9A 4KI1A 3UPRB 2DJUA 4LLDA 3MBXL 2R56L 3HZYA 1JV5B 5SX5K 1AY1H 4MXWL 5F89B 2KPNA 1PKQE 2DWEB 3FZUC 5AD0B 2ED7A 3O2VH 3MRMB 5I8OL 5F71A 2VXUH 3SE4A 5FXCH 1T1WA 1G7IA 3PL6B 2GJ6D 1J1PL 2PYFB 4Q6IA 2QHLA 4LSQL 5JW4R 1T03H 2RBLA 5GS0D 3K46A 1TQBB 4JPVL 4JRYB 4LPVA 4KXZH 4YBQD 1WIOA 3WO4C 3TM6A 1NAMB 4ELMF 5HYEA 4PRBB 1VADA 2UYLB 5EUOE 3AROA 4TVPE 5IJKA 1SYVA 4KMTH 5FKAB 4LP5A 4LMQI 5DZLA 3TJHD 1UADC 3MJ7B 5CAYB 1I4FB 1AGBB 4BZ2H 4HQQH 3GMRA 1D6VH 1T1XB 1FC1A 1FYTA 4ZQKA 5ISZE 2IC2A 4P9ML 3V6FB 3GMNB 4JDZB 4M4PA 4LF3B 3U7WL 4AQOA 1CXEA 3K8KA 5D1XA 3RGVB 5D5ME 4WI6A 5F1NA 4ELMB 3BEVA 3QT2A 4YQXH 4JO4H 1ZAGA 1VPOL 5K9QG 4KJPC 4R3SB 1PG7X 3DMMB 2NY5C 4WHTA 2QSCH 2A6KB 4JG1L 4NBXB 2E9IA 1T5XA 4Z95H 1KIRA 5B39B 5DK2A 3OAUH 2E6PA 4H1LG 5TFSL 3VD9A 2ADJA 2XZQL 3BIAX 1MLBB 4TULH 2QR0B 5HGDA 3RU8L 5I18L 4G6AC 3NCJL 5I1JL 2A6DB 5KVGH 4YZFF 3MREB 2B4CL 3O0RL 1Q0YL 4JJ5B 5IMKB 1JHTA 1WAAE 1RHFA 1YMHA 4YXLL 2NNAB 4JZOB 1WGOA 4K71C 3PHOB 2X7LA 2EH8L 4PJGE 5A2KH 3T08A 3QXAB 3VFTA 4YDIL 2PETA 2EXWD 4B7IA 5CBAA 1CD1A 2R1YB 2NXZD 5JUEH 2AI0H 3EOTL 3KPQA 3U6RA 3IXTB 3QG6B 4DVBA 1JI1A 3MRDA 3NTCH 1ZSDB 4F7TA 5SWQB 4HZAA 4LCIH 5DJDA 3FFDB 1P1ZA 5FKPA 3EYOB 4QLRA 1IQDA 4IS6B 1MI5E 4FFVC 3QZWB 1F8TL 1KTDB 4WHDA 5L8JB 5MENB 2ZUWA 1FBIH 1TVDA 3RPKA 1OTUC 3PQYB 1NC4A 3UTQB 1A7NH 3I3EA 5EU7E 2D7NA 2ARJQ 1NBYB 1A6TB 2AJXH 3TN0C 2C1OB 1ORQA 2C4FU 2X6MA 4X5LA 4KRLB 5H94A 1LILA 3OQ3B 1WBXB 3AB0B 4JR9H 3RKDD 3MLVH 3TNNB 2X4NA 1Z9LA 3HTLX 4XB8A 4ZS7L 4K3EL 2AP2A 2XXMB 4HS3A 5JW4M 3GSNL 5HHOE 1S78D 2ZG2A 4FXKB 4OCWL 2P46B 4QWWC 3MJ8B 4MJID 1XF2B 3FT3A 5D7LA 1P7KA 2OTWA 1H15B 1E4KC 2B0SH 2AXJA 4RSVA 2ZUVA 4JKLA 1FG2A 5ELIA 3FO1A 2A6JA 3MBEB 1NLDH 4HZLB 4ODHH 1H3PL 4NPYA 1VDGA 1UACH 3HUJF 4Z9KB 4A2LA 1VACA 1NBVH 5DF0A 4N0UA 3UCRA 3ILQC 1GAFL 1YUHB 4I2XB 1DQMH 4J8RA 1OCWH 2RIKA 3CD4A 1X4YA 2W38A 3OGOE 1NJ9A 5JW4N 2VQUA 2YD5A 4Q6YA 3SDCA 3ARWA 1JYNA 1HXMB 2C4XA 5CZKA 2MHAA 4NFDA 4C56D 4HWNA 4LDLB 5IW6A 2BY0A 1BGXL 1JTPA 1JI2A 2PYFA 4Q6IB 5EN2B 4XX1E 5BXFB 1A0QH 3PWNB 2H32H 1CDJA 1K6QH 1CICD 4MDIA 1S7QA 5IR1A 1DBKH 3NIFF 1DEEA 1BM3L 2D0HA 1UA6H 3F5WA 2F8VA 1P7QB 2YD7A 3RRQA 3K2MC 4WWKB 5TF0A 1NAKH 4LLDB 2XXCB 2BVPA 2ESVA 2D0FA 1ND0A 2C1PB 2R2EA 4DAGL 1UKQA 4CN6A 3GIZL 2D7PA 1OF2B 4S1QH 1MCOH 3ME0A 4Y5YC 4NKIH 4JFFE 1G6RH 1TPXB 2DBJA 3ARBA 4DGVH 5D6CA 3KLAA 1Q1JH 3RY5A 2IFGA 4N8CL 3O6ML 2ZCHH 4CU8A 4W6XB 3HNVH 3BW9A 4YHPA 4AG4H 5J13C 4X6BA 2WINA 2VXVH 5ICZA 4FXGA 4P49A 4DKEL 4WWKA 1P6AB 2D7OA 5J4MA 3S34L 1EFXB 1GOHA 4QRPD 5HVHC 2A9NH 2ED9A 3FQWB 4X98A 2VWEE 1ZT1A 4O2CB 5L8LB 5CEYA 4WENB 2ORBL 5EU6E 3HPJB 4O2FA 4HH9A 5KZCD 4LSVH 3IXAB 2AV1B 2CIKB 3V0AC 4R4BA 4XWGL 1KENH 1NCAH 1QUNA 4IRJD 1FV1A 3VCLA 1T3FA 2OP4L 3GO1L 3THML 3UMTA 1LEIA 1C08A 4LAQH 1MELA 1BQSA 1JPSL 1NJ9B 3G5YB 5IMMB 4QRQB 3NPSB 4TRPH 2LAGB 1LK2A 2BNQA 4UOW0 4NNPH 3Q5TA 2EEDA 3BZDA 5AWNL 5KJRL 4X4ZA 3RWEA 4JG1H 4OZHE 3X3GL 2HJLA 3GDBA 3E8UH 4GXUN 4HPOH 3K1DA 3KDMB 5J7CC 3T65B 3CFKA 4R7NA 4NP4H 5F93C 1Z5LA 3MRRB 3VXSD 4WJ5B 5I8KL 4NN7B 5JDSB 3CUPA 2YMXL 3R06A 1IGFL 3S4SG 4PRNA 2V7HA 4LCWA 1SBBA 5DJYA 4GS7B 5E2JA 3ZDZE 3B8YA 1QFHA 4N8VG 2QSVA 3KAAA 3ZYIA 4YE4L 4PRHE 1F6AB 3MROA 5EIQA 2VMFA 1P5UA 3TV3L 3VGAB 5HI3D 3HG1D 3KHQA 2MCPH 4IS6A 4X0KA 4HKBB 3UBXB 2CK2A 3UZEA 2N1KA 1UJ3A 2ZOKA 4OGXL 3IRZA 1FORH 5CZVL 3BYYA 5C70A 1JNNH 1HILA 5DJ0B 3OG4B 4NO5B 3TIEB 1YEEL 1ZA3A 3BJ91 4ZYKA 5ID1B 3D25A 4MS8C 4XPAH 3QDME 4BZ1H 4YHOH 4PJXB 5CP7B 5E08L 1F97A 1MVUA 2PTTA 1RJYA 1D9KD 1OP9A 4JFDE 1K3IA 2DIJA 4V1DA 4H26A 1EEZA 2UWEA 3UDWC 3R8BB 1H3VA 1DJSA 3F7VA 1JTTA 2XRAH 3LSOB 3TF7C 4AM0B 1G0DA 1SBSH 3BO8B 2BERA 1OARL 1T5WB 4MA7H 4K8RD 1HYSC 1AHWC 5HHVL 2NLJA 1DSFH 2MFNA 4PJXA 5EU4B 2HN7B 5K9KA 1EMTL 2RCSH 4KJYB 3DSFL 4PLJC 3HUJB 4OUUA 3QUML 4R2GC 4H1LH 4V1DD 4Y5XA 5CP3H 3V5DB 1TZGL 1IQWL 3AMKA 4Z8FH 3S96B 4MXQC 4BSJA 5IW1B 3QPXH 4NJ9H 1ZHKB 5DRZA 5TDOB 2VSDA 3GI8H 2QLVB 2D3VA 5D2LE 1P84K 5HYJD 4JFEE 2YEZA 3HMXH 4U6VH 2AXGA 1INDH 5KOMC 3STZB 1L0QA 4X8JB 1PY9A 4H8WH 4PJAB 1CL7H 4EN3D 4K2UL 3DUUA 5ALBL 4HG4K 2VDQL 4ALAL 1NAKL 3I02B 4PV8A 1MJUH 1HHGA 4Z7VE 4WJ5A 4X9BA 1IGML 4G6KL 3IJYB 3WIIH 5AD0A 2IGFL 4ZYKB 3LV3B 1FFNB 4XC1H 5DHYA 4OUOA 4YHZH 32C2A 1NGPL 1KTKE 1A7BA 1RFDL 