5C12A

Nuclease domain of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
242
structure length
230
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 78
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c12A00
4IFEA 5C12A 5C15A 5M1FA 4IEIA 5M1PA 5M1NA 3CPEA 5M1OA 5C2DA 3C6HA 4IDHA 5M1QA 5C10A 5C2FA 5M1KA 3C6AA 4IEEA
chains in the Genus database with same CATH superfamily
2HW3A 5GADP 3KHYA 1S6QA 5M1KA 1NGEA 1NOZA 2O8DA 2FBVA 3J7ZO 3FZFA 4CGIA 1SKSA 2B4JA 4BG8A 3CCJN 1XMOK 4XH5A 3OYLA 4CERA 1KC8O 2XO7A 1NK4A 1UOCA 3NVKA 4OVLA 4YDUA 4YNQA 5CZ1A 2B6AA 3K0SA 4X66K 3O3FA 1ZBUA 4FM2A 5AQWA 1ZBLA 1KVCA 2Q36A 3NF9A 1CZAN 3OYFA 2KHOA 3RMBA 3PY8A 4CJ5A 5AQRA 3RRHA 2UXCK 3ALYA 4FOEA 2HNYA 4M45A 4J2AA 3OYAA 1IV0A 4CZJA 4HTLA 4FW2A 1BCOA 3CJBA 4IEIA 4Z4IA 1BISA 1TKDA 1TKTA 3DYAA 3BF3A 3P4IA 3OY9A 1J53A 4DV4K 1QZ5A 4L3QA 4BE2A 4CZFA 2P9LB 4Z4HA 3ZT0A 1NLVA 2HHWA 3AVLA 4LSLA 4KB1A 4CGHA 4CJ4A 3QBWA 1X9JA 4I7FA 5JICA 4KH6A 3CCQN 3V1QA 1SAZA 4CHPA 4CF1A 3TAQA 3MEDA 4CEEA 1RTDA 4N41A 3E1YA 3ULEB 4KKOA 4FYDA 4BY9C 4E1NA 3EN9A 3T1YK 3CPEA 4Z0UA 5GINA 4CBUA 4CZHA 1OH7A 3V9ZA 1RDCA 2FSJA 3VQAA 2GV9A 4KAZA 3I55N 3SLCA 3SJHA 4FVUA 2Q1NA 4I9QA 1D8YA 5AQZA 4HVJA 4CGDA 3I0SA 4CIFA 2I5JA 3PIOL 2NRTA 2JGUA 2F4VK 4RW9A 4Y1DA 2P5OA 3CYMA 1NMNA 2YNIA 2I7PA 2HHHK 1C0GA 5CY4A 3VEZA 4M3YA 4DV0K 5E84A 3I8DA 4WFNL 2QWRA 3DLRA 1KSPA 1YHQN 3HPHA 2YHYA 1RT2A 2H3GX 3OYNA 2PAVA 3SQ0A 4H0YB 4ICLA 1GLCG 4BRGA 1VQ4N 1HKCA 3PUFA 4DUYK 3NMUA 2HF4A 1O13A 1QSSA 4OPHA 3A5NC 2YKNA 4BR4A 3NE6A 3UKRB 3ZSRA 1I3AA 1GLEG 3L4IA 1XMQK 1P90A 3HP6A 4CF0A 2HBKA 5CE3A 4UQGA 2RE2A 4JKBA 4FJXA 1J5OA 3D2EA 4WFBL 2IVOA 3SBGA 3L0QA 1OH6A 4ELUA 3PX4A 3WQUA 1RT1A 5C42A 1VQON 2ZD1A 1BA0A 1L3VA 3G25A 3MCPA 4CK1A 1SV5A 4F4KA 3CF5L 5EX5A 4MO4A 3O9TA 4FVMA 3VQBA 4RTFD 4BRMA 3DRPA 4B3TK 4FK4A 1MU2A 2YKMA 3THWA 3BGRA 3QIOA 3P31A 4XEIA 5FPEA 3CQ8A 1K73O 3O6WA 2WUSA 4AHCA 2W41A 2KQ2A 2HF3A 4CJFA 4JKAA 4C8NA 1FJGK 4C8OA 1U4BA 1W9HA 3T7ZA 4WQ5A 3EYZA 3ZX2A 1RNHA 1HX1A 1RFQA 4BR5A 4MLEA 4FLWA 1RDBA 5AQYA 3PLAA 1WSIA 5HL7L 2OPPA 3DWLA 3B6PA 4JV5K 1RT7A 4M3ZA 1EXQA 2V52B 3ZETA 1YAGA 1RTIA 3RTVA 4C8KA 3AVHA 4J8FA 2FF3B 5GIPA 3CXCM 4Q5VA 5GAGP 4R5PA 1TVRA 3DLEA 3IMXA 2E5LK 1A5VA 1TV6A 4M3XA 1VSIA 2ZF5O 3QFUA 1XNRK 3HPOA 2BE2A 2P1JA 1NGCA 2P9NA 2G8WA 1Z26A 4W5TA 3NFAA 2XY8A 3U9DA 3TAFA 4FL9A 2NZTA 4H0VB 3THXB 3FLCO 2KFNA 4N76A 3CETA 3F73A 1YTAA 2E2PA 3HM9A 3P83D 3UB5A 3E66A 1X9MA 1KVBA 2VG6A 4I6MB 4N47A 2E1YA 4JI3K 1NK9A 1T05A 1WBBA 3HT3A 4JI4K 1JKHA 1IH7A 5J2NA 1VSJA 1U45A 4CEAA 3ZSWA 2RKIA 1YF5L 2ZWHA 3ENBA 3LDQA 4H5NA 4DSEA 5EOYA 2QEXN 1NGDA 1YVUA 4J2BA 2VQFK 2P5GA 4LFAK 4GKKK 3VGKA 3ID6A 5BPNA 4OPJA 3K9JA 1BQNA 3LL3A 1FXXA 3DJCA 4BE1A 1HNWK 2BANA 5LMUK 1S1VA 4FZYA 3WNGA 2VQEK 2OPRA 1YITN 1X1PA 4E89A 3PSIA 3CQXA 4F9OA 5FRMA 1Z25A 3LANA 1WSFA 1IG8A 4KTQA 1N6QA 2BUPA 1NNEA 2NRWA 3NF7A 3MCAB 3U9ZA 1IBMK 4EFHA 2NRZA 1RDAA 4CVNE 1HMVA 5AQOA 4B1XB 2IVNA 4HUFA 3M3ZA 2CGJA 4YY3K 4YOXA 4AHRA 1RILA 4JKDA 3V6DA 3E01A 3HYFA 4BGAA 5LMNK 3AA2A 5BREA 1FK9A 5DM6L 3OS1A 4JI2K 4RWTA 3LWLA 1LWEA 1TL1A 3JXUA 3C6AA 4BR2A 4BRKA 4DV1K 2UUCK 3SPZA 5AZJB 1LOTB 3OTOK 2GEMA 2LSNA 4FJ5A 5C24A 2O8EB 3QFPA 3NAEA 5FPNA 3SBTA 4DF8A 1EQYA 2V51B 3V81A 4IEEA 3K9KA 1Q86O 2HMIA 5C12A 2NRHA 2ATQA 4KPYA 4DQRA 4N5SA 4E1JA 4CZLA 3OVNA 4RCHA 1NKEA 4CJUA 4M7YA 3NGZA 1VSDA 4JHDB 4QS9A 1GOCA 4CK2A 1IKWA 4FOIA 5AQQA 4FJNA 3H45C 1WAJA 3QICA 5AQLA 4BRFA 4HWIA 3AA3A 4FLZA 4CGGA 3I0RA 3JSMA 3AV9A 1BQMA 1RBVA 3DM2A 3AA5X 4CE9A 5BPLA 1W7AA 4CZIA 3OS2A 4DSIA 3KK7A 3WXIA 3V4IA 4WQ4A 4FXDA 3NH0A 1KAYA 4B9MA 4O5BA 5AQKA 2FSKA 3HTVA 2D0CA 3A2FA 1YTUA 1JL1A 3LM2A 1Q9XA 5EU7A 3N4PA 1RBSA 3LDOA 3T69A 5M1PA 4BQZA 4B1YB 2OA8A 4NYNA 3HJFA 3C0BA 4LF9K 4GNIA 1VSHA 4CEBA 3R3LA 1SQKA 4BRHA 1YJ9N 4BQLA 3ITHA 3AVIA 1I39A 1XC9A 4I9LA 2QK9A 2J4RA 1Q81O 3DXKB 2O8FA 4JKCA 3BZKA 3E9PA 4JRQA 1U6ZA 2IS3A 2HBJA 1K8KA 3ZYYX 3VQ5A 3J80O 2E20A 3AGRA 1K8AO 1OH5A 4RW4A 1EWRA 4CEDA 2DFEA 3MX5A 2O4IA 3AVMA 4E7JA 3HSCA 2AP1A 2F7TA 3DXMB 4KRFA 1BG3A 3AY9A 4FZZA 3UKUB 2G8IA 1NU0A 2P9SB 4BC4A 3ZLJA 5CYQA 3J7AP 2BDPA 3O08A 2D0OA 2KZZA 4LF7K 4DR3K 4DMNA 3U3GA 2F96A 4BDPA 1E3MA 1VRTA 4CJWA 1BA1A 1XHXA 4OPKA 4YFUA 1JLBA 2E4LA 3WXMB 3C95A 4FJ8A 3VQ4A 2D0BA 3VF6A 5TKWA 1QHAA 2YV0X 3FFIA 3KTQA 4H0PA 3LDPA 4DFMA 1KCFA 4EHUA 1YI2N 3TAPA 4WFAL 2OZSA 3ZEUB 4EHTA 4HCCA 1LV5A 2ASMA 4OKKA 4DHYA 3O5BA 3L3UA 3PO4A 3H1QA 1WSHA 1HQUA 1ZC6A 3L2UA 3RVCA 3EZ5A 4IKFA 1NGIA 3A0IX 3F2KA 1V4TA 3HSTB 1TAQA 3SNNA 1WLJA 3QESA 3MXMA 4BVOA 4KHSA 3EE9A 4IO9L 1BL3A 2HSTA 4WCEL 1BI4A 1WSGA 4DV2K 2HNDA 3OYHA 4HCBA 1XNQK 4JD2A 3QERA 1NGJA 2P9KA 4CJTA 1YJNN 3OYKA 2UU9K 4B9UA 4CEQA 2IGIA 4AH9A 5AQTA 1NG9A 3QEVA 3L3VA 4MQ3A 1WSJA 3WNFA 3C6HA 3ENHA 2P9IA 1NWKA 4B9TA 1RT3A 1X3MA 2WONA 3BUZB 3V1OA 3PX0A 4JKGB 4DFPA 4IFYA 4CZGA 4F8RA 1RTHA 2OZMA 3G6EN 2P9PA 3KWGA 3PO5A 3FZKA 1NJIO 3AVGA 1NGAA 5BPMA 2Y1JA 2O8BB 1IJJA 3U8XA 1JCFA 4J2DA 5IT9O 3HXMA 1BIZA 3NDKA 3PX6A 3QEXA 3KK2A 1MDUB 4DB3A 4JK9A 1TUUA 5HROA 4K8ZA 3LZJA 4ILJA 1ASWA 3K58A 2QWPA 4OX9K 4A62A 1SL1A 3ZCMA 4B3RK 4G9ZA 1TL3A 3C7NA 4WYBA 1RTJA 3GOIA 5FPMA 3ISNC 2WOMA 2KLAA 4FK0A 4JRPA 2OPSA 3OYMA 4PKGA 1IKXA 4FWPA 3THYA 5ELZA 5AQGA 1EETA 5T7BA 1SZ2A 1C0MA 4FJIA 4C1NK 3SPYA 4DV6K 4HUEA 4DS5A 4CCHA 4OJRA 1VQ5N 1K9MO 3J7YP 4AHUA 1BO5O 2A1SA 2GBZA 1IKYA 2JWKA 4KBOA 2O8DB 1RBRA 3QEWA 2ETJA 1S5JA 1T6CA 2IDOA 3VGLA 4BRNA 1QSLA 5FROA 4CJPA 2X6NA 4AHVA 3MAQA 1TYQA 4DQQA 3G0ZA 4OKJA 2CH6A 3O9QA 2KW4A 3SAGA 4LD0A 5LL6Z 2Q3SA 3SI6A 3J8AA 3V1RA 4O0IA 4OKEA 3LAKA 3VENA 1REVA 3O80A 4EZ9A 3V9XA 1A5WA 2QM1A 1KQSM 5J1EA 1N5YA 1HQEA 1KAXA 3MECA 5DM7L 2BH1A 1ATRA 1NJXA 3SUNA 4DUZK 1WB9A 2FBXA 3WEEB 3U6FA 4LH4A 4GV9A 1DKGD 1NOYA 4YOWA 4NLBA 1UAXA 3O3GA 4Z4GA 1L3UA 3MN7A 4WQ4C 4FJGA 2CGKA 1JLGA 1F21A 3ZT2A 1D9FA 1C6VA 4BC2A 1CZ9A 5FLXO 1VK0A 1QQMA 2NRRA 4Y0WA 2FBTA 5AFUH 2QXLA 3H46O 3K2PA 3A5LC 3CM6A 4OO1J 2D0PA 1HPMA 3OJUA 4CZEA 4H5RA 4JYAK 3CCVN 3JYTA 4FM1A 4BR0A 5AQUA 2OYQA 4CHOA 2ZE2A 5AQFA 4BR7A 3ZT1A 1L3TA 3FZHA 1VAZA 5KPRA 4BDYA 3V9WA 3CJ7A 3VQ9A 3K5MA 4DTPA 4ZTFA 4LF8K 3SMPA 4Z4EA 1S1UA 3IDHA 4ID1A 4IG0A 4E19A 3LPTA 1VQLN 1QQOA 4FWRA 3SK3A 5KPTA 2UXBK 2FSNA 1JCGA 1EO1A 4DQIA 1JXEA 3ZSXA 2ZGZA 4ISFA 3LPUA 3ULEA 3AGKA 4YORA 4JI7K 4I2QA 4B3MK 2W6LA 4JEPA 1S22A 5KRSA 3M1FA 3VEXA 1JL2A 4NXNK 2HVIA 3TABA 3ULDA 4LFBK 4KTWA 1VQ9N 1ILYA 