5C0TA

Crystal structure of the mercury-bound form of merb mutant d99s
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
208
structure length
208
Chain Sequence
b'MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALSTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Structural and Biochemical Characterization of a Copper-Binding Mutant of the Organomercurial Lyase MerB: Insight into the Key Role of the Active Site Aspartic Acid in Hg-Carbon Bond Cleavage and Metal Binding Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase,metal binding protein
total genus 64
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5c0tA00
3F0OA 3F2HA 3F2GA 3F0PA 5C0TA 3F2FA 5C17A 5DSFA 3FN8A 5C0UA
chains in the Genus database with same CATH superfamily
4JZDH 3U28C 1H1BA 3GCHC 3SGQE 4AGJA 5DG6A 3E0PB 3TNSA 2D8WA 3PTBA 3GCTG 4U32A 2ANWA 2K0QA 5KECA 1FN8A 1P9SA 2AS9A 4IC6A 4MVNA 2Z3CA 3RXBA 3H5CB 2UUYA 1CHOG 2GJGA 1C2HA 3RXJA 1HAXB 1C5UA 1W8BH 1NS3A 1XXDA 5JYIA 2CF9H 1MTWA 1GG6C 2JKHA 3PWCA 1HDTH 3SOSA 2BX4A 1OSSA 1ANCA 4OS2A 1S84A 2ZDKA 2XBWA 1YYY1 1AKSA 1FX0B 4DVAU 1IOEA 2VJ1A 1LTOA 3SHCH 5I25A 1IQKA 3UOUA 1G2MA 1ZTLA 3OTJE 1S5SA 3LGTA 2BD3A 3SU3A 2FX4A 4UFDH 3LGVA 1DVAH 1F7ZA 3HGNA 3KNXA 4Y8ZA 1LVOA 1O2HA 4GVUA 2VIVA 5A8ZA 2ILNA 1C1VH 2QN5T 1FZZA 1OWEA 2J98A 1AFEH 2W7SA 2AFQB 1TPAE 2QF0A 1H8DH 3M5MA 3SZNA 3S9CA 1ESTA 1TOCB 1RTFB 1FJSA 2J5UA 2Y80A 4NZQA 1B0FA 1FLEE 4IN2A 2CXVA 1O3OA 1P3EA 1NC6A 4DT4A 3URCA 1HGTH 1DWDH 1ELAA 2ZU1A 5HMAA 2FOCA 3MH7A 4AFSA 4BXWA 1OYQA 3N7OA 1HB0B 3RM0H 4YOGA 2LPRA 2VB0A 1AY6H 3EDXB 2GCHF 2NU2E 3FOAA 2GT8A 2C8WB 2ASUB 1W13U 1HJ9A 1QA7A 2F3CE 1MD7A 3TPIZ 3SNEA 2F43B 2PHBA 3HKIB 2BLVA 1S6LA 3P95A 2C3SA 1O3LA 3PV4A 3LU9B 2WPKS 1HYLA 1HAYB 1XUFA 4H6TA 1GI6A 1D3PB 1GJ5H 1K0HA 1YPHC 2HNTE 3M3TA 1OYTH 3BTWE 3PRDA 3TK5A 1SQRA 5AVDA 2A2XH 1EZSC 5EXNA 2J4IA 2YMSC 2XWBI 3PTNA 1Z8RA 3GICB 5HKKD 2B9LA 2QF4A 4UFFH 3SU6A 2R3UA 1W7GH 1FPHH 1SGTA 3DFJA 5E2PA 1W10U 1O2XA 1K1OA 1ZRBA 1H8IH 2ODQA 1JIRA 5A8YA 2A1DB 4XBDA 1CHGA 3P6ZB 1P04A 3ZZAA 2GT7A 1A4WH 2DE9A 2BDGA 2TBSA 1TLDA 2VBCA 3FAOA 2M2AA 4CR5A 2P3TB 3RXMA 3F9GA 2WYGA 2BB4A 2PSYA 3RXAA 1LDTT 2KCPA 3TK9A 2ZFFH 1AWFH 3SNAA 1C5TA 1CSOE 1MTNC 4NWKA 3BG8A 3B9FH 2G81E 1LHEH 1HXEH 4X8UH 1O5DH 4UE7H 5EJ1A 1AUTC 2BDAA 1GI7B 2CV3A 5LH8A 1NTPA 2K1QA 3SJIA 1YPEH 3SORA 2BXTH 1T31A 4ABIA 1HV7A 2ODYB 1Y3YA 1MTUA 1K1NA 3LJOA 3MO6A 3KIDU 3Q77A 2ULLA 4X1SU 4UDWH 2TIOA 1QBNA 4WXIA 2VIPA 1MD8A 5JBTA 2UUJB 1BBRH 1C5SA 1O0DH 3E16B 5B6LA 2VIOA 4AB9A 2KR7A 2FIRH 4HGCA 4YOJA 1C5RA 5KEDA 3F1SB 4NSVA 5EXLA 3RXVA 5EPYA 2KZ4A 2OLGA 5EW1H 1O2ZA 3MU0A 4WF8A 2V35A 1C5LH 9LPRA 1BTZA 2G4UA 1GBJA 3SJ8A 1GJ9B 4X1NU 3EA7A 2OC0A 1COWD 4JZFH 1QL7A 4CH8B 1OP2A 3O8DA 5EGMA 3TJUA 3ZZBA 2A4QA 3QUMP 1G3EA 3MNXA 4XE4A 1NT1A 2OD3B 1Q3XA 2C8ZB 4K8BA 2AERH 3SZEA 4K2YA 1EZXC 3HPTB 3M37A 1OWIA 2KAIA 2P8OB 3ATKA 3KHVA 3EYDA 2ZDMA 3TGIE 2BY9X 4JCNA 1VZQH 1YC0A 3A7VA 5LGOA 1EP6A 1UTPA 5CHAC 5DP6A 5DSFA 3ZZ3A 3UNSA 1H8HD 1P2IA 3BEIB 2J97A 2VU8E 1C1TA 5L2YH 1QZ8A 1O2WA 1O3BA 4XOJA 4CRGA 1TX8A 1JOUB 3C1KA 1SLWB 2ANKH 1EOLA 3FFGA 4GAWA 1G2LA 1O2GH 5EQQA 1C1PA 2FEQH 5CE1A 1DUAA 3A7XA 1K22H 1QL9A 1O37A 2BVSH 2AGEX 3DHKH 2AMPA 2KX4A 3CP7A 2C4FH 4FXGH 2CHAB 2TGTA 4JYTA 2GV6A 1K28D 2V3OH 4I32A 1KXFA 2GZ9A 3LH1A 4ZKRU 1GJDB 3BEUA 1DWBH 1EJMA 1BZXE 3UQOA 4JK5A 1O32A 3PRBA 3KQEA 2QA9E 2P93A 3MH4A 3UREA 4CHAC 4Y8XA 1QRXA 1Z1IA 3FO8D 1UVUH 2FI5E 3BTGE 1WV7H 1HCGA 1QFKH 3FVFB 3TGKE 1FPCH 2PP6A 1E37B 2D26C 3M61U 2ZHFH 2CMYA 1SHYA 1C5PA 1P01A 1Z8GA 3ZVEA 8LPRA 4E7RG 1C5MD 1C9PA 4GCHG 1O3DA 4MNYA 2KCYA 3W94A 5FXLA 4M9FA 3UOPA 2BZAA 1HRTH 2QCYA 2GV7A 3T2NA 1EX3A 1NRPH 2FOHA 1DM4B 3VB6A 2ZC9H 1GI8B 1CE5A 2W26A 3RXOA 1EPTB 4BNRA 1LO6A 1TPOA 1MABB 1FV9A 2YOLA 1WSSH 2VWOA 1XUIA 1UCYK 1DLEA 1TGSZ 3M35A 2QXHA 2ZEBA 3F2GA 4X1PU 3RXUA 3ELAH 4CH2B 2FOEA 4WMDA 3ZVFA 3A83A 2J92A 1Z1JA 3V0XA 1LCYA 1UW7A 1HAZB 1GI3A 1KLJH 2FS8A 1UTJA 3I29A 3RXLA 4H6SB 4J2YB 1DITH 1C4Y2 5A09A 6CHAC 4TT3D 3SU1A 1UVOA 5DGJA 1GMCF 1GJ4H 2GDEH 1SHHB 4NIXA 2TGDA 1TPSA 2GZ8A 2AH4X 3A7WA 1VCWA 2D2DA 2QY0B 3O8CA 1BITA 1EAIA 2F9OA 4CRDA 4OGXA 5C1UA 1TE0A 3M5LA 1HUTH 3A87A 4X2YA 2A2QH 3F0PA 2GCTB 1AQ7A 4IN1A 1FN6A 4D9RA 5A0BA 1RD3B 2XCFA 4Z1MD 1O2NA 1TRYA 4XD7D 1FY4A 2ZQ1A 3V3MA 1O39A 3OFND 3PMBB 2ZFRH 1AUJA 4I8JA 4NIWA 1HIAB 1YGCH 3RDZA 1MTVA 3T29A 3ZVBA 2GGVB 2ZTXA 2CK3D 3T26A 4FUGA 5FPTA 3VFEA 1LPZB 2VVCA 4K3JA 2VNTA 3TU7H 5JDUB 2R3YA 1EKBB 1P2QA 2XNIA 1GBDA 1W11U 3QGJA 1ZOMA 4A1TA 3SUGA 4Q63A 1TB6H 1TNKA 4CRFA 1TAWA 4Z6AH 4HI3A 2DUCA 1LKBA 3P8NA 4FVDA 1PQ8A 4I8LA 3SW2B 2A31A 3F9EA 1RGQA 1DXPA 4Q7ZA 4Y7BA 4U30A 1SFQB 1VCQA 2ZU5A 1Z6JH 1ZSKA 2FS9A 3N99A 2STBE 2BX3A 1PPZA 2GTBA 4E06H 1V2ST 3GYLB 4RKOB 3GY2A 2EY4C 1DE7H 2SGEE 4UD9H 5EQRA 1O31A 3MNSA 4XRNA 1NESE 1SPJA 1O3HA 4UFEH 3A88A 1CBWC 1GI4A 1PQ7A 4NCYA 2ZWLH 4X6MA 1ZHRA 3GOVB 5FL7D 1O5BB 1IQMA 1OP8A 5AFZH 2V7QD 4YT6H 5I46H 4UONA 1W0ZU 2FO9A 2WV9A 4DY7B 1BOQA 1SQTA 1ZJDA 4XDEA 1ZPBA 4X2XA 2W3IA 5EXMA 2KM0A 4RSPA 1MAYA 1V2WT 2R2MB 4MPVA 1ETSH 1C2LA 3BV9B 4FUHA 5EQSA 1MU8B 5EG4A 1VITG 4X6OA 4XBBA 2HGTH 2PKSC 4FU9A 3JZ2B 2UUFB 1GBBA 1V2LT 1HAGE 3O8BA 3LH3A 1TX6A 2PLXA 5DP3A 3BTKE 4ABAA 2Y81A 1AFQB 4WH6A 3RXKA 1P2KA 1OWHA 2TGPZ 5T1VA 3M7TA 4D76A 1BRAA 2HOBA 1E1QD 4INKA 3TH4H 1RTKA 4ABDA 1OS8A 1VJAU 2BQWB 5DK1A 3T5FH 2JH5D 1G9IE 4YXWD 1T32A 4XSKU 4AOQA 2EEKA 1YCPK 3P17H 2BDYA 2ZKSA 5PTPA 1IHSH 3ATIA 2BY7X 3N7EA 2BHGA 1A5IA 1UTOA 1V2TT 3CENA 5EU8A 1SBWA 5GXPA 3PV2A 5GJ4B 5F8XA 4A1VA 3H09A 1QIXB 4ZMAH 1CT4E 1PFXC 1ETTH 1PYTD 4CREA 1Y59T 1MH0A 2W6JD 1K9OE 1O2JA 1HPGA 3SJOA 3T27A 5FPSA 1LHFH 2O8LA 4ISOA 2ODPA 1ELDE 1UTNA 4NFFA 3RC5A 1TYNA 4NGAH 1DPOA 2RA0A 1NZQH 4DG4A 1EAWA 4IBLH 1V2MT 1GBFA 1GBMA 2OXSA 1GMHF 1QY6A 1C5YB 3RC4A 2W6ID 