5C0XH

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
355
structure length
293
Chain Sequence
SEVITITKRNGAFQNSSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTSSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 70
structure length 293
sequence length 355
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xH01
4TQUS 4G7ZC 1IW7C 4TKOB 1GHKA 1GHJA 1Y8OB 5BN3A 4BA2I 2PCFB 3T56B 3D4RA 1IW7D 1FR3A 3A8JE 1SMYC 2A68C 1Y69U 1VF5C 2B8GA 5A35A 3M85A 1ONLA 2K7VA 5K36H 3W3AA 2JEBI 2KA7A 2QF7A 2EDGA 1HPCA 2D5DA 1B9MA 3QJYA 2DN8A 1DCZA 4LK1C 2K32A 2NN6G 2LMCB 1Z7TA 1HCZA 3OOCA 1Y8PB 3CRKC 1H9SA 4H13C 1GUGA 2AWOA 2O5JC 4GZYC 1GJXA 1GUOA 1LABA 3A8IE 1IYUA 3LWUA 2YYZA 3QIAA 4DK0A 4IFDH 2A6EC 2A69D 3I73A 3PUWA 2BA1A 3VR5A 2PNRC 2JXMB 2KCCA 2L5TA 3PV0A 1Z6HA 3VR4A 2PPBC 1TU2B 5K36G 5KNBA 1DXMA 5BN4A 5JEAH 1OXVA 4L8JA 4KN4C 4XTCS 1FYCA 3IKJA 3ND9A 2D62A 2E74C 3H94A 1GUTA 3I4LA 3N6RA 1H9SB 3RLFA 1VDZA 3GQBA 3GD7A 3OPOA 1ZYRC 3QG1A 4I7ZC 3T51B 1Q1BA 1Q90A 2D2CC 3FMCA 2IT1A 3LNNA 1A6XA 3L7ZC 5C0XH 1QJOA 3A7LA 3MXUA 1HQMC 1O78A 4PV1C 4DNRB 1OXSC 2A6HC 2DNEA 1OXUA 2EJFC 1K8OA 1V43A 4H44C 1Q1EA 4OGQC 3P20A 4G7OC 5C0XG 1IYVA 3FPPA 3VA7A 2NN6I 4RCNA 2BE5C 4G7HC 3BG3A 2V4DA 3PUXA 3KLRA 1PMRA 2O5IC 1E2ZA 3M7NA 4OO1G 2B8FA 3VR3A 3BDOA 1Q12A 1ZKOA 2AUKA 1O7LA 2ZT9C 1BDOA 2BE5D 1E2VA 2EJGC 1CTMA 2F1MA 2K33A 5JEAG 1E2WA 3M4YA 2E76C 1YNNC 4H0LC 2Q8IB 2JE6I 1CI3M 4JBWA 4KHZA 5KNDA 2EVBA 3A8KE 3PUZA 4KN7C 1OXTA 1DD2A 2A69C 3HGBA 3NE5B 4OO1H 2R6GA 1I6VC 3DXJC 2DNCA 1OXXK 3EQLC 3PUYA 3U9SA 1GUNA 1EWHA 4DK1A 1B9NA 4KKSA 3PUVA 3T53B 3AB9A 2A6HD 3WDNA 1TKWB 4BA1I 2CW0C 2A6ED 3VR6A 2BDOA 1T5EA 1H9MA 3MFYA 1LACA 3D31A 4HR7B 1Y8NB 4JK1C 3VR2A 1V8QA 3TZUA 4XIGS 1CFMA 1GUSA 1H9RA 1H9KA 2AUJD 4KI0A 1G291 4KKUA 3SE0A 4KKTA 2E75C 1K8MA 4IFDG 1H9JA 1VF7A 2BA0A 5BN5A 3SDZA 3OW7A 3A7AB 4LJZC 1HTPA 2EJMA 4KMUC 1VCIA 2NN6H 1YNJC 3CRLC 3I72A 3IFTA 4DNTB 3ND8A 5KNCA 4IQZA 2JEAI 2A68D
chains in the Genus database with same CATH superfamily
4C3JB 1EQVA 4HSPA 4PQXA 3T13A 5CBAE 5BN3A 3KLWA 1PFNA 5IYCH 1EFID 1GOZA 2IJ0A 1LT4D 3Q8DA 3PO2G 2K01A 2Q2IA 1K8GA 1MD2D 1I3QH 3SK8A 2YTXA 4N9PA 2K32A 2LMCB 2KEDA 3HOUG 3JAME 4ODGA 1EY8A 4DV6Q 1F77A 4DK6C 4DV4L 1STAA 1M1KC 1HXYD 2KCCA 3NTIA 3HFZB 1EIYB 5CV6A 1DXMA 1YI2A 5C3EG 2KCTA 3WOFA 1O80A 4A3IH 2I46A 1QZGA 3M7GA 3K5NA 2RDHA 4A3BG 4IOCA 1YBYA 3U4ZA 3I4MG 2JA5G 1ZYRD 3C1EA 1XMOQ 2M2LA 2B3GA 5EPLA 1TVXA 1A63A 5C6AA 5M9OA 2E2DC 4DGZA 1C7YA 1STYA 2BE5C 3S14B 2V4DA 3J81E 1TY0A 4KD4A 3GTOH 3TN2A 2MO1A 3S2HH 1W3SA 4BY1B 1XNRQ 4LUVA 1BDOA 2Q2TA 4AIMA 5JEAG 1I4GA 1Q46A 1YNNC 2Q8IB 1CI3M 3NHHA 4A3FB 1DD2A 2R6GA 3HOYG 4BY1G 2JA8B 3J7YW 5IGCA 1DONA 2JSOA 2WB1G 2KHJA 4GKKL 4A3GH 1LO5D 4R4CA 2FXQA 1NJIC 4X65L 4X65Q 4DV7L 1Y8NB 1ET9A 4JK1C 1V8QA 3IRBA 1QCBD 5FLMH 1S72A 4ZQ3A 4XDXA 4A3MB 4K6LA 4A3MH 3SDZA 1VMCA 4OWWB 3K81C 4DAYA 4DR6Q 4IOAA 1LTRD 2PZWA 1AEXA 2VUMH 2NN6H 2LXJA 4KJNA 1HUNA 1QWYA 2F0TA 3QR8A 2EOTA 3KF6B 1GHJA 1GHKA 1LTAD 2ZXOA 2RDGA 4DV1L 1L0WA 3SK5A 3ERSX 4PG3A 3M85A 4Y52H 1HNZL 3BU2A 2SOBA 5LMNL 4DV5L 1HA5A 1NSNS 3CC7A 1HQRD 4A3BB 3CQZH 4CJ1B 1JMCA 2QA4A 1I50H 3CC4A 2DJGC 1D2BA 4C3HB 1FNWA 3A8IE 2F0FA 3QIAA 5FLXL 4OEMB 3C46A 4A3EH 2BA1A 1YHBA 4DR7L 3MC0B 2J4XA 4PNYA 4APVA 5GAGC 4LF8Q 3S1RB 1JCKB 4DR5Q 3QO2A 4KD3A 4HJ9A 2OEOA 1VDZA 4HCEA 3CCVA 1D7QA 4X3UA 4A3FG 3U58A 4FF1A 1FNUA 3MXUA 1SNMA 4QMGA 5IYDG 3OHXC 3M4QA 3RLNA 3UDGA 2QILA 2H4OA 4FF2A 1B50A 4G7OC 1G51A 2FHTA 3I3CA 1BO0A 5E4XA 4DNIA 1ILPA 4F7XA 1YEZA 4G4KA 3I90A 4EVOA 2MNAA 4FO2A 5M3MB 1TWHH 5IT9E 2EJGC 2IW3A 3M9BA 4PZ8A 4LF4L 1PTOD 3GTMB 2VB3X 3S24A 1F9SA 5ELBA 1G6PA 2B2VC 1D6EC 3FEWX 4OO1H 1TS4A 5C3EB 3DXJC 3TEHB 1GKHA 4IJHA 3RN5A 3HOVH 3PUYA 3BYTB 1KLUD 5IODA 3GTOB 2EYFA 2DGYA 3PUVA 2R7FA 3AB9A 2VB2X 5IGDA 2A6ED 3H3VC 1YHAA 3DWQA 4F87A 5E3FA 4C2MH 5FKAC 2VNUD 4RCOA 5LHY1 2B63H 3NEMA 1S5CD 3OW7A 2X69A 1WVLA 1JICA 2HQLA 3R2TA 4GNXC 3E9HA 1YNJC 4HSVA 2AHOB 4RMFA 5C44G 5J3BA 1W6JA 2RSNA 1L1OC 2PCFB 1BCPD 3F2CA 2Z1CA 1BBUA 3JAMc 4ZYSA 3J80c 1EIGA 1NNXA 3RZDB 2OQ0A 3CW2C 1R4PB 3UDIA 5A35A 4CDFC 3PIO3 1VQGA 5JJLA 1SE3A 2OQKA 1VQOA 4B3ML 1HPCA 4K5XA 5IP9G 5JOBA 3I4OA 3TMEA 3DUZA 3EVQA 3CRKC 3BVGA 4GZYC 2Q8RE 2X6LA 4JG2A 5IGGA 4Q5VA 4TSSA 4LF6L 4LF6Q 1SMXA 1SE4A 5K36G 5G3LD 2PO4A 4UDUC 1X6OA 3H09A 2UUCQ 1FYCA 2QGQA 4ILWA 4J15A 1EY0A 4AH6A 2KJXA 3J7AV 1EYAA 2K03A 3MEFA 3FMCA 1X3QA 1F2YA 4OWXB 4Q0FA 3SGIA 1U5KA 1WTRA 2TSSA 3HOYB 4Y7NH 3S9WA 2KEEA 4DUYL 3J81L 1N9WA 4H44C 1Q1EA 3HOXH 4ME5A 3FPPA 4CJ2C 3K5LA 3NP8A 4B3MQ 5C4XG 1Z9FA 1K3RA 1EYCA 1X3PA 1B53A 4RHRA 3S17H 5KEEA 1QVCA 1J8IA 5IGEA 5LMNQ 2WFWA 1ET6A 1O7ZA 4M1UB 2XIWA 3A56A 5C4XH 5BR8L 2P5ZX 5M5YH 3EQLC 4JV5Q 1EWHA 1L0YB 5C5LA 3D6WA 3FKIG 2ZXPA 1TS3A 2F0QA 4LUZA 3RZDH 3PO3H 3T1YL 1BCPC 1X32A 1JB7A 3Q0AA 1VQEA 4XIGS 1H9RA 1PH8A 2L11A 4GOPC 1SRUA 2BA0A 3HKSA 3Q22A 1HZAA 5LL6X 2F0JA 2YTVA 2K5QA 1RL2A 3F8TA 4AYBB 1BCPB 2NTTA 3PIP3 4DV2Q 4TQUS 2NZOA 1IW7C 1KLGD 2EQSA 2XWJB 3K5OA 2F3VA 5EPKA 3X3MA 1LTTD 1EU4A 5I6YA 4DV3Q 1N32L 5KIXA 2F0MA 3PCOB 3U50C 4JI3Q 2PYKA 2JEBI 4DAYB 4KTAA 4FYDA 4EQOA 1IKMA 4H13C 4YWMA 5BR8Q 4DR1Q 1WOCA 3ONAB 4K5VA 2PQAA 2K04A 3GDEA 2UXBL 3NUCA 4JI6Q 1B3QA 4FDBA 3H3VH 1AN8A 5BN4A 4ID6A 5CC4A 1PTOF 1FGUA 1K28A 4JBJA 3TP5A 1OO9B 3N6RA 2JYOA 1PZJD 4NPSA 2XSCA 5LL6S 4H02A 4A3JG 1VQLA 5IT9c 2VQEL 3L7ZC 5LMUQ 1L2FA 1O78A 4GNXA 2HIVA 3MXNA 5DAUA 1HFGA 1SDFA 2F4VL 3I4MH 2Z6KA 2F4VQ 1CQVA 1U0LA 2XWBB 3IAYA 3TBIB 1E2ZA 3FKIH 1KC8C 1VS0A 1D1IA 3KBXA 3M4OH 2L15A 2D9UA 2F0UA 2BE5D 3CC2A 3DWPA 3EJIA 2NWGA 4IPGA 4BWGB 5FOBB 4KLKA 3J7A5 2IWHA 1QZHA 2ICEC 4OWTB 3HOXB 4U68A 1UEAB 3ICEA 1Y1VB 1GUWA 5K5PA 1EY9A 4K5WA 1JB3A 1BKBA 1LM0A 2XRQD 3NENA 3URYA 1CHPD 1XXGA 4WJ3M 1PTOC 4JC0A 2WIIB 2OF1A 1YNXA 2IPKD 2I5MX 1FGBD 2RBMA 3GTGB 4P75A 3C1FA 4B3TQ 3GTPB 4LJZC 3MXGA 3PO2B 5CMDA 3GTPH 1K8AC 4KMUC 1ESRA 4RA8A 1X3EA 3PF5A 2JA7B 3ND8A 1TWGH 5D3DA 1N34Q 1E24A 2VQEQ 3A8JE 4A93B 1SMYC 1LTBD 4HAEA 4N9TA 4FNFA 5M5WB 1XMOL 5ELOA 1LTGD 2CW0D 3QB3A 3GV3A 4C3HG 2JA7G 1IBLL 4R4TA 2VUMB 1BUVT 2D5DA 4P72A 4A3JB 4A3KG 4RKBA 4XXEA 1CA5A 2CVRA 1QNKA 1WI5A 4LFAQ 5FLMG 1JJGA 1HCZA 1LT3D 2RVLA 3K7AH 1GJXA 1T9HA 2D0OA 3S16B 1GUOA 3KF8B 2CH4A 3OMGA 2ICIA 4LFBQ 1VMPA 5C4HA 1PH1A 2MUYA 2R7ZH 3PV0A 4XT1B 4A3LG 2CH4W 4YY3Q 3D3RA 4V190 4YWLA 2GA4B 5CBEE 4L5RC 1Q7YC 1J9OA 2GVBA 1H9SB 4MN3A 2ZTCA 2EZVA 1MSGA 3AEVA 3N52A 1J6QA 1KDAA 1KL9A 1QB5D 3TP8A 4B3TL 5CV9A 1HQMC 1PA6A 2LSSA 3TS0A 5JJIA 3CCLA 3CHBD 5ELCA 2CQOA 1Y1WH 3A5ZB 3BVZA 4WORA 3VA7A 5C4JH 2B29A 3MAQA 1RF2D 5KRUA 2IX1A 2AUKA 2IX3A 2KVMA 2DUDA 3SR1A 2B63G 3UDFA 5M3FH 1E2WA 1D1KA 2K75A 5CV8A 1C9OA 1GO3E 2UU9L 1E0BA 4CBVA 1G2TA 2RA4A 2VS1A 3FPUB 3TS2A 1A3TA 1D8LA 3A74A 4TRDA 3U9SA 1WYDA 3NTKA 4DK1A 1SBBB 3D6CA 4CJ0B 1VQ5A 4KKSA 1NE3A 4H7BA 2KBNA 3J81c 1VQAA 2JA6H 4DR2L 4EQPA 3H0GH 4HJ7A 1G2SA 3BZKA 1HZBA 3F2DA 4KKTA 5C3EH 1WTPA 4FF4A 4DXGA 3MXPA 3L2PA 1WTWA 1EY6A 5GAEC 4JI7L 1F9QA 1D5XC 4LMQD 2A68D 3GTQH 2XNAC 3V96A 2E2JB 2J0TD 2CWPA 3KYHC 4ZK9B 2JA8H 3KOJA 1WTHA 2JA8G 2N8NA 2OTLA 4B9WA 4FVMA 1SEBD 2QW7A 5DEHA 4QL5A 1B9MA 3PO2H 3J7ZC 1E22A 1HUMA 3GO5A 4M8AA 3J80i 5IYCG 4L5SA 3DEPA 1T5XD 1TWHB 3GTLB 4XQQA 1IYUA 3NSWA 3OWEB 3VYRA 1SYFA 1L1OA 1QUQA 3OYYA 2WAQG 4ZKBB 3H0GG 4CDEC 3HOWH 3BS1A 4XTCS 2KCMA 4HIKA 3NQTA 4BY7H 2XVSA 3LX0A 3MHBA 5KYLA 1XNQL 2QKIC 3DM1A 1EWCA 5EAYA 3TP6A 5IY0A 1KTKA 1W6KA 2DNEA 4LF9Q 1K8OA 5EJWA 1SFOB 4QQBX 4OXPA 4NB3A 1PTOB 5I9PA 2L9HA 1N33L 1D5MC 3H0GB 1S4ZA 3FHWA 4JI3L 1TQOA 3DLLA 2O2LD 2F03A 5DM73 2YV5A 1Y14B 1Q81C 1EY5A 1WTVA 1LT5D 2XN9C 2VY3A 1HNXQ 2FJ2A 3KLSX 4Z9CB 2F0NA 4J6HA 1TS5A 3GTQB 3T4AC 3T53B 1CUKA 2Q2HA 2HUGA 1HH2P 1A2UA 4BA1I 4LF7Q 3HG9A 2BDOA 4C1NI 1F2LA 3K59A 1RCVD 3W5OA 4JCVE 4L6TB 1B4OA 4K2KA 1VQHA 4C1NK 2GN5A 1GD7A 1LUZA 2WP8J 3TZDA 1HR0L 1JJ2A 4BBRH 2EY1A 1Q8IA 1RODA 3HZXA 3PF4A 1SNPA 2LS01 2RF4A 4KY6A 3ERQA 3SK4A 2KHIA 1WD1A 5EKIA 1P8LA 4ZUJA 1XNQQ 4YCWA 4ZCKA 4BA2I 3T56B 1VQKA 2LXKA 2H1EA 4C3HH 5HGQA 1NTGA 2WB1B 1EL0A 1VQ9A 3WOEA 2QF7A 2I07B 1DCZA 4FXGC 4YHHQ 4FXKC 2NZ1D 1JT8A 3EA6A 2ES2A 3F2BA 2Q2UA 1YZ6A 2UUBQ 5C4XB 4KK7A 2JQOA 3GTGH 3ULJA 1B7YB 4HCSA 5IIFA 2E74C 5C44B 2ZM6Q 2RDFA 2B2WC 4P73A 1KAWA 3T51B 5FO8B 4A76A 2NTSA 1K83B 3DMUA 3I56A 3GTMH 1SYEA 4L63B 1BQQT 2UXCL 4RGNA 5IOCA 5CORA 1RIPA 1DOLA 4IPCA 2EY6A 1JWSD 3BG3A 1X3FA 4G7HC 1MSHA 