5C12A

Nuclease domain of the large terminase subunit gp2 of bacterial virus sf6
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
242
structure length
230
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 78
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c12A00
5M1OA 5M1QA 5C10A 4IEEA 5C2FA 5M1FA 5C2DA 3C6AA 4IDHA 5M1NA 4IEIA 5M1KA 5C12A 3C6HA 4IFEA 3CPEA 5M1PA 5C15A
chains in the Genus database with same CATH superfamily
1B9FA 5E41A 4B8AB 1VQ4N 2P9IB 4ELTA 1L5UA 3EY1A 3EKSA 1N5YA 4GV9A 3CHWA 5SWMA 1CLQA 2VGMA 2QK9A 1X3NA 4FLTA 1HQEA 1ZBHA 1SS6A 3EZ5A 1ASWA 2HW3A 3L4QA 1RBUA 3ZETA 1RBSA 4BR9A 1HR0K 2OTJN 3KWGA 1JCFA 3E9LA 4CJ5A 3UKUB 5AQFA 3F9KA 3KD5E 4FOIA 4NLBA 3VERA 3AARA 2Z1JA 2E6LA 2GUIA 4YDUC 4FWSA 2YNHA 2IGIA 4B9TA 1OH7A 2RPIA 3P4IA 1BHLA 1HQUA 3LP3A 3MWPA 4NO7A 3RVCA 5M1OA 1TVRA 4FVUA 4BDZA 1QSYA 4FZZA 2KFNA 1LW0A 1S3XA 3C6TA 3ZT3A 2WC9A 2O8EA 5EXWA 5GAGP 3LP1A 3OJSA 3L8BA 3AVJA 5CZ1A 4LF9K 4GVEA 3KIOA 4RCHA 3GE1A 4FWMA 4CGGA 2ZJQL 3AVBA 4X65K 1NJXA 3O9SA 4BR2A 1OKJA 1HNIA 1NJZA 3KTQA 2UXBK 4JYAK 2GV9A 1YJNN 1SL0A 4KB0A 4W5NA 2GWJA 2Q31A 1U2VA 1YVUA 1NU0A 1RDUA 3BZCA 2IVNA 3NE6A 4WFNL 3LDSA 2IAJA 3CJ1A 3VEZA 4JEPA 4BRMA 4BDYA 2HHWA 4QS9A 2P9SB 4E1JA 4CJQA 1SL1A 4MDBA 1XHZA 1KAXA 5BPMA 1OH8A 3NH1A 3OYAA 2D5RA 2P9KB 3DYAA 1KAYA 2E6MA 2Y1IA 3J7YP 4JKBA 5C15A 2GWKA 3QESA 2QA4N 1C0FA 1S9GA 4ELVA 3GDQA 4FWNA 4OJRA 3L2UA 4ISFA 4BVOA 2OANA 3QNOA 3HVTA 2NRTA 5DMRA 4O4GA 5HBMA 2DFEA 1O13A 1QHTA 1K8KB 2HOEA 2QEXN 4JI5K 1CZBA 1YIJN 3IKMA 1D9FA 3FZKA 1RBRA 3UKRA 4W5QA 5BRDA 3BZKA 4CEOA 1KFDA 3HP9A 4PKIA 2X74A 3QEIA 3SUPA 2ZJRL 4FWPA 3JAMO 5BR9A 4YOYA 1ILYA 4PHTX 1SKRA 3C6AA 4BR4A 4PL7A 4OKEA 3S41A 3L2QA 1X9SA 2O8DA 3MMVA 2XHBA 4BG8A 4DCHA 4DUZK 1Q86O 3FZMA 3MN9A 1K9MO 3ZCMA 3OBWA 2OA8A 5KGXA 5DM7L 2FSJA 3WNFA 1UWBA 4QS8A 4NLCA 5AQKA 1NK9A 3NGZA 1V4TA 2NRHA 3DRSA 2ZQBA 3CC7N 4A2BA 1N32K 4DSLA 2JGUA 3VQ6A 3WXIA 3P39A 3DLHA 1S6QA 3FE1A 4B1YB 1VSJA 3RWUA 1L3TA 1J53A 4N47A 4M45A 3CPWM 4BRDA 3L2VA 4KHYA 5AFUA 4H8KA 2HBKA 3BUZB 1A5XA 4CEDA 4BRIA 1WAJA 2P9LA 2O8FA 2X6NA 3G0ZA 1ESVA 2RKIA 4FJ8A 5AQGA 3AVLA 5AQPA 4F9OA 2HF4A 4AHSA 5HRNA 2UXCK 1B92A 3I55N 1T6CA 2I5JA 3FGUA 3CD6N 4CK1A 3VOVA 2HBJA 3KKRA 4E1MA 3CETA 2FC0A 4YOWA 3THXA 1BA1A 3CCEN 1YHQN 4EAHD 5IT9O 2XY6A 2FXUA 3CYMA 2HHSA 1VRTA 3FR0A 3O8MA 3HOSA 2V7ZA 2HHXA 3EZWA 4G9ZA 3G4SN 5KQDA 1NK8A 1BCOA 3UIQA 1I39A 2W6KA 3A5MC 3P5JA 1GLFO 2E2NA 1LAWA 3VEYA 4WYBA 4CZJA 2LSNA 4FZYA 4N5SA 4FJIA 5KTQA 5GIPA 2E5LK 5HRRA 2O8BB 2V52B 5EVZA 4B1ZA 4YHHK 4FW2A 5JLFA 3H3NO 4HTLA 1SZ2A 4NCGA 2VWBA 4WQ4C 3EL2A 4KH4A 3MCAB 1U04A 1VQKN 3VTIA 5LJWA 5LY3A 2UYTA 4B3TK 5JVGL 3OYEA 4M3TA 4CJVA 1KTQA 4UQGA 1V4SA 5AQRA 3WT0A 1KVAA 4CEZA 4H0OA 1HJOA 1NKEA 4N56A 2F4VK 5HRPA 3I0SA 1WNSA 4CCHA 2AJQA 3ZT4A 4FM0A 4JHDB 4DUYK 4DTMA 1EX4A 2QXFA 4KHWA 4FVMA 4DR6K 5I3UA 4FM1A 1RFQA 3PUFA 1WSIA 4DS5A 4DB3A 4AHUA 2ITGA 3VQ4A 2XY5A 3AO4A 4GKKK 3HYFA 2HNDA 2YHWA 5C2FA 3D2FA 4FO0A 2G8UA 4BRHA 3L3VA 4H5WA 4KHNA 4DSJA 2KTQA 2OYQA 2D1KA 4EZ6A 3KK1A 3LDPA 2ZD1A 3N4PA 3O4NA 4GV6A 3MECA 4ILGB 2W41A 1I3AA 2FBYA 4IO8A 4FLWA 1VSIA 2G8HA 1NMDA 5AZIA 4A57A 4KAZA 2A40A 4CJTA 4BRCA 1U49A 4EZ9A 4DV1K 5FPMA 2VQEK 1P90A 3PO4A 3ZSVA 4M3ZA 3MAQA 4F2SA 3HVRA 2KZMA 1HRHA 2WTUA 4WFBL 1FK9A 3MCPA 1T44A 4JS4A 4LF5K 2P9UA 4JKAA 3SBGA 2D0OA 3TPQA 3CC2N 1TYQB 3K9KA 2GX9A 1Q8IA 3U3YA 1VQNN 3HO1A 4JN4A 1KSPA 3ZT0A 4OVLA 3P1GA 1RT6A 1ASUA 2CH5A 2FSKA 4KH5A 4FOEA 4CGJA 3C6UA 3M8QA 4DKWA 1HX1A 4FJ9A 3MXJA 4CGDA 3VEOA 4E7JA 4C1NK 4ZHRA 4DV0K 3DXMA 1Q81O 3NMUA 2QKKA 3O3HA 3R9PA 1HNZK 2NRRA 4C8MA 4JD2B 3J8AA 4GV3A 1TK8A 3EO3A 3DRPA 3KK2A 2W6LA 3TI0A 1VSDA 4QOZB 3QBXA 3LDQA 1T7PA 3HTVA 3HZ6A 3CJBA 4LFAK 2QWLA 3LL3A 4YNQA 3P31A 2BGGA 1L3UA 4MO4A 3NF6A 3AA2A 1VQPN 4FJNA 2YX6A 4BQLA 2ZJPL 3QETA 2OTLN 3VQPA 4IKFA 3CIPA 1RDDA 4OPKA 2E1YA 3O80A 5K14A 1TK5A 3LDOA 3H3OB 3DJCA 4CJ7A 4K41A 3NH0A 4DTNA 3M6GA 2F96A 4ID1A 3EEQA 5C25A 5HL7L 1KVBA 4H5NA 3S3NA 2X6SA 2H3GX 4ZTJA 4O8UA 1CXQA 4WQ5C 3T1AA 4DV7K 2W40A 2OPRA 3C65A 4DFJA 4JNEA 1JJ2M 