3N7DA 1WAYB 1MQ6A 2HVXA 2WPHS 1TGNA 2A0QB 2Z9JA 2JJ2D 2NU1E 1MQ5A 3ZYEA 4ZUHA 2XC5A 4CBNA 1PPHE 2ZU3A 1CVWH 3SUFA 2ZFSA 2JETC 3RU4T 5G4BA 3F9HA 1KY9A 4DOQA 4ESTE 4DW2U 5ETXA 1E38B 4X8SH 1ZMLA 1L0ZA 1KTTB 2HPPH 3KQDA 4HFPB 3RXDA 3VB3A 1D3DB 1ZHMA 4K60A 7ESTE 4PROA 1K2I1 3WWBA 1VITH 1BRBE 2FTLE 4YTAA 2BD7A 2GDDA 4WMFA 1TBQH 1ZSJA 5TCAA 3MTYA 4DJZB 4I7YH 1TGTA 3VB4A 4B1TA 4I33A 1O2RA 1AKSB 3NCLA 2ZPRA 8ESTE 3SU2A 3RMNH 1GBHA 3BTEE 3MH5A 2GKVE 2TRMA 1VGCB 2SGDE 1F2SE 1GI9B 1V2OT 4OS6A 1W0YH 4R0IA 2HVYB 8GCHF 1D4PB 3SQHE 1B7XB 1FY8E 1HAVB 5CHBA 1MKWK 1J15A 2BXUH 3GY3A 1XUHA 3WY8A 1P57B 3U1JB 1O3IA 3LC3A 1NRRH 1TA6A 1UO6A 5ESBA 4LZ1H 1XX9A 2J98B 1IQFA 1A46H 1Z7KA 1EUFA 2LELA 1PPCE 3QZRA 5HGGA 1D3TB 3GCHB 8KME2 3SQEE 1O3PB 3DFLA 1UHBA 2FOGA 2OC7A 4AG2A 2WUBA 2OC1A 1S82A 2XOKD 1NU7B 4I31A 3MO3A 1D6RA 3EAJA 5C5NA 2IPHA 2BOKA 4Q2KA 2F9VA 2EC9H 1DSTA 1GG6B 1K1LA 1UCYE 3SNBA 4RKJB 1AI8H 1AN1E 1TPPA 5DPAA 2ZPQA 1BDAA 3SYJA 1EZQA 1ZJKA 4IGDA 1LHGH 3RLYH 1SI5H 4TYDA 1RXPA 1GJCB 3GY5A 1O3JA 5DP7A 4GSOA 5FPYA 1T4UH 1AB9C 5DP8A 1ZYOA 1N1LA 1P12E 3A81A 1KTSB 1GWAA 1VCPA 4P02A 1TNJA 3TVJB 3SV7A 1C2DA 3P70B 2XWAA 3NPSA 1H9HE 1OWKA 2Y6TA 4YT7H 1EOJA 2FOFA 3Q3YA 3RXFA 1KSNA 1ZMNA 4ABGA 1UTMA 5C1YA 3F68H 5IYTA 1YCPM 2H5CA 4YLUA 5EIYA 2G8TA 4ZXXH 3SJKA 2GX4A 1NRQH 2TPIZ 2IJOB 1K1PA 4HZHA 3JZ1B 1TBRH 1GBCA 3QTVH 1IQGA 5GCHF 3T62A 4AGKA 1K21H 5DP4A 1O5AB 1GHYH 1TQ7B 2R0KA 2VIQA 1GI5A 1YPHE 7GCHF 3ZZ4A 1NFUA 1ID5H 1NPMA 3S7KB 1XMNB 4TWWA 3Q76A 3MU8A 3A8DA 5C0UA 5JBCS 3RU4E 1A0JA 4Y6DA 4Y11E 3RM2H 3RMOH 1J8AA 1C5VA 1DS2E 1DANH 2Z7FE 3BTQE 3D23A 2FX6A 2H9HA 1MKXH 1ELGA 2TGAA 1A3EH 4D7GA 2HNTC 4ISIH 4H4FA 3KQ5A 1QNJA 1CGJE 2FOAA 2BOHB 3KN2A 1RIWC 2FOMB 1QB9A 2G00A 3NWUA 1DT2A 1PPFE 2YMSB 4NWLA 2IOTA 2FTMA 1L1JA 3TLOA 1W2KH 3ZZ6A 5HXFA 3F9FA 4F48B 5DP5A 3ESTA 2ZFPH 3UPEA 2PTNA 1TNLA 4FU8A 2OCVB 3NZIA 3DD2H 1NU9A 1AVGH 1RIWB 1G3DA 4Y79A 1TNIA 3VEQB 1HAIH 3V13A 1MTSA 2QXJA 1JWTA 1O5EH 2A7CA 3Q00A 2PWXA 4A7IB 2AGGX 2C90B 5AF9H 3LONA 2A7JA 2AYWA 3S69A 5FBIA 1ELEE 4TPIZ 1SLVB 1YPGH 1QQ4A 1MTNB 1EP5A 3NKKA 2F9NA 1SGPE 2BZ6H 2OTVA 3DSOA 3L6PA 1CO7E 4TWYA 1C5OH 2G4TA 1PQ5A 2K8IA 1EASA 3FP7E 4KKDA 4I8HA 4X2VA 3GYMA 4M7GA 2KAIB 4GPGA 1YF4A 1UTLM 3UR6A 1GL1A 1P09A 1BQYA 4NA8A 4TY6A 1LVMA 2RG3A 4ZKSU 4AN7A 3RXGA 4IMQA 5DJ7A 3KEEA 3LGIA 3SJ9A 1PJPA 4LOYH 5F8TA 3RMLH 1AE5A 4FUCA 2ZCHP 3U8OH 1U6QA 2QC2A 3TJVA 1VR1H 3LGYA 2WPIS 1CU1A 2ZGBH 3F0OA 1P0SH 3FZZA 2ZDLA 4Q7XA 4U01A 2SFAA 1GDNA 2IPQX 1YLCA 5E0GA 1C1RA 1D9IA 1BTUA 1ZPCA 1AVWA 2BYAX 3BTDE 2NWNA 1FY3A 1LMWB 4X0WU 3OX7U 5EW2H 4Q7YA 2ZNKH 1MBMA 3KL6A 1P03A 3UB0A 1UK4A 3K65B 1QL8A 3GCOA 1GHWH 2PR3A 1GBIA 2OUAA 3HK3B 1GMDG 2AMQA 2WV4A 1SMFE 5ABWA 2FI4E 1F92A 2RCEA 4OS4A 5H4IB 1OWJA 1E35B 1C2EA 4WH8A 4Y71A 4CRAA 3AAVA 1FI8A 1IHTH 3EE7A 5CDFE 1A2CH 3D62A 5CHAB 2R2WU 3FP8E 1FQ3A 3QK1A 1QGFA 1CQQA 3EQ0H 5F8ZA 5LPRA 1O3FA 1KDQB 1SVPA 4XBCA 2BY8X 4MG3A 1J14A 1MBQA 2R0LA 3U8RH 1TRMA 2W3KA 4E7NA 4FUEA 5F53A 1ETRH 2FODA 5FBEA 1BMFD 1PPEE 3FKSD 3RLWH 2ZIQH 4X1QU 1GJ6A 4HG6A 2BD8A 1SGFG 2OK5A 4JK6A 2AGIX 1AIXH 1P02A 3ZYDA 2ZPSA 1SSXA 4THNH 1AVXA 3PLPA 1OX1A 2F9UA 2VIWA 1O3KA 3EGKH 8GCHG 5DP9A 1ELTA 4R8TB 2FOBA 1FIZA 2J38A 2FZZA 1PYTC 4CHAB 3TIUA 5SGAE 3PLKA 3U8TH 3GCTF 1G3CA 1RFNA 3BN9A 2J34A 1AE8H 3BTTE 1BMLA 1T8OA 5FCKA 1YPLH 3EA9A 1ESBA 1SOZA 1UCYH 1INCA 3F6UH 1F5RA 1XKBC 1AHTH 4P00A 5L30H 4RT0A 1CHOF 3BTME 4MQAA 3GISB 4TSFD 1Y5AT 3BTFE 1RRKA 2Q6DA 1GVLA 1T8LA 2A4GA 3OAAD 1GI1A 2Q6FA 3RXEA 1Y3VA 5BPEA 3UIRA 3OYPA 3BIVH 3CNRA 2O9QA 3KQCA 3S9BA 4K8YA 3VXFH 3PYHA 4BAOB 3MO9A 1SQAA 2OBQA 3RU4D 4WVPE 3K9XB 4F55A 1KXBA 4A92A 4BTIB 1V2VT 1C5XB 1P11E 1SKYE 3A8BA 1DICA 1V2UT 1BTXA 1KXAA 4NA7A 3SGBE 1B0EA 4AFQA 3AVZA 3A8CA 1HAOH 5HM9A 2XBVA 1GHZA 3UWIA 2PUQH 4ZHAA 3BIUH 1DWCH 1P05A 2IJD1 3I77A 1SOTA 2PW8H 1T8MA 1O3NA 4NIYA 2FLRH 3LC5A 1JIMA 4NZLA 1P2MA 1KXCA 2RDLA 1SGRE 3V7TA 4JZ1A 1F5LA 3QGNB 6CHAB 2ZDVH 1GHVH 3UNRA 3LJJA 1TBZH 1F0UA 2XTTB 1EJNA 4JZIA 1LHDH 3A7YA 2BVRH 1Y3WA 1ARCA 3B23B 3D65E 4WXVA 3MH6A 4Y7AA 3RXIA 3AK5A 3UTUH 1Q31A 2GCHG 3LPRA 2ALVA 4ZHLU 3EA8A 1DX5M 2A7HA 5L2ZH 2NU0E 5FHTA 4MNWA 1SG8B 1BTYA 1F5KU 1T7CA 3LIWA 3KQBA 1XKAC 4J1YA 4BXSA 4Y0YE 3H7OA 1SGCA 2P94A 5GCHG 1GPZA 3MU4A 1EATA 1HLTH 4Q4LA 1GJ8B 1H8ED 7GCHG 1GJBB 1CA0C 4UEHH 1LQEA 3KGPA 3RMMH 2BY5X 3RXSA 1THSH 3TH3H 2B7DH 1Y8TA 2ANMH 3PB1E 3SNDA 1EAXA 4INHA 4YLQH 1KXEA 5GWZA 1GGDC 5F03A 3CS0A 5F6MA 2GD4B 4JYVH 3ITIA 5B6OA 1S0QA 1N6XA 1QCPA 1WBGB 1Y5UT 1X7AC 4O3TA 1S0RA 2PKAA 4OM9A 1LHCH 1CA0B 1O33A 2Z6BD 1EAUA 1TALA 2ZGXH 2UUKB 4FUJA 4O03A 3DUXH 5EODA 2KCAA 5L6NH 1RS0A 4O9VA 2Y5HA 2JIZD 1YBWA 1YLNA 2G5VA 1GGDB 4Y0ZE 1BRUP 1C2GA 2QV1A 4MNXA 3ZVDA 3FN8A 4B76A 3F2HA 5ESTE 1YPKH 3W95A 3V12A 3AAUA 3K2UA 1TX7A 3RP2A 1CBWB 3OEHD 2L6OA 2SGQE 4YESB 1OHHD 4O3UA 2CGAA 5HIZA 1H9LB 1O3GA 3AW0A 2VGCC 4U2WA 3MWIU 1Y5BT 1G37A 1GI2A 3RXCA 3UUZA 5C2ZA 2Y7ZA 1V2NT 1XUJA 1YCPH 2EI6A 1IQEA 1Z8JB 2Z9IA 1O5CB 2KFWA 2Y5FA 1E34B 4OS7A 3TH2H 1UTKA 2HALA 2M5TA 3WW7A 1Z71A 2H2ZA 1MU6B 2CJIA 3ZVCA 3PMHB 3PWBA 3E90B 1ABIH 1QTFA 2BDIA 1FONA 3M7UA 3OY5U 1T8NA 2PKSB 1SGNE 1V6DA 2C8XB 2ZG0H 3BEFB 5A0CA 3BSQA 3UNQA 2G55A 2ZO3H 1NM6A 1IQLA 1Z6EA 1S81A 2G52A 3KYGA 4FVBA 3PO1C 2FLBH 2WYJA 1A7SA 3GDUA 1BMMH 1C4V2 2CF8H 1HJAC 1O5GH 5T6FA 1QR3E 1YLDA 4MTBA 5JB8S 3VB5A 1JBUH 2JJ1D 4K1EA 2A45B 1PPGE 2O8WA 1B5GH 3OSYA 4ISHH 3MU5A 5J4SA 3ATLA 2ZP0H 1G30B 2WPDD 3SV8A 2QIQA 1K1IA 4X6PA 1NFXA 1DUEA 3ZZ8A 4LK4A 3RXQA 1O2VA 5FCRA 4ACBA 5DN6D 1HJ8A 2JH6D 4JMYA 3QTOH 1J16A 4MPUA 1ANBA 2O8MA 3T28A 2Y5GA 3NK8A 4ABBA 1L4ZA 1NFYA 1EQ9A 4ABEA 2H1UA 1LQDB 2ZHQH 1KLTA 2XW9A 3A80A 6ESTA 5E0HA 2PUXB 4KTUA 2F4LA 4MPXA 1M9UA 1DWEH 4RN6A 2FXRA 3KF2A 3PMJA 5EOKA 2ZHDA 2PFEA 2Z9LA 1GBEA 3ZZ7A 1TMTH 2OP9A 1QBOA 2QF3A 4IW4E 1VKYA 2V0BA 