5C2FA 1OVYA 4JNEA 1C0TA 4IDKA 4K41A 2HMPA 3QBXA 4JS5A 5HRRA 3SUQA 4YOUA 3KIOA 1MA9B 1LWCA 3VEYA 1KRPA 3QNOA 4JAXA 3QNNA 3VTIA 5I9EB 1SKWA 4B8CA 5FDLA 3DLBA 5KQDA 2HHSA 5AQIA 2A6AA 3F9KA 1UA1A 4IJNA 4RG8A 4DR4K 4FWSA 3DLGA 4PL7A 4DLEA 3UKRA 4NO7A 2X74A 4PA1A 5H1SQ 1NGBA 2V7YA 5AQMA 4FJHA 1VQ7N 3CG7A 3ZX3A 5AQSA 4U7BA 5AZIB 1A5XA 3D0PA 3I33A 3SV3A 4IOAL 3LP1A 4JLHA 1HPZA 4B1WB 5C25A 1RBUA 1KVAA 5F2RA 4QAGA 3AVCA 3PIPL 5C2DA 4AQYK 3HK2A 3S3OA 3H1VX 2KFZA 3TR8A 3ZX0A 2EX3A 3F5TA 3ENOA 1HYSA 4IZ9A 4B1ZA 2UYTA 4JS4A 3CCEN 1IKVA 1HYZA 3AA4A 1TKZA 1BGXT 2WTUA 4CF8A 5AQXA 1EKEA 1U47A 5HBMA 1HJRA 2DTUA 1WSEA 4O55A 4DR7K 3AARA 1ESVA 4NLCA 2E6MA 1Q18A 2DY4A 3A8YA 3TU5A 5CHIA 1C0FA 5J2QA 3MEEA 3WXLA 1FW6A 3WUHA 3FZLA 3QIPA 3THXA 2PY5A 2DPNA 1DT9A 3VQQA 5GAHP 3L2VA 4GMJB 1E4GT 2FC0A 4E7IA 4B9SA 1O1WA 5B8HA 3ZSZA 3F9MA 1N33K 1KLMA 5AQVA 4E0DA 3MX2A 2ZJRL 4FWNA 3I8BA 4W5OA 1N8RO 2P9UB 2E88A 3RR8A 4CJLA 1I94K 3MXJA 3CFRA 4IOXA 2E6LA 3VETA 4JK7A 4YDUC 2EHGA 1ZXOA 4B1VA 3VESA 4AHSA 5BRDA 4Q0BA 1JJ2M 3N4QA 3VMFB 4FM0A 4R79A 4DTJA 4FPAA 4O4GA 4LFCK 3UIQA 3VQ6A 1T8EA 1GOAA 4FO0A 1N36K 3O1BA 3MWPA 1BU6O 4FW1A 1DEJA 3L2RA 1Q8IA 3C94A 5JMVA 3P38A 3R9PA 4CFCA 2NLXA 3FGUA 5DK5A 3QLHA 3ATVA 5CYMA 1VSMA 4F2SA 1D4XA 3HM8A 1VQKN 1NJWA 5SZTA 3KLIA 4KI6A 3G4SN 2VGNA 3AVBA 4IG3A 3OJSA 4FPBA 1ASUA 3HO1A 2DFFA 4FWMA 1LCUA 4OGCA 5LJVA 4JKHA 2QKBA 4CEOA 1S9GA 1C1BA 3QDKA 3HRGA 1RDDA 4CHZA 3MN9A 2HNZA 3ID8A 3EY1A 4IFEA 3MXIA 3K5OA 2YHBA 5AR0A 1DTQA 3IG1A 3SCXA 4DQPA 4CFAA 3ZT4A 4DG1A 3OYBA 4DWIA 4KHPK 2D0AA 4A5BA 5M1QA 1NJYA 5TKYA 1QVFM 5AZJA 3W3DA 1JLAA 4DR1K 5HLFA 2Z1JA 2O8EA 5KGWA 4CF2A 5C10A 3QEIA 4FLXA 4DCHA 5D3GA 4M63C 3E9LA 4OLAA 2DFHA 2Y1IA 3VPZA 4B9NA 3TSQA 3GDQA 4JHDA 3CQYA 4KB0A 3QEPA 3SJJA 4IJAA 1GLFO 3D6RA 3DI6A 4B3SK 4GVEA 1S9EA 1U2VA 4CHQA 4PWDA 1QTMA 4KHYA 4IWVA 3MEGA 3TAEA 4IOCL 1NK6A 2O8FB 3I56N 1YXQA 3D45A 2ZM6K 2Z1HA 3SAHA 3IFRA 2YNGA 4CW7B 3FZMA 3V9SA 4FWQA 4FJMA 1VSKA 4CECA 1IBKK 3RSEB 2WC9A 2XRIA 5I3UA 4PHTX 3KKRA 3CC7N 1IO2A 4QOZB 3WXJA 1B9FA 4L8RB 3CIPA 2KTQA 3TTFA 1X9SA 3K5NA 2D1KA 4M3RA 4X65K 4CJKA 1Y64A 3NBPA 2YI1A 4N56A 2B5JA 3U4LA 3O3HA 1RDWX 3CM5A 4G1QA 3DXKA 4WQ5C 3VQ7A 4CJRA 4FZXC 2X78A 4ILGB 2XHBA 4YOVA 4DLGA 3LALA 3TI0A 4DSLA 3CFOA 3M8QA 1HYVA 4FJ7A 1QZ6A 4UY8O 3AAQA 4CJVA 4IBNA 3DRRA 4CD1A 4LF6K 3KLHA 2O8CA 1TUYA 4B08A 3ZSYA 3DAWA 5LY3A 3UKUA 5M1FA 1N32K 3VQCA 4IXCA 4GV3A 4C8MA 3RR7A 3MN6A 1VQ8N 3QINA 1IG9A 4BRDA 4BRPA 2RPIA 1HLUA 4NCGA 1SL2A 1KTQA 3GE1A 3O4WA 3O9UA 4JD2B 1S1WA 2XY7A 4K25A 4LC9B 3AO3A 2G8UA 1UA0A 4ID5A 3ZEUA 5KGXA 3LDLA 3TTDA 3L2WA 1HNXK 4CESA 5HP1A 3CMEN 4NYFA 2JWLA 1VQNN 5AQHA 4JN4A 4IO8A 1C1CA 4A59A 3OYGA 4B3OA 4HTUA 5E41A 5KTQA 1BWFO 3VA3A 2Z1GA 5E26A 2BGGA 3IKMA 5IWAK 3NCIA 4DU4A 3RMAA 2HBLA 3E9OA 1OKJA 3HOSA 3TARA 1ZBSA 1BCMA 1J54A 2D5RA 4BRLA 4ZTJA 2VWBA 4CEFA 1ATNA 3RMCA 4CZMA 3M6GA 1HUXA 3CI5A 3PV8A 2HHQA 1NGGA 3NVMA 4M3TA 3M8SA 1G99A 3CMAN 2NRVA 4B9QA 3QMLA 1QE1A 4BR9A 4GY2B 1D9DA 1Z05A 2HVHA 1XC3A 3JS6A 1NGHA 4JKGA 4I2PA 4NCAA 3OYCA 5GAEP 3THYB 4PL8A 5JVGL 2FF6A 2RHKA 4BVPA 1NMDA 4E1MA 4AILC 3D2FA 1E4FT 4NCBA 4A61A 4MFBA 3VTHA 2O8BA 2QW9A 1CXUA 4DSKA 3H3NO 4EP4A 4DTUA 1Q9YA 1YT3A 2VCPA 4A2BA 4DSFA 4H4MA 3OW2M 3EL2A 2I7NA 1CXQA 2YHAA 2QWOA 5EXWA 3SMSA 4E7LA 2KZMA 3HVTA 2P51A 4WF9L 3VN5A 4X64K 2XY5A 1T03A 4O0JA 2IAJA 3TSPA 3VQ8A 4DU1A 4B1UB 2QWLA 1D5AA 3W0LA 4CI6A 3QETA 1NK5A 3AVFA 1Q82O 1KD1O 1NM1A 2IOCA 4HHTA 4GVMA 1VHXA 4LF5K 3HVRA 2YCHA 4GKJK 1RCHA 2A5XA 4BC5A 4CHNA 1FKOA 5BN8A 2YNFA 5F1XA 1YVNA 3S41A 1HNIA 5KI6A 4ELTA 4BREA 4DTMA 1RGIA 4W5QA 3RRGA 1W2BM 3CFPA 4C1NI 1RBTA 5C0YA 3LP3A 2GTDA 4A57A 4BGBA 4DTRA 4H4OA 3CPWM 4RW8A 1HR0K 1LAVA 3EZWA 3VEWA 4EZ6A 5JS1A 2HBMA 2PFUA 4E7KA 2FXUA 2A41A 2NUBA 2F9TA 1NBWA 2GUPA 4M7XA 2HHVA 3WQTA 1L3SA 3DMJA 3KWIA 4XH1A 3IS9A 4CEZA 3WEEA 3T1HK 4CIEA 2ZJQL 5M1OA 2Q0RA 4BDZA 3OHRA 4KO0A 1C0UA 1JLFA 3VF2A 1J6ZA 4AM7A 2VWJA 2GELA 4DSJA 2P9LA 4KHNA 3BZCA 4A5AA 3O1WA 4MDAA 4YHHK 1P8ZA 3ZT3A 1QQCA 3J81O 1S6PA 2AA4A 5C15A 1RT4A 3K59A 3O4QA 1HRHA 3AO1A 4AHTA 3H3OB 5JLFA 1S72N 2FBYA 3LAMA 4CF9A 1X9WA 4FJLA 4FK2A 2YX6A 4JI5K 4CBWA 4DQ8A 4OPAA 4O44A 1SS6A 1C1AA 1ZBFA 1VQMN 1L5UA 1HNVA 3QO9A 5FRNA 4CJ7A 2Q0UA 2GX9A 5SWMA 2D4WA 4M3WA 4B8AB 1WAFA 3NF6A 3HZ6A 4BRIA 4FJJA 1HJOA 3B6OA 3BY5A 4M41A 3CCUN 4Z94A 3IAYA 3D2EB 2G8KA 1KLNA 3L6QA 3LM9A 2NRXA 2QXFA 4BRAA 2HHXA 4DTNA 1TK8A 3VQPA 3TANA 3GL1A 4LF4K 5J2PA 3T1AA 3AVKA 2UUAK 3S9HA 4H5TA 3KVGA 2YHXA 4ISGA 4Z4CA 2F8TA 3L8BA 4U67L 5BR9A 1S1XA 2CH5A 2ZJPL 1K6YA 1U49A 4FLYA 3THWB 1OVQA 3T19A 1UWBA 5JS2A 2Q97A 2ZGYA 3R1XA 3KD1E 4JI1K 3ZSOA 2A1RA 4DFKA 3FR0A 3GBTA 2PBDA 4QCLA 1GOBA 2ASOA 3OYEA 1XI1A 4Y1CA 4BWMA 3KLFA 1HKBA 3SQ2A 2PYLA 2JLEA 1JLEA 1T3VA 4EP5A 2XY6A 3DLHA 3G10A 3NHGA 4DTXA 5KQ8A 1JXBA 4V19S 2WBNA 3L4QA 2O4GA 2OTLN 3ZETB 3DRSA 3C6TA 1JCEA 3WXKA 1TK5A 1QS4A 4LY7A 2CGLA 3HP9A 4CGFA 3LDSA 1EX4A 1NGFA 5A2QO 1Q7YO 4J2EA 3P1GA 4O8KA 2P9NB 3MN5A 4DFJA 1NK7A 1SKRA 1BUPA 4TSXA 4F2RA 3P5JA 2QKKA 1WUAA 5AZIA 4O5FA 1XWLA 3IUCA 2AJQA 4JKFA 1N34K 1X3NA 4K42A 2PZSA 1QQNA 2G8VA 2UXDK 3CCSN 3FFKB 2X6SA 1RT5A 4MDBA 3M8RA 4PKHA 3SYZA 3P39A 1BDGA 3MWTA 1ATSA 3TWHA 3AVNA 3EEQA 1TGOA 1ITGA 2UUBK 4CJEA 1MWKA 4LSNA 1HKGA 4CZKA 2HHTA 3AO4A 3CCMN 4F3TA 3KK3A 1VSEA 4LH5A 4JI0K 1Y97A 4W5RA 1KAZA 5AQPA 4KTZA 4DTSA 1CZBA 1T44A 4ISEA 3VQDA 3EO3A 2G8FA 3KKSA 1NKCA 5JVHL 4CGJA 1QSYA 4I6MA 2V7ZA 3LP0A 3O9SA 3U3YA 1BOTO 3R6MA 4K8XA 3AO5A 3RWUA 3AVJA 3CC4N 1SUQA 3WT0A 3NGIA 1LAWA 4FLVA 2ASPA 4CD3A 1XHZA 4C23A 1IBLK 1M90O 5ADXA 2W6KA 3HL8A 1XUPO 1G15A 3KZBA 2Q31A 4DR2K 5AQNA 4H0XB 1U48A 4IFVA 3CJ1A 4KI4A 5BN9A 2YJEA 5EY4A 4CJ3A 4K0KK 3SUOA 3R8EA 3SQ4A 1QHTA 4KHQA 2HB5A 5BR8K 5JLHA 3RMDA 5K14A 3DOKA 3O4NA 3TAGA 1VQ6N 1T7PA 2P9UA 1V4SA 3HOTA 3NH1A 1WBDA 3CCLN 1VSFA 3JAMO 1LW2A 4BG9A 4CHYA 4XIUA 4CJQA 3T3FA 4MLHA 5AJ3K 3CD6N 1W97L 4E3SA 4JK8A 1ASVA 3Q7BA 2IVPA 4H03B 3GG4A 3KLGA 4DV7K 1RT6A 3TSUA 5J2MA 3UE5A 1S3XA 3VEVA 4BC3A 3OYJA 1W0HA 3SQ1A 3WNEA 3SV4A 2ITMA 1RDUA 4H8KA 1DGKN 3CC2N 2OTJN 4KREA 2YHWA 2GWJA 3V9UA 3H08A 1LW0A 2VG7A 3C65A 2E8AA 5HRSA 4CFDA 2YNHA 4BE0A 3A5MC 1ZBHA 3M5RA 3VERA 4PY5A 2Q2RA 2ITGA 1Z6RA 1EP4A 2A40A 4W5NA 2W42A 4GV6A 5CZ2A 1CLQA 5EVZA 1JLQA 4B9LA 2FLOA 1U2VB 3TAMA 3SAFA 1NK8A 3CJCA 3ATUA 4ZHRA 4DS4A 1VRUA 3ZSVA 1HNZK 2GWKA 4H0TB 4BROA 3NGYA 4CBXA 4DKWA 3S3MA 5AFUA 2RF2A 3LWMA 3NF8A 