4HJGA 4OZIA 1H3UA 5C7XL 3OB8A 4WI3A 2EC9U 3B9EA 1MH5A 5CILH 1F2QA 4KQ4L 1GGBH 4KZEH 1JNNL 1JZ3A 4APQD 3HI5H 3CSPA 2OLDA 4C56E 3WDIA 3NCFB 4PJGA 4NQCB 5JHDB 3C08L 4PJ8A 1I7ZB 2FYYB 2VLME 3EDFA 4MNGA 1MHEA 5GSRA 4NM4H 4ETQB 3BQUB 4NO2B 4YE4H 1X5XA 5E4IA 5DMKA 2FB4H 3M8OH 1LEIB 1JMXA 3P0VH 5DJ8B 3VFVB 4ZUWB 1H5BB 3X12A 5C0CD 2G60H 3CMOL 4X7EC 5A2JH 4LCCC 4WCYL 1EX0A 2GEEA 3RUGF 3SN6N 5K9JL 2XZZA 3WNOA 3AY4C 4IDLA 3LAFA 5B38G 4XXCA 4NRYB 2CIIB 1W72A 4FXLA 4GH7B 1DN2A 1Q72L 5CBEA 3DI3B 4QGTA 4HWEH 4C57C 1QR1B 1RZJH 3DRQB 4BM7A 5D72L 1A1OB 3VFGH 3KYMA 4KROC 2OMBA 3QXWA 3VGFA 3DV6A 3ZDYE 1UC6A 2NLJB 4K07A 2EDOA 1A7NL 5LAXA 1NCCL 2AJYL 4WUUD 4KKLC 4FG6D 1UACL 4QT5B 3P0YH 3QFJD 5DJAA 2GITA 1KB9J 5JHDE 2JCCB 5C2UB 5I0ZA 4EI6B 1BREA 1FHGA 5TF1L 2GFBA 2R2EB 2WBJD 1B4JL 4N8CH 1DSFL 1CL7L 1MVUB 2PTTB 3QDMB 4PGBA 5B8CB 1MCWW 3WLBA 1QSVA 1UM5H 1A5FL 1ZT1B 4M02A 3B9KB 4LVHB 3FOLB 5F7FA 3LKSB 5HGBA 1P5VA 1V3KA 4JANB 5ACMA 3SE8H 4S1SL 3RWDA 1XR8A 2V6HA 4XZUB 3O9WA 1OAZH 1TCMA 5JQHC 3RKDC 1NFKA 4ZFOA 3VG9C 3VU2A 2LTQC 3H3KA 4P23D 3DMMD 1CR9H 1K8IB 3CFJB 2QSCL 1AP2B 5LQBL 1MY5A 3ZTNH 2ZCHL 3QEQA 3RWDB 3S96A 1XF3A 4NFCA 5GRUL 4IDJH 4LLQA 3IDNB 5TPWH 1MCOL 4CVWA 1KCVL 2M8XA 5DA0B 4X9FA 4U1HB 5JTWA 3DARA 1HINL 3H9HA 4M6MH 1T7XA 4NPYB 1W0YT 1R5VB 3BISA 4Y4FD 4UNVA 1PG7H 2J5LC 3T77B 4HBCH 3CFKB 3BP5B 1LVEA 4HLJA 2AJUH 3DXAE 3QJHA 2D4FA 5DK0A 1P4LA 1T20A 4K7PH 3W9DB 3NH7L 4HCRA 5DA4A 1S7SB 4KRPD 4HIEB 4OLZH 3S3SA 1MNUL 2ARWA 3AAZA 1D5BB 1WBXA 2GITB 3PUCA 1U8JA 1BZ7A 3G6JF 3VXRE 1RI8A 1VGEH 2M2DA 3HZMB 4XXDA 1CL7I 1YN7B 1YDPB 5CSBA 3HG1E 5C86A 1EVTC 4PJ7B 4OT1L 4XVSH 4GMSL 5C0JA 5EPMB 3RI5K 5E7FA 1OCWL 1XZ0A 3MGTA 5DJDB 4X4XB 4J7RA 3MLTA 1HILB 2V5MA 1DQDL 1XGPB 2HVJA 2VISB 3SKNA 3VXSE 4R7DB 2X40A 3K4ZA 2NR6D 2PW2A 1ZTXL 5FDWB 3BH8A 4ZO6A 3O81A 5ERWB 1CBVH 4X0KB 2FX8L 2YPLD 4JFEA 5HGAA 3GUTB 7CGTA 4PGCB 3LCYA 3VGBA 1JCKA 4DFHA 1F6AA 4ZPTB 4NWUL 1M4KA 3O6KH 3MREA 3T2QA 1HEZB 2UVEA 1NFIA 3MXVL 1JYXA 1NBZA 3HS0B 2W91A 1KF9B 3MPCA 4F57L 3T0XA 1FL3A 4G9FB 3EDEA 1MCWM 4RMSA 2FD6L 2R29L 5HVGB 3MYJA 3BPCB 4EI5D 7FABH 1QPXA 4PTUA 4EN3C 5C0AB 4KHXL 4M00A 3ZKXB 4QF1B 4ODXB 4HIJA 5FUCC 5IVXA 4OF7A 4P46D 1QEWA 3K8LA 1F11B 3MLUL 3DETC 2OZ4H 1N7ML 1CD1B 2R1YA 5FCUH 3IU4H 4FP8H 3BUTA 4MNGE 5D2NE 4JVWA 2W0LA 3D85A 1RIVH 4ORZC 1HI6A 4EDWH 1JFQH 1MAJA 4PV8B 1VKXA 1MFCL 2MKLC 2YPLB 4HUWA 1YEJH 1PKOA 2FWOA 5IW6B 2IANE 3QA3B 1U8PA 1SYVB 2IBZY 3ARFB 2D31A 1EBAA 2XTJD 2Q6WA 3E6HA 2QR0A 4X8JA 3QRGH 4JG0L 4RGOH 5IBTH 5KSBF 2P5WE 1EO8H 2Z4QB 4LPUA 2HFEB 3LOWA 3TO4B 3ZE0F 4G7YH 4UAOC 3L6FB 4LF3A 2QQNL 5T3ZL 3S3JA 2UZIH 5HDQH 1FYTB 4ZQKB 2HN7A 3SO3C 1B2WL 3WHXB 2YPLE 4MAUH 5I76B 1XIWC 4OZHF 1H15A 2OTWB 1AIFB 1CFQA 5D7SH 5A2FA 5IK3B 3O8XD 4UIMA 5I1AA 1JVKA 2VLRB 3ECBB 4OM1H 3NCEB 2V5SA 4B50A 1P4BH 3UTSE 5IJVA 1TNNA 3HC3L 1HK6A 3IETB 3QDAA 5EU6D 3ES6A 4XBEL 3VMOA 2NZIA 1F4XH 2MMXA 5J56B 4P2CG 1A6TA 1NBYA 1ND0B 2C1PA 2BSTB 4LLAA 4I1NB 2DQIL 3MV7A 2VDQH 2BVTA 3DVNA 4KRMB 3VRIA 1UM4H 1KGCD 2NZ9C 3DRTA 1AXSA 1C8PA 1DVFA 2Y5TB 4ZO9A 1EBPA 1IEHA 2YC1B 4GSDH 4GKNA 3TNMA 4P4RB 4E0RA 5C3LD 5I8OH 3DHMA 3STBA 3HZYB 1FCGA 1XGYH 2UV3A 2ERJB 1K4DA 5H2BB 3DOSA 1CVRA 1KLFA 4X9IA 3WIIL 4BK4A 3Q6FA 1HH9A 2HT4C 3SKOB 1WIUA 1KJ2H 1XGQB 3GNML 3RDTA 5LGJB 3KS0J 2A74B 2VXTH 1QRKA 4MX7A 1E6JL 3B9AA 5I8EB 2CRYA 1FL6B 1NGXB 3O2DL 3B9DA 1FFOA 4EUPG 1FC2D 1H3XA 5HGDB 4UTAH 5C0BE 2X4QA 1NMAH 5GJSH 5C0IB 4JRXD 2W65B 3MRRA 3T0EA 2G9HA 3FO1B 4LGSB 5EBWA 1E27A 4HUNB 1NGZA 1AC0A 4KKBC 2GSIA 1MWAB 3BEVB 4NO0A 4G7YL 4Z7UE 5DJXB 2HMIC 3FB8A 4CUCA 4IM8A 5FA3B 2Z31B 2I27N 4LOUC 5FYJE 3F62A 5I75C 4YC2B 3A6CH 2YKLH 1ULVA 4G9DA 2C9AA 5HDLA 5E1AB 3EYSL 5C2BL 1FSKC 5D2NC 4Y19A 2ZWLT 4XPHL 3CDFA 1U92A 3CVHL 3T4YA 1BD2D 1HCFX 2JIXB 3IFOB 1IFHL 4N5ED 5D9SB 1KCLA 1T7WA 4XNYL 4OBRA 3O3BA 4LSTH 5F8RC 5GISL 5MENA 1WZ1L 4NQDB 1JGVH 1ZK9A 1NCWL 4QOKE 5JXEC 2LE9A 4MX7B 2I9TA 5ITFA 4DAGH 3QUYA 1HSAB 4W68A 2ED8A 3S9DB 4NZDA 2XN9B 3TBWB 1CLZL 3SKOA 5J6HA 4WHCA 3QDJD 4HH9B 4OLVH 1HOCB 4N5UA 1EXUA 5C2BH 1KCRH 3R0NA 3IFNH 4YNYA 1IRAY 2GJJA 3N1MC 3S4SA 1I8MB 5E2UH 5CBAB 2KQNA 4HF5L 5FUOH 1CE6A 4FTVD 2MSPA 4HXAL 1CGSH 2FHBA 3OJDB 2WV3A 5EU7C 3TJEL 1E4JA 5F6HJ 2GJZA 3MLWL 3CFEB 1C5BH 4RGMB 