1KMHB 3MOCA 2PGQB 2FPZA 2ZCKP 2ZDNA 1OKXA 1W12U 4FUFA 1TONA 2AEIH 1BA8B 2JETB 2NU3E 1ZMJA 3URDA 1UHBB 3E6PH 4CR9A 1J17T 5EJLA 4ZKNU 3UWJH 5C17A 1EJAA 3A85A 4ABFA 1MUEB 4BTUB 2THFB 1ESAA 1ELVA 3E0NB 1XXFA 4NIVA 2HNTF 2WUCA 2BD4A 1ZR0A 1WUNH 9ESTA 3MNBA 2J2UA 2BTCE 2R9PA 2ZA5A 2V3HH 3TK6A 2SNVA 4MDSA 3NUMA 5DO4H 3O8RA 1QRWA 2O8TA 2VWLA 1YPMH 1DFPA 1RTLA 6LPRA 1BTWA 1LKAA 2FP7B 4ABHA 2LNCA 5C67A 1FY1A 3IITA 1QURH 3SV2H 1QB6A 4GCHF 2A4OA 1QBVH 4BTTB 2OC8A 3SBKA 6GCHF 5EJZA 5GIBA 1GHBF 4XFQA 3SI4H 5JPMH 2BLWA 1WQSA 1OWDA 1C2KA 2BDBA 1O2TA 1FXYA 1BJVA 4KP0A 2HWLB 3LGUA 4ASHA 3U98H 1WQVH 3SGAE 1SC8U 1W0KD 1BB0B 5FAHA 4BAHB 1TOMH 2H5DA 2Z3DA 4DIIH 1OPHB 5K0HA 1HAVA 1NY22 2OQ5A 1QJ1B 2VWMA 3SI3H 1ORFA 2QE7D 4GHTA 4KTSA 5KGOA 4B71A 1L2EA 1C5QA 1GHAF 1V3XA 1GBLA 1NBME 4Q80A 1FDPA 2QGRA 2BD2A 1E0FD 2H9TH 4K5ZA 3NXPA 5C3NA 3MYWA 1CGIE 1AB9B 1GMCG 2ZI2H 2ALPA 2OQUA 3U1IB 1TFXA 1ZRKA 4DT7B 1AD8H 1UTQA 4MPWA 3S0NA 1P2NA 1LPKB 4I8GA 2ZZUH 1A5HA 1V2RT 3PROA 4IMZA 3ODFA 1FAXA 1SQOA 2Q6GA 3RXPA 1W3CA 1NROH 3FANA 2UWOA 3PLBA 2D1JA 2RDEA 1DLKB 4YZUA 1WCZA 5CMXH 1C1NA 1NO9H 4Y8YA 3QLPH 1V2QT 1C1WH 1A1RA 1GBKA 2W7UA 4A5TS 3A7TA 1IQJA 3OY6U 5EPNA 4CBOA 3DA9B 1MCVA 4YO9A 2PV9B 3SHAH 4WY3A 2ZGHA 4AYYB 2QYIA 3S7HB 3UAIC 5IK2D 1O2OA 2B5TB 3U69H 1T4VH 2WV5A 3QX5H 2EI7A 1PQAA 1V2JT 4IS5A 3FP6E 1EFRD 1QA0A 1P9UA 2P3UB 2BDHA 1L1GA 4A6LA 2WPLS 4RI0A 1ELBA 4K69A 1DSUA 4KELA 1C1MA 1DY9A 2A5KA 2VH6A 2XC0A 1IAUA 1W0JD 4X2WA 3LOXA 2GP9B 1OXGA 1P06A 1GDQA 2HRVA 2FWWA 1W7XH 1FUJA 1TNGA 4DCDA 1IQNA 2WINI 3LKWA 5TJXA 1H9IE 3STIA 3ZV8A 1Z8IB 3ZVAA 1C1OA 3A89A 3RXRA 4X8VH 1ZGVA 2HLCA 5GPIB 5BRRE 5FX6A 1TABE 3S9AA 3AASA 2ZFQH 4NSYA 2F9PA 1SGYE 3A84A 1TGBA 2O8UA 2Z9KA 1BCUH 3SO3A 4AG1A 1UVTH 1O38A 1THPB 5T3HA 2BMGB 3L33A 2QXGA 1GVZA 1MKXK 1KXDA 4DGJA 4WWYA 1VITF 4B73A 4ISNA 1DY8A 1WTHD 4BAQB 1THRH 1C2MA 4X6NA 4VGCC 4YOIA 2PGBB 2ZFTA 1WXRA 2Z94A 4H42U 1YM0A 2BQ6B 5T6GA 1C4U2 2ZHEH 3PV5A 5GNDA 3TNTA 3TJOA 3D49H 1TNHA 1O3CA 4ISLA 4SGAE 1SGFA 2G5NA 5E0JA 2XCNA 4OGYA 4VGCB 1P10A 2P95A 1UK3A 1C2JA 2VVVA 1FAKH 4TPYA 4AC9A 1C5NH 1J9CH 3H7TA 5HM2A 3STJA 3SUDA 2LP6A 1N8OC 3SNCA 2Y82A 4I86A 1ZGIA 1BRCE 5K7RA 1SLXB 1SR5C 5E8EH 5JBBS 2VH0A 1TMBH 7KMEH 4OS5A 3QDZB 3BF6H 2HLDD 1C1SA 1GBAA 1HXFH 3HK6B 2F9BH 1O2MA 1TGCA 1O30A 1LVYA 1BBRK 4OS1A 1OOKB 1N8OB 3Q3XA 4AORA 2P8OC 4GHQA 4KGAA 1JRSA 3ENSB 3GDSA 2PSXA 1BJUA 3M3SA 1O2SA 1O2QA 1O2KA 4D9QA 2VVUA 2V3MA 1GBTA 1GMHG 3MFJA 4ABJA 1ABJH 3LGWA 1BIOA 2XNDD 3VPKA 3SU4A 3DCLA 1WU1A 3SU5A 4JYUH 4B2CA 1EZUC 1S6FA 2EA3A 3C27B 1UVSH 3E3TA 1QRZA 2BM2A 2IN2A 4WMEA 2BD5A 2FYRA 5JB9S 2CHAC 4E05H 5A8XA 4ZKOU 2VWNA 1O2UA 1K1MA 2BLQA 1TA2A 2ZCLP 1OP0A 1A3BH 4NA9H 4SGBE 1RJXB 4K1TA 3DSPA 1NRNH 3TGJE 3QZQA 4JZEH 3M36A 2WZQA 4GUXA 1O2PA 3ZV9A 2QAAA 5IDKA 5E2OA 1E1RD 3HKJB 3W1EA 2XRCA 3U9AH 1V2PT 4ZXYH 3MI4A 2A5AA 5TCCA 1DXWA 7LPRA 1H4WA 1NBMD 2FYQA 5FX5A 1BTHH 3K6ZA 3G01A 3FZDA 1PPBH 4BOHA 2AHME 3OEED 1ELCA 5HIYA 2A4RA 3VG8A 2FMJA 4BAMB 1YY3A 2OBOA 3GS9A 2PTCE 1UVPA 4O97A 1MZDA 1KYNA 1SGQE 4Z0KA 1A0HB 1O3EA 3L3TA 3QN7A 3M5OA 1ANEA 1ZSLA 4Y76A 1IQIA 1UK2A 4NFEA 4UFGH 4B2BA 1C2FA 2J94A 3IWMA 3ZZ9A 5AHGH 2BLOA 1FMGA 5HYOA 3LT3A 1EPTC 1V2KT 4INLA 2P59A 1HFDA 3ZVGA 3ATMA 4NG9H 1ZLRA 1F0RA 3HGPA 1KDQA 2A32A 2JH0D 1TQ0B 1QJ6B 6GCHG 2FDAA 1GHBG 1N6YA 3K6YA 3WWFA 2CN0H 1P2OA 2YMSD 3RUOA 1G36A 2ZQ2A 2WHXA 2XC4A 3TJNA 4IC5A 1GJ7B 3ODDA 4BANB 3A82A 3MQKC 1LPGB 4GLYA 1A0LA 2J9NA 2ESTE 1GCTC 4RT1A 2I6QA 4ASUD 2FI3E 1O34A 3KYFA 4CRCA 1AZZA 1FY5A 1FIWA 3VXEH 1CT2E 1MCTA 2ZHWH 3T25A 1EXFA 1HAPH 1C9TA 3F3BA 1ANDA 2V6NA 3LDXH 1BTPA 5JBAS 4QT8C 3QO6A 3P8GA 1UMAH 1DDJA 1FNIA 1GHAG 2QF5A 2SGFE 3R3GB 1GCTB 5LPEA 3GY8A 1C2IA 3VB7A 3UY9A 2B0FA 3MNCA 2GCTC 4Y10E 3HATH 1QHRB 4FU7A 4FUBA 3CS7A 3M5NA 4YM9A 1S85A 2ZU4A 1SGDE 2YNAA 3R0FA 1EPTA 3MHWU 2PKAB 1F0SA 1O3AA 1Y3UA 1AO5A 3ZZ5A 2AIPA 1ZZZA 2FM2A 3SN8A 4AYVB 2WPJS 1AU8A 1QJ7B 1P2JA 3M3VA 2QXIA 1DOJA 1G32B 2EQNA 5DKMA 1BHXF 2P3FH 2GMTC 4KTCA 3OTPA 1S83A 4B6FA 3UFAA 4B75A 5LPFA 1AZ8A 3BTHE 1YKTA 2F83A 2GVFA 2RA3A 1LVBA 1UJ1A 2XYAA 3IG6B 4I8KA 5C94A 3GDVA 2C8YB 3DT0H 2VINA 4AFUA 2GZ7A 2GMTB 3A86A 1YPJH 5C0TA 1GJAB 2JDID 3QWCH 1SFIA 2DE8A 3ZIAD 3P92A 2VIDA 2ZTYA 4LXBH 4ZH8A 2BD9A 3ATWA 4ZAEA 2BDCA 1QB1A 1AGJA 3SU0A 3E8LA 1TIOA 2XBYA 2RFKC 1JXPA 3A8AA 2A5IA 2KCOA 4K1SA 2ZU2A 1GDUA 2Z3EA 3F2FA 3TITA 4DURA 3ZZCA 3I78A 4D7FA 4HTCH 1JRTA 3BG4C 1GL0E 1HIAA 1GHXH 2YNBA 1E36B 3EE0B 3SUEA 4FOUC 3OE7D 1AMHA 3P8OA 1HNEE 1XVOA 1A5GH 3OU0A 3P8FA 4FETA 1ACBE 1BUIA 2SGPE 1CGHA 1AFQC 2ZGCA 1BMNH 1Q2WA 2STAE 3AW1A 3BG4B 4B2AA 2VGCB 3GY4A 4AB8A 2NU4E 3KCGH 1CA8B 2OINA 4ZCNA 3MMGA 4FUIA 3UQVA 1SL3A 3NRLA 1L4DA 2H9EH 4ZHMU 1O2IA 1NRSH 1NN6A 3SV9A 1C1UH 2UWPA 3GCNA 4WJG2 1XUKA 1K1JA 1F0TA 2UWLA 1ZTJA 1TRNA 1WOFA 2ZF0H 1ZTKA 2BY6X 2C93B 1GVKB 3RC6A 2G51A 4B74A 3PO1B 4FUDA 1MMJN 2Z9GA 2Y7XA 2WPMS 1KIGH 1HAHH 4LZ4B 4AZ2B 1SGIB 1XVMA 5C5OA 1HJAB 1A61H 1WDIA 1GI0A 2BVXH 1O3MA 2SGAA 5AFYH 1D3QB 1BBRE 2WSSD 1CT0E 1ZPZA 2ZTZA 2W5EA 2P16A 2B8OH 1P3CA 2ANYA 2AIQA 3A7ZA 1C5WB 4A1XA 2FESH 1MZAA 4D8NA 1HBTH 3GY7A 4B6EA 3PMAB 2HPQH 2Q1JA 4BAKB 4F49A 1C1QA 1GMDF 1ZHPA 2I6SA 3DSGA 4MLFB 1L1NA 1NFWA 1O5FH 1AWHB 1YP9A 4MNVA 1EB2A 1S6HA 4X8TH 5A0AE 3VGCC 1SB1H 3GY6A 4AX9H 1P8VC 1QQUA 1JMOH 1Y3XA 4F4OC 1W14U 1BHXB 1O2LA 1C5ZB 1O35A 4CRBA 2ZGJA 2ZECA 4X1RU 5C1XA 1YWUA 5GDSH 1MKWH 1TMUH 4ACAA 1D6WA 1MAXA 3SV6A 4DIHH 3UR9A 1EB1H 5T6DA 4TY7A 2J95A 3RXHA 4AFZA 3VGCB 1O2YA 3PM3A 2L74A 1ELFA 3Q3KA 2EI8A 3ZZDA 2ZDAH 1VJ9U 3MU1A 3B8JA 2XBXA 1XUGA 1VGCC 2F91A 1TWXB 5A2MH 1O36A 1SGEE 1E79D 3RXTA 1BMAA 4ZROA 5J4QA 1ARBA 1GCDA 1WTGH 3E1XB 5C20A 1SLUB 2SNWA 2BQ7B 2H6MA 1IQHA 1BT7A 2AMDA 1WYKA 1KLIH 2XXLA 3E91A 1G3BA 3M7QA 1XM1A
chains in the Genus database with same CATH topology