4JOIC 5M3FB 1B44D 3AQQA 1C8CA 2JJQA 4XYOA 1HA6A 2K33A 4B3RQ 2JA9A 5I2YA 4OELB 2YTYA 4BBRB 4X6AH 3P7JA 3NE5B 1K0SA 5J22A 4A3DH 4HN7A 1GUNA 5A2QL 4UP8A 4DUZL 4DV6L 3K7UC 2E2IH 3KDFB 2BOSA 2Y0SG 1U9RA 1TKWB 2B2UC 2WINB 2C35B 2OT2A 1PH2A 1AW7A 4JI8Q 2E5LQ 3K8AA 1PH6A 1ENAA 4DAPA 3KJOA 3A7AB 1CKNA 3NXWA 4JOIA 3J81i 2R7ZG 4ZAIA 2Z4IA 1SXTA 3E0EA 3S1MB 2O4XA 3NQIA 2Y0SB 1M90C 3CU7A 1YJWA 2HIXA 1Y69U 1SE8A 2MHVA 1PYWD 3FDTA 3H91A 2XGTA 1QUQB 1JOKA 2F0DA 3W3AA 2B2WA 1TY2A 5M3MH 4GKJQ 2JA7H 2EY2A 3NWSA 3FKIB 2PMZE 3H15A 4GLXA 1II3A 1VQFA 1X9NA 5T1IA 3OOCA 1DYQA 3J80E 3E5SA 1MJEA 2ZTEA 2G5DA 4QY7A 1W2BA 3KLSA 1BF4A 3GTKH 1K3BC 2A73B 3ZYYX 3OW2A 2KENA 4DPGA 5FLXE 4A93G 3T16A 4DXFA 1XX8A 1EU3A 1A2TA 4U673 1L1OB 4QIWB 1SR3A 1STHA 3ND9A 1PH9A 4J1MA 3H94A 1GUTA 3I4LA 3K7AB 3C3LA 2E5LL 1PDQA 5C0XJ 1E1TA 1X56A 1E3PA 1N34L 1MJCA 1Q90A 3VA5A 4C2MB 1VQ6A 3LNNA 1UE6A 4A3DB 3HOXG 2Z6BA 2R61A 5DM63 3CMAA 3UE1A 1PRTD 2WV6D 2B63B 4ZLTF 4DV2L 1RJTA 3SVMA 1SYGA 1BXTA 4LFCL 1Q12A 4HJ8A 1EEFD 1A62A 2AMCB 2RQXA 4BXXH 3HS0C 1QVFA 4ULLA 1SN8A 1PH4A 3W1GA 1Y1WB 2A69C 4L5TA 1ZXTA 2MQHA 3FP9A 1EY4A 1N36L 3Q6SA 4QUCA 2WACA 2R92G 3KFUA 4A3CG 3HOWB 3HKZE 2OTJA 2B39A 1SE2A 2UUBL 2CW0C 1MHWC 1T5EA 1LACA 1D5ZC 1KD1C 2RKSA 1SYBA 1CHQD 1GUSA 2AUJD 3BVMA 1G291 3S16H 3CAMA 4JI2Q 2VUMG 1TWFH 2NYZD 5CV7A 3BZCA 4GN5A 1R4QB 1PHJA 5CGKA 3ZJYC 1EEID 2QEJC 4JI1L 1B3AA 2XRSD 3IFTA 4JI1Q 2A8VA 3PSIA 1XPUA 4QGUA 4V0BA 2RHSB 1IW7D 1FR3A 3D4RA 4YHHL 4I7AA 4C3IG 1IBKL 4JPBW 2Q8TA 4DR1L 2R93H 1XMQQ 4WJWA 4EQ5A 4LK1C 1PRTC 2F0KA 1QOHA 1HZCA 1TWAB 1N36Q 4JBMA 2YYZA 3T1HL 1VQJA 1FNVA 1F2MA 2NVYH 4LF7L 4RFBA 1A15A 2L5TA 3VR4A 2F52A 2G9HD 1WJJA 2ZJRA 1VQMA 2NB0A 1Q86C 3NTHA 3IKJA 2L1BA 5JPMC 1PFSA 2X6GA 3SK6A 1VQCA 1I6HH 1TR5A 1PXUA 3QG1A 4I7ZC 3OIQA 1Q1BA 1CSPA 3D8GA 4LUOA 3I8ZA 4A3BH 4OHJA 1NUCA 4PV1C 2QDBA 1I94Q 1OXUA 3G7LA 4IN3A 5I2XA 4N8X1 1PRTF 1XWEA 1J5EL 2O5IC 5M5XB 1N33Q 1FJGL 2VZAA 1NMGA 2EYOA 4PZ7A 2R7DA 1CT1D 3I2ZA 4UHVA 3I70A 3Q24A 4MZ9A 3RR5A 4KHZA 3G71A 1YNND 4HTHA 2UXDL 2NVTB 3P75A 4IUPA 3P1HA 2QCPX 1TXYA 1HHVA 2PI2A 3X3NA 1PYBA 3AFQA 4NXNL 2UXBQ 3W2DA 2L0CA 4NXNQ 3OIPA 2JA5B 2IL8A 4OL7A 1I3QB 3T1HQ 2C5CA 5C4JB 4KI0A 3SE0A 3CPFA 3SEBA 3CD6A 4BBRG 4A75A 4X62L 3S1NB 2KCNA 1TWAH 2F4IA 3NELA 4DUYQ 1BCPF 4DNTB 3CRLC 5NUCA 4RGTA 3EROA 1QILA 3K0XA 1QG7A 3BYYB 2BCOA 1JOQA 1HNWL 3V05A 1HNWQ 5GQOA 4O2DA 5IP9H 3ITPA 1SFOH 4PZ6A 2EPBA 2R92B 1ONLA 2IX0A 1PH3A 3DHQA 2KA7A 4DFAA 2K05A 2EDGA 4R4IA 4HIDA 3S2DH 3L9AX 2DN8A 2L12A 1PFMA 2NN6G 4A3GG 2XTIA 1G6ZA 1VQDA 1Y8PB 4JI6L 5HGTA 1GUGA 3BDLA 4UY8C 3NPPA 4RGMA 1YJNA 1Z47A 4A3EB 2IHEA 1IL2A 2L4NA 2LY7A 3CKIB 4A3MG 4LFBL 1KABA 3I73A 3PMFA 3HOYH 4HJ5A 1ICFB 2PZUA 4KJOA 4BBSG 1SNDA 4F88A 4O42A 4HEDA 4NKLA 2R93G 3VDYA 3M4PA 1CZWA 3MA2B 1B70B 4N8FA 4LF5Q 5JEAH 4L8JA 5DNFA 4LF5L 2K14A 2OXPA 1A3VA 1S3OA 3GD7A 2AQ1B 2DY7A 3G48A 4X66L 1IHZA 3G4SA 4DR2Q 1A6XA 1QJOA 4DNRB 3OTOQ 2KQ3A 4IUNA 2KUMA 1XNRL 1GXDC 3NBHB 1NMFA 5D3IB 3BJUA 4GS3A 5JEAJ 1IYVA 1WCMG 4WRDA 1PYSB 4BBSB 4OO1G 1DJRD 3PUXA 4P71A 2MPMA 2B8FA 3BDOA 1CQFA 2H5XA 1QVGA 4CHTB 1NCVA 4J8QA 1EY7A 2F1MA 4IZ8A 2N49A 1SJED 3GV6A 2K1BA 4NXMQ 4EGVA 3J80L 5TSSA 3S1NH 1OTCA 2WKDA 5JJZA 4KN7C 2ZXRA 5JVH3 3EFXD 3QOLA 2K52A 4R4QA 5COYA 3S14H 5M5XH 2RSOA 2ASBA 5I9OA 3CPWA 1WTXA 1EYGA 2BH2A 2A6HD 2EIFA 3KBGA 3RZOB 1UUPA 3MFYA 5DLQE 5FJ8H 1TWFB 2RHQB 3CCRA 2E75C 5IP7G 1VF7A 1I50B 3VYUA 1A0IA 3CCSA 1RHPA 4OX9Q 2E2IB 4JW0A 4E6IA 2DY8A 2D0PA 1AZPA 1STNA 3U9OA 3A55A 4DA2A 1FL0A 5KNCA 2JEAI 3HP3A 4IJLA 1UNSA 3H6MA 2DJFC 4NW2A 2E8GA 3VYSA 1U4PA 5FLXc 2WAQE 3AYHB 1PVOA 1RDPD 1CKOA 3FVQA 5FJ8G 1LYLA 4XT3B 3E0JA 5D14A 2V1CC 1A8VA 1S5ED 5C5MA 1Q3LA 2J7ZA 3T1YQ 2AWOA 4K8JA 3HRZC 3TP7A 3LWUA 1LABA 4CKCA 2MO0A 2A6EC 4GLVB 1IZ6A 4MHEA 2E2HB 2JXMB 3K57A 1CSQA 2KECA 5L37A 4G57A 1HR0Q 3PIOA 3SHLA 4B3SL 2RCNA 5CV5A 4KN4C 4B08A 3QOJA 4RWSC 4IPDA 1ZEQX 5IE8A 3PIPA 1KDCA 1S5FD 2NBFA 5M3FG 5C0XH 4RH6A 1LTSD 4FP5D 5JPNC 1TS2A 1I5FA 4JI4Q 1AFPA 3NK9A 1FVIA 5E4WC 4OIJA 2F0HA 4IURA 1X65A 3CXCA 1QE6A 4BY1H 1HJPA 3OMCA 4NP5A 1ENFA 1Y1WG 1STBA 1F9RA 1ZKOA 2LKVA 3S1MH 5LMNW 4JI5Q 1CTMA 2BDNA 1UWVA 1Y1VG 1RKNA 4NDXA 2NVQH 1XPOA 4POFA 2JE6I 4YWKA 1MIUA 3A8KE 3PUZA 1KRSA 4QB4A 2HT1A 2ZM6L 4IALA 5EBCA 3I4NH 3CF5A 4YCUA 2F0GA 2JA5H 3PQIA 1CKMA 1YVCA 3WDNA 4IFDI 1X3GA 4A3IB 1C4QA 4X62Q 1PZID 1EOVA 3R3OA 2IY5B 4RHSA 2JA6B 1H9KA 2Z0SA 1WCMB 1TWCB 3KUPA 4KKUA 2F0LA 4QCLA 3K6OA 1EQQA 5LMUL 2F0EA 1DOKA 3O13A 3CCJA 3OSOA 4JI4L 3OWFA 1HNZQ 1KNEA 3TSSA 3J7AF 4B3RL 4G7ZC 3S15B 2NUCA 2Z9HA 3K80C 2A68C 4QJFA 3PGZA 1VQ4A 4DAVA 1YIJA 1WD0A 1PTOH 4RG1A 2K50A 2G9DA 1HRJA 3M3YH 4CKBA 5HURA 1XMQL 4K0KL 1AE2A 1Z7TA 3UE0A 2N88A 1LTLA 1IBKQ 4DK0A 1E1OA 4IFDH 1K83H 3GTLH 4KHVA 2VL6A 1A3UA 4PMBA 4IUVA 5AFWA 4JV5L 2ATWA 3K0YA 4DUZQ 1LLRD 1PRTB 2D62A 3KF6A 5CYUA 5C4ZA 1U4MA 3MTSA 1SSOA 5C3WA 1KAAA 3GQBA 5JJKA 2MFIA 4ABNA 1IBMQ 2D2CC 3J81j 4A3JH 3C2PA 1X55A 1XJVA 4FXDA 2EXDA 3E6ZX 1PH5A 1GVPA 1NR4A 1V43A 4NXML 2NN6I 5FO9B 4IUUA 1DM0B 3VYTA 5IYBH 1ML0D 1AH9A 2ZT9C 3RUZA 4K8IA 4CKEA 1JWUD 2N78A 1YHQA 5GAHC 3STBD 2IHFA 2B2VA 4JBWA 3CCEA 4GN3B 2EVBA 1JR0D 1MI2A 1V1PA 5HY6A 4DK3C 4DU9A 2F0WA 2DNCA 2MP1A 1R9TH 4GKJL 3S15H 1R9TB 3HKZG 1S5DD 4EX5A 1KQSA 1QNUA 5JVG3 2QDLA 3K58A 1FD7D 1JOOA 4IUTA 1RTOA 5AJ3Q 2EYLA 3D31A 2B2TC 2E2JH 1ICWA 1CK1A 1M8AA 1K73C 4JI2L 2Z4HA 3DWAA 2NVTH 1RTNA 3LGJA 3UDXA 1AP0A 1K8MA 2N55A 3TRZA 2UUAL 4CDDC 4C56C 4C3IB 1ENCA 1SJHD 1AZQA 3D0FA 4IQZA 2K6AA 3HKZB 1HFNA 1EZ6A 3KDFA 4BY7G 3RD4A 1DZ1A 4DR6L 4DN4M 2CKZB 2F3WA 5J1ZA 5CV4A 3MWYW 2SNMA 1UAPA 2ZJPA 4KHPQ 1BBXC 1IBLQ 3V2TA 1WFQA 1AE3A 1EFWA 1NY4A 1CA6A 2UU9Q 2WAQB 2B2UA 4A4IA 5EKKA 2CQAA 4L5QA 3JAMi 3MZ5A 2B2TA 4LWCA 1SYCA 2HD3A 4ME3A 3PO3G 2VXWA 1EWIA 4B9XA 2A69D 2Z6KC 2KHSA 4R8IA 4R1JA 1ESFA 2R7ZB 5EGTA 2WKCA 4JI7Q 4X3SA 2AKWB 2SEBD 1NBWA 4LAAA 1JE5A 1HTLD 1MKHA 2F0PA 4A3GB 4QIWE 3G6JB 3F2UA 3A7LA 4IUQA 3HOZG 4DAMA 3JC66 3CMEA 3ULLA 3S17B 4A3KB 3KLRA 4KY7A 4LNQA 5ELEA 4DR3L 2A19A 1FJGQ 2JA6G 4QUFA 2PMZB 4NMZA 1DGSA 1ILQA 3JAML 2SDFA 3I4MB 4YIJA 3I4NB 4DR5L 3RNUA 1HR0W 4LF4Q 1B9NA 1V1OA 2HDMA 4IFDJ 1I6HB 1KIXA 4QF4A 5C0XI 3W1BA 2JP1A 5M3MG 5IWAL 1WCMH 4OONA 4IPHA 5FO7B 2K4KA 2K5VA 3TZUA 5T1GA 1EZ8A 4MNOA 4GOPA 2HDLA 1H9JA 2A1AA 3IFDA 3GTJH 3S2HB 2N3SA 2ID0A 4IO9A 5G3LF 4MIUA 1HTPA 1M4VA 2QEXA 1SLJA 1KNAA 1VCIA 3S1RH 1I94L 2EXZA 1C48A 1EQTA 4HJAA 4CDCC 1Y8OB 2M9VA 2K5WA 2K28A 2ZTDA 2PW5A 4R8NA 3A5UA 1VQ8A 2F0SA 2MJ8A 5GADC 5ELFA 4ALPA 2A74C 2K7VA 3CCQA 4A3LH 1SROA 5J39A 4GN4B 3HOVG 4DV5Q 4C3IH 3HEJA 1MGSA 1TIID 3QJYA 1JC7A 1HNXL 2EYPA 2O5JC 1C0AA 4DKAC 3AFPA 4A3KH 4EQNA 3VR5A 1F2ZA 2HCIA 3A54A 2PNRC 1Q82C 1TWCH 2R3ZA 1UE7A 4X3TA 1E7ZA 1F9PA 3HOVB 1KHIA 3WWVA 5IYDH 1ZYRC 4X66Q 4BY7B 1EUJA 5F2DA 4DV7Q 2ALYB 1SAPA 3RZOH 1OXSC 3EBEA 2YU9H 1KRTA 3HOZH 2GVAA 4X64L 2R92H 3P20A 4KY5A 1I4HA 1I4RA 3M4OB 4RCNA 1STEA 4YCVA 4AQYQ 2K5HA 1O7LA 4DV1Q 2UXCQ 1E2VA 3R8BA 4A3EG 3BDCA 4DR4Q 1VQNA 2F0IA 1UEBA 1PV4A 5E7NA 2HHHL 1KDBA 3IL8A 2WB1E 2C9OA 2R93B 3NWTA 3R2IA 3HGBA 4K14A 1GM5A 4P2CB 5IWAQ 2F3IA 3QWNA 1ASZA 1B1ZA 2EY5A 3Q23A 4XQNA 1K9MC 1BOSA 4P74A 5A2QE 5EBDA 1WTOA 1JJCB 4RKLA 3L3OC 4JBKA 2LFNA 4HR7B 2NVXH 4ZUIA 5EKLA 3DM3A 5CR3A 1WTQA 2NVXB 1VQBA 2A5HA 1S5BD 2F0VA 1V9PA 5BN5A 2PZTA 2E2HH 3B6YA 4O0AA 3KJPA 4F8MA 2KOLA 4ZRZA 3H3VI 3PO3B 1MBYA 1SMYD 2VQFQ 2JK8A 2SNSA 1B8AA 4UP9A 4R9WA 4TKOB 5M5WH 1YITA 1VF5C 1XTDA 2K5DA 4JI5L 5C3XA 3I4NG 5KGUA 1O7IA 2CCZA 2B2YA 2M00A 2NZHA 5D65A 1BNZA 3D4DA 1Q8KA 2FINB 1XTCD 2EYHA 2CHBD 1U4LA 4YY3L 1H9SA 1LT6D 3HOZB 2Z8LA 5ELNA 2OWOA 3U4VA 3GP7A 2F0OA 2HHHQ 1STGA 4XQJA 1Z6HA 4HIMA 1EYDA 4A3DG 4RGOS 3D4WA 2NVYB 5C44H 3LWEA 1OXVA 1JQYD 2CFMA 4DF7A 3G6EA 1LV9A 4JI0L 3AU7A 1PFBA 4POGA 4JYAL 2IT1A 4LW1A 3OTOL 3CCUA 4OX9L 3FRPB 3NBIA 2FFKB 2EJFC 3EN2A 4WFN3 1G8ZD 4DR4L 3E9IA 1IBML 3GTKB 4AQYL 1N32Q 1B2TA 5IYBG 4X3KA 4A3CH 2TMPA 2UXDQ 1K0RA 2K5NA 5ELDA 1LTID 4AYBE 3HOWG 4KV6A 1I4XA 1NR2A 2OCEA 4A3IG 5KNDA 4S3SA 2HCCA 2CWAA 4A3FH 4WJ4A 3CP0A 3TDQA 4DV0L 3ER0A 3L0OA 2PQEA 4K0KQ 4DR7Q 1EIHA 4GLAC 3VR6A 4PMWA 3I91A 3MVVA 3MFGA 4Y7NB 3HOUB 3VR2A 1PLFA 4CGYB 3HOUH 2B2YC 1CFMA 1NAPA 3GTJB 1G91A 1O7YA 4BXXG 5I6WA 4IFDG 4HMIA 4JI0Q 3RLOA 1IYJB 2I0QA 5FK9C 1P16A 2EJMA 2BH8A 1VQIA 4B3SQ 5KYIA 2UUCL 5IP7H 3I72A 5ISRA 1IL8A 1SNQA 1I4PA 5I4DA 1CM9A 5H1SE 4DV3L 3DEOA 5E1FA 4DR3Q 5M5YB 2MGSA 2B8GA 1UE5A 1H95A 5JAVA 4GNXB 5K36H 2AQ2B 2VW9A 4K6DA 1PH7A 1CZGA 4OO1I 1XYIA 1KXLA 2PI2E 2PW7A 4UP7A 2PNHA 4RAUC 1L0XB 5IGFA 1X54A 2Y0SE 3RN2A 1U4RA 3E3XA 3CQZB 4A93H 4AYBG 1IKLA 3KK7A 3PUWA 5IT9L 1CKNB 1YNJD 4C3JH 2EYMA 2RCFA 2AQ3B 1UE1A 3NBHA 4R4OA 2PQAB 2PPBC 4MTNA 2ENBA 1TU2B 3F1ZA 1RD9D 3MXNB 3TREA 5EPJA 5KNBA 5EQ0A 1Y1VH 4DV0Q 5GROA 4LF9L 3RLFA 1N8RC 3OPOA 2UUAQ 4LF8L 4O1NA 1V1PB 2AWNA 2FMCA 1VQ7A 3R93A 3SXHA 1BBWA 3K5MA 1SNOA 2NVQB 2ZJQA 1ASYA 2A6HC 3TQYA 3MEHA 4OGQC 1SNCA 4KHPL 5C0XG 2EYJA 3M3YB 3M7NA 1J5EQ 1PMRA 4UPAA 4LFCQ 3VR3A 5IGBA 4LFAL 3S1QH 3ULPA 4BBSH 1HZ9A 4FF3A 1YJ9A 1BR9A 1TWGB 3S1QB 1V1QA 4K2LA 3BZDB 1BVSA 4BS9A 3M4YA 2E76C 2HQEA 4H0LC 4PMCA 4DV4Q 1OXTA 2FMMA 1VQPA 1PZKD 1EQRA 2I5LX 1I6VC 4GOPB 1OXXK 1I4QA 2EE1A 3RMHA 3UI2A 3CCMA 4C3JG 4GKKQ 4MTKA 3I7FA 1EOTA 1XPRA 5AJ3L 1H9MA 2JN4A 3KF8A 3STBC 1SYDA 4ZKCB 4JI8L 1EIFA 3A0JA 4JVZA 4UAIA 3I55A 2L55A 2I5HA 1DOMA 1TT2A 2VQFL 2YU9B 1JORA 3AMUA 1JWMD 4JYAQ 1IXRA 3EIVA 4XYQA 4OIKA 4TVAB 3S2DB 1S40A 1JE4A 4X64Q 4HIOA 4I65A 4HMJA