2NXYC 3UPRA 1MVFA 2ZNWA 3CAFA 3ARBC 2IPTH 2AJZA 2VUOA 3BH9A 3FO9A 4X7TB 1UWEL 1FH5H 2KUTA 3DVNB 3EFFB 3H7BA 1NEZG 4E9LA 5EUKB 1FFPA 4ZODA 5E8EB 4X6CE 1CXKA 2ADIB 3HE6B 1GPOH 2DLFH 4QEGA 5I8CA 3VRLF 1ACZA 4JDTL 3GNMH 3DBXB 4P5MB 4Y19D 4LQFH 1D6EB 1QKZL 4Y4FB 2VLRA 1UYWH 4PRPB 5DZNA 4CBPA 2ATKB 5IFJB 2H32A 3OB0K 3BD4A 3GMNA 4MDIB 4LDOB 1I9JL 3T8XB 2NY7H 5BXFA 4Z7UB 4KZDL 4X9HA 5E8PB 3RVUC 3M07A 3OX8B 4K8RL 4IRSC 2O5YH 4LSVL 3JTTB 1B6DA 4O00A 5D2LB 3S4SB 4WW1A 1OP5K 2DQHH 3BESR 4N8VA 3VI4E 2DYPB 5TH2B 1QRNE 1ZKAA 5FOBA 2XN9A 4C4KO 2EIDA 4U6XB 2DYPA 3ZKND 1G9NL 3OXSB 3VH8B 1HSAA 1RZJC 3DXAA 1T1ZA 1ORSA 1CTOA 1QSFE 4F80A 1OAUL 2C3WA 3O3AA 2E9JA 2EYRA 1P2CA 5FO7B 3ULUF 1XF4A 2C3VB 3DROB 4FZ8L 4C58B 1X9QA 1FVDB 1AGDA 1J12A 4P57B 3FQXA 4XGZB 1IBGH 5F1IA 4U1JA 3DMMC 3FO2B 3D87B 2Z8SA 4M93B 4OCNC 3T1FB 5L2KE 3QDHA 4OCLC 1KGCE 1SJXA 1QR4A 1F4AA 4D0CA 5D1ZC 4JFQA 5DHVA 4OI8A 3WJLA 4UMGA 5FHBL 5C07A 4D8PB 4UT9H 3BKCH 1Q0YH 1S5IH 4V1DE 1IEAA 5MI0C 4LIQE 1DEDA 4X6EB 5EBWB 3WDJA 1LO4H 4XCYA 1FFPB 3UO1L 1DUZA 3GJFK 3ZTJG 2W0PA 3HNVL 1JPST 3H8NA 4PS4H 5KW9L 2OJZH 1Y0LB 3TZVD 3MRJB 2AEIT 3BDXA 2CK0L 3T2OA 4D0BA 4NJAH 1FRGL 4ODTL 3ARQA 4E41A 3QISA 1IKFH 4Z7UF 3OKOA 5EO9B 3SE8L 1R3IL 4YUEL 1YY8B 3ULVH 3HPLB 1NMBL 1QNZL 1OQOA 4TVPH 5DO2C 2P47B 4X6DB 1HKLL 5HJ3A 5C3TA 4Z7QE 3FB5A 4LSSL 4WUUE 4CVXA 4QKXB 4KKCC 2P48B 5HGGS 3WFHA 2YD1A 4PY8J 3CNKA 3NCYS 4NFBA 1A6WL 3TZVA 2OJEA 3SKJL 5HYSB 1EEYA 1MJ8H 3U1SL 3BRGC 3KPPA 1SMAA 4D9LL 1AQDA 4S1SH 1QG3A 1T1ZB 4DKFL 2XWTB 1SHMA 1MLBA 3VH8A 5GGQL 5B38B 1HXYA 1FGVH 4I0KA 3SY0A 1U8LA 3U2SB 5F88A 1I7UB 1FIGL 5F96H 3OB0H 4YX2H 5DFTA 4JR9L 1IEBA 2WUCL 3ARPA 1UFUA 2VDRH 1YPZB 4WEMB 4AL8H 2DQJL 4KHTH 2XQBL 5GS2H 3D3VE 5H35B 1E6OL 4TUOB 5ICYA 3FB8B 2NY6C 2AQ1A 2E8ZA 3VFMB 3W9DA 2P1YA 1OSPH 1OAUH 5KVFH 1H3PH 4M9OA 3QR2A 1TZHA 9CGTA 3MCLH 3OKLB 5LGHL 2DIBA 4RNRB 4K9EH 2ZJSH 3WNLA 2OM5A 1ZANH 2X42A 3V6OE 1G7MA 3SEPA 3NABH 3UJJL 4Y4FA 5C0GB 1CDHA 1QLEH 1YA5A 5AZ2H 2CXKA 2WIMA 4EI5A 1ORSB 1MSPA 4MXQD 2J8UF 4NDMA 4G43B 2O61A 5TQ2L 2AVGA 4R96B 4MB4A 1BBDL 3TYFA 3MSPA 1FYTD 1NSNH 1XCTA 2BSSA 3SBWC 1K3ZA 1S9YA 2HAZA 5DJZB 1LK3L 4GO6B 1Q9WA 5C7XH 1L7TL 3VWKB 3CFEA 4AEEA 3ULUD 3L3JA 1HN1A 1AD0A 3BSZH 4XP4H 1HI6B 4NZTH 1J7VR 1T0PB 4HDIA 1DUYA 5EUOA 2IGFH 3KYKH 5IB3B 5SWSA 4TVPD 4NQEB 1EH9A 1JN6B 5IFJA 1MIEL 1K8DB 3WLBB 1L7IH 2NY3C 5MP6H 5JOFB 2WQRA 1OQXA 3D6GA 3QIUB 1Q9LB 5A1AA 4YEEA 5I71B 3FB7B 3QZWG 4BH7A 3O4OC 4G7VH 3T09A 3RX8A 5F9DC 1DBMH 3P3YA 5BJTB 5EA0L 3LHPH 3NCCB 4H8WL 1CG9B 1LWRA 4HIHA 4WO4D 1NEUA 1VESA 2YXMA 1FRGH 1U0QA 4UOW1 1K5NA 3BMVA 1YEDB 1CGXA 2YKLL 4OF5A 1N4XL 5HHQB 4WTZG 1V7NL 3A67L 1N5AB 4UB0H 5A43C 1GGUA 1NCDH 3G9AB 3H7LA 3MV9D 2X9YA 4RMRA 4Z78A 1GXEA 1ZLVH 4YQXL 3QCTH 4WNQB 5IMOB 2BSRB 1PD6A 4YPJA 2H9GA 5GRWA 3QUXD 1SJEB 2PTUA 1FNHA 3OJVC 4O9HL 1YPZF 5IF0A 4H1LB 5EZJA 3T0BA 5A40E 2GAZB 1IBGL 1A7QL 1B0RB 5J1TC 4XVTH 1RIVL 3VXPB 1QSFA 1R3LA 4OIBA 1DLFL 2ZUUA 4XPHH 3BDBA 3ALXA 2R0KH 3WLWC 3VXNA 3W39A 3QUYB 4LSUH 4YHNA 5JW4Q 4NUGH 2NY5L 3T0AA 2SEBA 5DEZA 3RDTB 1S9WB 1OT2A 1G7HA 4GQPH 3A6BH 1YN7A 2E7BA 2X4PB 5CFHA 2IFFL 4AENA 1X5IA 1BPVA 4PJGB 4RRPA 3I50H 1BQLH 4ZFGH 5GGSA 3TT1H 3EO0B 5H2BA 3IKCB 4CMMB 1JN6A 1BP3B 5GGTH 5D7IA 4JPKH 4LIQH 2HG5B 3FONA 1Q72H 5J0BA 4HJGB 4JFHD 2PO6B 2GSIB 4U6HA 5F6IB 1E4KA 4PGEB 3E1F1 1HIMH 2V9QA 3L3OB 4JKPL 4PJDF 3MA7A 4BSVA 2HKHL 5ADPL 3DVFA 3KJ4C 3GI9L 1TQBC 3DX6A 4LLUA 4JFOB 1XCTB 2BSSB 2GY5A 4PD4K 1CGSL 4WY7L 4EIGB 4YFDB 3FN0L 1B9ZA 2Y36L 4ONOA 3LH2L 1HEZA 3HC3H 5FYKU 1ZS8A 2J88H 5GRXG 1P4BL 3KLDA 4TVSa 3MTRA 2R2CA 3MV01 3VFUA 1CXFA 5DD0L 4NBZB 1KJMB 5C0GA 3UTPD 3LZFL 1RD6A 1T4KA 2V2WA 3ZHDA 1KLGA 5I1HH 5BS0E 5EU3B 1KFAL 4P2QE 2HVJB 1G1YA 1GL4B 2J8UE 5DQDH 1IGCL 5E03A 2ZZUT 4UB0L 1Y18B 4OLZL 3FRPA 5JOPE 3OL2A 3PL6D 5JW3L 1YN6A 3NH7H 5H35A 2L7UA 3D9AH 3RIAK 2D9QB 2VR4A 5KVDH 2X4RA 4YXKL 4NQEE 4ZDHB 3IGAB 5IBTL 1RUKL 1MRFL 3SE3C 3MRFA 3C6LA 1ZT7B 4DQOL 3QSKB 1BQHA 3K0WA 4MD0A 1D5BA 4NZUH 5DD3H 2D31B 1F58L 4GQ9H 1U3HA 5I2IA 2DQDH 4J2XA 1M7DB 5EC1A 1U8PB 3MUHL 3TEUA 5IV2B 5DYOA 5BQ7A 1JNHA 1ZA6B 5T3ZD 2B7DT 3PXHA 5E99H 5EOCJ 1NUDA 4YDKH 2I60L 1BD2A 3MV8E 3ZYOA 5FYLD 4G9FE 1IQWH 1MCBA 3H9HB 5L9DL 4G3YH 1JF6A 2AJVH 2FO4B 1KTLB 43CAA 