2Q1NA 1C0UA 5EX5A 4CZIA 5I9EB 3S3OA 4DR2K 1NK7A 1WSHA 1M1KO 1BUPA 3R8EA 5CR4A 3NFAA 4AHRA 2P5GA 2YNIA 1BWFO 2F9WA 2YKMA 1EXQA 1KD1O 3AV9A 3SMSA 5KPTA 3VQQA 1EQYA 3E9OA 3TTDA 3IRXA 4M7YA 5GAEP 2YHBA 3ULEB 4CVNE 4B3SK 4FJHA 1YITN 3TTCA 4M3RA 3V9WA 1S9EA 4B3MK 3AVKA 3LPUA 1NGFA 3TAQA 1QQNA 2PY5A 3UB5A 4RWTA 1H1VA 2PBDA 3O1WA 1YJWN 3NVKA 5BRHA 1D8YA 4L8RB 1HNVA 2Z1IA 1G15A 3IUCA 3N4QA 3OYNA 1RILA 1JLAA 3ALYA 1NBWA 2Q97A 3CPEA 4DTXA 1OH6A 3SUOA 4JI2K 3CQ8A 1J54A 5AQUA 4J2EA 4DTOA 4JAXA 3K59A 3W0LA 2Q3SA 2DFFA 2YI1A 3V4IA 2HHTA 2DFHA 1IBKK 4L3QA 5C42A 3FLCO 4I6MB 4FWRA 4XEIA 4CIFA 2GUPA 4BC5A 1EP4A 3SCXA 2O8DB 1XMOK 2A41A 2IS3A 3F5TA 3LDNA 5FLXO 4XIUA 2Q0UA 3ZT1A 3PSFA 5M1KA 3QEXA 2XY7A 1O1WA 4K8XA 3KWIA 3M8RA 1BG3A 1IKWA 3U3GA 3OYMA 1XI1A 3E66A 4XH1A 3VQ9A 4H4MA 3H1VX 1S1TA 3NF9A 3P83D 5E26A 1JLFA 2IC3A 5FPNA 4E19A 4JV5K 3VGMA 3A2FA 3NGIA 3CC4N 3NDKA 1NK0A 1WSFA 3L4IA 1D4XA 3AVHA 1C1AA 4FWKA 1U47A 3I8BA 3M5RA 3WQUA 3ZSYA 4AF1A 1REVA 3DLEA 3DLKA 1B9DA 2RN2A 3KJVA 4DU1A 1HYVA 3CCMN 2A5XA 4CF9A 1GLDG 3SUQA 2Q0RA 1NGEA 1MDUB 5BRFA 4IXCA 4EP5A 4F8RA 4Z4EA 3SAGA 4KFBA 3SAFA 1T8EA 5AR0A 3ZSXA 2CGKA 4ICLA 4RW6A 3EYZA 2E1ZA 4KHSA 4J2BA 1EETA 4OKKA 1WSJA 5I42A 2IIRA 2QW9A 1IJJA 3MXIA 3D7EO 3L6QA 2P5OA 2KLAA 3THXB 3TABA 1NG9A 2B5JA 5LMNK 1GLEG 3L2RA 4ID5A 1A5WA 4CGFA 5DM6L 1S22A 1NGHA 3DWLA 1NGBA 3DAWA 4BGBA 4DSKA 4IG0A 3THYA 4B9VA 1ASVA 4LC9B 4DSIA 3V1RA 4E1NA 3SI6A 1HPZA 2RE2A 4EFHA 4O0JA 1YVNA 2HVHA 1HPMA 1ZXOA 3O4WA 4DFPA 4IO9L 3SNNA 3AGKA 4CGHA 1NK4A 4EHUA 4CEFA 4DU3A 3M8PA 2PYLA 2JWLA 2YV0X 3ZT2A 2OCEA 1QVFM 4CBUA 2FF6A 5FRNA 3AVCA 1ITGA 2GTDA 3K5OA 2ZGYA 1GOBA 3CJ9A 4EP4A 2WOMA 3AA4A 1RDBA 3LM9A 2VQFK 3CCUN 3KZBA 1JLQA 4O5BA 5KGWA 1GLLO 3C0BA 4BACA 4WF9L 3OW2M 2ZF5O 3ZX2A 2NUBA 3CCLN 2DY4A 4GY2B 1E4GT 3RSEA 4R5PA 3ASMA 3VF2A 3HM8A 4DSEA 3CCRN 1XMQK 4CE9A 4KBOA 4AHCA 1RDAA 4IFVA 4CZLA 4YY3K 5LL6Z 1W97L 1S1UA 1BI4A 1HKCA 2PZSA 2E20A 1QZ6A 5AFUH 3OYLA 4N41A 1NMNA 5BN9A 1KFSA 3HSCA 3W3DA 2ASPA 3KK7A 3DOLA 3LALA 1NLVA 2O4IA 4IWVA 4H5TA 3PX4A 5AZIB 4DTJA 3R6MA 1ZC6A 4AHTA 4B9NA 1HKGA 2XY8A 4CHZA 2E2PA 4B9UA 3K5NA 2I7PA 1DTTA 3AY9A 4BROA 1QVGM 1YJ9N 1NJWA 1GLAG 3U9ZA 4BC2A 4H03B 4DHYA 3PIOL 3VF4A 1YTAA 4FSVA 3TTFA 3VTHA 3ZX0A 1TUYA 4KTWA 4MFBA 4JLHA 4O55A 1HKBA 4YOVA 3V9XA 3LAMA 2HMIA 5GADP 4E7HA 4JK7A 3RMCA 5GIOA 2OZMA 3G6EN 4FK2A 3SPYA 2HHUA 4CJLA 3HM9A 3DXMB 4PWDA 2FF3B 4Z4GA 1FKOA 2KHOA 1DTQA 4FZXC 1BU6O 3HXMA 2A1RA 4CJPA 3EE9A 3GL1A 4DTRA 4YORA 1UA0A 5M1QA 1VSFA 3CFPA 2P9PA 2HB5A 2IDOA 4GW6A 4CK2A 4BR5A 4MDAA 2ASMA 4PL8A 4KREA 3QBWA 1U48A 5AQTA 3ZEUA 3NCIA 3PIPL 3DM2A 4ELUA 4O8KA 4FK4A 4LSNA 1YF5L 1S6PA 3QEVA 4AH9A 3CM5A 3PSIA 4Y1CA 1QQMA 4PQUA 3CQYA 1C0GA 5AQWA 2A6AA 2WFBA 3S9HA 1JKHA 3JXUA 4LFBK 3OY9A 1YTUA 1S72N 4KI6A 3J7AP 1EWQA 3K5MA 4B1XB 3SBTA 1QHAA 4ILJA 4NCBA 5M1PA 4FLXA 3SLCA 3O4QA 4BC3A 4CJWA 3NBPA 3TAMA 2V7YA 2QWPA 3CCSN 4RG8A 4Z4CA 3KLFA 2NRVA 3C95A 3THWB 3SK3A 3H6EA 2NRZA 2PFUA 1J6ZA 3O9RA 5AQYA 4BRFA 3SQ4A 4I2PA 3MK6A 3SJJA 4RW9A 3LWLA 4CF2A 4B3OA 1R59O 3IAYA 4LY7A 1E3MA 1NNEA 1BIZA 2UUAK 3LAKA 3ID8A 3OYFA 3ZYYX 1RDCA 3HPOA 2KFZA 1RT3A 5FRMA 1U45A 1NM1A 3O9TA 4JRPA 2B4JA 4ZTFA 2P9IA 1WSGA 3TAPA 3H45C 5J2MA 2E8AA 3L0QA 4A5AA 3U4LA 4N76A 3IMXA 3HOTA 2O4GA 1GLCG 1RT2A 2WBNA 3QFPA 4JI3K 3VQEA 5AQSA 4M7XA 5AJ3K 1NGAA 1OVYA 1TV6A 5BR8K 4MLEA 2Q2RA 5BPNA 3OVNA 2E4LA 2QWRA 3OYHA 2Z1GA 1N34K 1JCGA 1TKXA 3ATUA 4JKCA 4OPHA 3WEEB 1OVQA 2FBVA 4NYNA 5LJVA 4ISEA 3HJFA 4IDKA 1ZBSA 3BF3A 4CHOA 2PYJA 1QS4A 4Z4IA 1NGJA 4I9LA 2HHQA 2BUPA 3K57A 3TSQA 5AQLA 1JLEA 3TSUA 4IG3A 2VWKA 4CFDA 4H5VA 1LWCA 3R1XA 4I9QA 2HHVA 4KTQA 1RBTA 4PA1A 4CK3A 3QB0A 4DR5K 4YFUA 2BANA 3JYTA 3FFIA 2BTFA 3V1OA 3I8DA 1EWRA 3LANA 5ELZA 3IS9A 2W42A 4HUFA 2G8WA 1WUAA 3L3UA 4R79A 4I2QA 4CJEA 5AQOA 2DPNA 4HVJA 3AO2A 4OX9K 3GBTA 1IKYA 4A2AA 4B08A 4KKOA 1HNXK 4M63C 5D3GA 4K0KK 1BDGA 1BCMA 2UXDK 4Q5VA 3VEVA 4B9SA 1NOZA 1VSEA 2G8VA 3GG4A 2O8CB 2P9SA 3HPHA 3BEXA 4AHVA 3B6OA 4RW8A 5B8HA 4E0DA 1P8ZA 2OPQA 3ZSRA 1KVCA 1KRPA 1RGIA 2P9KA 3D45A 3I56N 3T19A 3CI5A 4M3XA 