1WN7A 3KD5E 1TAUA 4KFBA 2VGMA 5MLCQ 1WNSA 5AQJA 2E1ZA 1M1KO 5BRHA 4FJ9A 1K8KB 1TKXA 2OCEA 5HRPA 3OBYA 5HRNA 3H6EA 1ZBIA 4ILHA 2HOEA 4BRQA 3B8AX 1R59O 2QTDA 4JI8K 4FCYA 4BACA 4E7HA 1JLCA 4C8LA 2W40A 1TK0A 1R0AA 4DF4A 1YUWA 2BTFA 3CJAA 3VGMA 3HBTA 1J5EK 5M1NA 4ELVA 2RN2A 3NH2A 2G8HA 1OH8A 4F3OA 3AO2A 3CHWA 5CR4A 4CFBA 4M3UA 4FWOA 2R7YA 4BWJA 2NNWA 1YJWN 4PQUA 2O8CB 4KH5A 5F0XA 3RSEA 2E2OA 3AVAA 4KV8A 4KHWA 3WNHA 4FSVA 3OYDA 4Z4FA 3DXMA 4KH4A 1NJZA 2IC3A 2A3ZA 3MDQA 2GUIA 1NK0A 1BIUA 3DLKA 4CIGA 2E2QA 2P9SA 3TPQA 3OA9A 3VQEA 3TTCA 5GIOA 4DQSA 4M42A 1BI4B 3G71N 3DOLA 3OS0A 1VQPN 2F8SA 5BRFA 1U04A 1FKPA 3AAPA 3EE8A 3OBWA 1ZYQA 4GW6A 1MWMA 4H5WA 1DTTA 1H1VA 2VYPA 1EWQA 2P9KB 1S1TA 3BF1A 3O9RA 1QVGM 4FJKA 1KXPA 3C6UA 4NXMK 3A5OC 4NB4A 4IDHA 4BRCA 3SZ2A 4OLBA 3OYIA 3KK1A 1KFDA 3DLLL 4DTOA 1NKBA 2P9IB 3FE1A 4PUOA 4JKEA 3M8PA 2OANA 2IIRA 3SUPA 4O8UA 4MO5A 3QB0A 4KHUA 3LZIA 3PSFA 4A2AA 4FLUA 4H0OA 2P9PB 2E2NA 4HUGA 4CJSA 3THVA 5I42A 3HI0A 4XH4A 5FPDA 2QWMA 1B92A 2Z1IA 1B9DA 2QWNA 4EIAA 4DV3K 3L2QA 3K5LA 3EKSA 4X62K 4DV5K 3VF4A 2VWKA 4AF1A 3HPGA 3MK6A 1DLOA 3ASMA 3CERA 3O8MA 4K43A 1XQSC 3LDNA 3C7NB 1GLJO 2ZQBA 4DR5K 2A42A 1YIJN 5KRTA 5KPZA 2PYJA 4FWKA 1GLDG 4YOYA 2QI2A 3D2FB 1VSLA 4EAHD 1LWFA 3IRXA 4DU3A 3S3NA 4AM6A 3MMVA 2YJFA 5ADXH 1KFSA 3ZSQA 2WFBA 4OGEA 5LJWA 3KJVA 4CK3A 2EWSA 4DR6K 2KKZA 3D7EO 2F9WA 4FWLA 1GLAG 4RW7A 4H5VA 3CCRN 4PKIA 4QS8A 2OPQA 4B9VA 2QWQA 2VG5A 1TYQB 4FLTA 3CJ9A 3BDPA 3VOVA 4YOTA 4QS7A 1SL0A 3Q7CA 1J9AA 5DMRA 1GLBG 4RW6A 3VEOA 3VA0A 4JI6K 1BHLA 3EKUA 3LP2A 2QA4N 2HHUA 4WE1A 3KLEA 1T6DA 3BEXA 1WOQA 3K57A 5HOOA 3BP8A 1GLLO
chains in the Genus database with same CATH topology
2Q97A 5JMVA 2ZGYA 1BA1A 3R1XA 3P38A 5GADP 3KHYA 3R9PA 2NLXA 3FGUA 3ATVA 5M1KA 1NGEA 3FR0A 3GBTA 3WXMB 1D4XA 3HM8A 1VQKN 3J7ZO 2PBDA 3FZFA 3VF6A 2VGNA 2ASOA 3G4SN 5TKWA 4FPBA 1QHAA 4H0PA 3LDPA 4BG8A 3CCJN 1YI2N 4EHUA 4XH5A 4WFAL 3ZEUB 4EHTA 1HKBA 1KC8O 2ASMA 4DHYA 3O5BA 4FWMA 1LCUA 1T3VA 3H1QA 4JKHA 5LJVA 5KQ8A 3NVKA 2WBNA 4YDUA 3QDKA 1ZC6A 3L4QA 3RVCA 2OTLN 3HRGA 3ZETB 3MN9A 5AQWA 1NGIA 3ID8A 3A0IX 1JCEA 4IFEA 2Q36A 3F2KA 5AR0A 3WXKA 1CZAN 1V4TA 2KHOA 5AQRA 4BVOA 3EE9A 4A5BA 2CGLA 4IO9L 4FOEA 1NGFA 2HSTA 1Q7YO 5M1QA 4WCEL 4O8KA 5TKYA 1QVFM 2P9NB 4CZJA 4HTLA 3MN5A 3W3DA 5AZJA 3CJBA 4IEIA 1BUPA 1WUAA 4JD2A 3BF3A 3P4IA 5AZIA 1NGJA 2P9KA 4O5FA 1QZ5A 4L3QA 5C10A 3IUCA 1YJNN 4CZFA 2P9LB 1NLVA 4JKFA 4DCHA 1X3NA 4K42A 4M63C 5AQTA 3E9LA 3QBWA 1X9JA 5JICA 1QQNA 3C6HA 4KH6A 3ENHA 3FFKB 3CCQN 3CCSN 2P9IA 1NWKA 3VPZA 1SAZA 4MDBA 1X3MA 3BUZB 3TSQA 3GDQA 4PKHA 3E1YA 4JKGB 4JHDA 3ULEB 3CQYA 3P39A 1BDGA 4CZGA 3MWTA 1ATSA 4BY9C 3EN9A 3CPEA 5GINA 2P9PA 3KWGA 4CBUA 3FZKA 4CZHA 3G6EN 1NJIO 4IJAA 2FSJA 1MWKA 1GLFO 1NGAA 1HKGA 3D6RA 4CZKA 4GVEA 5BPMA 3CCMN 1U2VA 3I55N 3SLCA 3SJHA 4FVUA 2Q1NA 1IJJA 3U8XA 1KAZA 1JCFA 5AQPA 4IWVA 5AQZA 1T44A 4ISEA 3EO3A 1MDUB 4DB3A 3PIOL 4IOCL 2NRTA 4JK9A 5JVHL 1TUUA 4ILJA 4I6MA 2QWPA 2V7ZA 4A62A 3I56N 1YXQA 3O9SA 4G9ZA 1BOTO 3R6MA 3SAHA 3IFRA 3C7NA 2I7PA 4WYBA 1C0GA 3GOIA 5FPMA 3FZMA 3VEZA 3CC4N 5E84A 3WT0A 2KLAA 4FWQA 4WFNL 2QWRA 2ASPA 4CD3A 1YHQN 4PKGA 2YHYA 2H3GX 4C23A 3RSEB 1M90O 4FWPA 5ADXA 2WC9A 5ELZA 5AQGA 1SZ2A 2PAVA 4PHTX 1XUPO 4H0YB 3KZBA 2Q31A 5AQNA 1GLCG 4C1NK 4H0XB 3CC7N 3WXJA 4BRGA 1VQ4N 1HKCA 3CIPA 1VQ5N 3TTFA 3CJ1A 1K9MO 3NMUA 2HF4A 1O13A 1BO5O 5BN9A 2YJEA 4OPHA 2D1KA 5EY4A 3A5NC 2JWKA 4KBOA 4BR4A 3UKRB 3R8EA 1Y64A 5JLHA 2YI1A 1GLEG 3L4IA 1RDWX 3U4LA 1P90A 3DXKA 1T6CA 2HBKA 4WQ5C 5CE3A 3VGLA 2RE2A 4JKBA 4ILGB 1VQ6N 3D2EA 4YOVA 2P9UA 4BRNA 4WFBL 1V4SA 2IVOA 3SBGA 3HOTA 3L0QA 3WQUA 3CCLN 1VQON 1QZ6A 1TYQA 4UY8O 3AAQA 1BA0A 2CH6A 4CD1A 3G25A 3MCPA 1TUYA 3O9QA 4BG9A 3SAGA 3CF5L 5EX5A 4MO4A 5HOOA 3DAWA 3J8AA 5LY3A 3O9TA 4MLHA 3UKUA 3CD6N 5M1FA 1W97L 3VENA 4RTFD 4JK8A 4BRMA 3O80A 3Q7BA 4IXCA 4GV3A 2QM1A 2IVPA 3P31A 4XEIA 3MN6A 1KQSM 5FPEA 1VQ8N 1K73O 4H03B 3O6WA 2WUSA 4BRDA 4BRPA 3GG4A 1HLUA 1KAXA 5DM7L 2W41A 3TSUA 2BH1A 1ATRA 2HF3A 4JKAA 3UE5A 1S3XA 3VEVA 4BC3A 3GE1A 3O4WA 4JD2B 3O9UA 4WQ5A 3T7ZA 3ZX2A 2ITMA 3WEEB 4K25A 4LC9B 1HX1A 1RDUA 1RFQA 4BR5A 1DGKN 4MLEA 3CC2N 4GV9A 2OTJN 1DKGD 3ZEUA 3LDLA 5AQYA 4YOWA 4NLBA 2YHWA 3TTDA 3PLAA 2GWJA 5HL7L 3CMEN 1VQNN 2JWLA 3MN7A 5AQHA 3DWLA 4JN4A 4WQ4C 3C65A 2E8AA 2CGKA 4IO8A 3ZETA 2V52B 3A5MC 1YAGA 4A59A 4BC2A 3M5RA 1QQMA 4J8FA 2FF3B 5GIPA 3VERA 3CXCM 2NRRA 1BWFO 4Y0WA 2Q2RA 5GAGP 5AFUH 2QXLA 3H46O 3IMXA 1Z6RA 2A40A 5E26A 3A5LC 4OO1J 4GV6A 2D0PA 1HPMA 2ZF5O 3IKMA 3QFUA 1NGCA 2P9NA 4H5RA 4CZEA 5EVZA 3U9DA 2HBLA 3CCVN 4FL9A 2NZTA 2FLOA 1U2VB 4H0VB 3E9OA 4BR0A 5AQUA 1OKJA 3SAFA 3FLCO 3HOSA 3CJCA 3ATUA 1ZBSA 3CETA 5AQFA 4BR7A 4BRLA 2E2PA 3FZHA 1VAZA 5KPRA 2GWKA 2VWBA 4H0TB 3UB5A 4BROA 3E66A 1ATNA 4CBXA 4DKWA 4CZMA 5AFUA 3M6GA 3CJ7A 1HUXA 3CI5A 4I6MB 1NGGA 2E1YA 3NVMA 1G99A 3SMPA 2VGMA 5MLCQ 3IDHA 5AQJA 1VQLN 2E1ZA 3CMAN 1QQOA 1M1KO 2NRVA 4B9QA 3QMLA 4FWRA 3SK3A 4BR9A 2FSNA 1JCGA 4GY2B 5BRHA 5KPTA 1EO1A 1Z05A 1XC3A 1YF5L 2ZGZA 1NGHA 2ZWHA 1K8KB 3ENBA 3JS6A 4ISFA 3LDQA 4JKGA 3ULEA 3AGKA 4H5NA 4YORA 5EOYA 5GAEP 4PL8A 5JVGL 3OBYA 3H6EA 4JEPA 2QEXN 1NGDA 1S22A 2FF6A 4ILHA 2HOEA 2RHKA 4BRQA 3M1FA 1NMDA 3B8AX 3VEXA 4BVPA 1R59O 2QTDA 3VGKA 3ID6A 5BPNA 3D2FA 1E4FT 3K9JA 3LL3A 4A61A 3DJCA 3VTHA 2QW9A 1VQ9N 2W40A 1YUWA 1ILYA 2BTFA 3CJAA 3VGMA 3H3NO 5C2FA 1OVYA 3HBTA 5M1NA 4JNEA 1YITN 2VCPA 4A2BA 3CQXA 4F9OA 4K41A 3OW2M 3EL2A 2HMPA 3QBXA 2I7NA 4YOUA 1IG8A 2QWOA 5EXWA 3SMSA 1MA9B 3CHWA 5CR4A 4WF9L 2BUPA 4FWOA 2NRWA 3MCAB 3U9ZA 2NNWA 3VEYA 4EFHA 2NRZA 1YJWN 5AQOA 4KH5A 3TSPA 5F0XA 3RSEA 2E2OA 4JAXA 4B1XB 3VTIA 2IVNA 3M3ZA 2CGJA 4B1UB 4FSVA 4YOXA 2QWLA 5I9EB 4JKDA 3W0LA 4CI6A 3DXMA 5KQDA 4KH4A 4BGAA 5AQIA 2A3ZA 2A6AA 3MDQA 5BREA 4IJNA 1Q82O 1KD1O 5DM6L 2E2QA 2P9SA 4FWSA 1NM1A 3TPQA 3OA9A 3TTCA 5GIOA 4RWTA 4PL7A 3UKRA 2YCHA 3JXUA 4NO7A 2A5XA 4BC5A 3C6AA 4BR2A 5H1SQ 3G71N 4BRKA 1NGBA 5AZJB 2V7YA 1VQPN 5BRFA 5BN8A 5AQMA 5F1XA 1LOTB 3AAPA 1YVNA 3S41A 3EE8A 2GEMA 1VQ7N 3OBWA 3ZX3A 5AQSA 4U7BA 1MWMA 4H5WA 4BREA 1H1VA 1RGIA 2VYPA 5AZIB 3QFPA 2P9KB 3I33A 1W2BM 3BF1A 3O9RA 1QVGM 5FPNA 3SBTA 4C1NI 1KXPA 4IOAL 1EQYA 2V51B 3A5OC 4NB4A 4IDHA 5C0YA 4B1WB 2GTDA 4IEEA 5F2RA 3K9KA 4BRCA 1Q86O 4A57A 4BGBA 2NRHA 5C12A 3DLLL 3PIPL 3CPWM 5C2DA 4E1JA 4CZLA 4RCHA 2P9IB 3FE1A 3H1VX 3EZWA 4JKEA 4M7YA 3VEWA 2HBMA 2PFUA 2OANA 3ZX0A 2IIRA 3F5TA 4JHDB 2FXUA 2A41A 3ENOA 4QS9A 