2NY4C 4FQ1H 1JUFA 1RJLA 1FDLH 1KB5L 1UJ3B 3EOBB 2ZG1A 1LP9B 2X4SB 2Z8VC 3U7AA 3MNZB 4X6FB 3BOVA 2HH0H 4YHLH 2W59A 4F58L 4F8TA 1AHWA 3Q3GB 4OCYL 3RFZC 2R8SL 1CCZA 4LCWE 2FX7L 4ODSH 4X80L 2Q6WB 4QGYA 2LQRA 4UTAL 4LLVB 3VDCA 3IU3A 3F6LA 1EVUA 3MRKB 4Q97A 3T3PF 4CAGA 2FSEB 5KBNC 1SY6A 3B2VL 5L0QB 2W0KA 3C2AL 4U6HB 3OKDA 1RZIA 3B9KA 5IWLC 3MJGX 3P4MA 5ANME 3IJHB 1OLZA 4IRSA 3QDJA 1CK0L 4FZEH 1N5YL 2VISA 1IAOA 4X7CC 4U1JB 5D7KD 3G5XA 4JZJC 5DQDL 4K3DL 4DGVL 3F7QA 1XZ0B 2H1PH 4X99B 1R5IB 2AK4A 2ADGA 3V6ZB 3KPNB 1DQQB 1CGTA 3UJIL 4XP6H 1L6ZA 5FUZH 5D5MB 5J9PB 1OAQL 3B5HA 4KTDH 5C0RH 1MREH 1FLRL 3CZJA 2Q87A 2N7BA 3K2UH 4GAGH 4NQTA 4QXGL 4AEFA 3UTSD 3HZVB 4CDHA 1U2HA 4XI5C 1CGUA 4WCYH 2F19H 1B0RA 1CXIA 2D7QA 4DFIA 5M7QA 4RGND 3DO3A 2AJUL 3OR6B 5FECA 3OAYH 1SJVA 2BCKB 1OTTD 4KFZC 4WFGD 3S5LA 2NY2B 2EDQA 3DI2B 2BHZA 2XN9D 5FDWA 1Q94B 1I3VA 4MVBC 4D2NA 3K2UL 2ICWA 5SX5H 5MEND 5KANG 1R3HB 2CLRA 2RR3A 1VGEL 2G75B 2QQNH 1M71B 3ILPA 5GGTL 1IC4H 1T83A 3KXFE 2B1AL 1PYWA 4Y5YB 5LWYL 4OB5L 1QFUH 1D6EA 5D93C 1YNTA 1XAUA 3RBGA 2BDNL 2MPAL 4PJFF 1R24B 4OTXL 4UOJA 4NRZA 4N68A 3WFEH 2QV2A 4LNRB 4MD5B 3IAQA 3F65A 4FQJL 4NO0D 3MRNA 3QWRD 5EOTB 2A73A 3F7VB 1S5IL 1HWHB 1NCTA 4XZUA 3H3BC 3LRGA 4K23H 5T1MB 5KANI 5F44A 1DANU 2OP4H 3GO1H 2XZCL 4L8CB 4ONGL 1RV6X 3UXFA 1CICB 1ZEAL 1P7HL 5DMGD 1GOGA 2I5YL 5FGCE 3FOLA 3ZSTA 2HLAB 2K1MA 1Z9MA 2R8SH 5I1KL 3BAEH 1KSRA 4FQXD 4EVNB 3TIDA 1VFBB 3L5XL 5B8CA 1TETH 4G8IA 3FQNB 4FFWD 5EN2A 4IOIA 1MFNA 1PVHA 4U1MA 1NKRA 5KG9A 3STZA 1BWMA 1IVLA 3MMEB 4LLWA 3MRLA 3NZ8B 4UINH 1KLUB 2R9HD 4JHZA 1ZHLB 2CDEB 5HHVH 3DV6B 1KPRB 1I9IH 4JANA 2AEPL 1TCRA 3LKPA 4ZD3H 2GJ6A 4MB5A 1PEZA 2BVEA 3ARRA 1MIEH 5DD0H 4YFLF 5FF6B 5GGVH 4I3RL 2X44D 1PW3A 4JLRA 3U4EB 4K7PL 4HS6A 4LHUD 3BWAB 1DQJA 4DWHA 5HGHB 4AM0A 1UM6H 1YJDL 3U79A 1KIPB 3O6FA 3QIBD 4TOYH 1IC4L 1GHFH 4JY6A 2N4IA 3SDAB 3AM8A 3C6LC 1MQKH 1NANI 5GSRB 1MFAH 1MHEB 2HKFH 1KJ3L 4NKMA 3V2AR 1V7MH 2VAJA 3EIFA 4HPOL 5HYSA 3TZVB 3KPNA 1DQQA 2ADGB 3FN9A 1D5MA 4HW6A 3KPRE 4R6UA 2EDHA 4LPXA 4BZYA 3QEQD 3PHSA 5F7LB 4Z7NE 5GRJH 3VGGA 3NA4A 5HPMB 3KPQB 1OAYH 4UDTB 4DUXA 2RFXA 5IB1B 2FEEI 5ETUA 1UXWB 3MCLL 5LGHH 1IGMH 4I77H 5KVFL 3MNWA 1RZIB 4V2CB 2FGWH 1MF2H 1RZGA 4FQPA 4QRUB 1T21A 4M61B 4F9PA 5I1IL 1E0OB 5TPWL 1NANH 3LD8C 3MV7B 5IFAL 1FIEA 5D7IE 1JZ6A 3VXTB 5ENWA 1Q38A 4K3DH 5K59F 5J06A 2V5RA 1ETZA 4HKJA 5ACZA 1F3JB 4P5KA 3GM8A 5DUPL 1AHWB 3HR6A 4S1RL 4ERSL 4JFQB 1BFTA 5DHVB 1Z5LB 1LEGB 3DMMA 4TSCH 3JV6B 3MCKA 4LOUD 4QCIB 3T3PE 1I9RH 2ZSWB 3Q6GH 4GOSA 2VXVL 5CIPB 2VE6B 2ITCA 4EDXA 3SE9L 3FQXB 1NCCH 4L29B 4TNWK 4XGZA 4JO1L 1EHLH 2FO4A 2J8UB 4OZ4B 1HYRC 4JO3H 3UTTE 3UX9B 1Z6JT 1WZLA 3HUJA 4WU7B 1CIDA 1KIQB 5T1LB 2VDKH 4GMTH 4R4ND 4M6NH 4NCC2 2NY1D 3MR9B 5IESH 2FX9L 4P4KC 1TVBB 1AGBA 3BP4B 4CJ1A 1B4JH 2I07B 3BGFB 1N59B 4G7VL 1A6AB 3ALPA 4PRPD 1M7DA 4OCRH 5EC1B 3JVGC 2H3NB 1T66D 5K9JH 1I85A 1U3ZA 3TO4C 4NNYB 1HXMA 3RUGE 1HHJB 2WSKA 3GBML 3OAUL 5HVHB 3CGTA 4RAUB 5KW9H 2NTFB 2W60A 1BEYH 4YHOL 4DN4L 5CP7A 2IBZX 1T66C 3CSBA 2HLFD 5CP3A 2IH3B 2XPGB 4XNQB 5HTSA 2DQCH 3DVGA 1MFAL 2HKFL 3G6JE 3LIZH 1CQKA 5GGUB 1LDSA 2XTLA 2WWKT 4O02L 3AREC 4P5MA 5TE7L 3U4BH 4R4FL 4HIJB 4MNQA 2DQIH 4TPRL 2VN4A 5MP6L 1X5YA 4G8GD 4F7EB 1YEFH 3DHJA 4A6YH 4F2MA 1YMMA 4HS3B 3ULSB 5DC4B 4KUCD 1T89C 2Y7QB 4U1IB 4MWFA 2R0ZH 1QO3B 3SCMA 4XHQA 1Z2KA 3QIWB 1IGFH 4FQHA 4BK5A 5D6DA 1A3LL 1JGLH 1FPTH 1PZ5A 2UZIL 5HDQL 1LQSR 1PG7W 2AJ3B 3VFSB 2AEQH 4TNWF 5ADOL 3BXNA 1V3MA 4DKAA 1YEHL 3MLPA 4LLYA 5DVOA 1UXSA 1GZPA 3H0TA 4JFPB 4ZXBC 2E6QA 5ESVB 4XTRC 5KJRH 4OLUL 4CNIB 3R1GH 1LO0H 2A38A 2DQUH 4Z5RA 2X4UA 2IAMC 1RK1B 4FG6C 2R2HA 2DKSA 4FQIL 2V7NA 3B5GA 5IIEB 4I48B 3RHWF 1W8NA 3HC0A 3X17A 4NUGL 2EDYA 3VXSA 1AE6H 3PGDB 5IROC 4G8EA 4UQ3B 1KBGL 4FQXB 1JZ7A 4YEFA 3EUUA 1N26A 1ED3A 4TNVF 3W39B 5DD1H 2DMKA 3VFPA 1MI5A 3TT1L 3MLZL 2A6JB 3IXAA 1M05B 5DK0B 3GHEL 1A7RL 4FA8A 4HH8A 3V4VL 3KDMA 2PYED 1CLYL 1FSKB 4NUJA 5D2NB 1KYOK 2XKUA 5MEQA 1VFBA 5KVGL 4LP4A 2P49B 4PG2A 4WNQA 5IHBA 3FCTA 1C5CH 6FABL 1HH6A 4YFLI 5A3IC 3D39A 5LGKA 2GTWA 2DI8A 3FB6B 4RISH 1QFUL 1ORQB 5CMAB 2J4WH 4HAFA 4WFEE 4AIZA 5ITBL 1S78C 1QO3A 1AFVH 2YWYA 5D7LE 4IRJA 4OF3A 5LGJA 4L5FH 1A4KA 1JGDB 3VXSB 3ZYJA 3UDWA 1XH3B 2LVEA 3RPIA 