1RTHA 4OLAA 3FZFA 3DLGA 5AQIA 3VQ5A 1OH5A 2J4RA 2FLOA 4K42A 4OPAA 3SYZA 3WQTA 1NKCA 4X62K 4CF1A 4F3OA 1WBBA 5KRTA 1C1BA 1MU2A 4DTPA 1XNRK 3RTVA 3AVIA 1LOTB 4BE2A 3K5LA 4F3TA 1W9HA 4FJGA 3QLHA 1X3MA 1LWFA 5CYQA 4Z4HA 3BGRA 1DLOA 4FM2A 2HSTA 3ZSOA 1IKXA 3ZETB 3VQAA 4B9QA 3PY8A 3ZSZA 3NVMA 3EE8A 3T1HK 5F1XA 1S1XA 3TSPA 3OS2A 3CCVN 2RF2A 4Z0UA 4A61A 2ITMA 3RRGA 4HCBA 4IOXA 1RT5A 3CCQN 2JLEA 2E2OA 5JVHL 1DEJA 4PKHA 3ENHA 2YKNA 1ZBIA 1ZBUA 3DLBA 3K9JA 4W5RA 2ASOA 2ZWHA 1D5AA 3D6RA 4A5BA 3O1BA 4NXMK 3DOKA 4M42A 4O5FA 2HMPA 2O8EB 3F2KA 4FJMA 4HWIA 4DTSA 5J2QA 3MEEA 5M1NA 3LWMA 3OYKA 1YAGA 3THVA 4CIEA 3OHRA 1WLJA 3EN9A 5EOYA 3VEXA 1IO2A 3C7NA 4FLYA 4H0VB 3M3ZA 1QQCA 4CEEA 3J7ZO 3ZLJA 3RSEB 4CHQA 3LP2A 1KLMA 4JKGA 4KV8A 3V9SA 3WNEA 4H5RA 3NF7A 1C0MA 1HLUA 1VAZA 1Q9YA 3V9ZA 1FW6A 1U2VB 2E88A 3LM2A 4AM7A 4DV3K 4H0PA 3R3LA 3CQXA 1JLGA 3I33A 4BVPA 3ZSQA 1X9MA 4IOAL 4CESA 1JCEA 2Q36A 4CGIA 4H0XB 4BY9C 3O9QA 4OGCA 2HHHK 4C8LA 3KLEA 3IG1A 3U8XA 4JKEA 3BF1A 4BRKA 1YXQA 2BE2A 4NXNK 4NB4A 4H4OA 3AVMA 4OO1J 2VWJA 5EY4A 1KQSM 4IFYA 4JS5A 4J8FA 2KKZA 2A3ZA 3BP8A 4G1QA 3GOIA 4IZ9A 4FLVA 4JRQA 2QM1A 2YCHA 5C12A 4CJUA 3VA3A 2NRWA 4XH5A 1IBMK 1FXXA 5J2PA 4CBWA 3V9UA 3E9PA 3UKRB 5JMVA 2O8BA 1NGCA 3Q7CA 1S1WA 4O0IA 4FJKA 1JLCA 3NF8A 3HBTA 3MEDA 5T7BA 3CMEN 3QEPA 1LW2A 4DR3K 3VENA 1VQON 3J81O 4FJJA 4LF8K 1RCHA 3ISNC 5H1SQ 2AP1A 4BREA 2WUSA 3OA9A 4PKGA 3SV3A 2D0PA 3QICA 4E7IA 4JKHA 2P9PB 2JWKA 2NNWA 2GBZA 5FDLA 1KC8O 3LDLA 4DFMA 3T1YK 1NKBA 3WXJA 2NZTA 2VG6A 5CZ2A 4FPAA 5ADXA 4JHDA 5FPDA 4HHTA 3TAEA 2CGLA 3TAFA 1IG9A 1BQNA 5FPEA 4Y1DA 5JS2A 2UU9K 1HNWK 4H0YB 3RMAA 4IDHA 1JXEA 4DTUA 1Z26A 2YNFA 3TAGA 2UUBK 3ID6A 3RR7A 1YUWA 1N36K 2P9LB 2O8FB 4PY5A 4BG9A 1WOQA 2X78A 1WB9A 2D0BA 3MX5A 1WAFA 3O3FA 3O6WA 3C94A 1XNQK 1IG8A 1UAXA 2CGJA 1VRUA 4O44A 5E84A 3A5LC 4BRPA 3SMPA 2Y1JA 1RT4A 3VF6A 4YOTA 1QZ5A 3BY5A 1WBDA 4JI4K 5AQXA 3SPZA 3VQBA 4DR7K 4KI4A 4FJLA 2YHXA 3AVFA 2OPPA 4B8CA 4JI7K 1ZBFA 2Z1HA 2YJEA 1K6YA 1TYQA 4DQIA 4WQ5A 2EX3A 3CCJN 3H46O 3PX0A 5C10A 4A62A 3QIPA 2KW4A 3CERA 4CJ3A 4B1WB 2IOCA 1T03A 5HRSA 3MN6A 3O08A 2HBLA 1VQ6N 3LZJA 1W0HA 3RMBA 1LAVA 4IEIA 4NCAA 4YOUA 4OGEA 1HJRA 3CG7A 2OPSA 4FJXA 4JD2A 3QIOA 3VA0A 3MDQA 2YNGA 3OYCA 1S1VA 3DRRA 1VQMN 4K43A 5BPLA 3DLRA 3WXLA 3T69A 4CJKA 4OKJA 4F4KA 5JLHA 4B9MA 4QS7A 1J9AA 4C1NI 4K25A 4DF4A 1K73O 2ATQA 4LFCK 4JKFA 3HP6A 2F8SA 3WNHA 4FCYA 1MWMA 4IOCL 2P9NA 4GVMA 3AO3A 3AA5X 3D2FB 4FJ7A 3VQCA 3F73A 3RMDA 1NOYA 5HOOA 4J2DA 4W5OA 3VQ8A 5KPRA 1CZAN 2GELA 1YT3A 5CHIA 2QWMA 1VSLA 1X1PA 4E89A 1I94K 4AM6A 5CYMA 1N8RO 3SAHA 1TL1A 3CM6A 2D0CA 5F2RA 1SUQA 1TGOA 4DFKA 1GOCA 2QWOA 4LSLA 1NJYA 4KH6A 4A59A 5GINA 3KK3A 1C1CA 3BDPA 3ULEA 2P9UB 3ENOA 4IFEA 3A8YA 1LCUA 3G71N 5AZJA 3C6HA 1C0TA 3H1QA 1GOAA 1VQ9N 4JK9A 3MX2A 3SQ0A 3D2EA 3PX6A 1GLBG 4Y0WA 4LH5A 3K2PA 4DG1A 4B9LA 5C2DA 4DV2K 2G8IA 2ZE2A 4FLZA 2HNYA 1UA1A 1ZYQA 4FWLA 4DU4A 4HTUA 1VQ8N 4J2AA 5HP1A 3NHGA 1X9WA 1F21A 1FKPA 1QQOA 3G25A 4CD3A 4Z4FA 4LF7K 4CZMA 3RR8A 3F9MA 4CEAA 1DKGD 5HROA 5GAHP 4B3RK 3ENBA 1U6ZA 4I6MA 1NGIA 1IV0A 3PO5A 4BDPA 4CIGA 4GKJK 4IBNA 4DQSA 3OYIA 3ZSWA 2VYPA 1L3SA 1J5EK 2HVIA 3KLIA 2QI2A 5CY4A 3AVGA 3MEGA 2NLXA 5J1EA 3DMJA 3U9DA 2HNZA 1HUXA 3FFKB 4MLHA 2P1JA 1XC3A 3VGLA 4YDUA 5AQMA 1Z25A 3CFRA 4BRAA 3A5OC 4CJ4A 5HLFA 4DQRA 1BOTO 2E2QA 1Q9XA 3DXKA 2HF3A 1BIUA 3C7NB 3CFOA 5MLCQ 1XHXA 4DF8A 4FLUA 2ETJA 1TL3A 3QFUA 4JKGB 4HUGA 3KKSA 4K8ZA 4GNIA 3CJCA 4DS4A 1RTJA 3AA3A 3OS1A 3MWTA 4Z94A 5AQVA 4DR1K 2WONA 4PUOA 1SAZA 3CXCM 2BH1A 4CFBA 4FYDA 4E3SA 1IH7A 3SUNA 4DQQA 4LF6K 3IDHA 3WUHA 1T6DA 1NWKA 4XH4A 1CZ9A 3K58A 4QCLA 4IEEA 4ISGA 4KB1A 1M90O 4OLBA 5BREA 2VCPA 2YJFA 1RT1A 3VEWA 5AQHA 3WNGA 1BA0A 1IBLK 4TSXA 1L3VA 4BR0A 3B6PA 3OJUA 4IJNA 4CZFA 3TARA 4CD1A 1NK6A 5C24A 4BGAA 4JKDA 2IVPA 1ATRA 3UKUA 1RT7A 1J5OA 4BQZA 3FZHA 3ITHA 1WSEA 5IWAK 2CH6A 4AQYK 3KVGA 4FWQA 4KPYA 4FJ5A 1T05A 1VHXA 3MN7A 1D9DA 2VG7A 4DQ8A 1KXPA 4KTZA 1NJIO 3M1FA 1IKVA 1VSHA 1JL2A 5BN8A 4U7BA 3OS0A 4BRLA 4CZEA 3PLAA 1X9JA 3AVAA 4HCCA 4OPJA 3TANA 1CXUA 3L2WA 1EKEA 2A42A 