2F9TA 4O8UA 4FOIA 1NBWA 2GUPA 4IZ9A 4M7XA 4MO5A 3QB0A 3WQTA 5AQQA 4B1ZA 3H45C 4A2AA 3KWIA 4H0OA 2UYTA 3QICA 4XH1A 3CCEN 5AQLA 2P9PB 4BRFA 3WEEA 2E2NA 4HWIA 2ZJQL 5M1OA 2Q0RA 3HI0A 4XH4A 5AQXA 2QWMA 5FPDA 3OHRA 4EIAA 2QWNA 3EKSA 1J6ZA 3VF2A 3VF4A 4AM7A 4AF1A 2GELA 2P9LA 3MK6A 5BPLA 3AARA 4A5AA 3O1WA 4MDAA 4CZIA 3CERA 1ESVA 3O8MA 1P8ZA 4NLCA 3KK7A 3WXIA 4K43A 4WQ4A 1XQSC 1KAYA 3LDNA 2AA4A 5C15A 1Q18A 3C7NB 3A8YA 1GLJO 3TU5A 5AQKA 2FSKA 5CHIA 2A42A 3HTVA 1C0FA 1YIJN 3H3OB 3LM2A 5JLFA 1S72N 5KPZA 3N4PA 4FWKA 1GLDG 3WXLA 4YOYA 3LDOA 2QI2A 2YX6A 3WUHA 4CBWA 3FZLA 3T69A 3D2FB 4OPAA 4DQ8A 5M1PA 4BQZA 4B1YB 1SS6A 2DPNA 4EAHD 1DT9A 5GAHP 1VQMN 4AM6A 3MMVA 3C0BA 2YJFA 5ADXH 1E4GT 4GNIA 2WFBA 3R3LA 1SQKA 5LJWA 4CJ7A 4BRHA 2Q0UA 2GX9A 1YJ9N 4BQLA 5B8HA 2D4WA 3F9MA 2EWSA 2KKZA 3HZ6A 3D7EO 4BRIA 5AQVA 2J4RA 1Q81O 2F9WA 1HJOA 3MX2A 3DXKB 2ZJRL 4FWLA 3CCUN 4Z94A 4FWNA 1GLAG 4JKCA 3I8BA 3D2EB 1N8RO 2P9UB 2E88A 3E9PA 1U6ZA 2HBJA 4H5VA 1K8KA 4PKIA 3ZYYX 3CCRN 4QS8A 3L6QA 3LM9A 1K8AO 2E20A 3AGRA 2NRXA 2QWQA 4BRAA 1TYQB 4IOXA 3VETA 3CJ9A 3MX5A 3GL1A 4JK7A 3VOVA 4YDUC 3HSCA 1ZXOA 4YOTA 2AP1A 2F7TA 3DXMB 3VESA 4B1VA 4QS7A 1BG3A 3Q7CA 5BRDA 3AY9A 4H5TA 1JJ2M 3KVGA 2YHXA 1GLBG 3N4QA 4ISGA 3UKUB 3VEOA 4FPAA 3VMFB 4R79A 2P9SB 4U67L 4BC4A 3EKUA 5BR9A 2CH5A 2QA4N 3O08A 2ZJPL 2D0OA 1T6DA 4FO0A 3BEXA 1WOQA 3O1BA 3MWPA 1BU6O 1DEJA 3BP8A 1GLLO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFE A;  5C12 A;  5C15 A;  5M1F A;  4IEI A;  5M1P A;  5M1N A;  3CPE A;  5M1O A;  5C2D A;  3C6H A;  4IDH A;  5M1Q A;  5C10 A;  5C2F A;  5M1K A;  3C6A A;  4IEE A; 
#chains in the Genus database with same CATH topology
 2HW3 A;  5GAD P;  3KHY A;  1S6Q A;  5M1K A;  1NGE A;  1NOZ A;  2O8D A;  2FBV A;  3J7Z O;  3FZF A;  4CGI A;  1SKS A;  2B4J A;  4BG8 A;  3CCJ N;  1XMO K;  4XH5 A;  3OYL A;  4CER A;  1KC8 O;  2XO7 A;  1NK4 A;  1UOC A;  3NVK A;  4OVL A;  4YDU A;  4YNQ A;  5CZ1 A;  2B6A A;  3K0S A;  4X66 K;  3O3F A;  1ZBU A;  4FM2 A;  5AQW A;  1ZBL A;  1KVC A;  2Q36 A;  3NF9 A;  1CZA N;  3OYF A;  2KHO A;  3RMB A;  3PY8 A;  4CJ5 A;  5AQR A;  3RRH A;  2UXC K;  3ALY A;  4FOE A;  2HNY A;  4M45 A;  4J2A A;  3OYA A;  1IV0 A;  4CZJ A;  4HTL A;  4FW2 A;  1BCO A;  3CJB A;  4IEI A;  4Z4I A;  1BIS A;  1TKD A;  1TKT A;  3DYA A;  3BF3 A;  3P4I A;  3OY9 A;  1J53 A;  4DV4 K;  1QZ5 A;  4L3Q A;  4BE2 A;  4CZF A;  2P9L B;  4Z4H A;  3ZT0 A;  1NLV A;  2HHW A;  3AVL A;  4LSL A;  4KB1 A;  4CGH A;  4CJ4 A;  3QBW A;  1X9J A;  4I7F A;  5JIC A;  4KH6 A;  3CCQ N;  3V1Q A;  1SAZ A;  4CHP A;  4CF1 A;  3TAQ A;  3MED A;  4CEE A;  1RTD A;  4N41 A;  3E1Y A;  3ULE B;  4KKO A;  4FYD A;  4BY9 C;  4E1N A;  3EN9 A;  3T1Y K;  3CPE A;  4Z0U A;  5GIN A;  4CBU A;  4CZH A;  1OH7 A;  3V9Z A;  1RDC A;  2FSJ A;  3VQA A;  2GV9 A;  4KAZ A;  3I55 N;  3SLC A;  3SJH A;  4FVU A;  2Q1N A;  4I9Q A;  1D8Y A;  5AQZ A;  4HVJ A;  4CGD A;  3I0S A;  4CIF A;  2I5J A;  3PIO L;  2NRT A;  2JGU A;  2F4V K;  4RW9 A;  4Y1D A;  2P5O A;  3CYM A;  1NMN A;  2YNI A;  2I7P A;  2HHH K;  1C0G A;  5CY4 A;  3VEZ A;  4M3Y A;  4DV0 K;  5E84 A;  3I8D A;  4WFN L;  2QWR A;  3DLR A;  1KSP A;  1YHQ N;  3HPH A;  2YHY A;  1RT2 A;  2H3G X;  3OYN A;  2PAV A;  3SQ0 A;  4H0Y B;  4ICL A;  1GLC G;  4BRG A;  1VQ4 N;  1HKC A;  3PUF A;  4DUY K;  3NMU A;  2HF4 A;  1O13 A;  1QSS A;  4OPH A;  3A5N C;  2YKN A;  4BR4 A;  3NE6 A;  3UKR B;  3ZSR A;  1I3A A;  1GLE G;  3L4I A;  1XMQ K;  1P90 A;  3HP6 A;  4CF0 A;  2HBK A;  5CE3 A;  4UQG A;  2RE2 A;  4JKB A;  4FJX A;  1J5O A;  3D2E A;  4WFB L;  2IVO A;  3SBG A;  3L0Q A;  1OH6 A;  4ELU A;  3PX4 A;  3WQU A;  1RT1 A;  5C42 A;  1VQO N;  2ZD1 A;  1BA0 A;  1L3V A;  3G25 A;  3MCP A;  4CK1 A;  1SV5 A;  4F4K A;  3CF5 L;  5EX5 A;  4MO4 A;  3O9T A;  4FVM A;  3VQB A;  4RTF D;  4BRM A;  3DRP A;  4B3T K;  4FK4 A;  1MU2 A;  2YKM A;  3THW A;  3BGR A;  3QIO A;  3P31 A;  4XEI A;  5FPE A;  3CQ8 A;  1K73 O;  3O6W A;  2WUS A;  4AHC A;  2W41 A;  2KQ2 A;  2HF3 A;  4CJF A;  4JKA A;  4C8N A;  1FJG K;  4C8O A;  1U4B A;  1W9H A;  3T7Z A;  4WQ5 A;  3EYZ A;  3ZX2 A;  1RNH A;  1HX1 A;  1RFQ A;  4BR5 A;  4MLE A;  4FLW A;  1RDB A;  5AQY A;  3PLA A;  1WSI A;  5HL7 L;  2OPP A;  3DWL A;  3B6P A;  4JV5 K;  1RT7 A;  4M3Z A;  1EXQ A;  2V52 B;  3ZET A;  1YAG A;  1RTI A;  3RTV A;  4C8K A;  3AVH A;  4J8F A;  2FF3 B;  5GIP A;  3CXC M;  4Q5V A;  5GAG P;  4R5P A;  1TVR A;  3DLE A;  3IMX A;  2E5L K;  1A5V A;  1TV6 A;  4M3X A;  1VSI A;  2ZF5 O;  3QFU A;  1XNR K;  3HPO A;  2BE2 A;  2P1J A;  1NGC A;  2P9N A;  2G8W A;  1Z26 A;  4W5T A;  3NFA A;  2XY8 A;  3U9D A;  3TAF A;  4FL9 A;  2NZT A;  4H0V B;  3THX B;  3FLC O;  2KFN A;  4N76 A;  3CET A;  3F73 A;  1YTA A;  2E2P A;  3HM9 A;  3P83 D;  3UB5 A;  3E66 A;  1X9M A;  1KVB A;  2VG6 A;  4I6M B;  4N47 A;  2E1Y A;  4JI3 K;  1NK9 A;  1T05 A;  1WBB A;  3HT3 A;  4JI4 K;  1JKH A;  1IH7 A;  5J2N A;  1VSJ A;  1U45 A;  4CEA A;  3ZSW A;  2RKI A;  1YF5 L;  2ZWH A;  3ENB A;  3LDQ A;  4H5N A;  4DSE A;  5EOY A;  2QEX N;  1NGD A;  1YVU A;  4J2B A;  2VQF K;  2P5G A;  4LFA K;  4GKK K;  3VGK A;  3ID6 A;  5BPN A;  4OPJ A;  3K9J A;  1BQN A;  3LL3 A;  1FXX A;  3DJC A;  4BE1 A;  1HNW K;  2BAN A;  5LMU K;  1S1V A;  4FZY A;  3WNG A;  2VQE K;  2OPR A;  1YIT N;  1X1P A;  4E89 A;  3PSI A;  3CQX A;  4F9O A;  5FRM A;  1Z25 A;  3LAN A;  1WSF A;  1IG8 A;  4KTQ A;  1N6Q A;  2BUP A;  1NNE A;  2NRW A;  3NF7 A;  3MCA B;  3U9Z A;  1IBM K;  4EFH A;  2NRZ A;  1RDA A;  4CVN E;  1HMV A;  5AQO A;  4B1X B;  2IVN A;  4HUF A;  3M3Z A;  2CGJ A;  4YY3 K;  4YOX A;  4AHR A;  1RIL A;  4JKD A;  3V6D A;  3E01 A;  3HYF A;  4BGA A;  5LMN K;  3AA2 A;  5BRE A;  1FK9 A;  5DM6 L;  3OS1 A;  4JI2 K;  4RWT A;  3LWL A;  1LWE A;  1TL1 A;  3JXU A;  3C6A A;  4BR2 A;  4BRK A;  4DV1 K;  2UUC K;  3SPZ A;  5AZJ B;  1LOT B;  3OTO K;  2GEM A;  2LSN A;  4FJ5 A;  5C24 A;  2O8E B;  3QFP A;  3NAE A;  5FPN A;  3SBT A;  4DF8 A;  1EQY A;  2V51 B;  3V81 A;  4IEE A;  3K9K A;  1Q86 O;  2HMI A;  5C12 A;  2NRH A;  2ATQ A;  4KPY A;  4DQR A;  4N5S A;  4E1J A;  4CZL A;  3OVN A;  4RCH A;  1NKE A;  4CJU A;  4M7Y A;  3NGZ A;  1VSD A;  4JHD B;  4QS9 A;  1GOC A;  4CK2 A;  1IKW A;  4FOI A;  5AQQ A;  4FJN A;  3H45 C;  1WAJ A;  3QIC A;  5AQL A;  4BRF A;  4HWI A;  3AA3 A;  4FLZ A;  4CGG A;  3I0R A;  3JSM A;  3AV9 A;  1BQM A;  1RBV A;  3DM2 A;  3AA5 X;  4CE9 A;  5BPL A;  1W7A