1H0DA 3FQTA 4PRBA 2EXYD 1INEL 4YLQT 2PYEE 3VCLB 2UZXB 3KPRA 5ANMB 3FT2B 4PGDA 3SDYL 3QNYA 4R2GB 3EKCA 4RGMC 4YHMH 1OM3L 1LO5B 5ESVA 4BZ2L 5I18H 4FQJH 2J4WL 4OZFA 5DQJA 4AZ8A 3IT8D 3ULUL 1RK0A 4Y5VB 4NN5B 1UXSB 5IB2B 3F7RA 1SY6L 5IB3A 3OBAA 2JELL 2AJSH 2VLRD 4PR5B 4YAQA 4NGHL 5GHWH 2E5EA 2W60B 2OL3B 5C07E 4HGMA 2EXWC 4JPVH 3PDDA 2BHYA 2A6DA 3MOAL 1FZKB 3PJSA 2MHAB 4JFZH 3KYAA 2PCPB 4QHUB 5T1MA 4MVBD 3LRSA 4XNUH 4GS7C 2VXUL 3DV4B 5DRXA 3QIUD 3MLSL 3RAJH 1DBBL 1U93A 5E6IA 3UTTA 3GSRB 2XA8L 2V9RA 4JE4B 4IJ3C 4TRPL 1DANT 3B2VH 4QXGH 2I9LA 4KDVA 3VXMD 5JW5A 4ETYA 5I15H 5TQ0H 3V6FA 3KWWB 1OSZB 4JHWL 4JFDD 1UGNA 3G9VA 1OPGL 5JPNB 5CIPA 1BJ8A 3MRPA 4HMEA 4PB9L 1XF2A 2VQ1A 3GSNH 2VLJD 4GXVH 3STLA 4FXKA 3K8MA 4JPIB 4I9WD 4KKAC 3TBYB 5HHPA 5BV7L 1A4JB 1EV2E 3PP3H 1URLA 3JWDL 2CO7B 4XAWH 1U95B 1UM4L 4BQCA 4O5LL 4PJEB 4CGTA 5HXMA 4OD2B 2OXHA 2VJXA 4J8RB 3FOMB 2FYYA 2CR3A 1T21B 4M61A 5LCVH 3ARYA 4Y8DC 2J3SA 1PDKA 2OR9H 2GY7B 1H3TA 1RK1A 2DQTL 3LN4B 5F7DA 2DWEA 3U46A 3PGFL 5D1ZB 4XMKH 2R69H 2F54B 5E6ID 3UTTD 3C2SA 3QRFM 2J8UA 3U6RB 3GSXA 1QEWB 1BX2B 3UZVB 3WKMH 3O4LD 1BZ9A 1FE8L 4K71B 4PV9A 2B20A 1P7KB 2YA1A 2EE6A 2NX5D 4B0MM 2EH8H 3D1MC 2OI9B 3N9GL 4U1LA 3KYOB 2Q76B 3IJYA 4F37F 3VFSA 1ADQH 2AJ3A 4YH6A 3GMPB 1F8TH 3S34H 3WL9A 1AGCA 5DMIH 1N0LA 1JHTB 3I02A 4HKJB 5ACZB 1MJ8L 1JNHB 2DYPD 1L9MA 4PS4L 2ZCLH 1N4XH 3HMWH 3TN0D 2D9CA 1Q9KB 2NY3D 4PJCF 1JWSB 2MPAH 3CVHB 4KWUA 3TO2B 5TE6H 3INUL 4PGCA 1KIRB 3N1GC 4RMQA 1T04B 3IFLH 4X6CA 3PDOB 5IVNA 1RURH 3QAZC 1G6RA 4M1DL 1JNJA 2WQ8A 4D3CH 5JA8B 4S0TD 5IB1A 2ZCKH 2H2SD 3IVKA 1CF8H 1TXKA 1MWAL 2L4OA 4QOKA 4NO3A 3DVGB 4P3WA 4HGWB 2HT3D 3EYFB 1IZKA 3LS4H 2QHRL 1X7QA 1P6FA 3GBLA 4WV1A 4DKDC 5FGRA 1W0WA 4IRZL 1OAKH 4NT6B 3INUH 2BVUA 5DQ9B 2DMCA 5F21B 4AK1A 3LB6C 1BBJA 5DFWH 5LCVL 1YMHB 1ZHLA 3BKJH 5L7XH 3FMGH 1N8ZB 3VGEA 3W81A 1YDPA 5FM4A 4DN3L 1DBAL 5C8JB 5IHUL 4YHYB 2DD8H 1QA9B 1U8NB 4PJDE 4KHTL 2JF1A 3ARGC 4H26B 4LARH 4XP9L 3IGAA 5JMOC 1WICA 4H8WC 5FYJL 3O6KL 4XCFL 4N9GB 3QQ9D 2WK2A 3MR9A 4R0LB 3I6GA 3MBXH 4PJIF 2R9HC 1EAPA 4N0YH 5EU5A 4NIKB 1KJ2A 1XGRA 2W1NA 4KV5F 5DUBB 1ZANL 4NO5A 3MUZ1 4N9OB 2NX5E 1A2YA 3PP3K 3U1SH 3I6LE 5CWSA 1KIUA 1CFNA 2CDEA 1NKOA 4PJXE 4KROB 1KNOB 5DD5H 5IM7A 1I9EA 3VFUB 1F3JA 2VDRL 1ETZB 2YN5A 2EE2A 3JV5A 2WUCH 2JJWA 1CLOH 5F3HA 5GSVB 3WFDL 5L6YL 3PWUB 5IBUB 4S1DC 4OLXL 3SGKC 4AY0A 4EOWH 4OQTA 4NM8H 4DZ8A 3RWGA 4PRNB 1KCKA 3MJ6A 3QJFA 2VZOA 1R0AH 3U48A 3K81A 3MLWH 2O5XL 5IHUH 5SV4A 2AXFB 4BELD 1P4IH 3TIDB 4U0RC 2HJFA 1UXWA 3MA7B 4BSVB 3L3OA 3O4LB 5J13B 5IMLA 2XA8H 1CDBA 2Z9TA 4M8VA 1VFAA 1OL0A 4HK0B 4YHML 2HJLB 3EHBD 1F4YL 1R3KA 4AMKH 3QRGL 4JG0H 3OR6A 1JMZA 1V3LA 3VXME 1UZ6F 3OR7B 2GCYB 1F58H 1S9XB 4GRMA 4MXVE 3TBWA 3HZVA 3MRGA 3S35X 5B3JF 4XMLL 3AM8C 5C6WH 5T3ZH 4KQ3L 1LK2B 1TVHA 5E2TH 4LNRA 1K5NB 3U30C 3CFDA 4U6YA 5D1QB 4HUVA 1CLCA 4NGHH 2EH7H 3PV6B 2F54D 4Y4KC 3CFDB 4U6YB 4XP4L 2NR6C 2NYYC 3X14A 3QEGH 1L7TH 2P43B 5BVJA 2O26U 4GBXB 5EUOF 1Q8MA 4JLRB 3WN5A 3G6JB 4F7CA 5CZVH 3RVXC 3VW3L 4OLXH 3AS0A 5SWSB 4L8SB 4E41E 1QZ1A 3REVA 4OFPA 1KB5A 1LO2L 3EYQC 4KVCH 4X4MA 1MWAA 2VDMH 2LABA 4WTXA 2NY2D 2EEAA 1JGVL 5F3BB 2VDLH 1WBZA 5BS0B 2VDPH 1QFWL 3OF6D 2WINB 1BJ1J 2W65A 3FAXA 1J8HB 1J11A 5ITBH 2HMID 1B6UA 5HHQA 3K74B 2Y25A 1ACYH 2BFVH 4LLVA 3WLWD 4MHHI 4MJ4A 4UTBL 1ZGLA 1OPGH 3G04B 1OLLA 3FN0H 1FP5A 5HI5C 4LLWB 3OV6A 3KPLA 3JV4B 2O61B 3GRWA 4H25B 4X99A 3FQRA 3H2WA 2V17H 1CFTB 4JKPH 4JVPA 3H42L 5CGYC 1AJ7L 4KDTA 1FYHB 2MCG1 5CKAA 4MA8L 5MEPA 3HCVB 4RCAA 1BZQK 5CJ8A 4XH2A 1K4DB 5IGXL 4LIQL 4U7MA 1KXVC 5E6IC 4UILH 4OGAC 3R0MA 1HHGB 4MXWH 5JPMA 5GGRA 4J12A 5TQ0L 3WFZA 1LEKB 3CCHA 3VWKA 4DEPB 1J1OL 4PRID 4OFYD 4M3KB 5GHWL 8FABA 4HMDA 4O4YL 4L3CA 3JBG7 1CFSA 4NQSA 1KC5H 4PJIE 3GIVB 1ZT7A 3AVEA 4ORGA 4N0CC 3CX5J 3WJJA 2AXGB 4G6MH 5C9JA 2HFFA 2DQUL 5MERB 1U8LB 2F19L 4A6YL 4J3WA 5IOPB 4P59L 3DURA 1U8IB 1NC2D 1AI1L 3VWKD 3QEUB 4G5ZL 3QHFH 5A2IH 4Z76B 4CMHB 3S36H 4L8DA 1NCWH 1UZ6E 5D71L 5E2VH 1FPTL 5DQ9A 1KELH 2FJGB 3BP7A 4CVZB 4OGYL 3GMMA 3QEQE 1KLGB 3QCVL 3B6SB 5BW7C 3TA3C 3IS1X 1VHPA 2VXQL 1OHQA 1MFBL 1QSEE 1RZKC 1N3NB 4LBEB 4ZTOL 4OV5B 1J8HE 2EZ0C 1WSST 3KPSD 3G5ZA 3OZ9L 1R6VA 2Q86A 2FL5B 1T80A 3BX7C 2N56A 3ZDXE 3K3QA 3HI6H 5GS1B 5DTFA 1LE9B 