chains in the Genus database with same CATH topology
4C3JB 1EQVA 4HSPA 4PQXA 3T13A 5CBAE 5BN3A 1PFNA 1EFID 1GOZA 2IJ0A 1LT4D 2K01A 1MD2D 3SK8A 4N9PA 2K32A 2LMCB 2KEDA 3JAME 4ODGA 1EY8A 1F77A 1STAA 1HXYD 2KCCA 3NTIA 5CV6A 1DXMA 3WOFA 1O80A 2I46A 3M7GA 3K5NA 2RDHA 1ZYRD 3C1EA 2M2LA 5EPLA 1TVXA 5C6AA 5M9OA 2E2DC 4DGZA 1STYA 2BE5C 3S14B 2V4DA 3J81E 1TY0A 4KD4A 3TN2A 4BY1B 1BDOA 5JEAG 1I4GA 1YNNC 2Q8IB 1CI3M 3NHHA 4A3FB 1DD2A 2R6GA 2JA8B 3J7YW 5IGCA 1DONA 2JSOA 1LO5D 1Y8NB 1ET9A 4JK1C 1V8QA 1QCBD 4ZQ3A 4XDXA 4A3MB 4K6LA 3SDZA 1VMCA 4DAYA 1LTRD 2PZWA 1AEXA 2NN6H 4KJNA 1HUNA 1QWYA 2F0TA 2EOTA 1GHKA 1GHJA 1LTAD 2ZXOA 2RDGA 3SK5A 3M85A 2SOBA 1HA5A 1NSNS 1HQRD 4A3BB 4CJ1B 1D2BA 4C3HB 1FNWA 3A8IE 2F0FA 3QIAA 5FLXL 3C46A 2BA1A 3MC0B 2J4XA 4PNYA 3S1RB 1JCKB 3QO2A 4KD3A 2OEOA 1VDZA 4HCEA 4X3UA 4FF1A 1FNUA 3MXUA 1SNMA 4QMGA 3OHXC 2QILA 2H4OA 4FF2A 1B50A 4G7OC 2FHTA 3I3CA 1BO0A 5E4XA 1ILPA 4F7XA 4G4KA 3I90A 4EVOA 4FO2A 5M3MB 5IT9E 2EJGC 2IW3A 1PTOD 3GTMB 2VB3X 1F9SA 5ELBA 2B2VC 1D6EC 3FEWX 4OO1H 1TS4A 5C3EB 3DXJC 3PUYA 3BYTB 1KLUD 3GTOB 5IODA 2EYFA 3PUVA 3AB9A 2VB2X 5IGDA 2A6ED 3H3VC 3DWQA 4F87A 5E3FA 5FKAC 2VNUD 4RCOA 5LHY1 1S5CD 3OW7A 2X69A 1WVLA 1JICA 3R2TA 1YNJC 4HSVA 1W6JA 2RSNA 2PCFB 1BCPD 2Z1CA 4ZYSA 1EIGA 3RZDB 1R4PB 5A35A 3PIO3 1SE3A 1HPCA 4K5XA 5JOBA 3TMEA 3DUZA 3EVQA 3CRKC 3BVGA 4GZYC 2Q8RE 2X6LA 5IGGA 4Q5VA 4TSSA 1SE4A 5K36G 5G3LD 2PO4A 4UDUC 3H09A 1FYCA 4ILWA 1EY0A 2KJXA 3J7AV 1EYAA 2K03A 3FMCA 1X3QA 1F2YA 4Q0FA 1WTRA 2TSSA 3HOYB 3S9WA 2KEEA 3J81L 4H44C 1Q1EA 4ME5A 3FPPA 4CJ2C 3K5LA 3NP8A 1EYCA 1X3PA 1B53A 4RHRA 5KEEA 1J8IA 5IGEA 1ET6A 1O7ZA 4M1UB 2XIWA 3A56A 3EQLC 1EWHA 1L0YB 5C5LA 3D6WA 2ZXPA 1TS3A 2F0QA 1BCPC 1X32A 3Q0AA 4XIGS 1H9RA 2L11A 2BA0A 3Q22A 5LL6X 2F0JA 2K5QA 4AYBB 1BCPB 2NTTA 3PIP3 4TQUS 2XWJB 1IW7C 1KLGD 3K5OA 3X3MA 5EPKA 2F3VA 1LTTD 1EU4A 5I6YA 5KIXA 2F0MA 2PYKA 2JEBI 4KTAA 4FYDA 4EQOA 1IKMA 4H13C 3ONAB 4K5VA 2K04A 3NUCA 1AN8A 5BN4A 4ID6A 5CC4A 1PTOF 3TP5A 1OO9B 3N6RA 2JYOA 1PZJD 2XSCA 5LL6S 3L7ZC 1O78A 3MXNA 5DAUA 1HFGA 1SDFA 1CQVA 2XWBB 3IAYA 3TBIB 1E2ZA 1D1IA 3KBXA 2D9UA 2F0UA 2BE5D 3DWPA 3EJIA 2NWGA 4BWGB 5FOBB 2IWHA 2ICEC 3HOXB 4U68A 1UEAB 1Y1VB 1GUWA 5K5PA 1EY9A 4K5WA 1JB3A 2XRQD 3URYA 1CHPD 1XXGA 1PTOC 2IPKD 2OF1A 2WIIB 1FGBD 2RBMA 3GTGB 3C1FA 3GTPB 4LJZC 3MXGA 3PO2B 5CMDA 1ESRA 4KMUC 4RA8A 2JA7B 3ND8A 5D3DA 4A93B 3A8JE 1SMYC 1LTBD 4HAEA 4N9TA 4FNFA 5M5WB 1LTGD 2CW0D 3QB3A 3GV3A 4C3HG 2VUMB 1BUVT 2D5DA 4A3JB 4RKBA 4XXEA 1CA5A 2CVRA 1QNKA 1HCZA 1LT3D 2RVLA 1GJXA 3S16B 1GUOA 3OMGA 2ICIA 1VMPA 5C4HA 2MUYA 3PV0A 4XT1B 3D3RA 4V190 2GA4B 5CBEE 1J9OA 1H9SB 4MN3A 2EZVA 1MSGA 3N52A 1KDAA 1QB5D 3TP8A 5CV9A 1HQMC 3CHBD 5ELCA 3BVZA 4WORA 3VA7A 3MAQA 1RF2D 5KRUA 2IX1A 2AUKA 2IX3A 2KVMA 3SR1A 1E2WA 1D1KA 5CV8A 1E0BA 4CBVA 1G2TA 2RA4A 3FPUB 1A3TA 4TRDA 3U9SA 3NTKA 4DK1A 1SBBB 3D6CA 4CJ0B 4KKSA 4H7BA 4EQPA 1G2SA 4KKTA 1WTPA 4FF4A 4DXGA 3MXPA 1WTWA 1EY6A 1F9QA 1D5XC 4LMQD 2A68D 2XNAC 3V96A 2E2JB 2J0TD 4ZK9B 4B9WA 4FVMA 1SEBD 5DEHA 1B9MA 1HUMA 3GO5A 4M8AA 3DEPA 1T5XD 1TWHB 3GTLB 4XQQA 1IYUA 3NSWA 3OWEB 3VYRA 1SYFA 4ZKBB 3BS1A 4XTCS 3NQTA 2XVSA 3LX0A 3MHBA 5KYLA 2QKIC 3DM1A 1EWCA 3TP6A 1KTKA 1W6KA 2DNEA 1K8OA 5EJWA 1SFOB 1PTOB 5I9PA 2L9HA 1D5MC 3H0GB 1S4ZA 1TQOA 2O2LD 2F03A 5DM73 1EY5A 1WTVA 1LT5D 2XN9C 2FJ2A 3KLSX 4Z9CB 2F0NA 4J6HA 1TS5A 3GTQB 3T4AC 3T53B 2HUGA 1A2UA 4BA1I 3HG9A 2BDOA 4C1NI 1F2LA 3K59A 1RCVD 4L6TB 1B4OA 4K2KA 4C1NK 2WP8J 3TZDA 2EY1A 1Q8IA 1RODA 3HZXA 1SNPA 2LS01 4KY6A 3ERQA 3SK4A 1WD1A 5EKIA 4ZUJA 4BA2I 3T56B 2H1EA 2WB1B 1EL0A 3WOEA 2QF7A 2I07B 1DCZA 4FXGC 4FXKC 2NZ1D 3EA6A 5C4XB 4KK7A 4HCSA 5IIFA 2E74C 5C44B 2RDFA 2B2WC 3T51B 5FO8B 2NTSA 1K83B 3DMUA 1SYEA 4L63B 1BQQT 4RGNA 5IOCA 5CORA 1DOLA 2EY6A 1JWSD 3BG3A 4G7HC 1MSHA 5M3FB 1B44D 1C8CA 4XYOA 1HA6A 2K33A 5I2YA 4BBRB 3P7JA 3NE5B 5J22A 4HN7A 1GUNA 5A2QL 2BOSA 1U9RA 1TKWB 2B2UC 2WINB 2OT2A 1AW7A 1ENAA 4DAPA 3A7AB 3NXWA 4ZAIA 2Z4IA 1SXTA 3S1MB 2O4XA 3NQIA 2Y0SB 3CU7A 1Y69U 2MHVA 1PYWD 3FDTA 3H91A 1JOKA 2F0DA 3W3AA 2B2WA 1TY2A 2EY2A 3NWSA 3FKIB 1II3A 5T1IA 3OOCA 1DYQA 3J80E 3E5SA 3KLSA 1BF4A 2A73B 3ZYYX 5FLXE 3T16A 4DXFA 1XX8A 1EU3A 1A2TA 4U673 4QIWB 1STHA 3ND9A 4J1MA 3H94A 1GUTA 3I4LA 3K7AB 3C3LA 1PDQA 5C0XJ 1Q90A 3VA5A 4C2MB 3LNNA 4A3DB 2R61A 5DM63 1PRTD 2WV6D 2B63B 4ZLTF 1RJTA 3SVMA 1SYGA 1BXTA 1Q12A 1EEFD 2RQXA 3HS0C 4ULLA 1Y1WB 2A69C 1ZXTA 1EY4A 3Q6SA 4QUCA 2WACA 3HOWB 2B39A 1SE2A 2CW0C 1T5EA 1LACA 1D5ZC 2RKSA 1SYBA 1CHQD 1GUSA 2AUJD 3BVMA 1G291 2NYZD 5CV7A 1R4QB 5CGKA 1EEID 2QEJC 1B3AA 2XRSD 3IFTA 4V0BA 3D4RA 1IW7D 1FR3A 4C3IG 2Q8TA 4WJWA 4LK1C 1PRTC 2F0KA 1QOHA 1TWAB 2YYZA 1FNVA 1F2MA 4RFBA 1A15A 2L5TA 3VR4A 2G9HD 2NB0A 3NTHA 3IKJA 2L1BA 5JPMC 2X6GA 3SK6A 1TR5A 1PXUA 3QG1A 4I7ZC 3OIQA 1Q1BA 3D8GA 3I8ZA 4OHJA 1NUCA 4PV1C 2QDBA 1OXUA 3G7LA 4IN3A 5I2XA 1PRTF 1XWEA 2O5IC 5M5XB 2EYOA 1CT1D 3I70A 3Q24A 4KHZA 1YNND 4HTHA 2NVTB 3P75A 4IUPA 3P1HA 2QCPX 1HHVA 3X3NA 3W2DA 2L0CA 3OIPA 2JA5B 2IL8A 4OL7A 1I3QB 2C5CA 5C4JB 4KI0A 3SE0A 3SEBA 3S1NB 2KCNA 2F4IA 1BCPF 4DNTB 3CRLC 5NUCA 4RGTA 3EROA 1QILA 1QG7A 3BYYB 2BCOA 1JOQA 3V05A 3ITPA 2EPBA 2R92B 1ONLA 2IX0A 3DHQA 2KA7A 4DFAA 2K05A 2EDGA 3L9AX 2DN8A 2L12A 1PFMA 2NN6G 1G6ZA 1Y8PB 5HGTA 1GUGA 3BDLA 3NPPA 4RGMA 1Z47A 4A3EB 2L4NA 2LY7A 3CKIB 1KABA 3I73A 3PMFA 2PZUA 4KJOA 1SNDA 4F88A 4O42A 4HEDA 4NKLA 1CZWA 3MA2B 5JEAH 4L8JA 5DNFA 2OXPA 1A3VA 3GD7A 2AQ1B 2DY7A 1IHZA 1A6XA 1QJOA 4DNRB 2KQ3A 4IUNA 2KUMA 1GXDC 5D3IB 5JEAJ 1IYVA 4WRDA 4BBSB 4OO1G 1DJRD 3PUXA 2MPMA 2B8FA 3BDOA 1CQFA 4CHTB 1NCVA 4J8QA 1EY7A 2F1MA 4IZ8A 1SJED 3GV6A 2K1BA 4EGVA 3J80L 5TSSA 2WKDA 5JJZA 4KN7C 2ZXRA 5JVH3 3EFXD 3QOLA 5COYA 2RSOA 5I9OA 1WTXA 2A6HD 3KBGA 3RZOB 1UUPA 3MFYA 1TWFB 2E75C 1VF7A 1I50B 3VYUA 1RHPA 2E2IB 4E6IA 2DY8A 1AZPA 1STNA 3U9OA 3A55A 4DA2A 5KNCA 2JEAI 3HP3A 1UNSA 3H6MA 4NW2A 3VYSA 1U4PA 1RDPD 3FVQA 4XT3B 3E0JA 5D14A 1S5ED 5C5MA 1Q3LA 2J7ZA 2AWOA 4K8JA 3HRZC 3TP7A 3LWUA 1LABA 4CKCA 2A6EC 4MHEA 2E2HB 2JXMB 3K57A 2KECA 4G57A 3SHLA 5CV5A 4KN4C 4B08A 3QOJA 4RWSC 1ZEQX 1KDCA 1S5FD 2NBFA 5C0XH 4RH6A 1LTSD 4FP5D 5JPNC 1TS2A 1AFPA 3NK9A 5E4WC 4OIJA 2F0HA 4IURA 1QE6A 3OMCA 4NP5A 1ENFA 1STBA 1F9RA 1ZKOA 2LKVA 1CTMA 2BDNA 1RKNA 4NDXA 2JE6I 3A8KE 3PUZA 4QB4A 4IALA 5EBCA 2F0GA 3WDNA 4IFDI 4A3IB 1C4QA 1PZID 3R3OA 4RHSA 2JA6B 1H9KA 3KUPA 1WCMB 1TWCB 4KKUA 2F0LA 4QCLA 3K6OA 2F0EA 1DOKA 3O13A 3OSOA 3OWFA 1KNEA 3J7AF 3TSSA 4G7ZC 3S15B 2NUCA 2A68C 4DAVA 1WD0A 1PTOH 2G9DA 1HRJA 4CKBA 5HURA 1Z7TA 2N88A 4DK0A 4IFDH 4KHVA 1A3UA 4PMBA 4IUVA 5AFWA 3K0YA 1LLRD 1PRTB 2D62A 5C4ZA 5CYUA 1U4MA 3MTSA 1SSOA 5C3WA 1KAAA 3GQBA 4ABNA 2D2CC 4FXDA 3E6ZX 1NR4A 1V43A 2NN6I 5FO9B 4IUUA 1DM0B 3VYTA 1ML0D 2ZT9C 3RUZA 4K8IA 4CKEA 1JWUD 2B2VA 4JBWA 2EVBA 1JR0D 1MI2A 1V1PA 4DU9A 2F0WA 2DNCA 2MP1A 1R9TB 1S5DD 1QNUA 5JVG3 3K58A 1FD7D 1JOOA 4IUTA 1RTOA 2EYLA 3D31A 2B2TC 1ICWA 1CK1A 1M8AA 2Z4HA 3DWAA 1RTNA 1AP0A 1K8MA 2N55A 4C56C 4C3IB 1ENCA 1SJHD 1AZQA 4IQZA 2K6AA 3HKZB 1HFNA 1EZ6A 3RD4A 1DZ1A 4DN4M 2F3WA 5J1ZA 5CV4A 3MWYW 2SNMA 1UAPA 1BBXC 3V2TA 1CA6A 2WAQB 2B2UA 5EKKA 2CQAA 3MZ5A 2B2TA 1SYCA 2VXWA 4B9XA 2A69D 2KHSA 4R8IA 1ESFA 2R7ZB 5EGTA 2WKCA 4X3SA 2SEBD 4LAAA 1HTLD 2F0PA 4A3GB 3G6JB 3F2UA 3A7LA 4IUQA 3S17B 4A3KB 3KLRA 4KY7A 5ELEA 4QUFA 2PMZB 4NMZA 3JAML 1ILQA 2SDFA 3I4MB 4YIJA 