2D0AA 2F7TA 3JSMA 4BWMA 4DV4K 2D4WA 1XWLA 4JI8K 3O3GA 2F9TA 4FL9A 4CECA 5AQQA 3CMAN 1VSKA 1ATSA 1VSMA 2YHAA 1RTIA 4MO5A 4CZKA 4AILC 1HMVA 1SL2A 4CF8A 4CBXA 4V19S 1QSSA 3WXKA 4YOXA 1HYSA 4CHNA 3VETA 4KHUA 3LP0A 4BRNA 1VQ5N 3AAPA 5AQJA 4DR4K 1DGKN 1TKZA 1TK0A 3IFRA 2R7YA 1T3VA 2I7NA 3DLLL 2UUCK 4RTFD 3HL8A 3KHYA 1ZBLA 1BL3A 3CJAA 2ZM6K 5KPZA 3HSTB 3NH2A 5F0XA 1KLNA 2G8FA 3J80O 4CI6A 2IVOA 5KQ8A 1TUUA 3OYGA 3HK2A 1BQMA 3THYB 4FXDA 4CJFA 4FPBA 1WN7A 1JXBA 3QINA 2DTUA 4M3WA 3LPTA 4X66K 1K8KA 3V81A 3TWHA 3DI6A 4LD0A 1TKDA 2G8KA 2FBXA 1EO1A 2P51A 5DK5A 3AGRA 4FWOA 5KI6A 3QDKA 5EU7A 2XO7A 3PV8A 3LZIA 3CF5L 1TAQA 4LF4K 3G10A 2ZGZA 4DQPA 3VQ7A 1SKSA 1Q7YO 1LWEA 4C8KA 3AAQA 3U6FA 2EHGA 1N33K 3HPGA 5J2NA 4DV6K 4RW4A 3T7ZA 3KD1E 4Q0BA 4U67L 3VQDA 3M8SA 3HT3A 3E01A 3OBYA 1Z6RA 2QXLA 5C0YA 1C6VA 5SZTA 3SV4A 3D0PA 4CHPA 3KLGA 1TAUA 2KZZA 4DWIA 4MQ3A 1NK5A 1R0AA 3AO1A 1E4FT 4DSFA 3RRHA 4WFAL 4DLEA 3S3MA 3CJ7A 4WQ4A 2FBTA 3V6DA 2GEMA 3OTOK 3ULDA 4F2RA 4BWJA 1U4BA 3OYDA 1K8AO 4DV5K 4KO0A 4BR7A 5ADXH 5FROA 2P9NB 1XQSC 3VGKA 5M1FA 4WE1A 2AA4A 2F8TA 3QO9A 1TKTA 4JI6K 1BI4B 1HYZA 4DMNA 4CZGA 3FZLA 4WCEL 4EIAA 3THWA 1RBVA 4M3UA 1KAZA 1G99A 1N6QA 4CW7B 3H08A 1NGDA 2PAVA 5LMUK 2HBMA 1QE1A 3SQ2A 3O9UA 3VESA 4C8OA 4CHYA 5KRSA 4E7KA 3HI0A 2VGNA 2A1SA 4HUEA 4CERA 1RDWX 5AQNA 4M41A 4I7FA 4B1VA 4NYFA 4FK0A 1NGGA 2QWNA 1W2BM 3OYJA 3MN5A 2KQ2A 3VPZA 4FW1A 4BE1A 4M3YA 4CJRA 4H0TB 4BC4A 3P38A 5AZJB 4CFCA 4B1UB 4KHQA 3ATVA 4CF0A 4CJSA 3D2EB 2RHKA 4JI1K 1BGXT 4X64K 1SKWA 4JK8A 3O5BA 3VN5A 1RTDA 1XC9A 3I0RA 4W5TA 3VMFB 4QAGA 4EHTA 4CFAA 3SZ2A 3QMLA 4CEQA 3B8AX 3WEEA 3UE5A 3K0SA 1ATNA 1MWKA 3JS6A 1RNHA 2OZSA 5TKWA 1FJGK 1VQLN 3SJHA 4C23A 5CE3A 5AQZA 2QKBA 1YI2N 1DT9A 3WXMB 3HRGA 3AO5A 4GMJB 4BRGA 4RW7A 1JL1A 2EWSA 1KCFA 1A5VA 3EKUA 3ZEUB 3ZX3A 4ILHA 4KRFA 2B6AA 1Y97A 3Q7BA 1QSLA 2QWQA 3NGYA 1W7AA 1LV5A 3MXMA 2FSNA 4BE0A 1SQKA 5JS1A 3A0IX 3V1QA 3AVNA 1VQ7N 1BISA 4LH4A 1MA9B 3QEWA 1Y64A 3E1YA 2QTDA 4UY8O 3KLHA 4KHPK 3TU5A 4DLGA 3DXKB 2XRIA 1Q82O 4CZHA 2BDPA 3A5NC 1Z05A 4E7LA 1SV5A 1Q18A 3TR8A 1XUPO 5JICA 3OYBA 3SQ1A 2O8CA 3NAEA 1BO5O 1S5JA 2V51B 5TKYA 1VK0A 4CEBA 1QTMA 4JI0K 3QERA 2NRXA 2YHYA 5A2QO 1UOCA 4C8NA 1JLBA 4IJAA 1GLJO 3T3FA 2VG5A 3QNNA 4BRQA
chains in the Genus database with same CATH topology
1QQOA 4CD3A 3C65A 3G25A 4JNEA 1JJ2M 2Q1NA 2P9IB 1VQ4N 3QB0A 5EX5A 4CZIA 5I9EB 3EKSA 4CZMA 4GV9A 3F9MA 1M1KO 3CHWA 1BUPA 2BTFA 3R8EA 5CR4A 1DKGD 2VGMA 5GAHP 1BWFO 2F9WA 3ENBA 1X3NA 1U6ZA 4I6MA 5ELZA 1NGIA 1SS6A 1WUAA 1KD1O 4R79A 3L4QA 3SMSA 5KPTA 5AQOA 3ZETA 4BR9A 2DPNA 1EQYA 3E9OA 2OTJN 3TTDA 3GBTA 4M7YA 3KWGA 1JCFA 4A2AA 3E9LA 5GAEP 2VYPA 3ULEB 3UKUB 4M63C 5AQFA 1YITN 2QI2A 3TTCA 4FOIA 2NLXA 4NLBA 1BDGA 3VERA 3AARA 3U9DA 3VEVA 1NGFA 1HUXA 3FFKB 3GG4A 1QQNA 4FWSA 4MLHA 4YDUC 1XC3A 3UB5A 2P9SA 3VGLA 3BEXA 4YDUA 4RWTA 1H1VA 5AQMA 5B8HA 2PBDA 4BRAA 3A5OC 3O1WA 3P4IA 1P8ZA 1YJWN 3NVKA 1BOTO 2E2QA 5BRHA 3MWPA 3RVCA 4NO7A 1RGIA 2P9KA 3DXKA 5M1OA 2HF3A 3C7NB 3IUCA 3I56N 3CI5A 4FVUA 3N4QA 5MLCQ 1NBWA 2Q97A 3CPEA 3FZFA 5AQIA 1S3XA 3QFUA 2J4RA 2WC9A 2FLOA 4JKGB 4K42A 4OPAA 5EXWA 3WQTA 5GAGP 4GNIA 3CJCA 5AQUA 4GVEA 4JAXA 3W0LA 3MWTA 4Z94A 4RCHA 2YI1A 3GE1A 4FWMA 5AQVA 1LOTB 1SAZA 2ZJQL 3CXCM 2BH1A 4L3QA 3O9SA 4BR2A 3FLCO 4I6MB 1OKJA 4FWRA 4XEIA 1X3MA 2GUPA 2HSTA 4BC5A 4B9QA 3ZETB 2A41A 3NVMA 3EE8A 5F1XA 3TSPA 3F5TA 3IDHA 3LDNA 3WUHA 1YJNN 1T6DA 1NWKA 2GWJA 2Q31A 2Q0UA 4XH4A 5M1KA 3CCVN 1U2VA 3KWIA 4A61A 1RDUA 2IVNA 2ITMA 1BG3A 4WFNL 4IEEA 3E66A 4ISGA 4IOXA 4XH1A 3CCQN 1M90O 3CJ1A 5BREA 2VCPA 2YJFA 2E2OA 3H1VX 4JEPA 3VEZA 3VEWA 1DEJA 4PKHA 4QS9A 3ENHA 2P9SB 5E26A 4BRMA 4E1JA 5AQHA 5FPNA 3VGMA 1BA0A 4MDBA 4BR0A 3CC4N 1KAXA 4IJNA 4CZFA 5BPMA 4CD1A 4BGAA 3L4IA 4JKDA 1D4XA 3K9JA 2P9KB 2IVPA 1ATRA 4FWKA 1KAYA 2ASOA 3I8BA 2ZWHA 3M5RA 4JKBA 3WQUA 3UKUA 4AF1A 5C15A 2GWKA 3D6RA 4A5BA 2QA4N 3O1BA 4BQZA 2A5XA 3FZHA 3CCMN 1GLDG 4O5FA 1C0FA 2HMPA 2CH6A 2Q0RA 3GDQA 1NGEA 3KVGA 3F2KA 4FWNA 4FWQA 4HWIA 1MDUB 5BRFA 4ISFA 4IXCA 5M1NA 3SAGA 3SAFA 1YAGA 5AR0A 4BVOA 2OANA 3MN7A 2CGKA 