4MD0B 4MSWA 3BVNA 3D2UB 4CVUA 5TDPB 2W0FA 3SCMC 5SWSE 4ORGB 3LQMA 3UTQA 1PEWA 4WHYH 4D0BB 1F2XK 2OMNA 3LEVL 3V5HB 3V6OC 1JWSA 3I2CH 5L2JA 5KS9B 4QRRD 3QIBB 2NX5A 3MV9B 4XPFH 2KH2B 3FQUB 4XCYB 1OP3H 4L5FL 4LHUB 1ODAA 2NY4B 3KYKL 3OZ9H 4HUUA 3KLHD 1KN4L 5B8CC 4JAMB 3TFKC 2HTKD 4NKQB 1J0IA 2R0LL 4OV6F 3MRDB 3OKNA 5FYKH 3KYOA 4EQ2A 4Z8FL 1OGAA 1FNGB 3AMLA 2KDGA 3QYCA 3IKCA 4CMMA 1G0YR 1G9NH 5HHMB 5BCAA 5GGSB 1EO5A 2EDJA 3RY6A 1T7VA 1AGDB 1CYGA 2BNRD 1UKTA 3MV7E 5C09D 1NDMB 3V4UH 2UUDK 3RBSA 3EYVB 5I1CH 1FE8H 3WD5H 3MXVH 3OKOB 5EO9A 2VERN 4JB9L 4JFOA 3OAZH 4I3SH 1A1MB 1IC7H 1BWWA 1HE7A 4R7NB 1IT9L 4L3EB 3GUTA 4WW1B 1AXIB 1U8OA 1FZJA 3VXMA 4NKDB 1MFDH 3DYPA 1YEGL 4P3DA 3D18A 4PJAF 4MQ7A 1EERB 5IMOA 3T3MF 4YDLC 2ITDB 4P2QA 3WNMA 4AH2A 4WFED 1FNGA 1BIHA 4BSWB 4F15C 4WFGE 3VRJB 4MNQE 3RWEB 3WKNA 4AT6B 2QSTA 5CD5C 2DQEL 1MRCH 2YS4A 3MGTB 3VXUA 3SOBH 3CH1B 1OOAA 4EN3A 5IVXE 5I1IH 3HG1A 2Z31D 5KS9A 3RWIB 1T1YA 4PRAA 3AREA 4GBXD 4TSAL 4Y4FC 3TN0A 3TV3H 2BK8A 3ARDA 3CK0L 3TYGH 4Y2OA 4JKKA 3AAZB 1IAIM 3V4PH 1GGIL 2PKDA 3C5SA 3BP6B 5LXGL 2V2TA 3BD3A 1SJEA 3RWHA 4JZJA 4UIKL 2QHRH 2Y4SA 1S7RB 3M1BB 5D93B 3GI9H 3O4LA 2GJZB 1ZLWK 2NW2B 2VSCA 1HIML 4MQXD 4A6YA 1X3DA 2ARJB 2LU4A 3T77A 3QBTB 1MQKL 3MRBA 2DQCL 1KCSL 5DGRA 3HNTH 1U3YA 4JPKL 2E6JA 1R3IH 2YOCA 4Z76A 2RJMA 2DM4A 4I5BA 5I74B 4MJ6B 1TJHL 3WHE0 3PWUA 4PLKC 4Z0BL 5F6HI 5T1LD 4ISVA 4M7ZC 2ADIA 3L9RB 1REIA 5JIPA 4KPHH 4TUJB 3SDYH 2BVPB 2LAAA 1T22B 2DBLL 3PV7A 2ZUQB 3P77B 4EN3B 3FO9B 5F1SA 3P9LA 3B5TA 4ALAH 4J3SA 4YIQA 1CFBA 5E1AA 5SWZE 2GYSA 3UTPE 1WZ1H 3D39B 3LY6A 1NCAL 3PGCB 2B39A 1K4CB 5JPMB 2JB6A 3EO1B 1SEBB 4GW1A 3WSQL 5I66B 5IB5B 5IHLB 4MQTB 5GS0H 4P23B 4EXPX 4U7KA 4M5ZH 5C0CB 5D7IB 2F74A 3OPZH 4LKCA 3QPXL 3GK8H 3T0VA 3VFNB 5EBLA 5DMGC 3WS6C 3T0EB 3ZT7A 4N0CD 4PBWD 3A0OA 2AK4E 3MLRL 2VLRE 3U2SA 3ARFC 3P30L 3M17A 1ED3B 1NLBL 3PABB 4J3XA 5CUSL 1LD9B 3KNBA 3QUYD 2OL3L 5KSAA 2XZAH 3ZKMC 3BQUD 5I1KH 4OKDA 3M17B 2JIXA 4FFZH 1NDMA 1J8KA 5E8NA 1CD0A 3E6FA 3BGAA 4HC1H 4WV1B 1LP9F 1NMCC 4PJ7E 5IEKA 4PYHA 1IC1A 4PTTB 1QBML 4DOHE 3VXRB 4JRWA 2DBLH 4TUOA 5ICYB 1QRND 4DVRH 4KI5D 1UYWL 4NRYA 2XWBB 4LHUA 3UTSA 1KCUH 4KDTC 1DQDH 1GZQB 2RHEA 3V4PL 2AQ3A 5CLTA 1U6AH 3N06B 5K93A 3X12B 4JZNB 4NM4L 5GQBA 5D7SL 3HI1A 1Q0XL 3NZHL 1WVZA 1T22A 1AGEA 3K7UA 3BQUA 1FL6A 1NGXA 3T2NH 2IPTL 2NPLX 5HYJA 3FO0L 1I1RA 1MCRA 2CLVB 4JFZL 4RWHA 4ACPA 5TQ2H 1A6ZB 3CLEL 3QXDB 4AIOA 5TJWK 3QQNA 3BHBB 4MDJB 2IF7A 5F70A 1HH9B 3ZTNL 2VITB 2YWZA 1PAMA 1AIFA 3VD5A 1A6VH 4ESKA 5T3XL 3GKWL 3GMMB 3LS5L 3DYMA 4HK0A 4LSPL 1YECH 2Q1EA 3PHOA 4P5TC 3C2AH 2NYYD 5HJ3B 4LKXA 1LDPL 1CXHA 1IGYA 5F9WB 4Y1AE 5DZOA 4X7DC 4KTDL 2AERT 3SGJC 4LCUA 5B39A 2APWA 3EYUL 1HHJA 4PJAA 3J8F7 3ES6B 4RAHA 3S6CA 1RJZB 1CR9L 3RGHA 4CADA 1BQHG 1CK0H 3MV8B 4JM2F 4D8PA 1KNOA 3F58L 4XVJH 5E8PA 4MAYB 2P8MA 1QFWM 4R26H 3DUHA 5ISZA 3ROOB 3SGJA 3D85B 2DLIA 3S35L 3LDBB 3OKLA 5E4EC 2DL9A 4OZIE 4YHKL 5KS9E 5I19L 5BV7H 5J12C 1MFCH 4X5XA 5FK9A 2D0GA 4Y19E 4WEBL 2F54E 4TSBH 5F7KC 4U49A 3VXUE 3ZE2E 5I1GL 1X5JA 4L29A 2E3VA 3U0PB 1QVOB 1BD2E 4LVHC 3OGCB 2JJSC 2FIKB 2YBRB 3HMXL 4JFDB 5IFHL 4QF1A 2AAVA 4F7MB 1IEBB 1VADB 4LASH 2P45B 3BO8A 1IGIH 2J6EL 4GJTB 4RFOL 2FX8H 4K23L 1NGYA 4KUZH 1X5ZA 1MFEH 4OM0L 4JRYE 5GXBB 1TIUA 2XKSA 5T5NF 1OAYL 1NDGB 5DDHA 4ODTH 2Z91B 4RDQF 5HHXH 4PG9B 5HYSG 3MRMA 3QI9C 3C9NA 1VKXB 2APVA 3WCYA 3EFDL 3QG7H 2KZ1B 1BVZA 3AXLA 1ZA3B 3VFRB 5FM5M 5IFAH 1YEHH 3WFHB 2PF6A 3SDCD 3C5ZA 2QEJA 1XGPA 1IM3A 2IANB 4Y89A 2C26A 4ZUUB 1NEZA 3UBXG 1OTUD 1G7LA 4KI5F 1LDPH 2GJ6E 1XMWA 5EPMA 4NSKA 3LPGA 2BRRH 4X6CB 4FZEL 5JORA 3V5KA 2IPKB 1J0JA 1P9MA 4HIIB 1OM3H 1DBBH 4U1SA 2FB4L 3D5OF 2IAMA 2D7TL 4F9LA 1PG7L 2PYEA 3UTSB 2JK5B 2FECI 2AS5M 4HHAA 1OY3B 3LIZL 2KBGA 2H1PL 3FFCB 2EDNA 2QADC 4NO0B 3QO0A 4ZFZA 4RZCB 1C1EL 4M5YL 5CJQH 5MEQB 2E7LA 4F58H 1TNMA 3B6SA 3T1FA 4YNYB 2PW2B 4U6TA 1MCQA 1SMOA 1NUGA 4LRNH 4LVNC 5K59E 3L7FB 2WZPD 5C0EB 4JFFD 1R5VA 2HRLA 2V2XA 4FQXC 5CHNB 2MTPA 4FOMA 5EZLB 2X4QB 1XF4B 1WFOA 5DHXB 2YMXH 3Q5OA 5BZDA 1FFOB 4DVRL 1LD9A 3KNBB 3FOMA 1A6UH 1XGTA 2RCSL 3ULVD 5IBUG 2HKHH 5EU6B 1A1NA 4RFOH 3EJZC 3BUYA 4WW2B 1KENL 5ESAA 1NL0L 4O51B 5JZ7C 2F5BL 5F9OH 4P4KD 1IILE 3V52L 1KG0B 4N1EA 1AKJB 4ZPVB 5FA3A 3RL1B 