3I4NB 1B9NA 1V1OA 2HDMA 4IFDJ 1I6HB 4QF4A 5C0XI 2JP1A 5FO7B 3TZUA 5T1GA 1EZ8A 2HDLA 1H9JA 3IFDA 3S2HB 2ID0A 5G3LF 4MIUA 1HTPA 1M4VA 1KNAA 1VCIA 2EXZA 1C48A 1EQTA 1Y8OB 2M9VA 2K5WA 2K28A 2PW5A 4R8NA 2F0SA 2MJ8A 5ELFA 2A74C 2K7VA 5J39A 3HEJA 1MGSA 1TIID 3QJYA 1JC7A 2EYPA 2O5JC 4EQNA 3VR5A 1F2ZA 2HCIA 3A54A 2PNRC 2R3ZA 4X3TA 1F9PA 3HOVB 1ZYRC 4BY7B 5F2DA 1SAPA 1OXSC 3P20A 4KY5A 1I4HA 1I4RA 3M4OB 4RCNA 1STEA 1O7LA 1E2VA 3R8BA 3BDCA 2F0IA 1KDBA 3IL8A 2C9OA 2R93B 3NWTA 3R2IA 3HGBA 4K14A 4P2CB 3QWNA 1B1ZA 2EY5A 3Q23A 4XQNA 1BOSA 5A2QE 5EBDA 1WTOA 4RKLA 3L3OC 2LFNA 4HR7B 4ZUIA 5EKLA 5CR3A 1WTQA 2NVXB 2A5HA 1S5BD 2F0VA 5BN5A 2PZTA 4F8MA 2KOLA 4ZRZA 3PO3B 1MBYA 1SMYD 2SNSA 4R9WA 4TKOB 1VF5C 2K5DA 5C3XA 5KGUA 2B2YA 2M00A 5D65A 1BNZA 3D4DA 2FINB 1XTCD 2EYHA 2CHBD 1U4LA 1H9SA 1LT6D 3HOZB 2Z8LA 3GP7A 2F0OA 1STGA 4XQJA 1Z6HA 1EYDA 4RGOS 3D4WA 2NVYB 3LWEA 1OXVA 1JQYD 4DF7A 1LV9A 3AU7A 1PFBA 2IT1A 3FRPB 3NBIA 2FFKB 2EJFC 4WFN3 1G8ZD 3GTKB 1B2TA 4X3KA 2TMPA 5ELDA 1LTID 4KV6A 1I4XA 1NR2A 5KNDA 4S3SA 2HCCA 3TDQA 2PQEA 1EIHA 3VR6A 4PMWA 3I91A 3MVVA 3MFGA 4Y7NB 3HOUB 3VR2A 1PLFA 4CGYB 2B2YC 3GTJB 1CFMA 1NAPA 1G91A 1O7YA 5I6WA 4IFDG 4HMIA 5FK9C 2EJMA 5KYIA 3I72A 5ISRA 1IL8A 1SNQA 1I4PA 5I4DA 1CM9A 3DEOA 5E1FA 5M5YB 2MGSA 2B8GA 5JAVA 5K36H 2AQ2B 4K6DA 1CZGA 4OO1I 1XYIA 2PW7A 5IGFA 4RAUC 1L0XB 1U4RA 3CQZB 1IKLA 3KK7A 3PUWA 5IT9L 1YNJD 2EYMA 2AQ3B 3NBHA 3C2PA 2PPBC 2ENBA 1TU2B 1RD9D 5KNBA 5EPJA 5EQ0A 3RLFA 3OPOA 4O1NA 1V1PB 2AWNA 2FMCA 3R93A 3SXHA 3K5MA 1SNOA 2NVQB 2A6HC 3MEHA 4OGQC 1SNCA 5C0XG 2EYJA 3M3YB 3M7NA 1PMRA 3VR3A 5IGBA 4FF3A 1BR9A 1TWGB 3S1QB 4K2LA 3BZDB 4BS9A 3M4YA 2E76C 2HQEA 4H0LC 4PMCA 1OXTA 2FMMA 1PZKD 1I6VC 1OXXK 1I4QA 2EE1A 3RMHA 3UI2A 4C3JG 1EOTA 1H9MA 3KF8A 1SYDA 4ZKCB 4UAIA 2L55A 1DOMA 1TT2A 2YU9B 1JORA 3AMUA 1JWMD 4XYQA 4OIKA 3S2DB 1JE4A 4I65A 4HMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQU S;  4G7Z C;  1IW7 C;  4TKO B;  1GHK A;  1GHJ A;  1Y8O B;  5BN3 A;  4BA2 I;  2PCF B;  3T56 B;  3D4R A;  1IW7 D;  1FR3 A;  3A8J E;  1SMY C;  2A68 C;  1Y69 U;  1VF5 C;  2B8G A;  5A35 A;  3M85 A;  1ONL A;  2K7V A;  5K36 H;  3W3A A;  2JEB I;  2KA7 A;  2QF7 A;  2EDG A;  1HPC A;  2D5D A;  1B9M A;  3QJY A;  2DN8 A;  1DCZ A;  4LK1 C;  2K32 A;  2NN6 G;  2LMC B;  1Z7T A;  1HCZ A;  3OOC A;  1Y8P B;  3CRK C;  1H9S A;  4H13 C;  1GUG A;  2AWO A;  2O5J C;  4GZY C;  1GJX A;  1GUO A;  1LAB A;  3A8I E;  1IYU A;  3LWU A;  2YYZ A;  3QIA A;  4DK0 A;  4IFD H;  2A6E C;  2A69 D;  3I73 A;  3PUW A;  2BA1 A;  3VR5 A;  2PNR C;  2JXM B;  2KCC A;  2L5T A;  3PV0 A;  1Z6H A;  3VR4 A;  2PPB C;  1TU2 B;  5K36 G;  5KNB A;  1DXM A;  5BN4 A;  5JEA H;  1OXV A;  4L8J A;  4KN4 C;  4XTC S;  1FYC A;  3IKJ A;  3ND9 A;  2D62 A;  2E74 C;  3H94 A;  1GUT A;  3I4L A;  3N6R A;  1H9S B;  3RLF A;  1VDZ A;  3GQB A;  3GD7 A;  3OPO A;  1ZYR C;  3QG1 A;  4I7Z C;  3T51 B;  1Q1B A;  1Q90 A;  2D2C C;  3FMC A;  2IT1 A;  3LNN A;  1A6X A;  3L7Z C;  5C0X H;  1QJO A;  3A7L A;  3MXU A;  1HQM C;  1O78 A;  4PV1 C;  4DNR B;  1OXS C;  2A6H C;  2DNE A;  1OXU A;  2EJF C;  1K8O A;  1V43 A;  4H44 C;  1Q1E A;  4OGQ C;  3P20 A;  4G7O C;  5C0X G;  1IYV A;  3FPP A;  3VA7 A;  2NN6 I;  4RCN A;  2BE5 C;  4G7H C;  3BG3 A;  2V4D A;  3PUX A;  3KLR A;  1PMR A;  2O5I C;  1E2Z A;  3M7N A;  4OO1 G;  2B8F A;  3VR3 A;  3BDO A;  1Q12 A;  1ZKO A;  2AUK A;  1O7L A;  2ZT9 C;  1BDO A;  2BE5 D;  1E2V A;  2EJG C;  1CTM A;  2F1M A;  2K33 A;  5JEA G;  1E2W A;  3M4Y A;  2E76 C;  1YNN C;  4H0L C;  2Q8I B;  2JE6 I;  1CI3 M;  4JBW A;  4KHZ A;  5KND A;  2EVB A;  3A8K E;  3PUZ A;  4KN7 C;  1OXT A;  1DD2 A;  2A69 C;  3HGB A;  3NE5 B;  4OO1 H;  2R6G A;  1I6V C;  3DXJ C;  2DNC A;  1OXX K;  3EQL C;  3PUY A;  3U9S A;  1GUN A;  1EWH A;  4DK1 A;  1B9N A;  4KKS A;  3PUV A;  3T53 B;  3AB9 A;  2A6H D;  3WDN A;  1TKW B;  4BA1 I;  2CW0 C;  2A6E D;  3VR6 A;  2BDO A;  1T5E A;  1H9M A;  3MFY A;  1LAC A;  3D31 A;  4HR7 B;  1Y8N B;  4JK1 C;  3VR2 A;  1V8Q A;  3TZU A;  4XIG S;  1CFM A;  1GUS A;  1H9R A;  1H9K A;  2AUJ D;  4KI0 A;  1G29 1;  4KKU A;  3SE0 A;  4KKT A;  2E75 C;  1K8M A;  4IFD G;  1H9J A;  1VF7 A;  2BA0 A;  5BN5 A;  3SDZ A;  3OW7 A;  3A7A B;  4LJZ C;  1HTP A;  2EJM A;  4KMU C;  1VCI A;  2NN6 H;  1YNJ C;  3CRL C;  3I72 A;  3IFT A;  4DNT B;  3ND8 A;  5KNC A;  4IQZ A;  2JEA I;  2A68 D; 
#chains in the Genus database with same CATH topology
 4C3J B;  1EQV A;  4HSP A;  4PQX A;  3T13 A;  5CBA E;  5BN3 A;  3KLW A;  1PFN A;  5IYC H;  1EFI D;  1GOZ A;  2IJ0 A;  1LT4 D;  3Q8D A;  3PO2 G;  2K01 A;  2Q2I A;  1K8G A;  1MD2 D;  1I3Q H;  3SK8 A;  2YTX A;  4N9P A;  2K32 A;  2LMC B;  2KED A;  3HOU G;  3JAM E;  4ODG A;  1EY8 A;  4DV6 Q;  1F77 A;  4DK6 C;  4DV4 L;  1STA A;  1M1K C;  1HXY D;  2KCC A;  3NTI A;  3HFZ B;  1EIY B;  5CV6 A;  1DXM A;  1YI2 A;  5C3E G;  2KCT A;  3WOF A;  1O80 A;  4A3I H;  2I46 A;  1QZG A;  3M7G A;  3K5N A;  2RDH A;  4A3B G;  4IOC A;  1YBY A;  3U4Z A;  3I4M G;  2JA5 G;  1ZYR D;  3C1E A;  1XMO Q;  2M2L A;  2B3G A;  5EPL A;  1TVX A;  1A63 A;  5C6A A;  5M9O A;  2E2D C;  4DGZ A;  1C7Y A;  1STY A;  2BE5 C;  3S14 B;  2V4D A;  3J81 E;  1TY0 A;  4KD4 A;  3GTO H;  3TN2 A;  2MO1 A;  3S2H H;  1W3S A;  4BY1 B;  1XNR Q;  4LUV A;  1BDO A;  2Q2T A;  4AIM A;  5JEA G;  1I4G A;  1Q46 A;  1YNN C;  2Q8I B;  1CI3 M;  3NHH A;  4A3F B;  1DD2 A;  2R6G A;  3HOY G;  4BY1 G;  2JA8 B;  3J7Y W;  5IGC A;  1DON A;  2JSO A;  2WB1 G;  2KHJ A;  4GKK L;  4A3G H;  1LO5 D;  4R4C A;  2FXQ A;  1NJI C;  4X65 L;  4X65 Q;  4DV7 L;  1Y8N B;  1ET9 A;  4JK1 C;  1V8Q A;  3IRB A;  1QCB D;  5FLM H;  1S72 A;  4ZQ3 A;  4XDX A;  4A3M B;  4K6L A;  4A3M H;  3SDZ A;  1VMC A;  4OWW B;  3K81 C;  4DAY A;  4DR6 Q;  4IOA A;  1LTR D;  2PZW A;  1AEX A;  2VUM H;  2NN6 H;  2LXJ A;  4KJN A;  1HUN A;  1QWY A;  2F0T A;  3QR8 A;  2EOT A;  3KF6 B;  1GHJ A;  1GHK A;  1LTA D;  2ZXO A;  2RDG A;  4DV1 L;  1L0W A;  3SK5 A;  3ERS X;  4PG3 A;  3M85 A;  4Y52 H;  1HNZ L;  3BU2 A;  2SOB A;  5LMN L;  4DV5 L;  1HA5 A;  1NSN S;  3CC7 A;  1HQR D;  4A3B B;  3CQZ H;  4CJ1 B;  1JMC A;  2QA4 A;  1I50 H;  3CC4 A;  2DJG C;  1D2B A;  4C3H B;  1FNW A;  3A8I E;  2F0F A;  3QIA A;  5FLX L;  4OEM B;  3C46 A;  4A3E H;  2BA1 A;  1YHB A;  4DR7 L;  3MC0 B;  2J4X A;  4PNY A;  4APV A;  5GAG C;  4LF8 Q;  3S1R B;  1JCK B;  4DR5 Q;  3QO2 A;  4KD3 A;  4HJ9 A;  2OEO A;  1VDZ A;  4HCE A;  3CCV A;  1D7Q A;  4X3U A;  4A3F G;  3U58 A;  4FF1 A;  1FNU A;  3MXU A;  1SNM A;  4QMG A;  5IYD G;  3OHX C;  3M4Q A;  3RLN A;  3UDG A;  2QIL A;  2H4O A;  4FF2 A;  1B50 A;  4G7O C;  1G51 A;  2FHT A;  3I3C A;  1BO0 A;  5E4X A;  4DNI A;  1ILP A;  4F7X A;  1YEZ A;  4G4K A;  3I90 A;  4EVO A;  2MNA A;  4FO2 A;  5M3M B;  1TWH H;  5IT9 E;  2EJG C;  2IW3 A;  3M9B A;  4PZ8 A;  4LF4 L;  1PTO D;  3GTM B;  2VB3 X;  3S24 A;  1F9S A;  5ELB A;  1G6P A;  2B2V C;  1D6E C;  3FEW X;  4OO1 H;  1TS4 A;  5C3E B;  3DXJ C;  3TEH B;  1GKH A;  4IJH A;  3RN5 A;  3HOV H;  3PUY A;  3BYT B;  1KLU D;  5IOD A;  3GTO B;  2EYF A;  2DGY A;  3PUV A;  2R7F A;  3AB9 A;  2VB2 X;  5IGD A;  2A6E D;  3H3V C;  1YHA A;  3DWQ A;  4F87 A;  5E3F A;  4C2M H;  5FKA C;  2VNU D;  4RCO A;  5LHY 1;  2B63 H;  3NEM A;  1S5C D;  3OW7 A;  2X69 A;  1WVL A;  1JIC A;  2HQL A;  3R2T A;  4GNX C;  3E9H A;  1YNJ C;  4HSV A;  2AHO B;  4RMF A;  5C44 G;  5J3B A;  1W6J A;  2RSN A;  1L1O C;  2PCF B;  1BCP D;  3F2C A;  2Z1C A;  1BBU A;  3JAM c;  4ZYS A;  3J80 c;  1EIG A;  1NNX A;  3RZD B;  2OQ0 A;  3CW2 C;  1R4P B;  3UDI A;  5A35 A;  4CDF C;  3PIO 3;  1VQG A;  5JJL A;  1SE3 A;  2OQK A;  1VQO A;  4B3M L;  1HPC A;  4K5X A;  5IP9 G;  5JOB A;  3I4O A;  3TME A;  3DUZ A;  3EVQ A;  3CRK C;  3BVG A;  4GZY C;  2Q8R E;  2X6L A;  4JG2 A;  5IGG A;  4Q5V A;  4TSS A;  4LF6 L;  4LF6 Q;  1SMX A;  1SE4 A;  5K36 G;  5G3L D;  2PO4 A;  4UDU C;  1X6O A;  3H09 A;  2UUC Q;  1FYC A;  2QGQ A;  4ILW A;  4J15 A;  1EY0 A;  4AH6 A;  2KJX A;  3J7A V;  1EYA A;  2K03 A;  3MEF A;  3FMC A;  1X3Q A;  1F2Y A;  4OWX B;  4Q0F A;  3SGI A;  1U5K A;  1WTR A;  2TSS A;  3HOY B;  4Y7N H;  3S9W A;  2KEE A;  4DUY L;  3J81 L;  1N9W A;  4H44 C;  1Q1E A;  3HOX H;  4ME5 A;  3FPP A;  4CJ2 C;  3K5L A;  3NP8 A;  4B3M Q;  5C4X G;  1Z9F A;  1K3R A;  1EYC A;  1X3P A;  1B53 A;  4RHR A;  3S17 H;  5KEE A;  1QVC A;  1J8I A;  5IGE A;  5LMN Q;  2WFW A;  1ET6 A;  1O7Z A;  4M1U