2V7QD 2O8MA 4R8TB 3M5NA 3PRDA 2YOLA 2WV9A 3WWBA 4K8BA 1W0KD 3SZEA 2K0QA 3DSPA 3KEEA 3F2GA 2KM0A 2FM2A 2WZQA 2YMSC 3RC6A 3EYDA 2IJOB 5HKKD 2F4LA 3SU6A 2QF4A 2QE7D 4B74A 5IDKA 1E1RD 5EQSA 4I33A 4B71A 4B73A 4TSFD 3W1EA 4OM9A 1DY8A 4KTCA 5DSFA 1CU1A 1DXWA 3OTPA 3SU2A 3KF2A 1NBME 4B6FA 3OAAD 1NS3A 2A4GA 3F0OA 1H8HD 4B75A 1WXRA 1NBMD 2KCAA 3O8BA 2GVFA 4TT3D 3SU1A 3OYPA 4U01A 2JIZD 3PV5A 4WH6A 2WSSD 5GNDA 2AHME 3OEED 1KMHB 1FX0B 5T1VA 3U1IB 5CHBA 2A4RA 2QV1A 3VG8A 2VBCA 3FN8A 2OBOA 5C0UA 2M2AA 1E1QD 3GS9A 4B76A 3O8CA 2OBQA 4A1XA 3F2HA 4F55A 3M5LA 5EQQA 2XCNA 4B6EA 2KCPA 3UB0A 4YXWD 3U1JB 3M5OA 1W3CA 2L6OA 3OEHD 3SU3A 4A92A 1OHHD 5ESBA 3F0PA 5C0TA 4NWKA 5C17A 2JDID 1SKYE 2LELA 3KNXA 2XCFA 4Z1MD 3ZIAD 3SUDA 4I32A 4XD7D 3KN2A 3N7EA 2KFWA 2OC7A 2FOMB 2P59A 1A1RA 1MABB 3OFND 3PV2A 5GJ4B 5H4IB 2OC1A 2IJD1 2XOKD 3SU0A 3WW7A 2K1QA 4A1VA 3H09A 1JXPA 2YMSB 3M5MA 3PRBA 2KCOA 4NWLA 3E90B 4I31A 4WH8A 5EPNA 2HLDD 2J5UA 2GGVB 3F2FA 2CK3D 3FO8D 5CDFE 3SV6A 5FPTA 2W6JD 5IK2D 2F9VA 4DT4A 5FPSA 3WWFA 2XNIA 2YMSD 3RC5A 3O8RA 3SUEA 2WHXA 5B6LA 4A1TA 1EFRD 3OE7D 3SUGA 1RTLA 2KR7A 4Q63A 3P8OA 4RI0A 3SYJA 2FP7B 3AK5A 4ASUD 3P8NA 1DY9A 2KZ4A 4TYDA 3FOAA 2W6ID 5EPYA 3RC4A 3N7DA 4FETA 1W0JD 3LONA 5FPYA 3LOXA 1RGQA 1DXPA 4WF8A 5F53A 2KCYA 2F43B 2JJ2D 1E79D 4M9FA 1S6LA 1BMFD 2XNDD 2JJ1D 2OC8A 3N99A 3FKSD 3SU4A 1N1LA 3DCLA 3F3BA 3LKWA 3SU5A 5EQRA 2OINA 4ZCNA 3SUFA 2WPDD 3DSOA 2OK5A 3SV7A 3SV8A 2OC0A 1COWD 3L6PA 2QF5A 1BT7A 3NRLA 3O8DA 5GPIB 4Q4LA 1H8ED 2K8IA 5ETXA 5DN6D 2F9UA 3SV9A 4JMYA 2A4QA 5FL7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0O A;  3F2H A;  3F2G A;  3F0P A;  5C0T A;  3F2F A;  5C17 A;  5DSF A;  3FN8 A;  5C0U A; 
#chains in the Genus database with same CATH topology
 4JZD H;  3U28 C;  1H1B A;  3GCH C;  3SGQ E;  4AGJ A;  5DG6 A;  3E0P B;  3TNS A;  2D8W A;  3PTB A;  3GCT G;  4U32 A;  2ANW A;  2K0Q A;  5KEC A;  1FN8 A;  1P9S A;  2AS9 A;  4IC6 A;  4MVN A;  2Z3C A;  3RXB A;  3H5C B;  2UUY A;  1CHO G;  2GJG A;  1C2H A;  3RXJ A;  1HAX B;  1C5U A;  1W8B H;  1NS3 A;  1XXD A;  5JYI A;  2CF9 H;  1MTW A;  1GG6 C;  2JKH A;  3PWC A;  1HDT H;  3SOS A;  2BX4 A;  1OSS A;  1ANC A;  4OS2 A;  1S84 A;  2ZDK A;  2XBW A;  1YYY 1;  1AKS A;  1FX0 B;  4DVA U;  1IOE A;  2VJ1 A;  1LTO A;  3SHC H;  5I25 A;  1IQK A;  3UOU A;  1G2M A;  1ZTL A;  3OTJ E;  1S5S A;  3LGT A;  2BD3 A;  3SU3 A;  2FX4 A;  4UFD H;  3LGV A;  1DVA H;  1F7Z A;  3HGN A;  3KNX A;  4Y8Z A;  1LVO A;  1O2H A;  4GVU A;  2VIV A;  5A8Z A;  2ILN A;  1C1V H;  2QN5 T;  1FZZ A;  1OWE A;  2J98 A;  1AFE H;  2W7S A;  2AFQ B;  1TPA E;  2QF0 A;  1H8D H;  3M5M A;  3SZN A;  3S9C A;  1EST A;  1TOC B;  1RTF B;  1FJS A;  2J5U A;  2Y80 A;  4NZQ A;  1B0F A;  1FLE E;  4IN2 A;  2CXV A;  1O3O A;  1P3E A;  1NC6 A;  4DT4 A;  3URC A;  1HGT H;  1DWD H;  1ELA A;  2ZU1 A;  5HMA A;  2FOC A;  3MH7 A;  4AFS A;  4BXW A;  1OYQ A;  3N7O A;  1HB0 B;  3RM0 H;  4YOG A;  2LPR A;  2VB0 A;  1AY6 H;  3EDX B;  2GCH F;  2NU2 E;  3FOA A;  2GT8 A;  2C8W B;  2ASU B;  1W13 U;  1HJ9 A;  1QA7 A;  2F3C E;  1MD7 A;  3TPI Z;  3SNE A;  2F43 B;  2PHB A;  3HKI B;  2BLV A;  1S6L A;  3P95 A;  2C3S A;  1O3L A;  3PV4 A;  3LU9 B;  2WPK S;  1HYL A;  1HAY B;  1XUF A;  4H6T A;  1GI6 A;  1D3P B;  1GJ5 H;  1K0H A;  1YPH C;  2HNT E;  3M3T A;  1OYT H;  3BTW E;  3PRD A;  3TK5 A;  1SQR A;  5AVD A;  2A2X H;  1EZS C;  5EXN A;  2J4I A;  2YMS C;  2XWB I;  3PTN A;  1Z8R A;  3GIC B;  5HKK D;  2B9L A;  2QF4 A;  4UFF H;  3SU6 A;  2R3U A;  1W7G H;  1FPH H;  1SGT A;  3DFJ A;  5E2P A;  1W10 U;  1O2X A;  1K1O A;  1ZRB A;  1H8I H;  2ODQ A;  1JIR A;  5A8Y A;  2A1D B;  4XBD A;  1CHG A;  3P6Z B;  1P04 A;  3ZZA A;  2GT7 A;  1A4W H;  2DE9 A;  2BDG A;  2TBS A;  1TLD A;  2VBC A;  3FAO A;  2M2A A;  4CR5 A;  2P3T B;  3RXM A;  3F9G A;  2WYG A;  2BB4 A;  2PSY A;  3RXA A;  1LDT T;  2KCP A;  3TK9 A;  2ZFF H;  1AWF H;  3SNA A;  1C5T A;  1CSO E;  1MTN C;  4NWK A;  3BG8 A;  3B9F H;  2G81 E;  1LHE H;  1HXE H;  4X8U H;  1O5D H;  4UE7 H;  5EJ1 A;  1AUT C;  2BDA A;  1GI7 B;  2CV3 A;  5LH8 A;  1NTP A;  2K1Q A;  3SJI A;  1YPE H;  3SOR A;  2BXT H;  1T31 A;  4ABI A;  1HV7 A;  2ODY B;  1Y3Y A;  1MTU A;  1K1N A;  3LJO A;  3MO6 A;  3KID U;  3Q77 A;  2ULL A;  4X1S U;  4UDW H;  2TIO A;  1QBN A;  4WXI A;  2VIP A;  1MD8 A;  5JBT A;  2UUJ B;  1BBR H;  1C5S A;  1O0D H;  3E16 B;  5B6L A;  2VIO A;  4AB9 A;  2KR7 A;  2FIR H;  4HGC A;  4YOJ A;  1C5R A;  5KED A;  3F1S B;  4NSV A;  5EXL A;  3RXV A;  5EPY A;  2KZ4 A;  2OLG A;  5EW1 H;  1O2Z A;  3MU0 A;  4WF8 A;  2V35 A;  1C5L H;  9LPR A;  1BTZ A;  2G4U A;  1GBJ A;  3SJ8 A;  1GJ9 B;  4X1N U;  3EA7 A;  2OC0 A;  1COW D;  4JZF H;  1QL7 A;  4CH8 B;  1OP2 A;  3O8D A;  5EGM A;  3TJU A;  3ZZB A;  2A4Q A;  3QUM P;  1G3E A;  3MNX A;  4XE4 A;  1NT1 A;  2OD3 B;  1Q3X A;  2C8Z B;  4K8B A;  2AER H;  3SZE A;  4K2Y A;  1EZX C;  3HPT B;  3M37 A;  1OWI A;  2KAI A;  2P8O B;  3ATK A;  3KHV A;  3EYD A;  2ZDM A;  3TGI E;  2BY9 X;  4JCN A;  1VZQ H;  1YC0 A;  3A7V A;  5LGO A;  1EP6 A;  1UTP A;  5CHA C;  5DP6 A;  5DSF A;  3ZZ3 A;  3UNS A;  1H8H D;  1P2I A;  3BEI B;  2J97 A;  2VU8 E;  1C1T A;  5L2Y H;  1QZ8 A;  1O2W A;  1O3B A;  4XOJ A;  4CRG A;  1TX8 A;  1JOU B;  3C1K A;  1SLW B;  2ANK H;  1EOL A;  3FFG A;  4GAW A;  1G2L A;  1O2G H;  5EQQ A;  1C1P A;  2FEQ H;  5CE1 A;  1DUA A;  3A7X A;  1K22 H;  1QL9 A;  1O37 A;  2BVS H;  2AGE X;  3DHK H;  2AMP A;  2KX4 A;  3CP7 A;  2C4F H;  4FXG H;  2CHA B;  2TGT A;  4JYT A;  2GV6 A;  1K28 D;  2V3O H;  4I32 A;  1KXF A;  2GZ9 A;  3LH1 A;  4ZKR U;  1GJD B;  3BEU A;  1DWB H;  1EJM A;  1BZX E;  3UQO A;  4JK5 A;  1O32 A;  3PRB A;  3KQE A;  2QA9 E;  2P93 A;  3MH4 A;  3URE A;  4CHA C;  4Y8X A;  1QRX A;  1Z1I A;  3FO8 D;  1UVU H;  2FI5 E;  3BTG E;  1WV7 H;  1HCG A;  1QFK H;  3FVF B;  3TGK