3OHRA 3EN9A 2NRTA 5EOYA 3VEXA 3C7NA 2E1ZA 4H0VB 1O13A 4DQ8A 3M3ZA 1KXPA 2HOEA 1K8KB 2IIRA 2QW9A 3M1FA 3J7ZO 3RSEB 1NJIO 1IJJA 2QEXN 1YIJN 3D7EO 3L6QA 3IKMA 2KLAA 5BN8A 3FZKA 4U7BA 4BRLA 1GLEG 4JKGA 4CZEA 3UKRA 1X9JA 5BRDA 3PLAA 4H5RA 5DM6L 1HLUA 1VAZA 4PKIA 1S22A 1NGHA 3DWLA 1U2VB 1NGBA 3DAWA 2E88A 3LM2A 4AM7A 4FWPA 4H0PA 4BGBA 2ZJRL 5BR9A 3R3LA 4YOYA 1ILYA 2A42A 3CQXA 3I33A 4LC9B 4BVPA 2F7TA 4PHTX 3C6AA 4BR4A 4IOAL 4PL7A 1JCEA 2D4WA 3S41A 2Q36A 3MMVA 2RE2A 4EFHA 4H0XB 4BG8A 4DCHA 2F9TA 4FL9A 3O9QA 1YVNA 5AQQA 3CMAN 3FZMA 3MN9A 1Q86O 1ATSA 1K9MO 3OBWA 4MO5A 4CZKA 1HPMA 1ZXOA 3U8XA 5DM7L 2FSJA 3BF1A 4JKEA 3O4WA 4BRKA 4IO9L 4QS8A 1YXQA 4NB4A 4NLCA 5AQKA 3AGKA 1V4TA 2NRHA 4CBXA 4OO1J 5JVHL 3CC7N 4A2BA 5EY4A 4EHUA 3WXKA 4YOXA 1KQSM 4J8FA 2KKZA 2JWLA 3VETA 3P39A 3WXIA 4BRNA 1VQ5N 3AAPA 5AQJA 1DGKN 2A3ZA 1QVFM 3FE1A 4B1YB 3BP8A 3IFRA 4CBUA 2FF6A 3GOIA 4IZ9A 1T3VA 2I7NA 3DLLL 4RTFD 2GTDA 3KHYA 2ZGYA 2QM1A 2YCHA 5C12A 2NRWA 3CJ9A 3CJAA 4XH5A 4BRDA 3CPWM 5KPZA 5AFUA 2HBKA 4CBWA 3BUZB 5F0XA 3E9PA 3UKRB 4BRIA 3LM9A 2P9LA 5JMVA 1NGCA 4CI6A 2IVOA 3CCUN 5KQ8A 3KZBA 1ESVA 3Q7CA 1TUUA 5AQGA 5AQPA 4F9OA 2HF4A 3I55N 1GLLO 1T6CA 3C0BA 3HBTA 3FGUA 4FPBA 2ZF5O 4WF9L 3OW2M 3ZX2A 3CMEN 3CD6N 3VOVA 2HBJA 3CCLN 4GY2B 3VENA 1E4GT 1K8KA 1VQON 3CETA 3RSEA 4YOWA 3VF2A 3HM8A 5H1SQ 1BA1A 2AP1A 4BREA 3CCRN 1YHQN 4EAHD 3CCEN 2WUSA 1EO1A 3OA9A 4KBOA 2FXUA 4PKGA 2D0PA 3FR0A 3QICA 3O8MA 4CZLA 3AGRA 3HOSA 4FWOA 2V7ZA 1W97L 3QDKA 4JKHA 2P9PB 3EZWA 2JWKA 2NNWA 1KC8O 3CF5L 4BY9C 4G9ZA 3LDLA 1HKCA 3WXJA 3G4SN 2NZTA 5KQDA 2ZGZA 4FPAA 1Q7YO 5ADXA 4JHDA 5FPDA 2E20A 2CGLA 1QZ6A 5AFUH 3AAQA 5BN9A 3A5MC 5FPEA 1GLFO 2E2NA 3HSCA 3W3DA 2ASPA 3KK7A 1NLVA 3VEYA 4H0YB 4H5TA 4IWVA 5AZIB 3T7ZA 4WYBA 4CZJA 3R6MA 4U67L 1ZC6A 4IDHA 1HKGA 3OBYA 3ID6A 5GIPA 1Z6RA 2QXLA 1YUWA 2E2PA 5C0YA 2I7PA 2P9LB 3AY9A 4BROA 1QVGM 2V52B 1WOQA 4BG9A 1YJ9N 5EVZA 1GLAG 3U9ZA 4B1ZA 4BC2A 4H03B 3MX5A 4DHYA 5JLFA 3PIOL 3VF4A 3H3NO 3O6WA 4HTLA 1E4FT 1IG8A 1SZ2A 4FSVA 3TTFA 4WFAL 3VTHA 3CJ7A 2VWBA 4WQ4C 3EL2A 3ZX0A 4KH4A 1TUYA 4WQ4A 2CGJA 3MCAB 2GEMA 1VQKN 3VTIA 5E84A 4BRPA 3A5LC 3SMPA 1K8AO 1HKBA 4YOVA 3VF6A 4YOTA 5LJWA 4BR7A 5ADXH 1QZ5A 5LY3A 2UYTA 5GADP 5JVGL 2P9NB 1XQSC 3VGKA 5M1FA 1V4SA 5AQXA 5AQRA 4JK7A 3WT0A 2AA4A 5GIOA 4H0OA 1HJOA 3G6EN 2YHXA 4CZGA 3FZLA 4WCEL 4JHDB 3DXMB 4EIAA 2FF3B 2YJEA 1KAZA 1G99A 1TYQA 2KHOA 4WQ5A 1BU6O 3CCJN 3H46O 5C10A 1RFQA 1NGDA 2PAVA 4DB3A 3EE9A 4A62A 2HBMA 3GL1A 3O9UA 3CERA 4YORA 3VESA 4B1WB 5M1QA 2P9PA 2YHWA 3MN6A 5C2FA 3D2FA 4FO0A 3HI0A 3O08A 2HBLA 2VGNA 4H5WA 4BRHA 4BR5A 1VQ6N 1RDWX 4MDAA 2ASMA 4PL8A 5AQNA 2D1KA 3QBWA 4B1VA 4IEIA 3LDPA 5AQTA 3ZEUA 1NGGA 2QWNA 3PIPL 3N4PA 4O8KA 4GV6A 1W2BM 4YOUA 3MN5A 3VPZA 1YF5L 2W41A 4ILGB 4IO8A 1QQMA 1NMDA 5AZIA 3CQYA 1C0GA 4JD2A 4A57A 5AQWA 4H0TB 3MDQA 2A40A 4BC4A 2A6AA 2WFBA 3P38A 4BRCA 3JXUA 5AZJB 1VQMN 5FPMA 4K43A 1P90A 5BPLA 1S72N 4B1UB 3WXLA 3T69A 3ATVA 4B1XB 3SBTA 1QHAA 3D2EB 2RHKA 4ILJA 5JLHA 5M1PA 4QS7A 3SLCA 4JK8A 4BC3A 3O5BA 4WFBL 4C1NI 4K25A 2V7YA 2QWPA 3MCPA 3CCSN 1K73O 1T44A 3VMFB 2NRVA 2P9UA 4JKFA 4EHTA 4JKAA 3SBGA 2D0OA 3TPQA 3SK3A 3H6EA 3CC2N 2NRZA 2PFUA 1J6ZA 3O9RA 3QMLA 1TYQB 3K9KA 2GX9A 3B8AX 5AQYA 3WEEA 4BRFA 1VQNN 3MK6A 1MWMA 3UE5A 4IOCL 1ATNA 1MWKA 3JS6A 4JN4A 5TKWA 1VQLN 3SJHA 2P9NA 1R59O 2CH5A 2FSKA 4KH5A 4C23A 4FOEA 5CE3A 3D2FB 5AQZA 1YI2N 4DKWA 1DT9A 1HX1A 3WXMB 3ID8A 3HRGA 3VEOA 5HOOA 3ZYYX 4C1NK 4BRGA 3DXMA 2EWSA 3EKUA 1NM1A 3ZEUB 3ZX3A 4ILHA 1Q81O 3NMUA 3O9TA 1CZAN 5KPRA 2GELA 5CHIA 3Q7BA 2QWMA 2P9IA 3R9PA 2NRRA 3H45C 2QWQA 4JD2B 3J8AA 2E8AA 4AM6A 3L0QA 4A5AA 3U4LA 3EO3A 4GV3A 2FSNA 3IMXA 1N8RO 3SAHA 3HOTA 1SQKA 1GLCG 3A0IX 3QBXA 2WBNA 3LDQA 3QFPA 5F2RA 3HTVA 3HZ6A 1VQ7N 3CJBA 5AQSA 1MA9B 2QWLA 3LL3A 4M7XA 2QWOA 3P31A 4MO4A 1Y64A 3E1YA 1NGAA 1OVYA 4KH6A 2QTDA 4A59A 4UY8O 3TU5A 4MLEA 2Q2RA 5BPNA 3DXKB 5GINA 1VQPN 2YX6A 4BQLA 2ZJPL 2OTLN 3ULEA 2P9UB 2QWRA 3ENOA 1Q82O 4IFEA 4CZHA 3CIPA 3A5NC 1JCGA 2E1YA 1Z05A 3O80A 1Q18A 3ATUA 3A8YA 1LCUA 4JKCA 4OPHA 3WEEB 3G71N 1XUPO 5AZJA 5JICA 3C6HA 3H1QA 1VQ9N 3LDOA 3H3OB 4JK9A 1BO5O 3DJCA 4CJ7A 4ISEA 3MX2A 5LJVA 4K41A 2V51B 3D2EA 5TKYA 1ZBSA 1GLBG 4Y0WA 3M6GA 3BF3A 5C2DA 2NRXA 1NGJA 5HL7L 2BUPA 2YHYA 4H5NA 3TSQA 5AQLA 2H3GX 4FWLA 3TSUA 4IJAA 4H5VA 4O8UA 1GLJO 4WQ5C 3R1XA 1VQ8N 2W40A 4BRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1O A;  5M1Q A;  5C10 A;  4IEE A;  5C2F A;  5M1F A;  5C2D A;  3C6A A;  4IDH A;  5M1N A;  4IEI A;  5M1K A;  5C12 A;  3C6H A;  4IFE A;  3CPE A;  5M1P A;  5C15 A; 