B;  2XIW A;  3A56 A;  5C4X H;  5BR8 L;  2P5Z X;  5M5Y H;  3EQL C;  4JV5 Q;  1EWH A;  1L0Y B;  5C5L A;  3D6W A;  3FKI G;  2ZXP A;  1TS3 A;  2F0Q A;  4LUZ A;  3RZD H;  3PO3 H;  3T1Y L;  1BCP C;  1X32 A;  1JB7 A;  3Q0A A;  1VQE A;  4XIG S;  1H9R A;  1PH8 A;  2L11 A;  4GOP C;  1SRU A;  2BA0 A;  3HKS A;  3Q22 A;  1HZA A;  5LL6 X;  2F0J A;  2YTV A;  2K5Q A;  1RL2 A;  3F8T A;  4AYB B;  1BCP B;  2NTT A;  3PIP 3;  4DV2 Q;  4TQU S;  2NZO A;  1IW7 C;  1KLG D;  2EQS A;  2XWJ B;  3K5O A;  2F3V A;  5EPK A;  3X3M A;  1LTT D;  1EU4 A;  5I6Y A;  4DV3 Q;  1N32 L;  5KIX A;  2F0M A;  3PCO B;  3U50 C;  4JI3 Q;  2PYK A;  2JEB I;  4DAY B;  4KTA A;  4FYD A;  4EQO A;  1IKM A;  4H13 C;  4YWM A;  5BR8 Q;  4DR1 Q;  1WOC A;  3ONA B;  4K5V A;  2PQA A;  2K04 A;  3GDE A;  2UXB L;  3NUC A;  4JI6 Q;  1B3Q A;  4FDB A;  3H3V H;  1AN8 A;  5BN4 A;  4ID6 A;  5CC4 A;  1PTO F;  1FGU A;  1K28 A;  4JBJ A;  3TP5 A;  1OO9 B;  3N6R A;  2JYO A;  1PZJ D;  4NPS A;  2XSC A;  5LL6 S;  4H02 A;  4A3J G;  1VQL A;  5IT9 c;  2VQE L;  3L7Z C;  5LMU Q;  1L2F A;  1O78 A;  4GNX A;  2HIV A;  3MXN A;  5DAU A;  1HFG A;  1SDF A;  2F4V L;  3I4M H;  2Z6K A;  2F4V Q;  1CQV A;  1U0L A;  2XWB B;  3IAY A;  3TBI B;  1E2Z A;  3FKI H;  1KC8 C;  1VS0 A;  1D1I A;  3KBX A;  3M4O H;  2L15 A;  2D9U A;  2F0U A;  2BE5 D;  3CC2 A;  3DWP A;  3EJI A;  2NWG A;  4IPG A;  4BWG B;  5FOB B;  4KLK A;  3J7A 5;  2IWH A;  1QZH A;  2ICE C;  4OWT B;  3HOX B;  4U68 A;  1UEA B;  3ICE A;  1Y1V B;  1GUW A;  5K5P A;  1EY9 A;  4K5W A;  1JB3 A;  1BKB A;  1LM0 A;  2XRQ D;  3NEN A;  3URY A;  1CHP D;  1XXG A;  4WJ3 M;  1PTO C;  4JC0 A;  2WII B;  2OF1 A;  1YNX A;  2IPK D;  2I5M X;  1FGB D;  2RBM A;  3GTG B;  4P75 A;  3C1F A;  4B3T Q;  3GTP B;  4LJZ C;  3MXG A;  3PO2 B;  5CMD A;  3GTP H;  1K8A C;  4KMU C;  1ESR A;  4RA8 A;  1X3E A;  3PF5 A;  2JA7 B;  3ND8 A;  1TWG H;  5D3D A;  1N34 Q;  1E24 A;  2VQE Q;  3A8J E;  4A93 B;  1SMY C;  1LTB D;  4HAE A;  4N9T A;  4FNF A;  5M5W B;  1XMO L;  5ELO A;  1LTG D;  2CW0 D;  3QB3 A;  3GV3 A;  4C3H G;  2JA7 G;  1IBL L;  4R4T A;  2VUM B;  1BUV T;  2D5D A;  4P72 A;  4A3J B;  4A3K G;  4RKB A;  4XXE A;  1CA5 A;  2CVR A;  1QNK A;  1WI5 A;  4LFA Q;  5FLM G;  1JJG A;  1HCZ A;  1LT3 D;  2RVL A;  3K7A H;  1GJX A;  1T9H A;  2D0O A;  3S16 B;  1GUO A;  3KF8 B;  2CH4 A;  3OMG A;  2ICI A;  4LFB Q;  1VMP A;  5C4H A;  1PH1 A;  2MUY A;  2R7Z H;  3PV0 A;  4XT1 B;  4A3L G;  2CH4 W;  4YY3 Q;  3D3R A;  4V19 0;  4YWL A;  2GA4 B;  5CBE E;  4L5R C;  1Q7Y C;  1J9O A;  2GVB A;  1H9S B;  4MN3 A;  2ZTC A;  2EZV A;  1MSG A;  3AEV A;  3N52 A;  1J6Q A;  1KDA A;  1KL9 A;  1QB5 D;  3TP8 A;  4B3T L;  5CV9 A;  1HQM C;  1PA6 A;  2LSS A;  3TS0 A;  5JJI A;  3CCL A;  3CHB D;  5ELC A;  2CQO A;  1Y1W H;  3A5Z B;  3BVZ A;  4WOR A;  3VA7 A;  5C4J H;  2B29 A;  3MAQ A;  1RF2 D;  5KRU A;  2IX1 A;  2AUK A;  2IX3 A;  2KVM A;  2DUD A;  3SR1 A;  2B63 G;  3UDF A;  5M3F H;  1E2W A;  1D1K A;  2K75 A;  5CV8 A;  1C9O A;  1GO3 E;  2UU9 L;  1E0B A;  4CBV A;  1G2T A;  2RA4 A;  2VS1 A;  3FPU B;  3TS2 A;  1A3T A;  1D8L A;  3A74 A;  4TRD A;  3U9S A;  1WYD A;  3NTK A;  4DK1 A;  1SBB B;  3D6C A;  4CJ0 B;  1VQ5 A;  4KKS A;  1NE3 A;  4H7B A;  2KBN A;  3J81 c;  1VQA A;  2JA6 H;  4DR2 L;  4EQP A;  3H0G H;  4HJ7 A;  1G2S A;  3BZK A;  1HZB A;  3F2D A;  4KKT A;  5C3E H;  1WTP A;  4FF4 A;  4DXG A;  3MXP A;  3L2P A;  1WTW A;  1EY6 A;  5GAE C;  4JI7 L;  1F9Q A;  1D5X C;  4LMQ D;  2A68 D;  3GTQ H;  2XNA C;  3V96 A;  2E2J B;  2J0T D;  2CWP A;  3KYH C;  4ZK9 B;  2JA8 H;  3KOJ A;  1WTH A;  2JA8 G;  2N8N A;  2OTL A;  4B9W A;  4FVM A;  1SEB D;  2QW7 A;  5DEH A;  4QL5 A;  1B9M A;  3PO2 H;  3J7Z C;  1E22 A;  1HUM A;  3GO5 A;  4M8A A;  3J80 i;  5IYC G;  4L5S A;  3DEP A;  1T5X D;  1TWH B;  3GTL B;  4XQQ A;  1IYU A;  3NSW A;  3OWE B;  3VYR A;  1SYF A;  1L1O A;  1QUQ A;  3OYY A;  2WAQ G;  4ZKB B;  3H0G G;  4CDE C;  3HOW H;  3BS1 A;  4XTC S;  2KCM A;  4HIK A;  3NQT A;  4BY7 H;  2XVS A;  3LX0 A;  3MHB A;  5KYL A;  1XNQ L;  2QKI C;  3DM1 A;  1EWC A;  5EAY A;  3TP6 A;  5IY0 A;  1KTK A;  1W6K A;  2DNE A;  4LF9 Q;  1K8O A;  5EJW A;  1SFO B;  4QQB X;  4OXP A;  4NB3 A;  1PTO B;  5I9P A;  2L9H A;  1N33 L;  1D5M C;  3H0G B;  1S4Z A;  3FHW A;  4JI3 L;  1TQO A;  3DLL A;  2O2L D;  2F03 A;  5DM7 3;  2YV5 A;  1Y14 B;  1Q81 C;  1EY5 A;  1WTV A;  1LT5 D;  2XN9 C;  2VY3 A;  1HNX Q;  2FJ2 A;  3KLS X;  4Z9C B;  2F0N A;  4J6H A;  1TS5 A;  3GTQ B;  3T4A C;  3T53 B;  1CUK A;  2Q2H A;  2HUG A;  1HH2 P;  1A2U A;  4BA1 I;  4LF7 Q;  3HG9 A;  2BDO A;  4C1N I;  1F2L A;  3K59 A;  1RCV D;  3W5O A;  4JCV E;  4L6T B;  1B4O A;  4K2K A;  1VQH A;  4C1N K;  2GN5 A;  1GD7 A;  1LUZ A;  2WP8 J;  3TZD A;  1HR0 L;  1JJ2 A;  4BBR H;  2EY1 A;  1Q8I A;  1ROD A;  3HZX A;  3PF4 A;  1SNP A;  2LS0 1;  2RF4 A;  4KY6 A;  3ERQ A;  3SK4 A;  2KHI A;  1WD1 A;  5EKI A;  1P8L A;  4ZUJ A;  1XNQ Q;  4YCW A;  4ZCK A;  4BA2 I;  3T56 B;  1VQK A;  2LXK A;  2H1E A;  4C3H H;  5HGQ A;  1NTG A;  2WB1 B;  1EL0 A;  1VQ9 A;  3WOE A;  2QF7 A;  2I07 B;  1DCZ A;  4FXG C;  4YHH Q;  4FXK C;  2NZ1 D;  1JT8 A;  3EA6 A;  2ES2 A;  3F2B A;  2Q2U A;  1YZ6 A;  2UUB Q;  5C4X B;  4KK7 A;  2JQO A;  3GTG H;  3ULJ A;  1B7Y B;  4HCS A;  5IIF A;  2E74 C;  5C44 B;  2ZM6 Q;  2RDF A;  2B2W C;  4P73 A;  1KAW A;  3T51 B;  5FO8 B;  4A76 A;  2NTS A;  1K83 B;  3DMU A;  3I56 A;  3GTM H;  1SYE A;  4L63 B;  1BQQ T;  2UXC L;  4RGN A;  5IOC A;  5COR A;  1RIP A;  1DOL A;  4IPC A;  2EY6 A;  1JWS D;  3BG3 A;  1X3F A;  4G7H C;  1MSH A;  4JOI C;  5M3F B;  1B44 D;  3AQQ A;  1C8C A;  2JJQ A;  4XYO A;  1HA6 A;  2K33 A;  4B3R Q;  2JA9 A;  5I2Y A;  4OEL B;  2YTY A;  4BBR B;  4X6A H;  3P7J A;  3NE5 B;  1K0S A;  5J22 A;  4A3D H;  4HN7 A;  1GUN A;  5A2Q L;  4UP8 A;  4DUZ L;  4DV6 L;  3K7U C;  2E2I H;  3KDF B;  2BOS A;  2Y0S G;  1U9R A;  1TKW B;  2B2U C;  2WIN B;  2C35 B;  2OT2 A;  1PH2 A;  1AW7 A;  4JI8 Q;  2E5L Q;  3K8A A;  1PH6 A;  1ENA A;  4DAP A;  3KJO A;  3A7A B;  1CKN A;  3NXW A;  4JOI A;  3J81 i;  2R7Z G;  4ZAI A;  2Z4I A;  1SXT A;  3E0E A;  3S1M B;  2O4X A;  3NQI A;  2Y0S B;  1M90 C;  3CU7 A;  1YJW A;  2HIX A;  1Y69 U;  1SE8 A;  2MHV A;  1PYW D;  3FDT A;  3H91 A;  2XGT A;  1QUQ B;  1JOK A;  2F0D A;  3W3A A;  2B2W A;  1TY2 A;  5M3M H;  4GKJ Q;  2JA7 H;  2EY2 A;  3NWS A;  3FKI B;  2PMZ E;  3H15 A;  4GLX A;  1II3 A;  1VQF A;  1X9N A;  5T1I A;  3OOC A;  1DYQ A;  3J80 E;  3E5S A;  1MJE A;  2ZTE A;  2G5D A;  4QY7 A;  1W2B A;  3KLS A;  1BF4 A;  3GTK H;  1K3B C;  2A73 B;  3ZYY X;  3OW2 A;  2KEN A;  4DPG A;  5FLX E;  4A93 G;  3T16 A;  4DXF A;  1XX8 A;  1EU3 A;  1A2T A;  4U67 3;  1L1O B;  4QIW B;  1SR3 A;  1STH A;  3ND9 A;  1PH9 A;  4J1M A;  3H94 A;  1GUT A;  3I4L A;  3K7A B;  3C3L A;  2E5L L;  1PDQ A;  5C0X J;  1E1T A;  1X56 A;  1E3P A;  1N34 L;  1MJC A;  1Q90 A;  3VA5 A;  4C2M B;  1VQ6 A;  3LNN A;  1UE6 A;  4A3D B;  3HOX G;  2Z6B A;  2R61 A;  5DM6 3;  3CMA A;  3UE1 A;  1PRT D;  2WV6 D;  2B63 B;  4ZLT F;  4DV2 L;  1RJT A;  3SVM A;  1SYG A;  1BXT A;  4LFC L;  1Q12 A;  4HJ8 A;  1EEF D;  1A62 A;  2AMC B;  2RQX A;  4BXX H;  3HS0 C;  1QVF A;  4ULL A;  1SN8 A;  1PH4 A;  3W1G A;  1Y1W B;  2A69 C;  4L5T A;  1ZXT A;  2MQH A;  3FP9 A;  1EY4 A;  1N36 L;  3Q6S A;  4QUC A;  2WAC A;  2R92 G;  3KFU A;  4A3C G;  3HOW B;  3HKZ E;  2OTJ A;  2B39 A;  1SE2 A;  2UUB L;  2CW0 C;  1MHW C;  1T5E A;  1LAC A;  1D5Z C;  1KD1 C;  2RKS A;  1SYB A;  1CHQ D;  1GUS A;  2AUJ D;  3BVM A;  1G29 1;  3S16 H;  3CAM A;  4JI2 Q;  2VUM G;  1TWF H;  2NYZ D;  5CV7 A;  3BZC A;  4GN5 A;  1R4Q B;  1PHJ A;  5CGK A;  3ZJY C;  1EEI D;  2QEJ C;  4JI1 L;  1B3A A;  2XRS D;  3IFT A;  4JI1 Q;  2A8V A;  3PSI A;  1XPU A;  4QGU A;  4V0B A;  2RHS B;  1IW7 D;  1FR3 A;  3D4R A;  4YHH L;  4I7A A;  4C3I G;  1IBK L;  4JPB W;  2Q8T A;  4DR1 L;  2R93 H;  1XMQ Q;  4WJW A;  4EQ5 A;  4LK1 C;  1PRT C;  2F0K A;  1QOH A;  1HZC A;  1TWA B;  1N36 Q;  4JBM A;  2YYZ A;  3T1H L;  1VQJ A;  1FNV A;  1F2M A;  2NVY H;  4LF7 L;  4RFB A;  1A15 A;  2L5T A;  3VR4 A;  2F52 A;  2G9H D;  1WJJ A;  2ZJR A;  1VQM A;  2NB0 A;  1Q86 C;  3NTH A;  3IKJ A;  2L1B A;  5JPM C;  1PFS A;  2X6G A;  3SK6 A;  1VQC A;  1I6H H;  1TR5 A;  1PXU A;  3QG1 A;  4I7Z C;  3OIQ A;  1Q1B A;  1CSP A;  3D8G A;  4LUO A;  3I8Z A;  4A3B H;  4OHJ A;  1NUC A;  4PV1 C;  2QDB A;  1I94 Q;  1OXU A;  3G7L