A;  4CZI A;  3OS2 A;  4DSI A;  3KK7 A;  3WXI A;  3V4I A;  4WQ4 A;  4FXD A;  3NH0 A;  1KAY A;  4B9M A;  4O5B A;  5AQK A;  2FSK A;  3HTV A;  2D0C A;  3A2F A;  1YTU A;  1JL1 A;  3LM2 A;  1Q9X A;  5EU7 A;  3N4P A;  1RBS A;  3LDO A;  3T69 A;  5M1P A;  4BQZ A;  4B1Y B;  2OA8 A;  4NYN A;  3HJF A;  3C0B A;  4LF9 K;  4GNI A;  1VSH A;  4CEB A;  3R3L A;  1SQK A;  4BRH A;  1YJ9 N;  4BQL A;  3ITH A;  3AVI A;  1I39 A;  1XC9 A;  4I9L A;  2QK9 A;  2J4R A;  1Q81 O;  3DXK B;  2O8F A;  4JKC A;  3BZK A;  3E9P A;  4JRQ A;  1U6Z A;  2IS3 A;  2HBJ A;  1K8K A;  3ZYY X;  3VQ5 A;  3J80 O;  2E20 A;  3AGR A;  1K8A O;  1OH5 A;  4RW4 A;  1EWR A;  4CED A;  2DFE A;  3MX5 A;  2O4I A;  3AVM A;  4E7J A;  3HSC A;  2AP1 A;  2F7T A;  3DXM B;  4KRF A;  1BG3 A;  3AY9 A;  4FZZ A;  3UKU B;  2G8I A;  1NU0 A;  2P9S B;  4BC4 A;  3ZLJ A;  5CYQ A;  3J7A P;  2BDP A;  3O08 A;  2D0O A;  2KZZ A;  4LF7 K;  4DR3 K;  4DMN A;  3U3G A;  2F96 A;  4BDP A;  1E3M A;  1VRT A;  4CJW A;  1BA1 A;  1XHX A;  4OPK A;  4YFU A;  1JLB A;  2E4L A;  3WXM B;  3C95 A;  4FJ8 A;  3VQ4 A;  2D0B A;  3VF6 A;  5TKW A;  1QHA A;  2YV0 X;  3FFI A;  3KTQ A;  4H0P A;  3LDP A;  4DFM A;  1KCF A;  4EHU A;  1YI2 N;  3TAP A;  4WFA L;  2OZS A;  3ZEU B;  4EHT A;  4HCC A;  1LV5 A;  2ASM A;  4OKK A;  4DHY A;  3O5B A;  3L3U A;  3PO4 A;  3H1Q A;  1WSH A;  1HQU A;  1ZC6 A;  3L2U A;  3RVC A;  3EZ5 A;  4IKF A;  1NGI A;  3A0I X;  3F2K A;  1V4T A;  3HST B;  1TAQ A;  3SNN A;  1WLJ A;  3QES A;  3MXM A;  4BVO A;  4KHS A;  3EE9 A;  4IO9 L;  1BL3 A;  2HST A;  4WCE L;  1BI4 A;  1WSG A;  4DV2 K;  2HND A;  3OYH A;  4HCB A;  1XNQ K;  4JD2 A;  3QER A;  1NGJ A;  2P9K A;  4CJT A;  1YJN N;  3OYK A;  2UU9 K;  4B9U A;  4CEQ A;  2IGI A;  4AH9 A;  5AQT A;  1NG9 A;  3QEV A;  3L3V A;  4MQ3 A;  1WSJ A;  3WNF A;  3C6H A;  3ENH A;  2P9I A;  1NWK A;  4B9T A;  1RT3 A;  1X3M A;  2WON A;  3BUZ B;  3V1O A;  3PX0 A;  4JKG B;  4DFP A;  4IFY A;  4CZG A;  4F8R A;  1RTH A;  2OZM A;  3G6E N;  2P9P A;  3KWG A;  3PO5 A;  3FZK A;  1NJI O;  3AVG A;  1NGA A;  5BPM A;  2Y1J A;  2O8B B;  1IJJ A;  3U8X A;  1JCF A;  4J2D A;  5IT9 O;  3HXM A;  1BIZ A;  3NDK A;  3PX6 A;  3QEX A;  3KK2 A;  1MDU B;  4DB3 A;  4JK9 A;  1TUU A;  5HRO A;  4K8Z A;  3LZJ A;  4ILJ A;  1ASW A;  3K58 A;  2QWP A;  4OX9 K;  4A62 A;  1SL1 A;  3ZCM A;  4B3R K;  4G9Z A;  1TL3 A;  3C7N A;  4WYB A;  1RTJ A;  3GOI A;  5FPM A;  3ISN C;  2WOM A;  2KLA A;  4FK0 A;  4JRP A;  2OPS A;  3OYM A;  4PKG A;  1IKX A;  4FWP A;  3THY A;  5ELZ A;  5AQG A;  1EET A;  5T7B A;  1SZ2 A;  1C0M A;  4FJI A;  4C1N K;  3SPY A;  4DV6 K;  4HUE A;  4DS5 A;  4CCH A;  4OJR A;  1VQ5 N;  1K9M O;  3J7Y P;  4AHU A;  1BO5 O;  2A1S A;  2GBZ A;  1IKY A;  2JWK A;  4KBO A;  2O8D B;  1RBR A;  3QEW A;  2ETJ A;  1S5J A;  1T6C A;  2IDO A;  3VGL A;  4BRN A;  1QSL A;  5FRO A;  4CJP A;  2X6N A;  4AHV A;  3MAQ A;  1TYQ A;  4DQQ A;  3G0Z A;  4OKJ A;  2CH6 A;  3O9Q A;  2KW4 A;  3SAG A;  4LD0 A;  5LL6 Z;  2Q3S A;  3SI6 A;  3J8A A;  3V1R A;  4O0I A;  4OKE A;  3LAK A;  3VEN A;  1REV A;  3O80 A;  4EZ9 A;  3V9X A;  1A5W A;  2QM1 A;  1KQS M;  5J1E A;  1N5Y A;  1HQE A;  1KAX A;  3MEC A;  5DM7 L;  2BH1 A;  1ATR A;  1NJX A;  3SUN A;  4DUZ K;  1WB9 A;  2FBX A;  3WEE B;  3U6F A;  4LH4 A;  4GV9 A;  1DKG D;  1NOY A;  4YOW A;  4NLB A;  1UAX A;  3O3G A;  4Z4G A;  1L3U A;  3MN7 A;  4WQ4 C;  4FJG A;  2CGK A;  1JLG A;  1F21 A;  3ZT2 A;  1D9F A;  1C6V A;  4BC2 A;  1CZ9 A;  5FLX O;  1VK0 A;  1QQM A;  2NRR A;  4Y0W A;  2FBT A;  5AFU H;  2QXL A;  3H46 O;  3K2P A;  3A5L C;  3CM6 A;  4OO1 J;  2D0P A;  1HPM A;  3OJU A;  4CZE A;  4H5R A;  4JYA K;  3CCV N;  3JYT A;  4FM1 A;  4BR0 A;  5AQU A;  2OYQ A;  4CHO A;  2ZE2 A;  5AQF A;  4BR7 A;  3ZT1 A;  1L3T A;  3FZH A;  1VAZ A;  5KPR A;  4BDY A;  3V9W A;  3CJ7 A;  3VQ9 A;  3K5M A;  4DTP A;  4ZTF A;  4LF8 K;  3SMP A;  4Z4E A;  1S1U A;  3IDH A;  4ID1 A;  4IG0 A;  4E19 A;  3LPT A;  1VQL N;  1QQO A;  4FWR A;  3SK3 A;  5KPT A;  2UXB K;  2FSN A;  1JCG A;  1EO1 A;  4DQI A;  1JXE A;  3ZSX A;  2ZGZ A;  4ISF A;  3LPU A;  3ULE A;  3AGK A;  4YOR A;  4JI7 K;  4I2Q A;  4B3M K;  2W6L A;  4JEP A;  1S22 A;  5KRS A;  3M1F A;  3VEX A;  1JL2 A;  4NXN K;  2HVI A;  3TAB A;  3ULD A;  4LFB K;  4KTW A;  1VQ9 N;  1ILY A;  5C2F A;  1OVY A;  4JNE A;  1C0T A;  4IDK A;  4K41 A;  2HMP A;  3QBX A;  4JS5 A;  5HRR A;  3SUQ A;  4YOU A;  3KIO A;  1MA9 B;  1LWC A;  3VEY A;  1KRP A;  3QNO A;  4JAX A;  3QNN A;  3VTI A;  5I9E B;  1SKW A;  4B8C A;  5FDL A;  3DLB A;  5KQD A;  2HHS A;  5AQI A;  2A6A A;  3F9K A;  1UA1 A;  4IJN A;  4RG8 A;  4DR4 K;  4FWS A;  3DLG A;  4PL7 A;  4DLE A;  3UKR A;  4NO7 A;  2X74 A;  4PA1 A;  5H1S Q;  1NGB A;  2V7Y A;  5AQM A;  4FJH A;  1VQ7 N;  3CG7 A;  3ZX3 A;  5AQS A;  4U7B A;  5AZI B;  1A5X A;  3D0P A;  3I33 A;  3SV3 A;  4IOA L;  3LP1 A;  4JLH A;  1HPZ A;  4B1W B;  5C25 A;  1RBU A;  1KVA A;  5F2R A;  4QAG A;  3AVC A;  3PIP L;  5C2D A;  4AQY K;  3HK2 A;  3S3O A;  3H1V X;  2KFZ A;  3TR8 A;  3ZX0 A;  2EX3 A;  3F5T A;  3ENO A;  1HYS A;  4IZ9 A;  4B1Z A;  2UYT A;  4JS4 A;  3CCE N;  1IKV A;  1HYZ A;  3AA4 A;  1TKZ A;  1BGX T;  2WTU A;  4CF8 A;  5AQX A;  1EKE A;  1U47 A;  5HBM A;  1HJR A;  2DTU A;  1WSE A;  4O55 A;  4DR7 K;  3AAR A;  1ESV A;  4NLC A;  2E6M A;  1Q18 A;  2DY4 A;  3A8Y A;  3TU5 A;  5CHI A;  1C0F A;  5J2Q A;  3MEE A;  3WXL A;  1FW6 A;  3WUH A;  3FZL A;  3QIP A;  3THX A;  2PY5 A;  2DPN A;  1DT9 A;  3VQQ A;  5GAH P;  3L2V A;  4GMJ B;  1E4G T;  2FC0 A;  4E7I A;  4B9S A;  1O1W A;  5B8H A;  3ZSZ A;  3F9M A;  1N33 K;  1KLM A;  5AQV A;  4E0D A;  3MX2 A;  2ZJR L;  4FWN A;  3I8B A;  4W5O A;  1N8R O;  2P9U B;  2E88 A;  3RR8 A;  4CJL A;  1I94 K;  3MXJ A;  3CFR A;  4IOX A;  2E6L A;  3VET A;  4JK7 A;  4YDU C;  2EHG A;  1ZXO A;  4B1V A;  3VES A;  4AHS A;  5BRD A;  4Q0B A;  1JJ2 M;  3N4Q A;  3VMF B;  4FM0 A;  4R79 A;  4DTJ A;  4FPA A;  4O4G A;  4LFC K;  3UIQ A;  3VQ6 A;  1T8E A;  1GOA A;  4FO0 A;  1N36 K;  3O1B A;  3MWP A;  1BU6 O;  4FW1 A;  1DEJ A;  3L2R A;  1Q8I A;  3C94 A;  5JMV A;  3P38 A;  3R9P A;  4CFC A;  2NLX A;  3FGU A;  5DK5 A;  3QLH A;  3ATV A;  5CYM A;  1VSM A;  4F2S A;  1D4X A;  3HM8 A;  1VQK N;  1NJW A;  5SZT A;  3KLI A;  4KI6 A;  3G4S N;  2VGN A;  3AVB A;  4IG3 A;  3OJS A;  4FPB A;  1ASU A;  3HO1 A;  2DFF A;  4FWM A;  1LCU A;  4OGC A;  5LJV A;  4JKH A;  2QKB A;  4CEO A;  1S9G A;  1C1B A;  3QDK A;  3HRG A;  1RDD A;  4CHZ A;  3MN9 A;  2HNZ A;  3ID8 A;  3EY1 A;  4IFE A;  3MXI A;  3K5O A;  2YHB A;  5AR0 A;  1DTQ A;  3IG1 A;  3SCX A;  4DQP A;  4CFA A;  3ZT4 A;  4DG1 A;  3OYB A;  4DWI A;  4KHP K;  2D0A A;  4A5B A;  5M1Q A;  1NJY A;  5TKY A;  1QVF M;  5AZJ A;  3W3D A;  1JLA A;  4DR1 K;  5HLF A;  2Z1J A;  2O8E A;  5KGW A;  4CF2 A;  5C10 A;  3QEI A;  4FLX A;  4DCH A;  5D3G A;  4M63 C;  3E9L A;  4OLA A;  2DFH A;  2Y1I A;  3VPZ A;  4B9N A;  3TSQ A;  3GDQ A;  4JHD A;  3CQY A;  4KB0 A;  3QEP A;  3SJJ A;  4IJA A;  1GLF O;  3D6R A;  3DI6 A;  4B3S K;  4GVE A;  1S9E A;  1U2V A;  4CHQ A;  4PWD A;  1QTM A;  4KHY A;  4IWV A;  3MEG A;  3TAE A;  4IOC L;  1NK6 A;  2O8F B;  3I56 N;  1YXQ A;  3D45 A;  2ZM6 K;  2Z1H A;  3SAH A;  3IFR A;  2YNG A;  4CW7 B;  3FZM A;  3V9S A;  4FWQ A;  4FJM A;  1VSK A;  4CEC A;  1IBK K;  3RSE B;  2WC9 A;  2XRI A;  5I3U A;  4PHT X;  3KKR A;  3CC7 N;  1IO2 A;  4QOZ B;  3WXJ A;  1B9F A;  4L8R B;  3CIP A;  2KTQ A;  3TTF A;  1X9S A;  3K5N A;  2D1K A;  4M3R A;  4X65 K;  4CJK A;  1Y64 A;  3NBP A;  2YI1 A;  4N56 A;  2B5J A;  3U4L A;  3O3H A;  1RDW X;  3CM5 A;  4G1Q A;  3DXK A;  4WQ5 C;  3VQ7 A;  4CJR A;  4FZX C;  2X78 A;  4ILG B;  2XHB A;  4YOV A;  4DLG A;  3LAL A;  3TI0 A;  4DSL A;  3CFO A;  3M8Q A;  1HYV A;  4FJ7 A;  1QZ6 A;  4UY8 O;  3AAQ A;  4CJV A;  4IBN A;  3DRR A;  4CD1 A;  4LF6 K;  3KLH A;  2O8C A;  1TUY A;  4B08 A;  3ZSY A;  3DAW A;  5LY3 A;  3UKU A;  5M1F A;  1N32 K;  3VQC A;  4IXC A;  4GV3 A;  4C8M A;  3RR7 A;  3MN6 A;  1VQ8 N;  3QIN A;  1IG9 A;  4BRD A;  4BRP A;  2RPI A;  1HLU A;  4NCG A;  1SL2 A;  1KTQ A;  3GE1 A;  3O4W A;  3O9U A;  4JD2 B;  1S1W A;  2XY7 A;  4K25 A;  4LC9 B;  3AO3 A;  2G8U A;  1UA0 A;  4ID5 A;  3ZEU A;  5KGX A;  3LDL A;  3TTD A;  3L2W A;  1HNX K;  4CES A;  5HP1 A;  3CME N;  4NYF A;  2JWL A;  1VQN N;  5AQH A;  4JN4 A;  4IO8 A;  1C1C A;  4A59 A;  3OYG A;  4B3O A;  4HTU A;  5E41 A;  5KTQ A;  1BWF O;  3VA3 A;  2Z1G A;  5E26 A;  2BGG A;  3IKM A;  5IWA K;  3NCI A;  4DU4 A;  3RMA A;  2HBL A;  3E9O A;  1OKJ A;  3HOS A;  3TAR A;  1ZBS A;  1BCM A;  1J54 A;  2D5R A;  4BRL A;  4ZTJ A;  2VWB A;  4CEF A;  1ATN A;  3RMC A;  4CZM A;  3M6G A;  1HUX A;  3CI5 A;  3PV8 A;  2HHQ A;  1NGG A;  3NVM A;  4M3T A;  3M8S A;  1G99 A;  3CMA N;  2NRV A;  4B9Q A;  3QML A;  1QE1 A;  4BR9 A;  4GY2 B;  1D9D A;  1Z05 A;  2HVH A;  1XC3 A;  3JS6 A;  1NGH A;  4JKG A;  4I2P A;  4NCA A;  3OYC A;  5GAE P;  3THY B;  4PL8 A;  5JVG L;  2FF6 A;  2RHK A;  4BVP A;  1NMD A;  4E1M A;  4AIL C;  3D2F A;  1E4F T;  4NCB A;  4A61 A;  4MFB A;  3VTH A;  2O8B A;  2QW9 A;  1CXU A;  4DSK A;  3H3N O;  4EP4 A;  4DTU A;  1Q9Y A;  1YT3 A;  2VCP A;  4A2B A;  4DSF A;  4H4M A;  3OW2 M;  3EL2 A;  2I7N A;  1CXQ A;  2YHA A;  2QWO A;  5EXW A;  3SMS A;  4E7L A;  2KZM A;  3HVT A;  2P51 A;  4WF9 L;  3VN5 A;  4X64 K;  2XY5 A;  1T03 A;  4O0J A;  2IAJ A;  3TSP A;  3VQ8 A;  4DU1 A;  4B1U B;  2QWL A;  1D5A A;  3W0L A;  4CI6 A;  3QET A;  1NK5 A;  3AVF A;  1Q82 O;  1KD1 O;  1NM1 A;  2IOC A;  4HHT A;  4GVM A;  1VHX A;  4LF5 K;  3HVR A;  2YCH A;  4GKJ K;  1RCH A;  2A5X A;  4BC5 A;  4CHN A;  1FKO A;  5BN8 A;  2YNF A;  5F1X A;  1YVN A;  3S41 A;  1HNI A;  5KI6 A;  4ELT A;  4BRE A;  4DTM A;  1RGI A;  4W5Q A;  3RRG A;  1W2B M;  3CFP A;  4C1N I;  1RBT A;  5C0Y A;  3LP3 A;  2GTD A;  4A57 A;  4BGB A;  4DTR A;  4H4O A;  3CPW M;  4RW8 A;  1HR0 K;  1LAV A;  3EZW A;  3VEW A;  4EZ6 A;  5JS1 A;  2HBM A;  2PFU A;  4E7K A;  2FXU A;  2A41 A;  2NUB A;  2F9T A;  1NBW A;  2GUP A;  4M7X A;  2HHV A;  3WQT A;  1L3S A;  3DMJ A;  3KWI A;  4XH1 A;  3IS9 A;  4CEZ A;  3WEE A;  3T1H K;  4CIE A;  2ZJQ L;  5M1O A;  2Q0R A;  4BDZ A;  3OHR A;  4KO0 A;  1C0U A;  1JLF A;  3VF2 A;  1J6Z A;  4AM7 A;  2VWJ A;  2GEL A;  4DSJ A;  2P9L A;  4KHN A;  3BZC A;  4A5A A;  3O1W A;  4MDA A;  4YHH K;  1P8Z A;  3ZT3 A;  1QQC A;  3J81 O;  1S6P A;  2AA4 A;  5C15 A;  1RT4 A;  3K59 A;  3O4Q A;  1HRH A;  3AO1 A;  4AHT A;  3H3O B;  5JLF A;  1S72 N;  2FBY A;  3LAM A;  4CF9 A;  1X9W A;  4FJL A;  4FK2 A;  2YX6 A;  4JI5 K;  4CBW A;  4DQ8 A;  4OPA A;  4O44 A;  1SS6 A;  1C1A A;  1ZBF A;  1VQM N;  1L5U A;  1HNV A;  3QO9 A;  5FRN A;  4CJ7 A;  2Q0U A;  2GX9 A;  5SWM A;  2D4W A;  4M3W A;  4B8A B;  1WAF A;  3NF6 A;  3HZ6 A;  4BRI A;  4FJJ A;  1HJO A;  3B6O A;  3BY5 A;  4M41 A;  3CCU N;  4Z94 A;  3IAY A;  3D2E B;  2G8K A;  1KLN A;  3L6Q A;  3LM9 A;  2NRX A;  2QXF A;  4BRA A;  2HHX A;  4DTN A;  1TK8 A;  3VQP A;  3TAN A;  3GL1 A;  4LF4 K;  5J2P A;  3T1A A;  3AVK A;  2UUA K;  3S9H A;  4H5T A;  3KVG A;  2YHX A;  4ISG A;  4Z4C A;  2F8T A;  3L8B A;  4U67 L;  5BR9 A;  1S1X A;  2CH5 A;  2ZJP L;  1K6Y A;  1U49 A;  4FLY A;  3THW B;  1OVQ A;  3T19 A;  1UWB A;  5JS2 A;  2Q97 A;  2ZGY A;  3R1X A;  3KD1 E;  4JI1 K;  3ZSO A;  2A1R A;  4DFK A;  3FR0 A;  3GBT A;  2PBD A;  4QCL A;  1GOB A;  2ASO A;  3OYE A;  1XI1 A;  4Y1C A;  4BWM A;  3KLF A;  1HKB A;  3SQ2 A;  2PYL A;  2JLE A;  1JLE A;  1T3V A;  4EP5 A;  2XY6 A;  3DLH A;  3G10 A;  3NHG A;  4DTX A;  5KQ8 A;  1JXB A;  4V19 S;  2WBN A;  3L4Q A;  2O4G A;  2OTL N;  3ZET B;  3DRS A;  3C6T A;  1JCE A;  3WXK A;  1TK5 A;  1QS4 A;  4LY7 A;  2CGL A;  3HP9 A;  4CGF A;  3LDS A;  1EX4 A;  1NGF A;  5A2Q O;  1Q7Y O;  4J2E A;  3P1G A;  4O8K A;  2P9N B;  3MN5 A;  4DFJ A;  1NK7 A;  1SKR A;  1BUP A;  4TSX A;  4F2R A;  3P5J A;  2QKK A;  1WUA A;  5AZI A;  4O5F A;  1XWL A;  3IUC A;  2AJQ A;  4JKF A;  1N34 K;  1X3N A;  4K42 A;  2PZS A;  1QQN A;  2G8V A;  2UXD K;  3CCS N;  3FFK B;  2X6S A;  1RT5 A;  4MDB A;  3M8R A;  4PKH A;  3SYZ A;  3P39 A;  1BDG A;  3MWT A;  1ATS A;  3TWH A;  3AVN A;  3EEQ A;  1TGO A;  1ITG A;  2UUB K;  4CJE A;  1MWK A;  4LSN A;  1HKG A;  4CZK A;  2HHT A;  3AO4 A;  3CCM N;  4F3T A;  3KK3 A;  1VSE A;  4LH5 A;  4JI0 K;  1Y97 A;  4W5R A;  1KAZ A;  5AQP A;  4KTZ A;  4DTS A;  1CZB A;  1T44 A;  4ISE A;  3VQD A;  3EO3 A;  2G8F A;  3KKS A;  1NKC A;  5JVH L;  4CGJ A;  1QSY A;  4I6M A;  2V7Z A;  3LP0 A;  3O9S A;  3U3Y A;  1BOT O;  3R6M A;  4K8X A;  3AO5 A;  3RWU A;  3AVJ A;  3CC4 N;  1SUQ A;  3WT0 A;  3NGI A;  1LAW A;  4FLV A;  2ASP A;  4CD3 A;  1XHZ A;  4C23 A;  1IBL K;  1M90 O;  5ADX A;  2W6K A;  3HL8 A;  1XUP O;  1G15 A;  3KZB A;  2Q31 A;  4DR2 K;  5AQN A;  4H0X B;  1U48 A;  4IFV A;  3CJ1 A;  4KI4 A;  5BN9 A;  2YJE A;  5EY4 A;  4CJ3 A;  4K0K K;  3SUO A;  