#chains in the Genus database with same CATH topology
 1B9F A;  5E41 A;  4B8A B;  1VQ4 N;  2P9I B;  4ELT A;  1L5U A;  3EY1 A;  3EKS A;  1N5Y A;  4GV9 A;  3CHW A;  5SWM A;  1CLQ A;  2VGM A;  2QK9 A;  1X3N A;  4FLT A;  1HQE A;  1ZBH A;  1SS6 A;  3EZ5 A;  1ASW A;  2HW3 A;  3L4Q A;  1RBU A;  3ZET A;  1RBS A;  4BR9 A;  1HR0 K;  2OTJ N;  3KWG A;  1JCF A;  3E9L A;  4CJ5 A;  3UKU B;  5AQF A;  3F9K A;  3KD5 E;  4FOI A;  4NLB A;  3VER A;  3AAR A;  2Z1J A;  2E6L A;  2GUI A;  4YDU C;  4FWS A;  2YNH A;  2IGI A;  4B9T A;  1OH7 A;  2RPI A;  3P4I A;  1BHL A;  1HQU A;  3LP3 A;  3MWP A;  4NO7 A;  3RVC A;  5M1O A;  1TVR A;  4FVU A;  4BDZ A;  1QSY A;  4FZZ A;  2KFN A;  1LW0 A;  1S3X A;  3C6T A;  3ZT3 A;  2WC9 A;  2O8E A;  5EXW A;  5GAG P;  3LP1 A;  3OJS A;  3L8B A;  3AVJ A;  5CZ1 A;  4LF9 K;  4GVE A;  3KIO A;  4RCH A;  3GE1 A;  4FWM A;  4CGG A;  2ZJQ L;  3AVB A;  4X65 K;  1NJX A;  3O9S A;  4BR2 A;  1OKJ A;  1HNI A;  1NJZ A;  3KTQ A;  2UXB K;  4JYA K;  2GV9 A;  1YJN N;  1SL0 A;  4KB0 A;  4W5N A;  2GWJ A;  2Q31 A;  1U2V A;  1YVU A;  1NU0 A;  1RDU A;  3BZC A;  2IVN A;  3NE6 A;  4WFN L;  3LDS A;  2IAJ A;  3CJ1 A;  3VEZ A;  4JEP A;  4BRM A;  4BDY A;  2HHW A;  4QS9 A;  2P9S B;  4E1J A;  4CJQ A;  1SL1 A;  4MDB A;  1XHZ A;  1KAX A;  5BPM A;  1OH8 A;  3NH1 A;  3OYA A;  2D5R A;  2P9K B;  3DYA A;  1KAY A;  2E6M A;  2Y1I A;  3J7Y P;  4JKB A;  5C15 A;  2GWK A;  3QES A;  2QA4 N;  1C0F A;  1S9G A;  4ELV A;  3GDQ A;  4FWN A;  4OJR A;  3L2U A;  4ISF A;  4BVO A;  2OAN A;  3QNO A;  3HVT A;  2NRT A;  5DMR A;  4O4G A;  5HBM A;  2DFE A;  1O13 A;  1QHT A;  1K8K B;  2HOE A;  2QEX N;  4JI5 K;  1CZB A;  1YIJ N;  3IKM A;  1D9F A;  3FZK A;  1RBR A;  3UKR A;  4W5Q A;  5BRD A;  3BZK A;  4CEO A;  1KFD A;  3HP9 A;  4PKI A;  2X74 A;  3QEI A;  3SUP A;  2ZJR L;  4FWP A;  3JAM O;  5BR9 A;  4YOY A;  1ILY A;  4PHT X;  1SKR A;  3C6A A;  4BR4 A;  4PL7 A;  4OKE A;  3S41 A;  3L2Q A;  1X9S A;  2O8D A;  3MMV A;  2XHB A;  4BG8 A;  4DCH A;  4DUZ K;  1Q86 O;  3FZM A;  3MN9 A;  1K9M O;  3ZCM A;  3OBW A;  2OA8 A;  5KGX A;  5DM7 L;  2FSJ A;  3WNF A;  1UWB A;  4QS8 A;  4NLC A;  5AQK A;  1NK9 A;  3NGZ A;  1V4T A;  2NRH A;  3DRS A;  2ZQB A;  3CC7 N;  4A2B A;  1N32 K;  4DSL A;  2JGU A;  3VQ6 A;  3WXI A;  3P39 A;  3DLH A;  1S6Q A;  3FE1 A;  4B1Y B;  1VSJ A;  3RWU A;  1L3T A;  1J53 A;  4N47 A;  4M45 A;  3CPW M;  4BRD A;  3L2V A;  4KHY A;  5AFU A;  4H8K A;  2HBK A;  3BUZ B;  1A5X A;  4CED A;  4BRI A;  1WAJ A;  2P9L A;  2O8F A;  2X6N A;  3G0Z A;  1ESV A;  2RKI A;  4FJ8 A;  5AQG A;  3AVL A;  5AQP A;  4F9O A;  2HF4 A;  4AHS A;  5HRN A;  2UXC K;  1B92 A;  3I55 N;  1T6C A;  2I5J A;  3FGU A;  3CD6 N;  4CK1 A;  3VOV A;  2HBJ A;  3KKR A;  4E1M A;  3CET A;  2FC0 A;  4YOW A;  3THX A;  1BA1 A;  3CCE N;  1YHQ N;  4EAH D;  5IT9 O;  2XY6 A;  2FXU A;  3CYM A;  2HHS A;  1VRT A;  3FR0 A;  3O8M A;  3HOS A;  2V7Z A;  2HHX A;  3EZW A;  4G9Z A;  3G4S N;  5KQD A;  1NK8 A;  1BCO A;  3UIQ A;  1I39 A;  2W6K A;  3A5M C;  3P5J A;  1GLF O;  2E2N A;  1LAW A;  3VEY A;  4WYB A;  4CZJ A;  2LSN A;  4FZY A;  4N5S A;  4FJI A;  5KTQ A;  5GIP A;  2E5L K;  5HRR A;  2O8B B;  2V52 B;  5EVZ A;  4B1Z A;  4YHH K;  4FW2 A;  5JLF A;  3H3N O;  4HTL A;  1SZ2 A;  4NCG A;  2VWB A;  4WQ4 C;  3EL2 A;  4KH4 A;  3MCA B;  1U04 A;  1VQK N;  3VTI A;  5LJW A;  5LY3 A;  2UYT A;  4B3T K;  5JVG L;  3OYE A;  4M3T A;  4CJV A;  1KTQ A;  4UQG A;  1V4S A;  5AQR A;  3WT0 A;  1KVA A;  4CEZ A;  4H0O A;  1HJO A;  1NKE A;  4N56 A;  2F4V K;  5HRP A;  3I0S A;  1WNS A;  4CCH A;  2AJQ A;  3ZT4 A;  4FM0 A;  4JHD B;  