A;  4IN3 A;  5I2X A;  4N8X 1;  1PRT F;  1XWE A;  1J5E L;  2O5I C;  5M5X B;  1N33 Q;  1FJG L;  2VZA A;  1NMG A;  2EYO A;  4PZ7 A;  2R7D A;  1CT1 D;  3I2Z A;  4UHV A;  3I70 A;  3Q24 A;  4MZ9 A;  3RR5 A;  4KHZ A;  3G71 A;  1YNN D;  4HTH A;  2UXD L;  2NVT B;  3P75 A;  4IUP A;  3P1H A;  2QCP X;  1TXY A;  1HHV A;  2PI2 A;  3X3N A;  1PYB A;  3AFQ A;  4NXN L;  2UXB Q;  3W2D A;  2L0C A;  4NXN Q;  3OIP A;  2JA5 B;  2IL8 A;  4OL7 A;  1I3Q B;  3T1H Q;  2C5C A;  5C4J B;  4KI0 A;  3SE0 A;  3CPF A;  3SEB A;  3CD6 A;  4BBR G;  4A75 A;  4X62 L;  3S1N B;  2KCN A;  1TWA H;  2F4I A;  3NEL A;  4DUY Q;  1BCP F;  4DNT B;  3CRL C;  5NUC A;  4RGT A;  3ERO A;  1QIL A;  3K0X A;  1QG7 A;  3BYY B;  2BCO A;  1JOQ A;  1HNW L;  3V05 A;  1HNW Q;  5GQO A;  4O2D A;  5IP9 H;  3ITP A;  1SFO H;  4PZ6 A;  2EPB A;  2R92 B;  1ONL A;  2IX0 A;  1PH3 A;  3DHQ A;  2KA7 A;  4DFA A;  2K05 A;  2EDG A;  4R4I A;  4HID A;  3S2D H;  3L9A X;  2DN8 A;  2L12 A;  1PFM A;  2NN6 G;  4A3G G;  2XTI A;  1G6Z A;  1VQD A;  1Y8P B;  4JI6 L;  5HGT A;  1GUG A;  3BDL A;  4UY8 C;  3NPP A;  4RGM A;  1YJN A;  1Z47 A;  4A3E B;  2IHE A;  1IL2 A;  2L4N A;  2LY7 A;  3CKI B;  4A3M G;  4LFB L;  1KAB A;  3I73 A;  3PMF A;  3HOY H;  4HJ5 A;  1ICF B;  2PZU A;  4KJO A;  4BBS G;  1SND A;  4F88 A;  4O42 A;  4HED A;  4NKL A;  2R93 G;  3VDY A;  3M4P A;  1CZW A;  3MA2 B;  1B70 B;  4N8F A;  4LF5 Q;  5JEA H;  4L8J A;  5DNF A;  4LF5 L;  2K14 A;  2OXP A;  1A3V A;  1S3O A;  3GD7 A;  2AQ1 B;  2DY7 A;  3G48 A;  4X66 L;  1IHZ A;  3G4S A;  4DR2 Q;  1A6X A;  1QJO A;  4DNR B;  3OTO Q;  2KQ3 A;  4IUN A;  2KUM A;  1XNR L;  1GXD C;  3NBH B;  1NMF A;  5D3I B;  3BJU A;  4GS3 A;  5JEA J;  1IYV A;  1WCM G;  4WRD A;  1PYS B;  4BBS B;  4OO1 G;  1DJR D;  3PUX A;  4P71 A;  2MPM A;  2B8F A;  3BDO A;  1CQF A;  2H5X A;  1QVG A;  4CHT B;  1NCV A;  4J8Q A;  1EY7 A;  2F1M A;  4IZ8 A;  2N49 A;  1SJE D;  3GV6 A;  2K1B A;  4NXM Q;  4EGV A;  3J80 L;  5TSS A;  3S1N H;  1OTC A;  2WKD A;  5JJZ A;  4KN7 C;  2ZXR A;  5JVH 3;  3EFX D;  3QOL A;  2K52 A;  4R4Q A;  5COY A;  3S14 H;  5M5X H;  2RSO A;  2ASB A;  5I9O A;  3CPW A;  1WTX A;  1EYG A;  2BH2 A;  2A6H D;  2EIF A;  3KBG A;  3RZO B;  1UUP A;  3MFY A;  5DLQ E;  5FJ8 H;  1TWF B;  2RHQ B;  3CCR A;  2E75 C;  5IP7 G;  1VF7 A;  1I50 B;  3VYU A;  1A0I A;  3CCS A;  1RHP A;  4OX9 Q;  2E2I B;  4JW0 A;  4E6I A;  2DY8 A;  2D0P A;  1AZP A;  1STN A;  3U9O A;  3A55 A;  4DA2 A;  1FL0 A;  5KNC A;  2JEA I;  3HP3 A;  4IJL A;  1UNS A;  3H6M A;  2DJF C;  4NW2 A;  2E8G A;  3VYS A;  1U4P A;  5FLX c;  2WAQ E;  3AYH B;  1PVO A;  1RDP D;  1CKO A;  3FVQ A;  5FJ8 G;  1LYL A;  4XT3 B;  3E0J A;  5D14 A;  2V1C C;  1A8V A;  1S5E D;  5C5M A;  1Q3L A;  2J7Z A;  3T1Y Q;  2AWO A;  4K8J A;  3HRZ C;  3TP7 A;  3LWU A;  1LAB A;  4CKC A;  2MO0 A;  2A6E C;  4GLV B;  1IZ6 A;  4MHE A;  2E2H B;  2JXM B;  3K57 A;  1CSQ A;  2KEC A;  5L37 A;  4G57 A;  1HR0 Q;  3PIO A;  3SHL A;  4B3S L;  2RCN A;  5CV5 A;  4KN4 C;  4B08 A;  3QOJ A;  4RWS C;  4IPD A;  1ZEQ X;  5IE8 A;  3PIP A;  1KDC A;  1S5F D;  2NBF A;  5M3F G;  5C0X H;  4RH6 A;  1LTS D;  4FP5 D;  5JPN C;  1TS2 A;  1I5F A;  4JI4 Q;  1AFP A;  3NK9 A;  1FVI A;  5E4W C;  4OIJ A;  2F0H A;  4IUR A;  1X65 A;  3CXC A;  1QE6 A;  4BY1 H;  1HJP A;  3OMC A;  4NP5 A;  1ENF A;  1Y1W G;  1STB A;  1F9R A;  1ZKO A;  2LKV A;  3S1M H;  5LMN W;  4JI5 Q;  1CTM A;  2BDN A;  1UWV A;  1Y1V G;  1RKN A;  4NDX A;  2NVQ H;  1XPO A;  4POF A;  2JE6 I;  4YWK A;  1MIU A;  3A8K E;  3PUZ A;  1KRS A;  4QB4 A;  2HT1 A;  2ZM6 L;  4IAL A;  5EBC A;  3I4N H;  3CF5 A;  4YCU A;  2F0G A;  2JA5 H;  3PQI A;  1CKM A;  1YVC A;  3WDN A;  4IFD I;  1X3G A;  4A3I B;  1C4Q A;  4X62 Q;  1PZI D;  1EOV A;  3R3O A;  2IY5 B;  4RHS A;  2JA6 B;  1H9K A;  2Z0S A;  1WCM B;  1TWC B;  3KUP A;  4KKU A;  2F0L A;  4QCL A;  3K6O A;  1EQQ A;  5LMU L;  2F0E A;  1DOK A;  3O13 A;  3CCJ A;  3OSO A;  4JI4 L;  3OWF A;  1HNZ Q;  1KNE A;  3TSS A;  3J7A F;  4B3R L;  4G7Z C;  3S15 B;  2NUC A;  2Z9H A;  3K80 C;  2A68 C;  4QJF A;  3PGZ A;  1VQ4 A;  4DAV A;  1YIJ A;  1WD0 A;  1PTO H;  4RG1 A;  2K50 A;  2G9D A;  1HRJ A;  3M3Y H;  4CKB A;  5HUR A;  1XMQ L;  4K0K L;  1AE2 A;  1Z7T A;  3UE0 A;  2N88 A;  1LTL A;  1IBK Q;  4DK0 A;  1E1O A;  4IFD H;  1K83 H;  3GTL H;  4KHV A;  2VL6 A;  1A3U A;  4PMB A;  4IUV A;  5AFW A;  4JV5 L;  2ATW A;  3K0Y A;  4DUZ Q;  1LLR D;  1PRT B;  2D62 A;  3KF6 A;  5CYU A;  5C4Z A;  1U4M A;  3MTS A;  1SSO A;  5C3W A;  1KAA A;  3GQB A;  5JJK A;  2MFI A;  4ABN A;  1IBM Q;  2D2C C;  3J81 j;  4A3J H;  3C2P A;  1X55 A;  1XJV A;  4FXD A;  2EXD A;  3E6Z X;  1PH5 A;  1GVP A;  1NR4 A;  1V43 A;  4NXM L;  2NN6 I;  5FO9 B;  4IUU A;  1DM0 B;  3VYT A;  5IYB H;  1ML0 D;  1AH9 A;  2ZT9 C;  3RUZ A;  4K8I A;  4CKE A;  1JWU D;  2N78 A;  1YHQ A;  5GAH C;  3STB D;  2IHF A;  2B2V A;  4JBW A;  3CCE A;  4GN3 B;  2EVB A;  1JR0 D;  1MI2 A;  1V1P A;  5HY6 A;  4DK3 C;  4DU9 A;  2F0W A;  2DNC A;  2MP1 A;  1R9T H;  4GKJ L;  3S15 H;  1R9T B;  3HKZ G;  1S5D D;  4EX5 A;  1KQS A;  1QNU A;  5JVG 3;  2QDL A;  3K58 A;  1FD7 D;  1JOO A;  4IUT A;  1RTO A;  5AJ3 Q;  2EYL A;  3D31 A;  2B2T C;  2E2J H;  1ICW A;  1CK1 A;  1M8A A;  1K73 C;  4JI2 L;  2Z4H A;  3DWA A;  2NVT H;  1RTN A;  3LGJ A;  3UDX A;  1AP0 A;  1K8M A;  2N55 A;  3TRZ A;  2UUA L;  4CDD C;  4C56 C;  4C3I B;  1ENC A;  1SJH D;  1AZQ A;  3D0F A;  4IQZ A;  2K6A A;  3HKZ B;  1HFN A;  1EZ6 A;  3KDF A;  4BY7 G;  3RD4 A;  1DZ1 A;  4DR6 L;  4DN4 M;  2CKZ B;  2F3W A;  5J1Z A;  5CV4 A;  3MWY W;  2SNM A;  1UAP A;  2ZJP A;  4KHP Q;  1BBX C;  1IBL Q;  3V2T A;  1WFQ A;  1AE3 A;  1EFW A;  1NY4 A;  1CA6 A;  2UU9 Q;  2WAQ B;  2B2U A;  4A4I A;  5EKK A;  2CQA A;  4L5Q A;  3JAM i;  3MZ5 A;  2B2T A;  4LWC A;  1SYC A;  2HD3 A;  4ME3 A;  3PO3 G;  2VXW A;  1EWI A;  4B9X A;  2A69 D;  2Z6K C;  2KHS A;  4R8I A;  4R1J A;  1ESF A;  2R7Z B;  5EGT A;  2WKC A;  4JI7 Q;  4X3S A;  2AKW B;  2SEB D;  1NBW A;  4LAA A;  1JE5 A;  1HTL D;  1MKH A;  2F0P A;  4A3G B;  4QIW E;  3G6J B;  3F2U A;  3A7L A;  4IUQ A;  3HOZ G;  4DAM A;  3JC6 6;  3CME A;  3ULL A;  3S17 B;  4A3K B;  3KLR A;  4KY7 A;  4LNQ A;  5ELE A;  4DR3 L;  2A19 A;  1FJG Q;  2JA6 G;  4QUF A;  2PMZ B;  4NMZ A;  1DGS A;  1ILQ A;  3JAM L;  2SDF A;  3I4M B;  4YIJ A;  3I4N B;  4DR5 L;  3RNU A;  1HR0 W;  4LF4 Q;  1B9N A;  1V1O A;  2HDM A;  4IFD J;  1I6H B;  1KIX A;  4QF4 A;  5C0X I;  3W1B A;  2JP1 A;  5M3M G;  5IWA L;  1WCM H;  4OON A;  4IPH A;  5FO7 B;  2K4K A;  2K5V A;  3TZU A;  5T1G A;  1EZ8 A;  4MNO A;  4GOP A;  2HDL A;  1H9J A;  2A1A A;  3IFD A;  3GTJ H;  3S2H B;  2N3S A;  2ID0 A;  4IO9 A;  5G3L F;  4MIU A;  1HTP A;  1M4V A;  2QEX A;  1SLJ A;  1KNA A;  1VCI A;  3S1R H;  1I94 L;  2EXZ A;  1C48 A;  1EQT A;  4HJA A;  4CDC C;  1Y8O B;  2M9V A;  2K5W A;  2K28 A;  2ZTD A;  2PW5 A;  4R8N A;  3A5U A;  1VQ8 A;  2F0S A;  2MJ8 A;  5GAD C;  5ELF A;  4ALP A;  2A74 C;  2K7V A;  3CCQ A;  4A3L H;  1SRO A;  5J39 A;  4GN4 B;  3HOV G;  4DV5 Q;  4C3I H;  3HEJ A;  1MGS A;  1TII D;  3QJY A;  1JC7 A;  1HNX L;  2EYP A;  2O5J C;  1C0A A;  4DKA C;  3AFP A;  4A3K H;  4EQN A;  3VR5 A;  1F2Z A;  2HCI A;  3A54 A;  2PNR C;  1Q82 C;  1TWC H;  2R3Z A;  1UE7 A;  4X3T A;  1E7Z A;  1F9P A;  3HOV B;  1KHI A;  3WWV A;  5IYD H;  1ZYR C;  4X66 Q;  4BY7 B;  1EUJ A;  5F2D A;  4DV7 Q;  2ALY B;  1SAP A;  3RZO H;  1OXS C;  3EBE A;  2YU9 H;  1KRT A;  3HOZ H;  2GVA A;  4X64 L;  2R92 H;  3P20 A;  4KY5 A;  1I4H A;  1I4R A;  3M4O B;  4RCN A;  1STE A;  4YCV A;  4AQY Q;  2K5H A;  1O7L A;  4DV1 Q;  2UXC Q;  1E2V A;  3R8B A;  4A3E G;  3BDC A;  4DR4 Q;  1VQN A;  2F0I A;  1UEB A;  1PV4 A;  5E7N A;  2HHH L;  1KDB A;  3IL8 A;  2WB1 E;  2C9O A;  2R93 B;  3NWT A;  3R2I A;  3HGB A;  4K14 A;  1GM5 A;  4P2C B;  5IWA Q;  2F3I A;  3QWN A;  1ASZ A;  1B1Z A;  2EY5 A;  3Q23 A;  4XQN A;  1K9M C;  1BOS A;  4P74 A;  5A2Q E;  5EBD A;  1WTO A;  1JJC B;  4RKL A;  3L3O C;  4JBK A;  2LFN A;  4HR7 B;  2NVX H;  4ZUI A;  5EKL A;  3DM3 A;  5CR3 A;  1WTQ A;  2NVX B;  1VQB A;  2A5H A;  1S5B D;  2F0V A;  1V9P A;  5BN5 A;  2PZT A;  2E2H H;  3B6Y A;  4O0A A;  3KJP A;  4F8M A;  2KOL A;  4ZRZ A;  3H3V I;  3PO3 B;  1MBY A;  1SMY D;  2VQF Q;  2JK8 A;  2SNS A;  1B8A A;  4UP9 A;  4R9W A;  4TKO B;  5M5W H;  1YIT A;  1VF5 C;  1XTD A;  2K5D A;  4JI5 L;  5C3X A;  3I4N G;  5KGU A;  1O7I A;  2CCZ A;  2B2Y A;  2M00 A;  2NZH A;  5D65 A;  1BNZ A;  3D4D A;  1Q8K A;  2FIN B;  1XTC D;  2EYH A;  2CHB D;  1U4L A;  4YY3 L;  1H9S A;  1LT6 D;  3HOZ B;  2Z8L A;  5ELN A;  2OWO A;  3U4V A;  3GP7 A;  2F0O A;  2HHH Q;  1STG A;  4XQJ A;  1Z6H A;  4HIM A;  1EYD A;  4A3D G;  4RGO S;  3D4W A;  2NVY B;  5C44 H;  3LWE A;  1OXV A;  1JQY D;  2CFM A;  4DF7 A;  3G6E A;  1LV9 A;  4JI0 L;  3AU7 A;  1PFB A;  4POG A;  4JYA L;  2IT1 A;  4LW1 A;  3OTO L;  3CCU A;  4OX9 L;  3FRP B;  3NBI A;  2FFK B;  2EJF C;  3EN2 A;  4WFN 3;  1G8Z D;  4DR4 L;  3E9I A;  1IBM L;  3GTK B;  4AQY L;  1N32 Q;  1B2T A;  5IYB G;  4X3K A;  4A3C H;  2TMP A;  2UXD Q;  1K0R A;  2K5N A;  5ELD A;  1LTI D;  4AYB E;  3HOW G;  4KV6 A;  1I4X A;  1NR2 A;  2OCE A;  4A3I G;  5KND A;  4S3S A;  2HCC A;  2CWA A;  4A3F H;  4WJ4 A;  3CP0 A;  3TDQ A;  4DV0 L;  3ER0 A;  3L0O A;  2PQE A;  4K0K Q;  4DR7 Q;  1EIH A;  4GLA C;  3VR6 A;  4PMW A;  3I91 A;  3MVV A;  3MFG A;  4Y7N B;  3HOU B;  3VR2 A;  1PLF A;  4CGY B;  3HOU H;  2B2Y C;  1CFM A;  1NAP A;  3GTJ B;  1G91 A;  1O7Y A;  4BXX G;  5I6W A;  4IFD G;  4HMI A;  4JI0 Q;  3RLO A;  1IYJ B;  2I0Q A;  5FK9 C;  1P16 A;  2EJM A;  2BH8 A;  1VQI A;  4B3S Q;  5KYI A;  2UUC L;  5IP7 H;  3I72 A;  5ISR A;  1IL8 A;  1SNQ A;  1I4P A;  5I4D A;  1CM9 A;  5H1S E;  4DV3 L;  3DEO A;  5E1F A;  4DR3 Q;  5M5Y B;  2MGS A;  2B8G A;  1UE5 A;  1H95 A;  5JAV A;  4GNX B;  5K36 H;  2AQ2 B;  2VW9 A;  4K6D A;  1PH7 A;  1CZG A;  4OO1 I;  1XYI A;  1KXL A;  2PI2 E;  2PW7 A;  4UP7 A;  2PNH A;  4RAU C;  1L0X B;  5IGF A;  1X54 A;  2Y0S E;  3RN2 A;  1U4R A;  3E3X A;  3CQZ B;  4A93 H;  4AYB G;  1IKL A;  3KK7 A;  3PUW A;  5IT9 L;  1CKN B;  1YNJ D;  4C3J H;  2EYM A;  2RCF A;  2AQ3 B;  1UE1 A;  3NBH A;  4R4O A;  2PQA B;  2PPB C;  4MTN A;  2ENB A;  1TU2 B;  3F1Z A;  1RD9 D;  3MXN B;  3TRE A;  5EPJ A;  5KNB A;  5EQ0 A;  1Y1V H;  4DV0 Q;  5GRO A;  4LF9 L;  3RLF A;  1N8R C;  3OPO A;  2UUA Q;  4LF8 L;  4O1N A;  1V1P B;  2AWN A;  2FMC A;  1VQ7 A;  3R93 A;  3SXH A;  1BBW A;  3K5M A;  1SNO A;  2NVQ B;  2ZJQ A;  1ASY A;  2A6H C;  3TQY A;  3MEH A;  4OGQ C;  1SNC A;  4KHP L;  5C0X G;  2EYJ A;  3M3Y B;  3M7N A;  1J5E Q;  1PMR A;  4UPA A;  4LFC Q;  3VR3 A;  5IGB A;  4LFA L;  3S1Q H;  3ULP A;  4BBS H;  1HZ9 A;  4FF3 A;  1YJ9 A;  1BR9 A;  1TWG B;  3S1Q B;  1V1Q A;  4K2L A;  3BZD B;  1BVS A;  4BS9 A;  3M4Y A;  2E76 C;  2HQE A;  4H0L C;  4PMC A;  4DV4 Q;  1OXT A;  2FMM A;  1VQP A;  1PZK D;  1EQR A;  2I5L X;  1I6V C;  4GOP B;  1OXX K;  1I4Q A;  2EE1 A;  3RMH A;  3UI2 A;  3CCM A;  4C3J G;  4GKK Q;  4MTK A;  3I7F A;  1EOT A;  1XPR A;  5AJ3 L;  1H9M A;  2JN4 A;  3KF8 A;  3STB C;  1SYD A;  4ZKC B;  4JI8 L;  1EIF A;  3A0J A;  4JVZ A;  4UAI A;  3I55 A;  2L55 A;  2I5H A;  1DOM A;  1TT2 A;  2VQF L;  2YU9 B;  1JOR A;  3AMU A;  1JWM D;  4JYA Q;  1IXR A;  3EIV A;  4XYQ A;  4OIK A;  4TVA B;  3S2D B;  1S40 A;  1JE4 A;  4X64 Q;  4HIO A;  4I65 A;  4HMJ A; 
#chains in the Genus database with same CATH homology
 4C3J B;  1EQV A;  4HSP A;  4PQX A;  3T13 A;  5CBA E;  5BN3 A;  1PFN A;  1EFI D;  1GOZ A;  2IJ0 A;  1LT4 D;  2K01 A;  1MD2 D;  3SK8 A;  4N9P A;  2K32 A;  2LMC B;  2KED A;  3JAM E;  4ODG A;  1EY8 A;  1F77 A;  1STA A;  1HXY D;  2KCC A;  3NTI A;  5CV6 A;  1DXM A;  3WOF A;  1O80 A;  2I46 A;  3M7G A;  3K5N A;  2RDH A;  1ZYR D;  3C1E A;  2M2L A;  5EPL A;  1TVX A;  5C6A A;  5M9O A;  2E2D C;  4DGZ A;  1STY A;  2BE5 C;  3S14 B;  2V4D A;  3J81 E;  1TY0 A;  4KD4 A;  3TN2 A;  4BY1 B;  1BDO A;  5JEA G;  1I4G A;  1YNN C;  2Q8I B;  1CI3 M;  3NHH A;  4A3F B;  1DD2 A;  2R6G A;  2JA8 B;  3J7Y W;  5IGC A;  1DON A;  2JSO A;  1LO5 D;  1Y8N B;  1ET9 A;  4JK1 C;  1V8Q A;  1QCB D;  4ZQ3 A;  4XDX A;  4A3M B;  4K6L A;  3SDZ A;  1VMC A;  4DAY A;  1LTR D;  2PZW A;  1AEX A;  2NN6 H;  4KJN A;  1HUN A;  1QWY A;  2F0T A;  2EOT A;  1GHK A;  1GHJ A;  1LTA D;  2ZXO A;  2RDG A;  3SK5 A;  3M85 A;  2SOB A;  1HA5 A;  1NSN S;  1HQR D;  4A3B B;  4CJ1 B;  1D2B A;  4C3H B;  1FNW A;  3A8I E;  2F0F A;  3QIA A;  5FLX L;  3C46 A;  2BA1 A;  3MC0 B;  2J4X A;  4PNY A;  3S1R B;  1JCK B;  3QO2 A;  4KD3 A;  2OEO A;  1VDZ A;  4HCE A;  4X3U A;  4FF1 A;  1FNU A;  3MXU A;  1SNM A;  4QMG A;  3OHX C;  2QIL A;  2H4O A;  4FF2 A;  1B50 A;  4G7O C;  2FHT A;  3I3C A;  1BO0 A;  5E4X A;  1ILP A;  4F7X A;  4G4K A;  3I90 A;  4EVO A;  4FO2 A;  5M3M B;  5IT9 E;  2EJG C;  2IW3 A;  1PTO D;  3GTM B;  2VB3 X;  1F9S A;  5ELB A;  2B2V C;  1D6E C;  3FEW X;  4OO1 H;  1TS4 A;  5C3E B;  3DXJ C;  3PUY A;  3BYT B;  1KLU D;  3GTO B;  5IOD A;  2EYF A;  3PUV A;  3AB9 A;  2VB2 X;  5IGD A;  2A6E D;  3H3V C;  3DWQ A;  4F87 A;  5E3F A;  5FKA C;  2VNU D;  4RCO A;  5LHY 1;  1S5C D;  3OW7 A;  2X69 A;  1WVL A;  1JIC A;  3R2T A;  1YNJ C;  4HSV A;  1W6J A;  2RSN A;  2PCF B;  1BCP D;  2Z1C A;  4ZYS A;  1EIG A;  3RZD B;  1R4P B;  5A35 A;  3PIO 3;  1SE3 A;  1HPC A;  4K5X A;  5JOB A;  3TME A;  3DUZ A;  3EVQ A;  3CRK C;  3BVG A;  4GZY C;  2Q8R E;  2X6L A;  5IGG A;  4Q5V A;  4TSS A;  1SE4 A;  5K36 G;  5G3L D;  2PO4 A;  4UDU C;  3H09 A;  1FYC A;  4ILW A;  1EY0 A;  2KJX A;  3J7A V;  1EYA A;  2K03 A;  3FMC A;  1X3Q A;  1F2Y A;  4Q0F A;  1WTR A;  2TSS A;  3HOY B;  3S9W A;  2KEE A;  3J81 L;  4H44 C;  1Q1E A;  4ME5 A;  3FPP A;  4CJ2 C;  3K5L A;  3NP8 A;  1EYC A;  1X3P A;  1B53 A;  4RHR A;  5KEE A;  1J8I A;  5IGE A;  1ET6 A;  1O7Z A;  4M1U B;  2XIW A;  3A56 A;  3EQL C;  1EWH A;  1L0Y B;  5C5L A;  3D6W A;  2ZXP A;  1TS3 A;  2F0Q A;  1BCP C;  1X32 A;  3Q0A A;  4XIG S;  1H9R A;  2L11 A;  2BA0 A;  3Q22 A;  5LL6 X;  2F0J A;  2K5Q A;  4AYB B;  1BCP B;  2NTT A;  3PIP 3;  4TQU S;  2XWJ B;  1IW7 C;  1KLG D;  3K5O A;  3X3M A;  5EPK A;  2F3V A;  1LTT D;  1EU4 A;  5I6Y A;  5KIX A;  2F0M A;  2PYK A;  2JEB I;  4KTA A;  4FYD A;  4EQO A;  1IKM A;  4H13 C;  3ONA B;  4K5V A;  2K04 A;  3NUC A;  1AN8 A;  5BN4 A;  4ID6 A;  5CC4 A;  1PTO F;  3TP5 A;  1OO9 B;  3N6R A;  2JYO A;  1PZJ D;  2XSC A;  5LL6 S;  3L7Z C;  1O78 A;  3MXN A;  5DAU A;  1HFG A;  1SDF A;  1CQV A;  2XWB B;  3IAY A;  3TBI B;  1E2Z A;  1D1I A;  3KBX A;  2D9U A;  2F0U A;  2BE5 D;  3DWP A;  3EJI A;  2NWG A;  4BWG B;  5FOB B;  2IWH A;  2ICE C;  3HOX B;  4U68 A;  1UEA B;  1Y1V B;  1GUW A;  5K5P A;  1EY9 A;  4K5W A;  1JB3 A;  2XRQ D;  3URY A;  1CHP D;  1XXG A;  1PTO C;  2IPK D;  2OF1 A;  2WII B;  1FGB D;  2RBM A;  3GTG B;  3C1F A;  3GTP B;  4LJZ C;  3MXG A;  3PO2 B;  5CMD A;  1ESR A;  4KMU C;  4RA8 A;  2JA7 B;  3ND8 A;  5D3D A;  4A93 B;  3A8J E;  1SMY C;  1LTB D;  4HAE A;  4N9T A;  4FNF A;  5M5W B;  1LTG D;  2CW0 D;  3QB3 A;  3GV3 A;  4C3H G;  2VUM B;  1BUV T;  2D5D A;  4A3J B;  4RKB A;  4XXE A;  1CA5 A;  2CVR A;  1QNK A;  1HCZ A;  1LT3 D;  2RVL A;  1GJX A;  3S16 B;  1GUO A;  3OMG A;  2ICI A;  1VMP A;  5C4H A;  2MUY A;  3PV0 A;  4XT1 B;  3D3R A;  4V19 0;  2GA4 B;  5CBE E;  1J9O A;  1H9S B;  4MN3 A;  2EZV A;  1MSG A;  3N52 A;  1KDA A;  1QB5 D;  3TP8 A;  5CV9 A;  1HQM C;  3CHB D;  5ELC A;  3BVZ A;  4WOR A;  3VA7 A;  3MAQ A;  1RF2 D;  5KRU A;  2IX1 A;  2AUK A;  2IX3 A;  2KVM A;  3SR1 A;  1E2W A;  1D1K A;  5CV8 A;  1E0B A;  4CBV A;  1G2T A;  2RA4 A;  3FPU B;  1A3T A;  4TRD A;  3U9S A;  3NTK A;  4DK1 A;  1SBB B;  3D6C A;  4CJ0 B;  4KKS A;  4H7B A;  4EQP A;  1G2S A;  4KKT A;  1WTP A;  4FF4 A;  4DXG A;  3MXP A;  1WTW A;  1EY6 A;  1F9Q A;  1D5X C;  4LMQ D;  2A68 D;  2XNA C;  3V96 A;  2E2J B;  2J0T D;  4ZK9 B;  4B9W A;  4FVM A;  1SEB D;  5DEH A;  1B9M A;  1HUM A;  3GO5 A;  4M8A A;  3DEP A;  1T5X D;  1TWH B;  3GTL B;  4XQQ A;  1IYU A;  3NSW A;  3OWE B;  3VYR A;  1SYF A;  4ZKB B;  3BS1 A;  4XTC S;  3NQT A;  2XVS A;  3LX0 A;  3MHB A;  5KYL A;  2QKI C;  3DM1 A;  1EWC A;  3TP6 A;  1KTK A;  1W6K A;  2DNE A;  1K8O A;  5EJW A;  1SFO B;  1PTO B;  5I9P A;  2L9H A;  1D5M C;  3H0G B;  1S4Z A;  1TQO A;  2O2L D;  2F03 A;  5DM7 3;  1EY5 A;  1WTV A;  1LT5 D;  2XN9 C;  2FJ2 A;  3KLS X;  4Z9C B;  2F0N A;  4J6H A;  1TS5 A;  3GTQ B;  3T4A C;  3T53 B;  2HUG A;  1A2U A;  4BA1 I;  3HG9 A;  2BDO A;  4C1N I;  1F2L A;  3K59 A;  1RCV D;  4L6T B;  1B4O A;  4K2K A;  4C1N K;  2WP8 J;  3TZD A;  2EY1 A;  1Q8I A;  1ROD A;  3HZX A;  1SNP A;  2LS0 1;  4KY6 A;  3ERQ A;  3SK4 A;  1WD1 A;  5EKI A;  4ZUJ A;  4BA2 I;  3T56 B;  2H1E A;  2WB1 B;  1EL0 A;  3WOE A;  2QF7 A;  2I07 B;  1DCZ A;  4FXG C;  4FXK C;  2NZ1 D;  3EA6 