E;  1FPC H;  2PP6 A;  1E37 B;  2D26 C;  3M61 U;  2ZHF H;  2CMY A;  1SHY A;  1C5P A;  1P01 A;  1Z8G A;  3ZVE A;  8LPR A;  4E7R G;  1C5M D;  1C9P A;  4GCH G;  1O3D A;  4MNY A;  2KCY A;  3W94 A;  5FXL A;  4M9F A;  3UOP A;  2BZA A;  1HRT H;  2QCY A;  2GV7 A;  3T2N A;  1EX3 A;  1NRP H;  2FOH A;  1DM4 B;  3VB6 A;  2ZC9 H;  1GI8 B;  1CE5 A;  2W26 A;  3RXO A;  1EPT B;  4BNR A;  1LO6 A;  1TPO A;  1MAB B;  1FV9 A;  2YOL A;  1WSS H;  2VWO A;  1XUI A;  1UCY K;  1DLE A;  1TGS Z;  3M35 A;  2QXH A;  2ZEB A;  3F2G A;  4X1P U;  3RXU A;  3ELA H;  4CH2 B;  2FOE A;  4WMD A;  3ZVF A;  3A83 A;  2J92 A;  1Z1J A;  3V0X A;  1LCY A;  1UW7 A;  1HAZ B;  1GI3 A;  1KLJ H;  2FS8 A;  1UTJ A;  3I29 A;  3RXL A;  4H6S B;  4J2Y B;  1DIT H;  1C4Y 2;  5A09 A;  6CHA C;  4TT3 D;  3SU1 A;  1UVO A;  5DGJ A;  1GMC F;  1GJ4 H;  2GDE H;  1SHH B;  4NIX A;  2TGD A;  1TPS A;  2GZ8 A;  2AH4 X;  3A7W A;  1VCW A;  2D2D A;  2QY0 B;  3O8C A;  1BIT A;  1EAI A;  2F9O A;  4CRD A;  4OGX A;  5C1U A;  1TE0 A;  3M5L A;  1HUT H;  3A87 A;  4X2Y A;  2A2Q H;  3F0P A;  2GCT B;  1AQ7 A;  4IN1 A;  1FN6 A;  4D9R A;  5A0B A;  1RD3 B;  2XCF A;  4Z1M D;  1O2N A;  1TRY A;  4XD7 D;  1FY4 A;  2ZQ1 A;  3V3M A;  1O39 A;  3OFN D;  3PMB B;  2ZFR H;  1AUJ A;  4I8J A;  4NIW A;  1HIA B;  1YGC H;  3RDZ A;  1MTV A;  3T29 A;  3ZVB A;  2GGV B;  2ZTX A;  2CK3 D;  3T26 A;  4FUG A;  5FPT A;  3VFE A;  1LPZ B;  2VVC A;  4K3J A;  2VNT A;  3TU7 H;  5JDU B;  2R3Y A;  1EKB B;  1P2Q A;  2XNI A;  1GBD A;  1W11 U;  3QGJ A;  1ZOM A;  4A1T A;  3SUG A;  4Q63 A;  1TB6 H;  1TNK A;  4CRF A;  1TAW A;  4Z6A H;  4HI3 A;  2DUC A;  1LKB A;  3P8N A;  4FVD A;  1PQ8 A;  4I8L A;  3SW2 B;  2A31 A;  3F9E A;  1RGQ A;  1DXP A;  4Q7Z A;  4Y7B A;  4U30 A;  1SFQ B;  1VCQ A;  2ZU5 A;  1Z6J H;  1ZSK A;  2FS9 A;  3N99 A;  2STB E;  2BX3 A;  1PPZ A;  2GTB A;  4E06 H;  1V2S T;  3GYL B;  4RKO B;  3GY2 A;  2EY4 C;  1DE7 H;  2SGE E;  4UD9 H;  5EQR A;  1O31 A;  3MNS A;  4XRN A;  1NES E;  1SPJ A;  1O3H A;  4UFE H;  3A88 A;  1CBW C;  1GI4 A;  1PQ7 A;  4NCY A;  2ZWL H;  4X6M A;  1ZHR A;  3GOV B;  5FL7 D;  1O5B B;  1IQM A;  1OP8 A;  5AFZ H;  2V7Q D;  4YT6 H;  5I46 H;  4UON A;  1W0Z U;  2FO9 A;  2WV9 A;  4DY7 B;  1BOQ A;  1SQT A;  1ZJD A;  4XDE A;  1ZPB A;  4X2X A;  2W3I A;  5EXM A;  2KM0 A;  4RSP A;  1MAY A;  1V2W T;  2R2M B;  4MPV A;  1ETS H;  1C2L A;  3BV9 B;  4FUH A;  5EQS A;  1MU8 B;  5EG4 A;  1VIT G;  4X6O A;  4XBB A;  2HGT H;  2PKS C;  4FU9 A;  3JZ2 B;  2UUF B;  1GBB A;  1V2L T;  1HAG E;  3O8B A;  3LH3 A;  1TX6 A;  2PLX A;  5DP3 A;  3BTK E;  4ABA A;  2Y81 A;  1AFQ B;  4WH6 A;  3RXK A;  1P2K A;  1OWH A;  2TGP Z;  5T1V A;  3M7T A;  4D76 A;  1BRA A;  2HOB A;  1E1Q D;  4INK A;  3TH4 H;  1RTK A;  4ABD A;  1OS8 A;  1VJA U;  2BQW B;  5DK1 A;  3T5F H;  2JH5 D;  1G9I E;  4YXW D;  1T32 A;  4XSK U;  4AOQ A;  2EEK A;  1YCP K;  3P17 H;  2BDY A;  2ZKS A;  5PTP A;  1IHS H;  3ATI A;  2BY7 X;  3N7E A;  2BHG A;  1A5I A;  1UTO A;  1V2T T;  3CEN A;  5EU8 A;  1SBW A;  5GXP A;  3PV2 A;  5GJ4 B;  5F8X A;  4A1V A;  3H09 A;  1QIX B;  4ZMA H;  1CT4 E;  1PFX C;  1ETT H;  1PYT D;  4CRE A;  1Y59 T;  1MH0 A;  2W6J D;  1K9O E;  1O2J A;  1HPG A;  3SJO A;  3T27 A;  5FPS A;  1LHF H;  2O8L A;  4ISO A;  2ODP A;  1ELD E;  1UTN A;  4NFF A;  3RC5 A;  1TYN A;  4NGA H;  1DPO A;  2RA0 A;  1NZQ H;  4DG4 A;  1EAW A;  4IBL H;  1V2M T;  1GBF A;  1GBM A;  2OXS A;  1GMH F;  1QY6 A;  1C5Y B;  3RC4 A;  2W6I D;  3N7D A;  1WAY B;  1MQ6 A;  2HVX A;  2WPH S;  1TGN A;  2A0Q B;  2Z9J A;  2JJ2 D;  2NU1 E;  1MQ5 A;  3ZYE A;  4ZUH A;  2XC5 A;  4CBN A;  1PPH E;  2ZU3 A;  1CVW H;  3SUF A;  2ZFS A;  2JET C;  3RU4 T;  5G4B A;  3F9H A;  1KY9 A;  4DOQ A;  4EST E;  4DW2 U;  5ETX A;  1E38 B;  4X8S H;  1ZML A;  1L0Z A;  1KTT B;  2HPP H;  3KQD A;  4HFP B;  3RXD A;  3VB3 A;  1D3D B;  1ZHM A;  4K60 A;  7EST E;  4PRO A;  1K2I 1;  3WWB A;  1VIT H;  1BRB E;  2FTL E;  4YTA A;  2BD7 A;  2GDD A;  4WMF A;  1TBQ H;  1ZSJ A;  5TCA A;  3MTY A;  4DJZ B;  4I7Y H;  1TGT A;  3VB4 A;  4B1T A;  4I33 A;  1O2R A;  1AKS B;  3NCL A;  2ZPR A;  8EST E;  3SU2 A;  3RMN H;  1GBH A;  3BTE E;  3MH5 A;  2GKV E;  2TRM A;  1VGC B;  2SGD E;  1F2S E;  1GI9 B;  1V2O T;  4OS6 A;  1W0Y H;  4R0I A;  2HVY B;  8GCH F;  1D4P B;  3SQH E;  1B7X B;  1FY8 E;  1HAV B;  5CHB A;  1MKW K;  1J15 A;  2BXU H;  3GY3 A;  1XUH A;  3WY8 A;  1P57 B;  3U1J B;  1O3I A;  3LC3 A;  1NRR H;  1TA6 A;  1UO6 A;  5ESB A;  4LZ1 H;  1XX9 A;  2J98 B;  1IQF A;  1A46 H;  1Z7K A;  1EUF A;  2LEL A;  1PPC E;  3QZR A;  5HGG A;  1D3T B;  3GCH B;  8KME 2;  3SQE E;  1O3P B;  3DFL A;  1UHB A;  2FOG A;  2OC7 A;  4AG2 A;  2WUB A;  2OC1 A;  1S82 A;  2XOK D;  1NU7 B;  4I31 A;  3MO3 A;  1D6R A;  3EAJ A;  5C5N A;  2IPH A;  2BOK A;  4Q2K A;  2F9V A;  2EC9 H;  1DST A;  1GG6 B;  1K1L A;  1UCY E;  3SNB A;  4RKJ B;  1AI8 H;  1AN1 E;  1TPP A;  5DPA A;  2ZPQ A;  1BDA A;  3SYJ A;  1EZQ A;  1ZJK A;  4IGD A;  1LHG H;  3RLY H;  1SI5 H;  4TYD A;  1RXP A;  1GJC B;  3GY5 A;  1O3J A;  5DP7 A;  4GSO A;  5FPY A;  1T4U H;  1AB9 C;  5DP8 A;  1ZYO A;  1N1L A;  1P12 E;  3A81 A;  1KTS B;  1GWA A;  1VCP A;  4P02 A;  1TNJ A;  3TVJ B;  3SV7 A;  1C2D A;  3P70 B;  2XWA A;  3NPS A;  1H9H E;  1OWK A;  2Y6T A;  4YT7 H;  1EOJ A;  2FOF A;  3Q3Y A;  3RXF A;  1KSN A;  1ZMN A;  4ABG A;  1UTM A;  5C1Y A;  3F68 H;  5IYT A;  1YCP M;  2H5C A;  4YLU A;  5EIY A;  2G8T A;  4ZXX H;  3SJK A;  2GX4 A;  1NRQ H;  2TPI Z;  2IJO B;  1K1P A;  4HZH A;  3JZ1 B;  1TBR H;  1GBC A;  3QTV H;  1IQG A;  5GCH F;  3T62 A;  4AGK A;  1K21 H;  5DP4 A;  1O5A B;  1GHY H;  1TQ7 B;  2R0K A;  2VIQ A;  1GI5 A;  1YPH E;  7GCH F;  3ZZ4 A;  1NFU A;  1ID5 H;  1NPM A;  3S7K B;  1XMN B;  4TWW A;  3Q76 A;  3MU8 A;  3A8D A;  5C0U A;  5JBC S;  3RU4 E;  1A0J A;  4Y6D A;  4Y11 E;  3RM2 