4DUY K;  4DTM A;  1EX4 A;  2QXF A;  4KHW A;  4FVM A;  4DR6 K;  5I3U A;  4FM1 A;  1RFQ A;  3PUF A;  1WSI A;  4DS5 A;  4DB3 A;  4AHU A;  2ITG A;  3VQ4 A;  2XY5 A;  3AO4 A;  4GKK K;  3HYF A;  2HND A;  2YHW A;  5C2F A;  3D2F A;  4FO0 A;  2G8U A;  4BRH A;  3L3V A;  4H5W A;  4KHN A;  4DSJ A;  2KTQ A;  2OYQ A;  2D1K A;  4EZ6 A;  3KK1 A;  3LDP A;  2ZD1 A;  3N4P A;  3O4N A;  4GV6 A;  3MEC A;  4ILG B;  2W41 A;  1I3A A;  2FBY A;  4IO8 A;  4FLW A;  1VSI A;  2G8H A;  1NMD A;  5AZI A;  4A57 A;  4KAZ A;  2A40 A;  4CJT A;  4BRC A;  1U49 A;  4EZ9 A;  4DV1 K;  5FPM A;  2VQE K;  1P90 A;  3PO4 A;  3ZSV A;  4M3Z A;  3MAQ A;  4F2S A;  3HVR A;  2KZM A;  1HRH A;  2WTU A;  4WFB L;  1FK9 A;  3MCP A;  1T44 A;  4JS4 A;  4LF5 K;  2P9U A;  4JKA A;  3SBG A;  2D0O A;  3TPQ A;  3CC2 N;  1TYQ B;  3K9K A;  2GX9 A;  1Q8I A;  3U3Y A;  1VQN N;  3HO1 A;  4JN4 A;  1KSP A;  3ZT0 A;  4OVL A;  3P1G A;  1RT6 A;  1ASU A;  2CH5 A;  2FSK A;  4KH5 A;  4FOE A;  4CGJ A;  3C6U A;  3M8Q A;  4DKW A;  1HX1 A;  4FJ9 A;  3MXJ A;  4CGD A;  3VEO A;  4E7J A;  4C1N K;  4ZHR A;  4DV0 K;  3DXM A;  1Q81 O;  3NMU A;  2QKK A;  3O3H A;  3R9P A;  1HNZ K;  2NRR A;  4C8M A;  4JD2 B;  3J8A A;  4GV3 A;  1TK8 A;  3EO3 A;  3DRP A;  3KK2 A;  2W6L A;  3TI0 A;  1VSD A;  4QOZ B;  3QBX A;  3LDQ A;  1T7P A;  3HTV A;  3HZ6 A;  3CJB A;  4LFA K;  2QWL A;  3LL3 A;  4YNQ A;  3P31 A;  2BGG A;  1L3U A;  4MO4 A;  3NF6 A;  3AA2 A;  1VQP N;  4FJN A;  2YX6 A;  4BQL A;  2ZJP L;  3QET A;  2OTL N;  3VQP A;  4IKF A;  3CIP A;  1RDD A;  4OPK A;  2E1Y A;  3O80 A;  5K14 A;  1TK5 A;  3LDO A;  3H3O B;  3DJC A;  4CJ7 A;  4K41 A;  3NH0 A;  4DTN A;  3M6G A;  2F96 A;  4ID1 A;  3EEQ A;  5C25 A;  5HL7 L;  1KVB A;  4H5N A;  3S3N A;  2X6S A;  2H3G X;  4ZTJ A;  4O8U A;  1CXQ A;  4WQ5 C;  3T1A A;  4DV7 K;  2W40 A;  2OPR A;  3C65 A;  4DFJ A;  4JNE A;  1JJ2 M;  2Q1N A;  1C0U A;  5EX5 A;  4CZI A;  5I9E B;  3S3O A;  4DR2 K;  1NK7 A;  1WSH A;  1M1K O;  1BUP A;  3R8E A;  5CR4 A;  3NFA A;  4AHR A;  2P5G A;  2YNI A;  1BWF O;  2F9W A;  2YKM A;  1EXQ A;  1KD1 O;  3AV9 A;  3SMS A;  5KPT A;  3VQQ A;  1EQY A;  3E9O A;  3TTD A;  3IRX A;  4M7Y A;  5GAE P;  2YHB A;  3ULE B;  4CVN E;  4B3S K;  4FJH A;  1YIT N;  3TTC A;  4M3R A;  3V9W A;  1S9E A;  4B3M K;  3AVK A;  3LPU A;  1NGF A;  3TAQ A;  1QQN A;  2PY5 A;  3UB5 A;  4RWT A;  1H1V A;  2PBD A;  3O1W A;  1YJW N;  3NVK A;  5BRH A;  1D8Y A;  4L8R B;  1HNV A;  2Z1I A;  1G15 A;  3IUC A;  3N4Q A;  3OYN A;  1RIL A;  1JLA A;  3ALY A;  1NBW A;  2Q97 A;  3CPE A;  4DTX A;  1OH6 A;  3SUO A;  4JI2 K;  3CQ8 A;  1J54 A;  5AQU A;  4J2E A;  4DTO A;  4JAX A;  3K59 A;  3W0L A;  2Q3S A;  2DFF A;  2YI1 A;  3V4I A;  2HHT A;  2DFH A;  1IBK K;  4L3Q A;  5C42 A;  3FLC O;  4I6M B;  4FWR A;  4XEI A;  4CIF A;  2GUP A;  4BC5 A;  1EP4 A;  3SCX A;  2O8D B;  1XMO K;  2A41 A;  2IS3 A;  3F5T A;  3LDN A;  5FLX O;  4XIU A;  2Q0U A;  3ZT1 A;  3PSF A;  5M1K A;  3QEX A;  2XY7 A;  1O1W A;  4K8X A;  3KWI A;  3M8R A;  1BG3 A;  1IKW A;  3U3G A;  3OYM A;  1XI1 A;  3E66 A;  4XH1 A;  3VQ9 A;  4H4M A;  3H1V X;  1S1T A;  3NF9 A;  3P83 D;  5E26 A;  1JLF A;  2IC3 A;  5FPN A;  4E19 A;  4JV5 K;  3VGM A;  3A2F A;  3NGI A;  3CC4 N;  3NDK A;  1NK0 A;  1WSF A;  3L4I A;  1D4X A;  3AVH A;  1C1A A;  4FWK A;  1U47 A;  3I8B A;  3M5R A;  3WQU A;  3ZSY A;  4AF1 A;  1REV A;  3DLE A;  3DLK A;  1B9D A;  2RN2 A;  3KJV A;  4DU1 A;  1HYV A;  3CCM N;  2A5X A;  4CF9 A;  1GLD G;  3SUQ A;  2Q0R A;  1NGE A;  1MDU B;  5BRF A;  4IXC A;  4EP5 A;  4F8R A;  4Z4E A;  3SAG A;  4KFB A;  3SAF A;  1T8E A;  5AR0 A;  3ZSX A;  2CGK A;  4ICL A;  4RW6 A;  3EYZ A;  2E1Z A;  4KHS A;  4J2B A;  1EET A;  4OKK A;  1WSJ A;  5I42 A;  2IIR A;  2QW9 A;  1IJJ A;  3MXI A;  3D7E O;  3L6Q A;  2P5O A;  2KLA A;  3THX B;  3TAB A;  1NG9 A;  2B5J A;  5LMN K;  1GLE G;  3L2R A;  4ID5 A;  1A5W A;  4CGF A;  5DM6 L;  1S22 A;  1NGH A;  3DWL A;  1NGB A;  3DAW A;  4BGB A;  4DSK A;  4IG0 A;  3THY A;  4B9V A;  1ASV A;  4LC9 B;  4DSI A;  3V1R A;  4E1N A;  3SI6 A;  1HPZ A;  2RE2 A;  4EFH A;  4O0J A;  