3BPLC 2OZ4L 5D1ZD 4BFGA 4FQ1L 4JFPA 3P4NB 4YO0B 3MFFA 3BP5A 4ODVH 5ICXA 1EAPB 4PJ7F 4QY8B 2HWZL 3RWJB 4YIQB 3RU8H 3A67H 1SQ2N 4G3YL 1MHHA 3RQ3A 5FB8B 3HCVA 5T1KD 5C0IA 5FUOL 2XIDA 1X6NA 2F5AH 1ZWIB 2P8LA 1I1YB 5IFHH 1TJIH 4G8GA 1EZVY 2NY6D 3EOTH 4KXZI 4H25A 3WSQH 4MNQD 1T6WA 2PN5A 2JCCA 2IQ9L 2OBGA 1AP2A 3ARBB 1E28A 3O6LL 4P4KA 1M1SA 4GRLD 3CFBA 1B90A 4F2MB 1YQ2A 3VG0H 4Y1AD 3G04A 1MF2L 3DTXB 2X70A 4NRZB 1J5OH 4P2OB 3TT3L 5C09A 4MCYA 3UPAA 5DJ2B 4XRCA 2CUMA 4ZUTB 1DEEB 3RVUD 3TA3D 3RUGA 3TNMB 1OAXL 5I1DA 2GTZB 1PQZB 3QFDA 1O7VA 1KXQE 4PJAE 4OD1L 2ZUSA 4ZOBA 4QHMB 2CDGA 3TBVB 1EZVX 4HT1H 2C3XA 1XIWB 4OGXH 4GRWF 1DBML 1N0XL 2WM0A 1T04A 3QH3B 4IJ3B 4QRRA 2X10A 3MV8D 3X14B 1CZ8H 3IETA 3X3GH 3RWFB 1DBKL 2A1WL 4XBPB 5FYKD 1A4KB 1XT5A 5D7IF 1TVHB 4BQ6A 4S0SD 5DJ6B 2VIRA 5EO1B 3RA7L 4AIZB 1GJIA 4I0PD 5B3NA 5F7MC 5LBSL 1JPGB 3L3KB 3KPSA 4WGVB 5SWZD 2ZSVA 4GFTB 3O41A 1CXLA 2R23B 1MH5B 1TTGA 2Z31A 1QBMH 2R2BB 4OKVA 1D3CA 2GT9A 4QYOA 3FO0H 2ITCB 3OTTA 1IAOB 32C2B 1WIPA 4NUJB 2KL6A 1OWWA 4OQTL 3HA0A 3QIWD 4WU5A 1QBLL 3LN4A 1LEGA 3QI9A 5F7DB 4XP5L 3S5LG 4D9QE 3UAJC 1UEYA 3UP1A 5C9KA 6CGTA 4GG6F 4ZFFB 3HS0A 4JO2L 4D9LH 2BSED 3IU3B 4G8EB 5F3HB 1YMMD 4PJDA 3GEWB 2NY2C 3DSFH 1U8KB 2P5WA 2YD2A 1RZ8A 2VKXA 3LQAL 5FA4B 3RGVD 3DO7B 1FAIH 2CQVA 4JFYA 1HHHA 5C0DA 4LASL 2F53D 2A6IB 2JTDA 3O6MH 1UJTA 2QQLH 3DGGB 3EOBA 2FO1A 1YNKL 5CWSB 2VLKD 3ZTJH 4DW2L 4WEUD 5JPNA 4S1QL 3O6FC 4FHBD 2VDML 2BNUA 3MRQB 4KY1H 4M8QA 4MJ2A 1DL7H 5HYJE 1LO2H 4HUUB 4MQSB 4XBGA 4XX1G 3LV3A 5TGBA 4GKNB 1YEIL 3VFTB 1E4WL 2O5ZH 4UU9B 1UJ3C 2P7TA 4GG8B 3OWEA 1DFBL 4R0LA 4FQLL 1OWRM 3S37X 3F7PC 1KJVB 4YZFE 5L7XL 3VJ6B 3QEGL 3D2UA 4Z0BH 3PWPA 2VAAB 4XBPA 1U8JB 3IRPX 3LSOA 3VE0A 2WLYA 4L9LA 2FR4B 4HV8B 4NHCH 5CCKL 3OXRA 2VUYA 2D2OA 5HY9A 1CICC 5IHZA 2FLBT 4JO4L 5C8JA 3JTSA 3O11B 1N8ZA 5B4MC 5INCA 1YEKH 1ZXQA 1OGAE 2A77H 3B3IA 1T0MB 2QBWA 5GRVL 3U7YH 1D9KA 5DJ0A 1RK0B 4Y5VA 5IB2A 4M8QB 4HLZH 4NQUA 3RNQB 4C83B 4LVOB 5BO1L 4NO3B 1T1XA 2G60L 3CMOH 2H26B 3B3IB 4FABH 4N0FA 4I9WE 4QXTA 3P0VL 1IM9D 1TJHH 3DGGA 4ZOEA 3ARGB 3TVMA 5BS0D 2V2WB 1C7SA 3QWRA 3B2UC 2OQJA 3OG6B 3RPIB 3V9FA 2HFFB 3O3DA 2KKQA 1JF1B 7FABL 4M7KH 3RDTC 4MZ3A 5KG9B 1S8DA 3H6JA 1Q9KA 4PJ8D 3RL2B 4G5ZH 4I0PB 1N59A 5GIRA 2HVKB 2FLRT 2YUVA 1LMKA 1T6VN 4MA8H 4XC3H 3H3PL 1ROWA 5D8JH 2Z92A 2HT2C 4ZOCA 4QXUH 2CJUH 2P5EE 5DWUH 5EWIH 3TIEA 1JZ4A 4K7PY 1RUQL 4HXBH 5M95B 3VWKC 2Y07H 2ZKHL 2P42B 2ZOKB 1DP0A 3GB7B 3ZKMD 2DKUA 4QOKD 4CN4A 4ZOAA 3IDJB 3JV6A 3NTCL 1QOKA 1DLFH 3KPLB 4XPBL 1SM3L 5A3ID 4G9FA 1LGVA 2DQEH 4XP9H 1SEQL 4BUHA 4JM4H 4R8WL 5EBGA 5I71C 4Y2DB 4Z77B 1BAFL 4IHOA 1XR8B 1WFUA 4PJEA 2AJXL 1OD7A 5DJYB 3WS6A 2R2HB 2J12B 5BS0A 5EZLA 3ULVL 3QH3A 1CDYA 3SQOL 2HRPL 4XPTH 4XNZC 4E42B 1BFOA 3QUMH 4K7PX 5ERWA 3VFOA 2R0LH 4GW5A 4LAQL 3V0WH 4HWBH 3MA9H 4UDTA 3SKNB 2K7PA 4MD4B 1DBJL 4G6AD 1A6WH 3MODL 3U30B 3RTQA 1D5ZA 5EA0H 1ZEAH 1I8IB 2P24A 4OZIF 3CDGA 1TFHA 3V4UL 5DMKB 2APTA 2ORBH 1S7TA 4L3ED 3I2CL 1I8LA 2RGSA 4JFXA 3ETBF 4NKMB 5HI4D 2Q7NA 4XHJC 5GS3A 3CFBB 1RUKH 5DSCB 4JN1H 5JHDA 5D5MA 3DV4A 5DRXB 1NC4D 1CG9A 1MHCB 2VKWA 5EB9A 1IGTA 2CRMA 3MUJA 1FZKA 1PBYA 5CBEB 3DXAD 5DC9B 5HHOB 2YK1H 2DLEA 4I8DA 1Q9LA 4WTZA 1AQKH 3FT4A 1FNSL 3MXWH 2VR9A 1KCSH 3C5ZB 5DHYB 3NIDF 3ZLQC 5GS0C 1KFAH 3HNSL 3LEXA 3QFDB 5I1HL 4O2CA 1HNFA 2CKBH 1BAFH 3FTGB 5INDA 5FCSH 1ZLSH 2V9TA 2X41A 1WAAA 4RBPK 3NCBB 4P9MH 2ICES 4ZUWA 3O2VL 1KPRA 3MCG1 1H8SA 5SX4I 4N0UE 4AIXA 2G2RA 3L3DB 3IDXH 4EQ3A 4Z77A 3FQTB 1K8IA 1KC5L 2C7UA 4XP1H 2ZKHH 4FQCH 3C8KB 3TYGL 3TBTA 4NRXA 3BUYB 4EEEA 2Y06H 3ARZA 3MNZA 2GI7A 2QJDA 1U3HC 1QVOA 3FB6A 4KJQD 3QHFL 4EUPA 3N1FC 1VACB 4G8IB 1P7QA 1MHHB 3KYNB 3N0PB 4WU7A 1KJ2B 4LPYA 3O3UN 1RZJL 3EJZD 3EFDH 3RZCB 3QUZD 5I1CL 1JZ2A 1UEMA 5ICXB 5DS8B 4DZBA 2AEQL 1QLEL 1H3GA 2FZ3A 5EBMA 1CICA 2P8MB 2Q3ZA 5GGRY 3BI9X 4P9HC 1EJ6A 2JCCF 4OCMC 1T5WA 3VFMA 1ZE3C 4I0PA 4L3EE 2GFBB 3NGBC 4Y4HD 1IT9H 3D48R 4LCIL 2P44B 1S3KH 2BC4B 4FTVE 4O51A 2CKNA 4NNXA 5GZOD 4QT5A 4JM2B 3IFNL 4IRZH 4WRLA 3IB4A 2OQJB 5E9DB 2FX7H 4ODSL 4X80H 4CU6A 1ZHKA 5DRZB 5IGXH 1FVEA 1QBBA 3MNWB 1K9TA 3L1OL 4ZXBB 4PLKD 1IKNA 5IT2L 3MOAH 1P1ZB 1IGYB 3FFDA 4YXLH 3V79C 3HE7C 3WIHA 2FGZA 4QRPE 5SWQA 4F7TB 1QFOA 1RUPL 4OF6A 5HHMD 5HPMA 