H;  3RMO H;  1J8A A;  1C5V A;  1DS2 E;  1DAN H;  2Z7F E;  3BTQ E;  3D23 A;  2FX6 A;  2H9H A;  1MKX H;  1ELG A;  2TGA A;  1A3E H;  4D7G A;  2HNT C;  4ISI H;  4H4F A;  3KQ5 A;  1QNJ A;  1CGJ E;  2FOA A;  2BOH B;  3KN2 A;  1RIW C;  2FOM B;  1QB9 A;  2G00 A;  3NWU A;  1DT2 A;  1PPF E;  2YMS B;  4NWL A;  2IOT A;  2FTM A;  1L1J A;  3TLO A;  1W2K H;  3ZZ6 A;  5HXF A;  3F9F A;  4F48 B;  5DP5 A;  3EST A;  2ZFP H;  3UPE A;  2PTN A;  1TNL A;  4FU8 A;  2OCV B;  3NZI A;  3DD2 H;  1NU9 A;  1AVG H;  1RIW B;  1G3D A;  4Y79 A;  1TNI A;  3VEQ B;  1HAI H;  3V13 A;  1MTS A;  2QXJ A;  1JWT A;  1O5E H;  2A7C A;  3Q00 A;  2PWX A;  4A7I B;  2AGG X;  2C90 B;  5AF9 H;  3LON A;  2A7J A;  2AYW A;  3S69 A;  5FBI A;  1ELE E;  4TPI Z;  1SLV B;  1YPG H;  1QQ4 A;  1MTN B;  1EP5 A;  3NKK A;  2F9N A;  1SGP E;  2BZ6 H;  2OTV A;  3DSO A;  3L6P A;  1CO7 E;  4TWY A;  1C5O H;  2G4T A;  1PQ5 A;  2K8I A;  1EAS A;  3FP7 E;  4KKD A;  4I8H A;  4X2V A;  3GYM A;  4M7G A;  2KAI B;  4GPG A;  1YF4 A;  1UTL M;  3UR6 A;  1GL1 A;  1P09 A;  1BQY A;  4NA8 A;  4TY6 A;  1LVM A;  2RG3 A;  4ZKS U;  4AN7 A;  3RXG A;  4IMQ A;  5DJ7 A;  3KEE A;  3LGI A;  3SJ9 A;  1PJP A;  4LOY H;  5F8T A;  3RML H;  1AE5 A;  4FUC A;  2ZCH P;  3U8O H;  1U6Q A;  2QC2 A;  3TJV A;  1VR1 H;  3LGY A;  2WPI S;  1CU1 A;  2ZGB H;  3F0O A;  1P0S H;  3FZZ A;  2ZDL A;  4Q7X A;  4U01 A;  2SFA A;  1GDN A;  2IPQ X;  1YLC A;  5E0G A;  1C1R A;  1D9I A;  1BTU A;  1ZPC A;  1AVW A;  2BYA X;  3BTD E;  2NWN A;  1FY3 A;  1LMW B;  4X0W U;  3OX7 U;  5EW2 H;  4Q7Y A;  2ZNK H;  1MBM A;  3KL6 A;  1P03 A;  3UB0 A;  1UK4 A;  3K65 B;  1QL8 A;  3GCO A;  1GHW H;  2PR3 A;  1GBI A;  2OUA A;  3HK3 B;  1GMD G;  2AMQ A;  2WV4 A;  1SMF E;  5ABW A;  2FI4 E;  1F92 A;  2RCE A;  4OS4 A;  5H4I B;  1OWJ A;  1E35 B;  1C2E A;  4WH8 A;  4Y71 A;  4CRA A;  3AAV A;  1FI8 A;  1IHT H;  3EE7 A;  5CDF E;  1A2C H;  3D62 A;  5CHA B;  2R2W U;  3FP8 E;  1FQ3 A;  3QK1 A;  1QGF A;  1CQQ A;  3EQ0 H;  5F8Z A;  5LPR A;  1O3F A;  1KDQ B;  1SVP A;  4XBC A;  2BY8 X;  4MG3 A;  1J14 A;  1MBQ A;  2R0L A;  3U8R H;  1TRM A;  2W3K A;  4E7N A;  4FUE A;  5F53 A;  1ETR H;  2FOD A;  5FBE A;  1BMF D;  1PPE E;  3FKS D;  3RLW H;  2ZIQ H;  4X1Q U;  1GJ6 A;  4HG6 A;  2BD8 A;  1SGF G;  2OK5 A;  4JK6 A;  2AGI X;  1AIX H;  1P02 A;  3ZYD A;  2ZPS A;  1SSX A;  4THN H;  1AVX A;  3PLP A;  1OX1 A;  2F9U A;  2VIW A;  1O3K A;  3EGK H;  8GCH G;  5DP9 A;  1ELT A;  4R8T B;  2FOB A;  1FIZ A;  2J38 A;  2FZZ A;  1PYT C;  4CHA B;  3TIU A;  5SGA E;  3PLK A;  3U8T H;  3GCT F;  1G3C A;  1RFN A;  3BN9 A;  2J34 A;  1AE8 H;  3BTT E;  1BML A;  1T8O A;  5FCK A;  1YPL H;  3EA9 A;  1ESB A;  1SOZ A;  1UCY H;  1INC A;  3F6U H;  1F5R A;  1XKB C;  1AHT H;  4P00 A;  5L30 H;  4RT0 A;  1CHO F;  3BTM E;  4MQA A;  3GIS B;  4TSF D;  1Y5A T;  3BTF E;  1RRK A;  2Q6D A;  1GVL A;  1T8L A;  2A4G A;  3OAA D;  1GI1 A;  2Q6F A;  3RXE A;  1Y3V A;  5BPE A;  3UIR A;  3OYP A;  3BIV H;  3CNR A;  2O9Q A;  3KQC A;  3S9B A;  4K8Y A;  3VXF H;  3PYH A;  4BAO B;  3MO9 A;  1SQA A;  2OBQ A;  3RU4 D;  4WVP E;  3K9X B;  4F55 A;  1KXB A;  4A92 A;  4BTI B;  1V2V T;  1C5X B;  1P11 E;  1SKY E;  3A8B A;  1DIC A;  1V2U T;  1BTX A;  1KXA A;  4NA7 A;  3SGB E;  1B0E A;  4AFQ A;  3AVZ A;  3A8C A;  1HAO H;  5HM9 A;  2XBV A;  1GHZ A;  3UWI A;  2PUQ H;  4ZHA A;  3BIU H;  1DWC H;  1P05 A;  2IJD 1;  3I77 A;  1SOT A;  2PW8 H;  1T8M A;  1O3N A;  4NIY A;  2FLR H;  3LC5 A;  1JIM A;  4NZL A;  1P2M A;  1KXC A;  2RDL A;  1SGR E;  3V7T A;  4JZ1 A;  1F5L A;  3QGN B;  6CHA B;  2ZDV H;  1GHV H;  3UNR A;  3LJJ A;  1TBZ H;  1F0U A;  2XTT B;  1EJN A;  4JZI A;  1LHD H;  3A7Y A;  2BVR H;  1Y3W A;  1ARC A;  3B23 B;  3D65 E;  4WXV A;  3MH6 A;  4Y7A A;  3RXI A;  3AK5 A;  3UTU H;  1Q31 A;  2GCH G;  3LPR A;  2ALV A;  4ZHL U;  3EA8 A;  1DX5 M;  2A7H A;  5L2Z H;  2NU0 E;  5FHT A;  4MNW A;  1SG8 B;  1BTY A;  1F5K U;  1T7C A;  3LIW A;  3KQB A;  1XKA C;  4J1Y A;  4BXS A;  4Y0Y E;  3H7O A;  1SGC A;  2P94 A;  5GCH G;  1GPZ A;  3MU4 A;  1EAT A;  1HLT H;  4Q4L A;  1GJ8 B;  1H8E D;  7GCH G;  1GJB B;  1CA0 C;  4UEH H;  1LQE A;  3KGP A;  3RMM H;  2BY5 X;  3RXS A;  1THS H;  3TH3 H;  2B7D H;  1Y8T A;  2ANM H;  3PB1 E;  3SND A;  1EAX A;  4INH A;  4YLQ H;  1KXE A;  5GWZ A;  1GGD C;  5F03 A;  3CS0 A;  5F6M A;  2GD4 B;  4JYV H;  3ITI A;  5B6O A;  1S0Q A;  1N6X A;  1QCP A;  1WBG B;  1Y5U T;  1X7A C;  4O3T A;  1S0R A;  2PKA A;  4OM9 A;  1LHC H;  1CA0 B;  1O33 A;  2Z6B D;  1EAU A;  1TAL A;  2ZGX H;  2UUK B;  4FUJ A;  4O03 A;  3DUX H;  5EOD A;  2KCA A;  5L6N H;  1RS0 A;  4O9V A;  2Y5H A;  2JIZ D;  1YBW A;  1YLN A;  2G5V A;  1GGD B;  4Y0Z E;  1BRU P;  1C2G A;  2QV1 A;  4MNX A;  3ZVD A;  3FN8 A;  4B76 A;  3F2H A;  5EST E;  1YPK H;  3W95 A;  3V12 A;  3AAU A;  3K2U A;  1TX7 A;  3RP2 A;  1CBW B;  3OEH D;  2L6O A;  2SGQ E;  4YES B;  1OHH D;  4O3U A;  2CGA A;  5HIZ A;  1H9L B;  1O3G A;  3AW0 A;  2VGC C;  4U2W A;  3MWI U;  1Y5B T;  1G37 A;  1GI2 A;  3RXC A;  3UUZ A;  5C2Z A;  2Y7Z A;  1V2N T;  1XUJ A;  1YCP H;  2EI6 A;  1IQE A;  1Z8J B;  2Z9I A;  1O5C B;  2KFW A;  2Y5F A;  1E34 B;  4OS7 A;  3TH2 H;  1UTK A;  2HAL A;  2M5T A;  3WW7 A;  1Z71 A;  2H2Z A;  1MU6 B;  2CJI A;  3ZVC A;  3PMH B;  3PWB A;  3E90 B;  1ABI H;  1QTF A;  2BDI A;  1FON A;  3M7U A;  3OY5 U;  1T8N A;  2PKS B;  1SGN E;  1V6D A;  2C8X B;  2ZG0 H;  3BEF B;  5A0C A;  3BSQ A;  3UNQ A;  2G55 A;  2ZO3 H;  1NM6 A;  1IQL A;  1Z6E A;  1S81 A;  2G52 A;  3KYG A;  4FVB A;  3PO1 C;  2FLB H;  2WYJ A;  1A7S A;  3GDU A;  1BMM H;  1C4V 2;  2CF8 H;  1HJA C;  1O5G H;  5T6F A;  1QR3 E;  1YLD A;  4MTB A;  5JB8 S;  3VB5 A;  1JBU H;  2JJ1 D;  4K1E A;  2A45 B;  1PPG E;  2O8W A;  1B5G H;  3OSY A;  4ISH H;  3MU5 A;  5J4S A;  3ATL A;  2ZP0 H;  1G30 B;  2WPD D;  3SV8 A;  