A;  5C4X B;  4KK7 A;  4HCS A;  5IIF A;  2E74 C;  5C44 B;  2RDF A;  2B2W C;  3T51 B;  5FO8 B;  2NTS A;  1K83 B;  3DMU A;  1SYE A;  4L63 B;  1BQQ T;  4RGN A;  5IOC A;  5COR A;  1DOL A;  2EY6 A;  1JWS D;  3BG3 A;  4G7H C;  1MSH A;  5M3F B;  1B44 D;  1C8C A;  4XYO A;  1HA6 A;  2K33 A;  5I2Y A;  4BBR B;  3P7J A;  3NE5 B;  5J22 A;  4HN7 A;  1GUN A;  5A2Q L;  2BOS A;  1U9R A;  1TKW B;  2B2U C;  2WIN B;  2OT2 A;  1AW7 A;  1ENA A;  4DAP A;  3A7A B;  3NXW A;  4ZAI A;  2Z4I A;  1SXT A;  3S1M B;  2O4X A;  3NQI A;  2Y0S B;  3CU7 A;  1Y69 U;  2MHV A;  1PYW D;  3FDT A;  3H91 A;  1JOK A;  2F0D A;  3W3A A;  2B2W A;  1TY2 A;  2EY2 A;  3NWS A;  3FKI B;  1II3 A;  5T1I A;  3OOC A;  1DYQ A;  3J80 E;  3E5S A;  3KLS A;  1BF4 A;  2A73 B;  3ZYY X;  5FLX E;  3T16 A;  4DXF A;  1XX8 A;  1EU3 A;  1A2T A;  4U67 3;  4QIW B;  1STH A;  3ND9 A;  4J1M A;  3H94 A;  1GUT A;  3I4L A;  3K7A B;  3C3L A;  1PDQ A;  5C0X J;  1Q90 A;  3VA5 A;  4C2M B;  3LNN A;  4A3D B;  2R61 A;  5DM6 3;  1PRT D;  2WV6 D;  2B63 B;  4ZLT F;  1RJT A;  3SVM A;  1SYG A;  1BXT A;  1Q12 A;  1EEF D;  2RQX A;  3HS0 C;  4ULL A;  1Y1W B;  2A69 C;  1ZXT A;  1EY4 A;  3Q6S A;  4QUC A;  2WAC A;  3HOW B;  2B39 A;  1SE2 A;  2CW0 C;  1T5E A;  1LAC A;  1D5Z C;  2RKS A;  1SYB A;  1CHQ D;  1GUS A;  2AUJ D;  3BVM A;  1G29 1;  2NYZ D;  5CV7 A;  1R4Q B;  5CGK A;  1EEI D;  2QEJ C;  1B3A A;  2XRS D;  3IFT A;  4V0B A;  3D4R A;  1IW7 D;  1FR3 A;  4C3I G;  2Q8T A;  4WJW A;  4LK1 C;  1PRT C;  2F0K A;  1QOH A;  1TWA B;  2YYZ A;  1FNV A;  1F2M A;  4RFB A;  1A15 A;  2L5T A;  3VR4 A;  2G9H D;  2NB0 A;  3NTH A;  3IKJ A;  2L1B A;  5JPM C;  2X6G A;  3SK6 A;  1TR5 A;  1PXU A;  3QG1 A;  4I7Z C;  3OIQ A;  1Q1B A;  3D8G A;  3I8Z A;  4OHJ A;  1NUC A;  4PV1 C;  2QDB A;  1OXU A;  3G7L A;  4IN3 A;  5I2X A;  1PRT F;  1XWE A;  2O5I C;  5M5X B;  2EYO A;  1CT1 D;  3I70 A;  3Q24 A;  4KHZ A;  1YNN D;  4HTH A;  2NVT B;  3P75 A;  4IUP A;  3P1H A;  2QCP X;  1HHV A;  3X3N A;  3W2D A;  2L0C A;  3OIP A;  2JA5 B;  2IL8 A;  4OL7 A;  1I3Q B;  2C5C A;  5C4J B;  4KI0 A;  3SE0 A;  3SEB A;  3S1N B;  2KCN A;  2F4I A;  1BCP F;  4DNT B;  3CRL C;  5NUC A;  4RGT A;  3ERO A;  1QIL A;  1QG7 A;  3BYY B;  2BCO A;  1JOQ A;  3V05 A;  3ITP A;  2EPB A;  2R92 B;  1ONL A;  2IX0 A;  3DHQ A;  2KA7 A;  4DFA A;  2K05 A;  2EDG A;  3L9A X;  2DN8 A;  2L12 A;  1PFM A;  2NN6 G;  1G6Z A;  1Y8P B;  5HGT A;  1GUG A;  3BDL A;  3NPP A;  4RGM A;  1Z47 A;  4A3E B;  2L4N A;  2LY7 A;  3CKI B;  1KAB A;  3I73 A;  3PMF A;  2PZU A;  4KJO A;  1SND A;  4F88 A;  4O42 A;  4HED A;  4NKL A;  1CZW A;  3MA2 B;  5JEA H;  4L8J A;  5DNF A;  2OXP A;  1A3V A;  3GD7 A;  2AQ1 B;  2DY7 A;  1IHZ A;  1A6X A;  1QJO A;  4DNR B;  2KQ3 A;  4IUN A;  2KUM A;  1GXD C;  5D3I B;  5JEA J;  1IYV A;  4WRD A;  4BBS B;  4OO1 G;  1DJR D;  3PUX A;  2MPM A;  2B8F A;  3BDO A;  1CQF A;  4CHT B;  1NCV A;  4J8Q A;  1EY7 A;  2F1M A;  4IZ8 A;  1SJE D;  3GV6 A;  2K1B A;  4EGV A;  3J80 L;  5TSS A;  2WKD A;  5JJZ A;  4KN7 C;  2ZXR A;  5JVH 3;  3EFX D;  3QOL A;  5COY A;  2RSO A;  5I9O A;  1WTX A;  2A6H D;  3KBG A;  3RZO B;  1UUP A;  3MFY A;  1TWF B;  2E75 C;  1VF7 A;  1I50 B;  3VYU A;  1RHP A;  2E2I B;  4E6I A;  2DY8 A;  1AZP A;  1STN A;  3U9O A;  3A55 A;  4DA2 A;  5KNC A;  2JEA I;  3HP3 A;  1UNS A;  3H6M A;  4NW2 A;  3VYS A;  1U4P A;  1RDP D;  3FVQ A;  4XT3 B;  3E0J A;  5D14 A;  1S5E D;  5C5M A;  1Q3L A;  2J7Z A;  2AWO A;  4K8J A;  3HRZ C;  3TP7 A;  3LWU A;  1LAB A;  4CKC A;  2A6E C;  4MHE A;  2E2H B;  2JXM B;  3K57 A;  2KEC A;  4G57 A;  3SHL A;  5CV5 A;  4KN4 C;  4B08 A;  3QOJ A;  4RWS C;  1ZEQ X;  1KDC A;  1S5F D;  2NBF A;  5C0X H;  4RH6 A;  1LTS D;  4FP5 D;  5JPN C;  1TS2 A;  1AFP A;  3NK9 A;  5E4W C;  4OIJ A;  2F0H A;  4IUR A;  1QE6 A;  3OMC A;  4NP5 A;  1ENF A;  1STB A;  1F9R A;  1ZKO A;  2LKV A;  1CTM A;  2BDN A;  1RKN A;  4NDX A;  2JE6 I;  3A8K E;  3PUZ A;  4QB4 A;  4IAL A;  5EBC A;  2F0G A;  3WDN A;  4IFD I;  4A3I B;  1C4Q A;  1PZI D;  3R3O A;  4RHS A;  2JA6 B;  1H9K A;  3KUP A;  1WCM B;  1TWC B;  4KKU A;  2F0L A;  4QCL A;  3K6O A;  2F0E A;  1DOK A;  3O13 A;  3OSO A;  3OWF A;  1KNE A;  3J7A F;  3TSS A;  4G7Z C;  3S15 B;  2NUC A;  2A68 C;  4DAV A;  1WD0 A;  1PTO H;  2G9D A;  1HRJ A;  4CKB A;  5HUR A;  1Z7T A;  2N88 A;  4DK0 A;  4IFD H;  4KHV A;  1A3U A;  4PMB A;  4IUV A;  5AFW A;  3K0Y A;  1LLR D;  1PRT B;  2D62 A;  5C4Z A;  5CYU A;  1U4M A;  3MTS A;  1SSO A;  5C3W A;  1KAA A;  3GQB A;  4ABN A;  2D2C C;  4FXD A;  3E6Z X;  1NR4 A;  1V43 A;  2NN6 I;  5FO9 B;  4IUU A;  1DM0 B;  3VYT A;  1ML0 D;  2ZT9 C;  3RUZ A;  4K8I A;  4CKE A;  1JWU D;  2B2V A;  4JBW A;  2EVB A;  1JR0 D;  1MI2 A;  1V1P A;  4DU9 A;  2F0W A;  2DNC A;  2MP1 A;  1R9T B;  1S5D D;  1QNU A;  5JVG 3;  3K58 A;  1FD7 D;  1JOO A;  4IUT A;  1RTO A;  2EYL A;  3D31 A;  2B2T C;  1ICW A;  1CK1 A;  1M8A A;  2Z4H A;  3DWA A;  1RTN A;  1AP0 A;  1K8M A;  2N55 A;  4C56 C;  4C3I B;  1ENC A;  1SJH D;  1AZQ A;  4IQZ A;  2K6A A;  3HKZ B;  1HFN A;  1EZ6 A;  3RD4 A;  1DZ1 A;  4DN4 M;  2F3W A;  5J1Z A;  5CV4 A;  3MWY W;  2SNM A;  1UAP A;  1BBX C;  3V2T A;  1CA6 A;  2WAQ B;  2B2U A;  5EKK A;  2CQA A;  3MZ5 A;  2B2T A;  1SYC A;  2VXW A;  4B9X A;  2A69 D;  2KHS A;  4R8I A;  1ESF A;  2R7Z B;  5EGT A;  2WKC A;  4X3S A;  2SEB D;  4LAA A;  1HTL D;  2F0P A;  4A3G B;  3G6J B;  3F2U A;  3A7L A;  4IUQ A;  3S17 B;  4A3K B;  3KLR A;  4KY7 A;  5ELE A;  4QUF A;  2PMZ B;  4NMZ A;  3JAM L;  1ILQ A;  2SDF A;  3I4M B;  4YIJ A;  3I4N B;  1B9N A;  1V1O A;  2HDM A;  4IFD J;  1I6H B;  4QF4 A;  5C0X I;  2JP1 A;  5FO7 B;  3TZU A;  5T1G A;  1EZ8 A;  2HDL A;  1H9J A;  3IFD A;  3S2H B;  2ID0 A;  5G3L F;  4MIU A;  1HTP A;  1M4V A;  1KNA A;  1VCI A;  2EXZ A;  1C48 A;  1EQT A;  1Y8O B;  2M9V A;  2K5W A;  2K28 A;  2PW5 A;  4R8N A;  2F0S A;  2MJ8 A;  5ELF A;  2A74 C;  2K7V A;  5J39 A;  3HEJ A;  1MGS A;  1TII D;  3QJY A;  1JC7 A;  2EYP A;  2O5J C;  4EQN A;  3VR5 A;  1F2Z A;  2HCI A;  3A54 A;  2PNR C;  2R3Z A;  4X3T A;  1F9P A;  3HOV B;  1ZYR C;  4BY7 B;  5F2D A;  1SAP A;  1OXS C;  3P20 A;  4KY5 A;  1I4H A;  1I4R A;  3M4O B;  4RCN A;  1STE A;  1O7L A;  1E2V A;  3R8B A;  3BDC A;  2F0I A;  1KDB A;  3IL8 A;  2C9O A;  2R93 B;  3NWT A;  3R2I A;  3HGB A;  4K14 A;  4P2C B;  3QWN A;  1B1Z A;  2EY5 A;  3Q23 A;  4XQN A;  1BOS A;  5A2Q E;  5EBD A;  1WTO A;  4RKL A;  3L3O C;  2LFN A;  4HR7 B;  4ZUI A;  5EKL A;  5CR3 A;  1WTQ A;  2NVX B;  2A5H A;  1S5B D;  2F0V A;  5BN5 A;  2PZT A;  4F8M A;  2KOL A;  4ZRZ A;  3PO3 B;  1MBY A;  1SMY D;  2SNS A;  4R9W A;  4TKO B;  1VF5 C;  2K5D A;  5C3X A;  5KGU A;  2B2Y A;  2M00 A;  5D65 A;  1BNZ A;  3D4D A;  2FIN B;  1XTC D;  2EYH A;  2CHB D;  1U4L A;  1H9S A;  1LT6 D;  3HOZ B;  2Z8L A;  3GP7 A;  2F0O A;  1STG A;  4XQJ A;  1Z6H A;  1EYD A;  4RGO S;  3D4W A;  2NVY B;  3LWE A;  1OXV A;  1JQY D;  4DF7 A;  1LV9 A;  3AU7 A;  1PFB A;  2IT1 A;  3FRP B;  3NBI A;  2FFK B;  2EJF C;  4WFN 3;  1G8Z D;  3GTK B;  1B2T A;  4X3K A;  2TMP A;  5ELD A;  1LTI D;  4KV6 A;  1I4X A;  1NR2 A;  5KND A;  4S3S A;  2HCC A;  3TDQ A;  2PQE A;  1EIH A;  3VR6 A;  4PMW A;  3I91 A;  3MVV A;  3MFG A;  4Y7N B;  3HOU B;  3VR2 A;  1PLF A;  4CGY B;  2B2Y C;  3GTJ B;  1CFM A;  1NAP A;  1G91 A;  1O7Y A;  5I6W A;  4IFD G;  4HMI A;  5FK9 C;  2EJM A;  5KYI A;  3I72 A;  5ISR A;  1IL8 A;  1SNQ A;  1I4P A;  5I4D A;  1CM9 A;  3DEO A;  5E1F A;  5M5Y B;  2MGS A;  2B8G A;  5JAV A;  5K36 H;  2AQ2 B;  4K6D A;  1CZG A;  4OO1 I;  1XYI A;  2PW7 A;  5IGF A;  4RAU C;  1L0X B;  1U4R A;  3CQZ B;  1IKL A;  3KK7 A;  3PUW A;  5IT9 L;  1YNJ D;  2EYM A;  2AQ3 B;  3NBH A;  3C2P A;  2PPB C;  2ENB A;  1TU2 B;  1RD9 D;  5KNB A;  5EPJ A;  5EQ0 A;  3RLF A;  3OPO A;  4O1N A;  1V1P B;  2AWN A;  2FMC A;  3R93 A;  3SXH A;  3K5M A;  1SNO A;  2NVQ B;  2A6H C;  3MEH A;  4OGQ C;  1SNC A;  5C0X G;  2EYJ A;  3M3Y B;  3M7N A;  1PMR A;  3VR3 A;  5IGB A;  4FF3 A;  1BR9 A;  1TWG B;  3S1Q B;  4K2L A;  3BZD B;  4BS9 A;  3M4Y A;  2E76 C;  2HQE A;  4H0L C;  4PMC A;  1OXT A;  2FMM A;  1PZK D;  1I6V C;  1OXX K;  1I4Q A;  2EE1 A;  3RMH A;  3UI2 A;  4C3J G;  1EOT A;  1H9M A;  3KF8 A;  1SYD A;  4ZKC B;  4UAI A;  2L55 A;  1DOM A;  1TT2 A;  2YU9 B;  1JOR A;  3AMU A;  1JWM D;  4XYQ A;  4OIK A;  3S2D B;  1JE4 A;  4I65 A;  4HMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...