3HZKB 1IZJA 1X5HA 1LE5B 3KXFA 1CFVH 4YWGH 1I7RA 2F9BT 4ZTPL 4G80A 2MJWA 1KJMA 4JKWA 4M43H 2WMPA 3C6SB 3CSYA 2DOCA 4TTDD 5TDNB 3ZZ1A 3N50A 1QLFA 1I1FB 2FR4A 3O2DA 4L9LB 5HYIA 3JWNC 3IDMA 2UWEB 4K8RC 2UY6A 2BNRE 3HAEB 3S36L 4E41B 4PD4J 2IG2L 3LEVH 3R06B 2H2SC 4G6JH 3ULSA 2VLKE 1DQJB 2ESVD 3SKMB 1IQDB 3GM0A 3EYOA 1JGUL 2X09A 4HUMB 4MNQB 5I73B 3W9EA 5KVMC 1DDHA 1CGVA 1NEZB 4KMTL 4JREC 4X5WB 5L0QC 5D4QA 4U0QB 1B0GB 2F54A 4KRNA 1VA9A 3SQOH 5D1ZA 5C6PB 3RHWK 5E8NB 4XCNB 5AYQA 2X7LB 3KPMA 3VD4A 5EIIA 4PY8I 4QHKI 2FSEA 4I18A 1LNUA 5GJSL 4M4RA 3BRFA 4XPGH 2FX9H 3WFCL 4RX4A 3L3IB 4M7JH 4PJIA 3BKML 1DQML 4UDUA 2NXYB 3ZL4H 3G6AB 4GMTL 3OXSA 2NY7L 3ZHKA 1N7MH 4P46A 5CJOH 4DK6A 1FV1B 1KT2A 5D70L 2XG5A 3BN9C 4OAWB 1KEGH 4F7MA 1MCLA 3Q6GL 5DVLA 3FQNA 5SWZA 2BVYA 4IIQA 4APQB 5FYLL 1JUFB 2CUHA 4MZ2A 3OMZA 4IMLB 1TENA 2GT9B 2GSGA 4BQ9A 3FN3A 1OSPL 4DUVA 4RGNE 4RWYL 3OKKB 3WIFA 4HSQA 5D8JL 1CLOL 1MCKA 3MJ9L 2XI9A 1B0WA 4EDXB 1TJGL 5I1EL 3WS3B 4P2OA 4B7LA 4XAKE 3CMGA 5LKNA 5HBBA 3P9LB 4U3HA 2X70B 4LARL 2VIRB 1XR9B 2VC2L 4LEOB 4XB7A 3KJ4B 4PB9H 3IF1A 4OZHA 2OK0L 2A73B 4JCLA 4K94L 5EOTA 3SDAC 1K2DB 1CBVL 1QD0A 4HKXA 3L3GB 3TJEH 4B41A 5EUKA 4DTGL 5JHLL 2K7QA 5FM8A 3MOQA 4QHMA 35C8H 4PJ5E 4H0GA 1M71A 3QXVA 1ZHNB 2VH5H 3D25B 1QYGH 4BFIA 5E1HB 1QFWH 4J3TA 4KQ3H 2XWBA 2YN3A 4AYFA 4LKXB 1WBYA 3CDCA 4U33A 1BJ1H 3WNKA 4MAYD 3PNWB 3BW9B 4YHPB 1NUNB 3KLSA 2JB5L 5I6XC 1KPVB 5CZXD 1EGJH 5DT1H 2WUBH 1WZKA 3BD5A 4R96A 4AEHL 5CEZE 3AS2A 1D5XA 4H5SA 3SDXA 4LHQB 3TJHC 1JPFA 1J0YA 2UY7A 1EO8L 4NWTH 4FN0A 3Q0HA 2QL1A 4F7PB 5JQ6L 1HQRA 1G9MH 2QTEA 2ESVE 4NQDA 4C59B 1S7TB 1A9BA 1MWAH 2GTWB 3PE9A 4P23C 3CFCL 4A2MA 4X6DE 2G5BB 3W11C 4ENED 3EO9L 4L4VE 5ACLA 3P4OB 3VA2C 4L8SC 5F8QC 2XY1A 2OI9C 4KJWC 4Z7VA 2XKNA 5BRZE 5BOZG 5CGYD 5AZ2L 5FF6A 3UYRL 5TE6L 4GW4A 3RJDA 3VDAA 1FCCA 4Q9BA 2YPVL 3VI3E 5I1LB 5I66A 1FZJB 1SEBA 4NQVB 1AKJA 2HFGH 2EO9A 4Y16A 2EDWA 3REWB 2W9LA 2Q7YB 3NAAL 3HFML 1QLRA 2C1OA 2IPUG 2DTML 2HWZH 2JCCE 2A2QT 3AUVA 1OGAD 3QFJE 4MA1B 3ZKNC 1BBDH 2AJYH 2RQ8A 4PREB 2EDRA 4ODWB 2DM3A 4EBQH 2P4AB 3DECA 5DMJB 3PABA 3FL7A 5KAQF 3OAZK 3TH2T 4X6FA 4JDVB 2EDBA 4PJ5D 2Q8AH 1QRNB 5FDYA 4IEFB 2O5YL 5DD5L 2PTVA 1R5WB 3QP3A 4DCQA 3MBEA 4IOIB 4NKOB 1W72H 4X9GA 5EBLB 1N6UA 5HPOA 2DD8L 2CLZB 4Y5XC 1U3JA 1WWBX 2WBWB 3WUWB 4WDIA 3PNWA 3ZKSD 3MJ8A 3GSVB 2NMSA 3N1PC 4DEPC 4Y16D 3UJTL 1F4XL 3QDGE 1MHPL 2G5RA 4JZOA 1IE5A 1K6QL 1GOFA 1S7RA 1EHNA 5E8OB 4HC1A 5GIRB 1GH7A 2BDNH 5DDHB 1Y6KR 2DMBA 4GXUM 4LSSH 5B4MD 3VRIB 4EKXA 3GMLA 5D6CB 4MQXC 2BSTA 4HIHB 1DUZB 5FUCE 2IALB 1I8KA 4F7EA 4TN9A 4MD5A 3HRZA 4PRAB 2IWGA 1WLHA 1F3RB 4M7KL 3PWLB 5C0ND 4LFHD 3OGCA 1JPTL 1EA9C 2DS4A 4ZUUA 2H26A 3MRHA 4PG2C 5D1XB 5GGTA 3T4AA 1MNUH 4Y8AA 4B5EA 3QUZB 1DLHA 2YPKB 2HT3C 3JZ7A 5IVZB 3BEWB 1ZV5A 3FO2A 1LO4L 3UO1H 2E9WA 1RULH 2BRRL 1ZLWH 4HFWB 4A6YB 3PWNA 2NW2A 2WIIA 3DX7A 3U36B 1U91A 4W4NA 4MAYA 3CXDL 5H8DA 2YSSA 2YUZA 1CZ8L 2V5YA 5F7EH 5B3JE 1A6PA 2YUWA 5I17B 4Y1AB 3C5JA 4YPGA 2BCKA 2ZCKL 5A16A 2ATPB 2HFEA 3VWJB 4OLEA 1I3UA 1INQB 5IOPA 2P5ED 2PR4L 2XN9E 4M6NL 1KT2B 2BXYA 4U6VL 1TDQA 2NY3B 4FNLL 4UINL 1FNLA 4X83A 5I9QB 2IEPA 1RUAL 3BGFC 3ZT5A 1CVSC 1KEMH 1F42A 1KJVA 4XAKD 3VWJA 1RHHB 5E4EB 4HS8L 4P46C 4RISL 3ABZA 4G42A 4FMKA 1WEJH 4I2XA 4ZUSA 3VFWA 4UU9A 4RGOL 5F89A 2JJUA 3P0YL 3VXQA 2J8OA 4OIIH 5DLML 1BFSA 2PO6A 4BYHA 1RZ7H 3SQBA 4WVRA 4V2BA 3C8DA 3P11L 2H45A 1EUTA 4J4PC 3AGVA 12E8L 2AI0L 3MJ7A 1N64H 4EUPH 1WCBB 1DBJH 3LMJL 4WUKH 4PGZA 3UC0H 4YHLL 5ECJE 2ZPKH 4FZ8H 1A7OL 3KHOA 5C6TL 5D7JB 1MEXL 1JBJA 4M62H 3F7YA 1QTYT 4S1DD 3EOAB 1HXYB 2B4CH 3O0RH 1BVLB 3RVWC 2W07A 1QKZH 4HCRL 1G1CA 4NQCD 5TDPA 3BDYH 4LDEB 2AKRB 5FKPB 1MAMH 3P9MA 4KK9C 4YDLB 4G8FB 2Q86B 4NN5C 1UT9A 5CINL 2DM7A 2UZYB 4LSRH 3IYLW 1ES0A 43CAB 5BRZD 4OSUH 5HDBF 3SDXE 5JOEA 2F53B 1S9VB 3WN5B 5T1DL 2WNGA 4UT7H 1OGAB 3LN5B 1LHZA 2R4SH 1JPGA 4ONFL 5E6ZA 3JV0A 1A6ZA 1I8LC 1A7PL 3B9KD 3RVTC 1G7JB 4BFEA 4H20L 4MNHB 5KSAB 1P69B 4RRPG 3WHE1 3X3FH 1AGEB 4CW1A 1Y6MR 3LQAC 1AD9A 4P2RD 2CKBA 4NN6C 4POZD 4N8PA 1CT8B 2JJSA 5EH1A 4HC1L 2VNCA 4HGKC 2Y1VA 4BH8B 5GRUH 3BMWA 3HNSH 3E8UL 1IFHH 1JHLL 3QHTC 3VXRA 1PKQA 5ISZD 4NQED 1VFMA 4JDZA 3PGCA 1AD0B 3HC4H 5HHOD 1NGZB 2IQAA 4LAJH 1TCRB 3LKPB 4AEIL 2Z93B 2G9HB