2QIQ A;  1K1I A;  4X6P A;  1NFX A;  1DUE A;  3ZZ8 A;  4LK4 A;  3RXQ A;  1O2V A;  5FCR A;  4ACB A;  5DN6 D;  1HJ8 A;  2JH6 D;  4JMY A;  3QTO H;  1J16 A;  4MPU A;  1ANB A;  2O8M A;  3T28 A;  2Y5G A;  3NK8 A;  4ABB A;  1L4Z A;  1NFY A;  1EQ9 A;  4ABE A;  2H1U A;  1LQD B;  2ZHQ H;  1KLT A;  2XW9 A;  3A80 A;  6EST A;  5E0H A;  2PUX B;  4KTU A;  2F4L A;  4MPX A;  1M9U A;  1DWE H;  4RN6 A;  2FXR A;  3KF2 A;  3PMJ A;  5EOK A;  2ZHD A;  2PFE A;  2Z9L A;  1GBE A;  3ZZ7 A;  1TMT H;  2OP9 A;  1QBO A;  2QF3 A;  4IW4 E;  1VKY A;  2V0B A;  1KMH B;  3MOC A;  2PGQ B;  2FPZ A;  2ZCK P;  2ZDN A;  1OKX A;  1W12 U;  4FUF A;  1TON A;  2AEI H;  1BA8 B;  2JET B;  2NU3 E;  1ZMJ A;  3URD A;  1UHB B;  3E6P H;  4CR9 A;  1J17 T;  5EJL A;  4ZKN U;  3UWJ H;  5C17 A;  1EJA A;  3A85 A;  4ABF A;  1MUE B;  4BTU B;  2THF B;  1ESA A;  1ELV A;  3E0N B;  1XXF A;  4NIV A;  2HNT F;  2WUC A;  2BD4 A;  1ZR0 A;  1WUN H;  9EST A;  3MNB A;  2J2U A;  2BTC E;  2R9P A;  2ZA5 A;  2V3H H;  3TK6 A;  2SNV A;  4MDS A;  3NUM A;  5DO4 H;  3O8R A;  1QRW A;  2O8T A;  2VWL A;  1YPM H;  1DFP A;  1RTL A;  6LPR A;  1BTW A;  1LKA A;  2FP7 B;  4ABH A;  2LNC A;  5C67 A;  1FY1 A;  3IIT A;  1QUR H;  3SV2 H;  1QB6 A;  4GCH F;  2A4O A;  1QBV H;  4BTT B;  2OC8 A;  3SBK A;  6GCH F;  5EJZ A;  5GIB A;  1GHB F;  4XFQ A;  3SI4 H;  5JPM H;  2BLW A;  1WQS A;  1OWD A;  1C2K A;  2BDB A;  1O2T A;  1FXY A;  1BJV A;  4KP0 A;  2HWL B;  3LGU A;  4ASH A;  3U98 H;  1WQV H;  3SGA E;  1SC8 U;  1W0K D;  1BB0 B;  5FAH A;  4BAH B;  1TOM H;  2H5D A;  2Z3D A;  4DII H;  1OPH B;  5K0H A;  1HAV A;  1NY2 2;  2OQ5 A;  1QJ1 B;  2VWM A;  3SI3 H;  1ORF A;  2QE7 D;  4GHT A;  4KTS A;  5KGO A;  4B71 A;  1L2E A;  1C5Q A;  1GHA F;  1V3X A;  1GBL A;  1NBM E;  4Q80 A;  1FDP A;  2QGR A;  2BD2 A;  1E0F D;  2H9T H;  4K5Z A;  3NXP A;  5C3N A;  3MYW A;  1CGI E;  1AB9 B;  1GMC G;  2ZI2 H;  2ALP A;  2OQU A;  3U1I B;  1TFX A;  1ZRK A;  4DT7 B;  1AD8 H;  1UTQ A;  4MPW A;  3S0N A;  1P2N A;  1LPK B;  4I8G A;  2ZZU H;  1A5H A;  1V2R T;  3PRO A;  4IMZ A;  3ODF A;  1FAX A;  1SQO A;  2Q6G A;  3RXP A;  1W3C A;  1NRO H;  3FAN A;  2UWO A;  3PLB A;  2D1J A;  2RDE A;  1DLK B;  4YZU A;  1WCZ A;  5CMX H;  1C1N A;  1NO9 H;  4Y8Y A;  3QLP H;  1V2Q T;  1C1W H;  1A1R A;  1GBK A;  2W7U A;  4A5T S;  3A7T A;  1IQJ A;  3OY6 U;  5EPN A;  4CBO A;  3DA9 B;  1MCV A;  4YO9 A;  2PV9 B;  3SHA H;  4WY3 A;  2ZGH A;  4AYY B;  2QYI A;  3S7H B;  3UAI C;  5IK2 D;  1O2O A;  2B5T B;  3U69 H;  1T4V H;  2WV5 A;  3QX5 H;  2EI7 A;  1PQA A;  1V2J T;  4IS5 A;  3FP6 E;  1EFR D;  1QA0 A;  1P9U A;  2P3U B;  2BDH A;  1L1G A;  4A6L A;  2WPL S;  4RI0 A;  1ELB A;  4K69 A;  1DSU A;  4KEL A;  1C1M A;  1DY9 A;  2A5K A;  2VH6 A;  2XC0 A;  1IAU A;  1W0J D;  4X2W A;  3LOX A;  2GP9 B;  1OXG A;  1P06 A;  1GDQ A;  2HRV A;  2FWW A;  1W7X H;  1FUJ A;  1TNG A;  4DCD A;  1IQN A;  2WIN I;  3LKW A;  5TJX A;  1H9I E;  3STI A;  3ZV8 A;  1Z8I B;  3ZVA A;  1C1O A;  3A89 A;  3RXR A;  4X8V H;  1ZGV A;  2HLC A;  5GPI B;  5BRR E;  5FX6 A;  1TAB E;  3S9A A;  3AAS A;  2ZFQ H;  4NSY A;  2F9P A;  1SGY E;  3A84 A;  1TGB A;  2O8U A;  2Z9K A;  1BCU H;  3SO3 A;  4AG1 A;  1UVT H;  1O38 A;  1THP B;  5T3H A;  2BMG B;  3L33 A;  2QXG A;  1GVZ A;  1MKX K;  1KXD A;  4DGJ A;  4WWY A;  1VIT F;  4B73 A;  4ISN A;  1DY8 A;  1WTH D;  4BAQ B;  1THR H;  1C2M A;  4X6N A;  4VGC C;  4YOI A;  2PGB B;  2ZFT A;  1WXR A;  2Z94 A;  4H42 U;  1YM0 A;  2BQ6 B;  5T6G A;  1C4U 2;  2ZHE H;  3PV5 A;  5GND A;  3TNT A;  3TJO A;  3D49 H;  1TNH A;  1O3C A;  4ISL A;  4SGA E;  1SGF A;  2G5N A;  5E0J A;  2XCN A;  4OGY A;  4VGC B;  1P10 A;  2P95 A;  1UK3 A;  1C2J A;  2VVV A;  1FAK H;  4TPY A;  4AC9 A;  1C5N H;  1J9C H;  3H7T A;  5HM2 A;  3STJ A;  3SUD A;  2LP6 A;  1N8O C;  3SNC A;  2Y82 A;  4I86 A;  1ZGI A;  1BRC E;  5K7R A;  1SLX B;  1SR5 C;  5E8E H;  5JBB S;  2VH0 A;  1TMB H;  7KME H;  4OS5 A;  3QDZ B;  3BF6 H;  2HLD D;  1C1S A;  1GBA A;  1HXF H;  3HK6 B;  2F9B H;  1O2M A;  1TGC A;  1O30 A;  1LVY A;  1BBR K;  4OS1 A;  1OOK B;  1N8O B;  3Q3X A;  4AOR A;  2P8O C;  4GHQ A;  4KGA A;  1JRS A;  3ENS B;  3GDS A;  2PSX A;  1BJU A;  3M3S A;  1O2S A;  1O2Q A;  1O2K A;  4D9Q A;  2VVU A;  2V3M A;  1GBT A;  1GMH G;  3MFJ A;  4ABJ A;  1ABJ H;  3LGW A;  1BIO A;  2XND D;  3VPK A;  3SU4 A;  3DCL A;  1WU1 A;  3SU5 A;  4JYU H;  4B2C A;  1EZU C;  1S6F A;  2EA3 A;  3C27 B;  1UVS H;  3E3T A;  1QRZ A;  2BM2 A;  2IN2 A;  4WME A;  2BD5 A;  2FYR A;  5JB9 S;  2CHA C;  4E05 H;  5A8X A;  4ZKO U;  2VWN A;  1O2U A;  1K1M A;  2BLQ A;  1TA2 A;  2ZCL P;  1OP0 A;  1A3B H;  4NA9 H;  4SGB E;  1RJX B;  4K1T A;  3DSP A;  1NRN H;  3TGJ E;  3QZQ A;  4JZE H;  3M36 A;  2WZQ A;  4GUX A;  1O2P A;  3ZV9 A;  2QAA A;  5IDK A;  5E2O A;  1E1R D;  3HKJ B;  3W1E A;  2XRC A;  3U9A H;  1V2P T;  4ZXY H;  3MI4 A;  2A5A A;  5TCC A;  1DXW A;  7LPR A;  1H4W A;  1NBM D;  2FYQ A;  5FX5 A;  1BTH H;  3K6Z A;  3G01 A;  3FZD A;  1PPB H;  4BOH A;  2AHM E;  3OEE D;  1ELC A;  5HIY A;  2A4R A;  3VG8 A;  2FMJ A;  4BAM B;  1YY3 A;  2OBO A;  3GS9 A;  2PTC E;  1UVP A;  4O97 A;  1MZD A;  1KYN A;  1SGQ E;  4Z0K A;  1A0H B;  1O3E A;  3L3T A;  3QN7 A;  3M5O A;  1ANE A;  1ZSL A;  4Y76 A;  1IQI A;  1UK2 A;  4NFE A;  4UFG H;  4B2B A;  1C2F A;  2J94 A;  3IWM A;  3ZZ9 A;  5AHG H;  2BLO A;  1FMG A;  5HYO A;  3LT3 A;  1EPT C;  1V2K T;  4INL A;  2P59 A;  1HFD A;  3ZVG A;  3ATM A;  4NG9 H;  1ZLR A;  1F0R A;  3HGP A;  1KDQ A;  2A32 A;  2JH0 D;  1TQ0 B;  1QJ6 B;  6GCH G;  2FDA A;  1GHB G;  1N6Y A;  3K6Y A;  3WWF A;  2CN0 H;  1P2O A;  2YMS D;  3RUO A;  1G36 A;  2ZQ2 A;  2WHX A;  2XC4 A;  3TJN A;  4IC5 A;  1GJ7 B;  3ODD A;  4BAN B;  3A82 A;  3MQK C;  1LPG B;  4GLY A;  1A0L A;  2J9N A;  2EST E;  1GCT C;  4RT1 A;  2I6Q A;  4ASU D;  2FI3 E;  1O34 A;  