3R8E A;  3SQ4 A;  1QHT A;  4KHQ A;  2HB5 A;  5BR8 K;  5JLH A;  3RMD A;  5K14 A;  3DOK A;  3O4N A;  3TAG A;  1VQ6 N;  1T7P A;  2P9U A;  1V4S A;  3HOT A;  3NH1 A;  1WBD A;  3CCL N;  1VSF A;  3JAM O;  1LW2 A;  4BG9 A;  4CHY A;  4XIU A;  4CJQ A;  3T3F A;  4MLH A;  5AJ3 K;  3CD6 N;  1W97 L;  4E3S A;  4JK8 A;  1ASV A;  3Q7B A;  2IVP A;  4H03 B;  3GG4 A;  3KLG A;  4DV7 K;  1RT6 A;  3TSU A;  5J2M A;  3UE5 A;  1S3X A;  3VEV A;  4BC3 A;  3OYJ A;  1W0H A;  3SQ1 A;  3WNE A;  3SV4 A;  2ITM A;  1RDU A;  4H8K A;  1DGK N;  3CC2 N;  2OTJ N;  4KRE A;  2YHW A;  2GWJ A;  3V9U A;  3H08 A;  1LW0 A;  2VG7 A;  3C65 A;  2E8A A;  5HRS A;  4CFD A;  2YNH A;  4BE0 A;  3A5M C;  1ZBH A;  3M5R A;  3VER A;  4PY5 A;  2Q2R A;  2ITG A;  1Z6R A;  1EP4 A;  2A40 A;  4W5N A;  2W42 A;  4GV6 A;  5CZ2 A;  1CLQ A;  5EVZ A;  1JLQ A;  4B9L A;  2FLO A;  1U2V B;  3TAM A;  3SAF A;  1NK8 A;  3CJC A;  3ATU A;  4ZHR A;  4DS4 A;  1VRU A;  3ZSV A;  1HNZ K;  2GWK A;  4H0T B;  4BRO A;  3NGY A;  4CBX A;  4DKW A;  3S3M A;  5AFU A;  2RF2 A;  3LWM A;  3NF8 A;  1WN7 A;  3KD5 E;  1TAU A;  4KFB A;  2VGM A;  5MLC Q;  1WNS A;  5AQJ A;  2E1Z A;  1M1K O;  5BRH A;  4FJ9 A;  1K8K B;  1TKX A;  2OCE A;  5HRP A;  3OBY A;  5HRN A;  3H6E A;  1ZBI A;  4ILH A;  2HOE A;  4BRQ A;  3B8A X;  1R59 O;  2QTD A;  4JI8 K;  4FCY A;  4BAC A;  4E7H A;  1JLC A;  4C8L A;  2W40 A;  1TK0 A;  1R0A A;  4DF4 A;  1YUW A;  2BTF A;  3CJA A;  3VGM A;  3HBT A;  1J5E K;  5M1N A;  4ELV A;  2RN2 A;  3NH2 A;  2G8H A;  1OH8 A;  4F3O A;  3AO2 A;  3CHW A;  5CR4 A;  4CFB A;  4M3U A;  4FWO A;  2R7Y A;  4BWJ A;  2NNW A;  1YJW N;  4PQU A;  2O8C B;  4KH5 A;  5F0X A;  3RSE A;  2E2O A;  3AVA A;  4KV8 A;  4KHW A;  3WNH A;  4FSV A;  3OYD A;  4Z4F A;  3DXM A;  4KH4 A;  1NJZ A;  2IC3 A;  2A3Z A;  3MDQ A;  2GUI A;  1NK0 A;  1BIU A;  3DLK A;  4CIG A;  2E2Q A;  2P9S A;  3TPQ A;  3OA9 A;  3VQE A;  3TTC A;  5GIO A;  4DQS A;  4M42 A;  1BI4 B;  3G71 N;  3DOL A;  3OS0 A;  1VQP N;  2F8S A;  5BRF A;  1U04 A;  1FKP A;  3AAP A;  3EE8 A;  3OBW A;  1ZYQ A;  4GW6 A;  1MWM A;  4H5W A;  1DTT A;  1H1V A;  2VYP A;  1EWQ A;  2P9K B;  1S1T A;  3BF1 A;  3O9R A;  1QVG M;  4FJK A;  1KXP A;  3C6U A;  4NXM K;  3A5O C;  4NB4 A;  4IDH A;  4BRC A;  3SZ2 A;  4OLB A;  3OYI A;  3KK1 A;  1KFD A;  3DLL L;  4DTO A;  1NKB A;  2P9I B;  3FE1 A;  4PUO A;  4JKE A;  3M8P A;  2OAN A;  2IIR A;  3SUP A;  4O8U A;  4MO5 A;  3QB0 A;  4KHU A;  3LZI A;  3PSF A;  4A2A A;  4FLU A;  4H0O A;  2P9P B;  2E2N A;  4HUG A;  4CJS A;  3THV A;  5I42 A;  3HI0 A;  4XH4 A;  5FPD A;  2QWM A;  1B92 A;  2Z1I A;  1B9D A;  2QWN A;  4EIA A;  4DV3 K;  3L2Q A;  3K5L A;  3EKS A;  4X62 K;  4DV5 K;  3VF4 A;  2VWK A;  4AF1 A;  3HPG A;  3MK6 A;  1DLO A;  3ASM A;  3CER A;  3O8M A;  4K43 A;  1XQS C;  3LDN A;  3C7N B;  1GLJ O;  2ZQB A;  4DR5 K;  2A42 A;  1YIJ N;  5KRT A;  5KPZ A;  2PYJ A;  4FWK A;  1GLD G;  4YOY A;  2QI2 A;  3D2F B;  1VSL A;  4EAH D;  1LWF A;  3IRX A;  4DU3 A;  3S3N A;  4AM6 A;  3MMV A;  2YJF A;  5ADX H;  1KFS A;  3ZSQ A;  2WFB A;  4OGE A;  5LJW A;  3KJV A;  4CK3 A;  2EWS A;  4DR6 K;  2KKZ A;  3D7E O;  2F9W A;  4FWL A;  1GLA G;  4RW7 A;  4H5V A;  3CCR N;  4PKI A;  4QS8 A;  2OPQ A;  4B9V A;  2QWQ A;  2VG5 A;  1TYQ B;  4FLT A;  3CJ9 A;  3BDP A;  3VOV A;  4YOT A;  4QS7 A;  1SL0 A;  3Q7C A;  1J9A A;  5DMR A;  1GLB G;  4RW6 A;  3VEO A;  3VA0 A;  4JI6 K;  1BHL A;  3EKU A;  3LP2 A;  2QA4 N;  2HHU A;  4WE1 A;  3KLE A;  1T6D A;  3BEX A;  1WOQ A;  3K57 A;  5HOO A;  3BP8 A;  1GLL O; 
#chains in the Genus database with same CATH homology
 2Q97 A;  5JMV A;  2ZGY A;  1BA1 A;  3R1X A;  3P38 A;  5GAD P;  3KHY A;  3R9P A;  2NLX A;  3FGU A;  3ATV A;  5M1K A;  1NGE A;  3FR0 A;  3GBT A;  3WXM B;  1D4X A;  3HM8 A;  1VQK N;  3J7Z O;  2PBD A;  3FZF A;  3VF6 A;  2VGN A;  2ASO A;  3G4S N;  5TKW A;  4FPB A;  1QHA A;  4H0P A;  3LDP A;  4BG8 A;  3CCJ N;  1YI2 N;  4EHU A;  4XH5 A;  4WFA L;  3ZEU B;  4EHT A;  1HKB A;  1KC8 O;  2ASM A;  4DHY A;  3O5B A;  4FWM A;  1LCU A;  1T3V A;  3H1Q A;  4JKH A;  5LJV A;  5KQ8 A;  3NVK A;  2WBN A;  4YDU A;  3QDK A;  1ZC6 A;  3L4Q A;  3RVC A;  2OTL N;  3HRG A;  3ZET B;  3MN9 A;  5AQW A;  1NGI A;  3ID8 A;  3A0I X;  1JCE A;  4IFE A;  2Q36 A;  3F2K A;  5AR0 A;  3WXK A;  1CZA N;  1V4T A;  2KHO A;  5AQR A;  4BVO A;  3EE9 A;  4A5B A;  2CGL A;  4IO9 L;  4FOE A;  1NGF A;  2HST A;  1Q7Y O;  5M1Q A;  4WCE L;  4O8K A;  5TKY A;  1QVF M;  2P9N B;  4CZJ A;  4HTL A;  3MN5 A;  3W3D A;  5AZJ A;  3CJB A;  4IEI A;  1BUP A;  1WUA A;  4JD2 A;  3BF3 A;  3P4I A;  5AZI A;  1NGJ A;  2P9K A;  4O5F A;  1QZ5 A;  4L3Q A;  5C10 A;  3IUC A;  1YJN N;  4CZF A;  2P9L B;  1NLV A;  4JKF A;  4DCH A;  1X3N A;  4K42 A;  4M63 C;  5AQT A;  3E9L A;  3QBW A;  1X9J A;  5JIC A;  1QQN A;  3C6H A;  4KH6 A;  3ENH A;  3FFK B;  3CCQ N;  3CCS N;  2P9I A;  1NWK A;  3VPZ A;  1SAZ A;  4MDB A;  1X3M A;  3BUZ B;  3TSQ A;  3GDQ A;  4PKH A;  3E1Y A;  4JKG B;  4JHD A;  3ULE B;  3CQY A;  3P39 A;  1BDG A;  4CZG A;  3MWT A;  1ATS A;  4BY9 C;  3EN9 A;  3CPE A;  5GIN A;  2P9P A;  3KWG A;  4CBU A;  3FZK A;  4CZH A;  3G6E N;  1NJI O;  4IJA A;  2FSJ A;  1MWK A;  1GLF O;  1NGA A;  1HKG A;  3D6R A;  4CZK A;  4GVE A;  5BPM A;  3CCM N;  1U2V A;  3I55 N;  3SLC A;  3SJH A;  4FVU A;  2Q1N A;  1IJJ A;  3U8X A;  1KAZ A;  1JCF A;  5AQP A;  4IWV A;  5AQZ A;  1T44 A;  4ISE A;  3EO3 A;  1MDU B;  4DB3 A;  3PIO L;  4IOC L;  2NRT A;  4JK9 A;  5JVH L;  1TUU A;  4ILJ A;  4I6M A;  2QWP A;  2V7Z A;  4A62 A;  3I56 N;  1YXQ A;  3O9S A;  4G9Z A;  1BOT O;  3R6M A;  3SAH A;  3IFR A;  3C7N A;  2I7P A;  4WYB A;  1C0G A;  3GOI A;  5FPM A;  3FZM A;  3VEZ A;  3CC4 N;  5E84 A;  3WT0 A;  2KLA A;  4FWQ A;  4WFN L;  2QWR A;  2ASP A;  4CD3 A;  1YHQ N;  4PKG A;  2YHY A;  2H3G X;  4C23 A;  3RSE B;  1M90 O;  4FWP A;  5ADX A;  2WC9 A;  5ELZ A;  5AQG A;  1SZ2 A;  2PAV A;  4PHT X;  1XUP O;  4H0Y B;  3KZB A;  2Q31 A;  5AQN A;  1GLC G;  4C1N K;  4H0X B;  3CC7 N;  3WXJ A;  4BRG A;  1VQ4 N;  1HKC A;  3CIP A;  1VQ5 N;  3TTF A;  3CJ1 A;  1K9M O;  3NMU A;  2HF4 A;  1O13 A;  1BO5 O;  5BN9 A;  2YJE A;  4OPH A;  2D1K A;  5EY4 A;  3A5N C;  2JWK A;  4KBO A;  4BR4 A;  3UKR B;  3R8E A;  1Y64 A;  5JLH A;  2YI1 A;  1GLE G;  3L4I A;  1RDW X;  3U4L A;  1P90 A;  3DXK A;  1T6C A;  2HBK A;  4WQ5 C;  5CE3 A;  3VGL A;  2RE2 A;  4JKB A;  4ILG B;  1VQ6 N;  3D2E A;  4YOV A;  