3KYF A;  4CRC A;  1AZZ A;  1FY5 A;  1FIW A;  3VXE H;  1CT2 E;  1MCT A;  2ZHW H;  3T25 A;  1EXF A;  1HAP H;  1C9T A;  3F3B A;  1AND A;  2V6N A;  3LDX H;  1BTP A;  5JBA S;  4QT8 C;  3QO6 A;  3P8G A;  1UMA H;  1DDJ A;  1FNI A;  1GHA G;  2QF5 A;  2SGF E;  3R3G B;  1GCT B;  5LPE A;  3GY8 A;  1C2I A;  3VB7 A;  3UY9 A;  2B0F A;  3MNC A;  2GCT C;  4Y10 E;  3HAT H;  1QHR B;  4FU7 A;  4FUB A;  3CS7 A;  3M5N A;  4YM9 A;  1S85 A;  2ZU4 A;  1SGD E;  2YNA A;  3R0F A;  1EPT A;  3MHW U;  2PKA B;  1F0S A;  1O3A A;  1Y3U A;  1AO5 A;  3ZZ5 A;  2AIP A;  1ZZZ A;  2FM2 A;  3SN8 A;  4AYV B;  2WPJ S;  1AU8 A;  1QJ7 B;  1P2J A;  3M3V A;  2QXI A;  1DOJ A;  1G32 B;  2EQN A;  5DKM A;  1BHX F;  2P3F H;  2GMT C;  4KTC A;  3OTP A;  1S83 A;  4B6F A;  3UFA A;  4B75 A;  5LPF A;  1AZ8 A;  3BTH E;  1YKT A;  2F83 A;  2GVF A;  2RA3 A;  1LVB A;  1UJ1 A;  2XYA A;  3IG6 B;  4I8K A;  5C94 A;  3GDV A;  2C8Y B;  3DT0 H;  2VIN A;  4AFU A;  2GZ7 A;  2GMT B;  3A86 A;  1YPJ H;  5C0T A;  1GJA B;  2JDI D;  3QWC H;  1SFI A;  2DE8 A;  3ZIA D;  3P92 A;  2VID A;  2ZTY A;  4LXB H;  4ZH8 A;  2BD9 A;  3ATW A;  4ZAE A;  2BDC A;  1QB1 A;  1AGJ A;  3SU0 A;  3E8L A;  1TIO A;  2XBY A;  2RFK C;  1JXP A;  3A8A A;  2A5I A;  2KCO A;  4K1S A;  2ZU2 A;  1GDU A;  2Z3E A;  3F2F A;  3TIT A;  4DUR A;  3ZZC A;  3I78 A;  4D7F A;  4HTC H;  1JRT A;  3BG4 C;  1GL0 E;  1HIA A;  1GHX H;  2YNB A;  1E36 B;  3EE0 B;  3SUE A;  4FOU C;  3OE7 D;  1AMH A;  3P8O A;  1HNE E;  1XVO A;  1A5G H;  3OU0 A;  3P8F A;  4FET A;  1ACB E;  1BUI A;  2SGP E;  1CGH A;  1AFQ C;  2ZGC A;  1BMN H;  1Q2W A;  2STA E;  3AW1 A;  3BG4 B;  4B2A A;  2VGC B;  3GY4 A;  4AB8 A;  2NU4 E;  3KCG H;  1CA8 B;  2OIN A;  4ZCN A;  3MMG A;  4FUI A;  3UQV A;  1SL3 A;  3NRL A;  1L4D A;  2H9E H;  4ZHM U;  1O2I A;  1NRS H;  1NN6 A;  3SV9 A;  1C1U H;  2UWP A;  3GCN A;  4WJG 2;  1XUK A;  1K1J A;  1F0T A;  2UWL A;  1ZTJ A;  1TRN A;  1WOF A;  2ZF0 H;  1ZTK A;  2BY6 X;  2C93 B;  1GVK B;  3RC6 A;  2G51 A;  4B74 A;  3PO1 B;  4FUD A;  1MMJ N;  2Z9G A;  2Y7X A;  2WPM S;  1KIG H;  1HAH H;  4LZ4 B;  4AZ2 B;  1SGI B;  1XVM A;  5C5O A;  1HJA B;  1A61 H;  1WDI A;  1GI0 A;  2BVX H;  1O3M A;  2SGA A;  5AFY H;  1D3Q B;  1BBR E;  2WSS D;  1CT0 E;  1ZPZ A;  2ZTZ A;  2W5E A;  2P16 A;  2B8O H;  1P3C A;  2ANY A;  2AIQ A;  3A7Z A;  1C5W B;  4A1X A;  2FES H;  1MZA A;  4D8N A;  1HBT H;  3GY7 A;  4B6E A;  3PMA B;  2HPQ H;  2Q1J A;  4BAK B;  4F49 A;  1C1Q A;  1GMD F;  1ZHP A;  2I6S A;  3DSG A;  4MLF B;  1L1N A;  1NFW A;  1O5F H;  1AWH B;  1YP9 A;  4MNV A;  1EB2 A;  1S6H A;  4X8T H;  5A0A E;  3VGC C;  1SB1 H;  3GY6 A;  4AX9 H;  1P8V C;  1QQU A;  1JMO H;  1Y3X A;  4F4O C;  1W14 U;  1BHX B;  1O2L A;  1C5Z B;  1O35 A;  4CRB A;  2ZGJ A;  2ZEC A;  4X1R U;  5C1X A;  1YWU A;  5GDS H;  1MKW H;  1TMU H;  4ACA A;  1D6W A;  1MAX A;  3SV6 A;  4DIH H;  3UR9 A;  1EB1 H;  5T6D A;  4TY7 A;  2J95 A;  3RXH A;  4AFZ A;  3VGC B;  1O2Y A;  3PM3 A;  2L74 A;  1ELF A;  3Q3K A;  2EI8 A;  3ZZD A;  2ZDA H;  1VJ9 U;  3MU1 A;  3B8J A;  2XBX A;  1XUG A;  1VGC C;  2F91 A;  1TWX B;  5A2M H;  1O36 A;  1SGE E;  1E79 D;  3RXT A;  1BMA A;  4ZRO A;  5J4Q A;  1ARB A;  1GCD A;  1WTG H;  3E1X B;  5C20 A;  1SLU B;  2SNW A;  2BQ7 B;  2H6M A;  1IQH A;  1BT7 A;  2AMD A;  1WYK A;  1KLI H;  2XXL A;  3E91 A;  1G3B A;  3M7Q A;  1XM1 A; 
#chains in the Genus database with same CATH homology
 2V7Q D;  2O8M A;  4R8T B;  3M5N A;  3PRD A;  2YOL A;  2WV9 A;  3WWB A;  4K8B A;  1W0K D;  3SZE A;  2K0Q A;  3DSP A;  3KEE A;  3F2G A;  2KM0 A;  2FM2 A;  2WZQ A;  2YMS C;  3RC6 A;  3EYD A;  2IJO B;  5HKK D;  2F4L A;  3SU6 A;  2QF4 A;  2QE7 D;  4B74 A;  5IDK A;  1E1R D;  5EQS A;  4I33 A;  4B71 A;  4B73 A;  4TSF D;  3W1E A;  4OM9 A;  1DY8 A;  4KTC A;  5DSF A;  1CU1 A;  1DXW A;  3OTP A;  3SU2 A;  3KF2 A;  1NBM E;  4B6F A;  3OAA D;  1NS3 A;  2A4G A;  3F0O A;  1H8H D;  4B75 A;  1WXR A;  1NBM D;  2KCA A;  3O8B A;  2GVF A;  4TT3 D;  3SU1 A;  3OYP A;  4U01 A;  2JIZ D;  3PV5 A;  4WH6 A;  2WSS D;  5GND A;  2AHM E;  3OEE D;  1KMH B;  1FX0 B;  5T1V A;  3U1I B;  5CHB A;  2A4R A;  2QV1 A;  3VG8 A;  2VBC A;  3FN8 A;  2OBO A;  5C0U A;  2M2A A;  1E1Q D;  3GS9 A;  4B76 A;  3O8C A;  2OBQ A;  4A1X A;  3F2H A;  4F55 A;  3M5L A;  5EQQ A;  2XCN A;  4B6E A;  2KCP A;  3UB0 A;  4YXW D;  3U1J B;  3M5O A;  1W3C A;  2L6O A;  3OEH D;  3SU3 A;  4A92 A;  1OHH D;  5ESB A;  3F0P A;  5C0T A;  4NWK A;  5C17 A;  2JDI D;  1SKY E;  2LEL A;  3KNX A;  2XCF A;  4Z1M D;  3ZIA D;  3SUD A;  4I32 A;  4XD7 D;  3KN2 A;  3N7E A;  2KFW A;  2OC7 A;  2FOM B;  2P59 A;  1A1R A;  1MAB B;  3OFN D;  3PV2 A;  5GJ4 B;  5H4I B;  2OC1 A;  2IJD 1;  2XOK D;  3SU0 A;  3WW7 A;  2K1Q A;  4A1V A;  3H09 A;  1JXP A;  2YMS B;  3M5M A;  3PRB A;  2KCO A;  4NWL A;  3E90 B;  4I31 A;  4WH8 A;  5EPN A;  2HLD D;  2J5U A;  2GGV B;  3F2F A;  2CK3 D;  3FO8 D;  5CDF E;  3SV6 A;  5FPT A;  2W6J D;  5IK2 D;  2F9V A;  4DT4 A;  5FPS A;  3WWF A;  2XNI A;  2YMS D;  3RC5 A;  3O8R A;  3SUE A;  2WHX A;  5B6L A;  4A1T A;  1EFR D;  3OE7 D;  3SUG A;  1RTL A;  2KR7 A;  4Q63 A;  3P8O A;  4RI0 A;  3SYJ A;  2FP7 B;  3AK5 A;  4ASU D;  3P8N A;  1DY9 A;  2KZ4 A;  4TYD A;  3FOA A;  2W6I D;  5EPY A;  3RC4 A;  3N7D A;  4FET A;  1W0J D;  3LON A;  5FPY A;  3LOX A;  1RGQ A;  1DXP A;  4WF8 A;  5F53 A;  2KCY A;  2F43 B;  2JJ2 D;  1E79 D;  4M9F A;  1S6L A;  1BMF D;  2XND D;  2JJ1 D;  2OC8 A;  3N99 A;  3FKS D;  3SU4 A;  1N1L A;  3DCL A;  3F3B A;  3LKW A;  3SU5 A;  5EQR A;  2OIN A;  4ZCN A;  3SUF A;  2WPD D;  3DSO A;  2OK5 A;  3SV7 A;  3SV8 A;  2OC0 A;  1COW D;  3L6P A;  2QF5 A;  1BT7 A;  3NRL A;  3O8D A;  5GPI B;  4Q4L A;  1H8E D;  2K8I A;  5ETX A;  5DN6 D;  2F9U A;  3SV9 A;  4JMY A;  2A4Q A;  5FL7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...