2P9U A;  4BRN A;  4WFB L;  1V4S A;  2IVO A;  3SBG A;  3HOT A;  3L0Q A;  3WQU A;  3CCL N;  1VQO N;  1QZ6 A;  1TYQ A;  4UY8 O;  3AAQ A;  1BA0 A;  2CH6 A;  4CD1 A;  3G25 A;  3MCP A;  1TUY A;  3O9Q A;  4BG9 A;  3SAG A;  3CF5 L;  5EX5 A;  4MO4 A;  5HOO A;  3DAW A;  3J8A A;  5LY3 A;  3O9T A;  4MLH A;  3UKU A;  3CD6 N;  5M1F A;  1W97 L;  3VEN A;  4RTF D;  4JK8 A;  4BRM A;  3O80 A;  3Q7B A;  4IXC A;  4GV3 A;  2QM1 A;  2IVP A;  3P31 A;  4XEI A;  3MN6 A;  1KQS M;  5FPE A;  1VQ8 N;  1K73 O;  4H03 B;  3O6W A;  2WUS A;  4BRD A;  4BRP A;  3GG4 A;  1HLU A;  1KAX A;  5DM7 L;  2W41 A;  3TSU A;  2BH1 A;  1ATR A;  2HF3 A;  4JKA A;  3UE5 A;  1S3X A;  3VEV A;  4BC3 A;  3GE1 A;  3O4W A;  4JD2 B;  3O9U A;  4WQ5 A;  3T7Z A;  3ZX2 A;  2ITM A;  3WEE B;  4K25 A;  4LC9 B;  1HX1 A;  1RDU A;  1RFQ A;  4BR5 A;  1DGK N;  4MLE A;  3CC2 N;  4GV9 A;  2OTJ N;  1DKG D;  3ZEU A;  3LDL A;  5AQY A;  4YOW A;  4NLB A;  2YHW A;  3TTD A;  3PLA A;  2GWJ A;  5HL7 L;  3CME N;  1VQN N;  2JWL A;  3MN7 A;  5AQH A;  3DWL A;  4JN4 A;  4WQ4 C;  3C65 A;  2E8A A;  2CGK A;  4IO8 A;  3ZET A;  2V52 B;  3A5M C;  1YAG A;  4A59 A;  4BC2 A;  3M5R A;  1QQM A;  4J8F A;  2FF3 B;  5GIP A;  3VER A;  3CXC M;  2NRR A;  1BWF O;  4Y0W A;  2Q2R A;  5GAG P;  5AFU H;  2QXL A;  3H46 O;  3IMX A;  1Z6R A;  2A40 A;  5E26 A;  3A5L C;  4OO1 J;  4GV6 A;  2D0P A;  1HPM A;  2ZF5 O;  3IKM A;  3QFU A;  1NGC A;  2P9N A;  4H5R A;  4CZE A;  5EVZ A;  3U9D A;  2HBL A;  3CCV N;  4FL9 A;  2NZT A;  2FLO A;  1U2V B;  4H0V B;  3E9O A;  4BR0 A;  5AQU A;  1OKJ A;  3SAF A;  3FLC O;  3HOS A;  3CJC A;  3ATU A;  1ZBS A;  3CET A;  5AQF A;  4BR7 A;  4BRL A;  2E2P A;  3FZH A;  1VAZ A;  5KPR A;  2GWK A;  2VWB A;  4H0T B;  3UB5 A;  4BRO A;  3E66 A;  1ATN A;  4CBX A;  4DKW A;  4CZM A;  5AFU A;  3M6G A;  3CJ7 A;  1HUX A;  3CI5 A;  4I6M B;  1NGG A;  2E1Y A;  3NVM A;  1G99 A;  3SMP A;  2VGM A;  5MLC Q;  3IDH A;  5AQJ A;  1VQL N;  2E1Z A;  3CMA N;  1QQO A;  1M1K O;  2NRV A;  4B9Q A;  3QML A;  4FWR A;  3SK3 A;  4BR9 A;  2FSN A;  1JCG A;  4GY2 B;  5BRH A;  5KPT A;  1EO1 A;  1Z05 A;  1XC3 A;  1YF5 L;  2ZGZ A;  1NGH A;  2ZWH A;  1K8K B;  3ENB A;  3JS6 A;  4ISF A;  3LDQ A;  4JKG A;  3ULE A;  3AGK A;  4H5N A;  4YOR A;  5EOY A;  5GAE P;  4PL8 A;  5JVG L;  3OBY A;  3H6E A;  4JEP A;  2QEX N;  1NGD A;  1S22 A;  2FF6 A;  4ILH A;  2HOE A;  2RHK A;  4BRQ A;  3M1F A;  1NMD A;  3B8A X;  3VEX A;  4BVP A;  1R59 O;  2QTD A;  3VGK A;  3ID6 A;  5BPN A;  3D2F A;  1E4F T;  3K9J A;  3LL3 A;  4A61 A;  3DJC A;  3VTH A;  2QW9 A;  1VQ9 N;  2W40 A;  1YUW A;  1ILY A;  2BTF A;  3CJA A;  3VGM A;  3H3N O;  5C2F A;  1OVY A;  3HBT A;  5M1N A;  4JNE A;  1YIT N;  2VCP A;  4A2B A;  3CQX A;  4F9O A;  4K41 A;  3OW2 M;  3EL2 A;  2HMP A;  3QBX A;  2I7N A;  4YOU A;  1IG8 A;  2QWO A;  5EXW A;  3SMS A;  1MA9 B;  3CHW A;  5CR4 A;  4WF9 L;  2BUP A;  4FWO A;  2NRW A;  3MCA B;  3U9Z A;  2NNW A;  3VEY A;  4EFH A;  2NRZ A;  1YJW N;  5AQO A;  4KH5 A;  3TSP A;  5F0X A;  3RSE A;  2E2O A;  4JAX A;  4B1X B;  3VTI A;  2IVN A;  3M3Z A;  2CGJ A;  4B1U B;  4FSV A;  4YOX A;  2QWL A;  5I9E B;  4JKD A;  3W0L A;  4CI6 A;  3DXM A;  5KQD A;  4KH4 A;  4BGA A;  5AQI A;  2A3Z A;  2A6A A;  3MDQ A;  5BRE A;  4IJN A;  1Q82 O;  1KD1 O;  5DM6 L;  2E2Q A;  2P9S A;  4FWS A;  1NM1 A;  3TPQ A;  3OA9 A;  3TTC A;  5GIO A;  4RWT A;  4PL7 A;  3UKR A;  2YCH A;  3JXU A;  4NO7 A;  2A5X A;  4BC5 A;  3C6A A;  4BR2 A;  5H1S Q;  3G71 N;  4BRK A;  1NGB A;  5AZJ B;  2V7Y A;  1VQP N;  5BRF A;  5BN8 A;  5AQM A;  5F1X A;  1LOT B;  3AAP A;  1YVN A;  3S41 A;  3EE8 A;  2GEM A;  1VQ7 N;  3OBW A;  3ZX3 A;  5AQS A;  4U7B A;  1MWM A;  4H5W A;  4BRE A;  1H1V A;  1RGI A;  2VYP A;  5AZI B;  3QFP A;  2P9K B;  3I33 A;  1W2B M;  3BF1 A;  3O9R A;  1QVG M;  5FPN A;  3SBT A;  4C1N I;  1KXP A;  4IOA L;  1EQY A;  2V51 B;  3A5O C;  4NB4 A;  4IDH A;  5C0Y A;  4B1W B;  2GTD A;  4IEE A;  5F2R A;  3K9K A;  4BRC A;  1Q86 O;  4A57 A;  4BGB A;  2NRH A;  5C12 A;  3DLL L;  3PIP L;  3CPW M;  5C2D A;  4E1J A;  4CZL A;  4RCH A;  2P9I B;  3FE1 A;  3H1V X;  3EZW A;  4JKE A;  4M7Y A;  3VEW A;  2HBM A;  2PFU A;  2OAN A;  3ZX0 A;  2IIR A;  3F5T A;  4JHD B;  2FXU A;  2A41 A;  3ENO A;  4QS9 A;  2F9T A;  4O8U A;  4FOI A;  1NBW A;  2GUP A;  4IZ9 A;  4M7X A;  4MO5 A;  3QB0 A;  3WQT A;  5AQQ A;  4B1Z A;  3H45 C;  4A2A A;  3KWI A;  4H0O A;  2UYT A;  3QIC A;  4XH1 A;  3CCE N;  5AQL A;  2P9P B;  4BRF A;  3WEE A;  2E2N A;  4HWI A;  2ZJQ L;  5M1O A;  2Q0R A;  3HI0 A;  4XH4 A;  5AQX A;  2QWM A;  5FPD A;  3OHR A;  4EIA A;  2QWN A;  3EKS A;  1J6Z A;  3VF2 A;  3VF4 A;  4AM7 A;  4AF1 A;  2GEL A;  2P9L A;  3MK6 A;  5BPL A;  3AAR A;  4A5A A;  3O1W A;  4MDA A;  4CZI A;  3CER A;  1ESV A;  3O8M A;  1P8Z A;  4NLC A;  3KK7 A;  3WXI A;  4K43 A;  4WQ4 A;  1XQS C;  1KAY A;  3LDN A;  2AA4 A;  5C15 A;  1Q18 A;  3C7N B;  3A8Y A;  1GLJ O;  3TU5 A;  5AQK A;  2FSK A;  5CHI A;  2A42 A;  3HTV A;  1C0F A;  1YIJ N;  3H3O B;  3LM2 A;  5JLF A;  1S72 N;  5KPZ A;  3N4P A;  4FWK A;  1GLD G;  3WXL A;  4YOY A;  3LDO A;  2QI2 A;  2YX6 A;  3WUH A;  4CBW A;  3FZL A;  3T69 A;  3D2F B;  4OPA A;  4DQ8 A;  5M1P A;  4BQZ A;  4B1Y B;  1SS6 A;  2DPN A;  4EAH D;  1DT9 A;  5GAH P;  1VQM N;  4AM6 A;  3MMV A;  3C0B A;  2YJF A;  5ADX H;  1E4G T;  4GNI A;  2WFB A;  3R3L A;  1SQK A;  5LJW A;  4CJ7 A;  4BRH A;  2Q0U A;  2GX9 A;  1YJ9 N;  4BQL A;  5B8H A;  2D4W A;  3F9M A;  2EWS A;  2KKZ A;  3HZ6 A;  3D7E O;  4BRI A;  5AQV A;  2J4R A;  1Q81 O;  2F9W A;  1HJO A;  3MX2 A;  3DXK B;  2ZJR L;  4FWL A;  3CCU N;  4Z94 A;  4FWN A;  1GLA G;  4JKC A;  3I8B A;  3D2E B;  1N8R O;  2P9U B;  2E88 A;  3E9P A;  1U6Z A;  2HBJ A;  4H5V A;  1K8K A;  4PKI A;  3ZYY X;  3CCR N;  4QS8 A;  3L6Q A;  3LM9 A;  1K8A O;  2E20 A;  3AGR A;  2NRX A;  2QWQ A;  4BRA A;  1TYQ B;  4IOX A;  3VET A;  3CJ9 A;  3MX5 A;  3GL1 A;  4JK7 A;  3VOV A;  4YDU C;  3HSC A;  1ZXO A;  4YOT A;  2AP1 A;  2F7T A;  3DXM B;  3VES A;  4B1V A;  4QS7 A;  1BG3 A;  3Q7C A;  5BRD A;  3AY9 A;  4H5T A;  1JJ2 M;  3KVG A;  2YHX A;  1GLB G;  3N4Q A;  4ISG A;  3UKU B;  3VEO A;  4FPA A;  3VMF B;  4R79 A;  2P9S B;  4U67 L;  4BC4 A;  3EKU A;  5BR9 A;  2CH5 A;  2QA4 N;  3O08 A;  2ZJP L;  2D0O A;  1T6D A;  4FO0 A;  3BEX A;  1WOQ A;  3O1B A;  3MWP A;  1BU6 O;  1DEJ A;  3BP8 A;  1GLL O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...