1YVN A;  2HVH A;  1HPM A;  1ZXO A;  3O4W A;  4DFP A;  4IO9 L;  3SNN A;  3AGK A;  4CGH A;  1NK4 A;  4EHU A;  4CEF A;  4DU3 A;  3M8P A;  2PYL A;  2JWL A;  2YV0 X;  3ZT2 A;  2OCE A;  1QVF M;  4CBU A;  2FF6 A;  5FRN A;  3AVC A;  1ITG A;  2GTD A;  3K5O A;  2ZGY A;  1GOB A;  3CJ9 A;  4EP4 A;  2WOM A;  3AA4 A;  1RDB A;  3LM9 A;  2VQF K;  3CCU N;  3KZB A;  1JLQ A;  4O5B A;  5KGW A;  1GLL O;  3C0B A;  4BAC A;  4WF9 L;  3OW2 M;  2ZF5 O;  3ZX2 A;  2NUB A;  3CCL N;  2DY4 A;  4GY2 B;  1E4G T;  3RSE A;  4R5P A;  3ASM A;  3VF2 A;  3HM8 A;  4DSE A;  3CCR N;  1XMQ K;  4CE9 A;  4KBO A;  4AHC A;  1RDA A;  4IFV A;  4CZL A;  4YY3 K;  5LL6 Z;  1W97 L;  1S1U A;  1BI4 A;  1HKC A;  2PZS A;  2E20 A;  1QZ6 A;  5AFU H;  3OYL A;  4N41 A;  1NMN A;  5BN9 A;  1KFS A;  3HSC A;  3W3D A;  2ASP A;  3KK7 A;  3DOL A;  3LAL A;  1NLV A;  2O4I A;  4IWV A;  4H5T A;  3PX4 A;  5AZI B;  4DTJ A;  3R6M A;  1ZC6 A;  4AHT A;  4B9N A;  1HKG A;  2XY8 A;  4CHZ A;  2E2P A;  4B9U A;  3K5N A;  2I7P A;  1DTT A;  3AY9 A;  4BRO A;  1QVG M;  1YJ9 N;  1NJW A;  1GLA G;  3U9Z A;  4BC2 A;  4H03 B;  4DHY A;  3PIO L;  3VF4 A;  1YTA A;  4FSV A;  3TTF A;  3VTH A;  3ZX0 A;  1TUY A;  4KTW A;  4MFB A;  4JLH A;  4O55 A;  1HKB A;  4YOV A;  3V9X A;  3LAM A;  2HMI A;  5GAD P;  4E7H A;  4JK7 A;  3RMC A;  5GIO A;  2OZM A;  3G6E N;  4FK2 A;  3SPY A;  2HHU A;  4CJL A;  3HM9 A;  3DXM B;  4PWD A;  2FF3 B;  4Z4G A;  1FKO A;  2KHO A;  1DTQ A;  4FZX C;  1BU6 O;  3HXM A;  2A1R A;  4CJP A;  3EE9 A;  3GL1 A;  4DTR A;  4YOR A;  1UA0 A;  5M1Q A;  1VSF A;  3CFP A;  2P9P A;  2HB5 A;  2IDO A;  4GW6 A;  4CK2 A;  4BR5 A;  4MDA A;  2ASM A;  4PL8 A;  4KRE A;  3QBW A;  1U48 A;  5AQT A;  3ZEU A;  3NCI A;  3PIP L;  3DM2 A;  4ELU A;  4O8K A;  4FK4 A;  4LSN A;  1YF5 L;  1S6P A;  3QEV A;  4AH9 A;  3CM5 A;  3PSI A;  4Y1C A;  1QQM A;  4PQU A;  3CQY A;  1C0G A;  5AQW A;  2A6A A;  2WFB A;  3S9H A;  1JKH A;  3JXU A;  4LFB K;  3OY9 A;  1YTU A;  1S72 N;  4KI6 A;  3J7A P;  1EWQ A;  3K5M A;  4B1X B;  3SBT A;  1QHA A;  4ILJ A;  4NCB A;  5M1P A;  4FLX A;  3SLC A;  3O4Q A;  4BC3 A;  4CJW A;  3NBP A;  3TAM A;  2V7Y A;  2QWP A;  3CCS N;  4RG8 A;  4Z4C A;  3KLF A;  2NRV A;  3C95 A;  3THW B;  3SK3 A;  3H6E A;  2NRZ A;  2PFU A;  1J6Z A;  3O9R A;  5AQY A;  4BRF A;  3SQ4 A;  4I2P A;  3MK6 A;  3SJJ A;  4RW9 A;  3LWL A;  4CF2 A;  4B3O A;  1R59 O;  3IAY A;  4LY7 A;  1E3M A;  1NNE A;  1BIZ A;  2UUA K;  3LAK A;  3ID8 A;  3OYF A;  3ZYY X;  1RDC A;  3HPO A;  2KFZ A;  1RT3 A;  5FRM A;  1U45 A;  1NM1 A;  3O9T A;  4JRP A;  2B4J A;  4ZTF A;  2P9I A;  1WSG A;  3TAP A;  3H45 C;  5J2M A;  2E8A A;  3L0Q A;  4A5A A;  3U4L A;  4N76 A;  3IMX A;  3HOT A;  2O4G A;  1GLC G;  1RT2 A;  2WBN A;  3QFP A;  4JI3 K;  3VQE A;  5AQS A;  4M7X A;  5AJ3 K;  1NGA A;  1OVY A;  1TV6 A;  5BR8 K;  4MLE A;  2Q2R A;  5BPN A;  3OVN A;  2E4L A;  2QWR A;  3OYH A;  2Z1G A;  1N34 K;  1JCG A;  1TKX A;  3ATU A;  4JKC A;  4OPH A;  3WEE B;  1OVQ A;  2FBV A;  4NYN A;  5LJV A;  4ISE A;  3HJF A;  4IDK A;  1ZBS A;  3BF3 A;  4CHO A;  2PYJ A;  1QS4 A;  4Z4I A;  1NGJ A;  4I9L A;  2HHQ A;  2BUP A;  3K57 A;  3TSQ A;  5AQL A;  1JLE A;  3TSU A;  4IG3 A;  2VWK A;  4CFD A;  4H5V A;  1LWC A;  3R1X A;  4I9Q A;  2HHV A;  4KTQ A;  1RBT A;  4PA1 A;  4CK3 A;  3QB0 A;  4DR5 K;  4YFU A;  2BAN A;  3JYT A;  3FFI A;  2BTF A;  3V1O A;  3I8D A;  1EWR A;  3LAN A;  5ELZ A;  3IS9 A;  2W42 A;  4HUF A;  2G8W A;  1WUA A;  3L3U A;  4R79 A;  4I2Q A;  4CJE A;  5AQO A;  2DPN A;  4HVJ A;  3AO2 A;  4OX9 K;  3GBT A;  1IKY A;  4A2A A;  4B08 A;  4KKO A;  1HNX K;  4M63 C;  5D3G A;  4K0K K;  1BDG A;  1BCM A;  2UXD K;  4Q5V A;  3VEV A;  4B9S A;  1NOZ A;  1VSE A;  2G8V A;  3GG4 A;  2O8C B;  2P9S A;  3HPH A;  3BEX A;  4AHV A;  3B6O A;  4RW8 A;  5B8H A;  4E0D A;  1P8Z A;  2OPQ A;  3ZSR A;  1KVC A;  1KRP A;  1RGI A;  2P9K A;  3D45 A;  3I56 N;  3T19 A;  3CI5 A;  4M3X A;  1RTH A;  4OLA A;  3FZF A;  3DLG A;  5AQI A;  3VQ5 A;  1OH5 A;  2J4R A;  2FLO A;  4K42 A;  4OPA A;  3SYZ A;  3WQT A;  1NKC A;  4X62 K;  4CF1 A;  4F3O A;  1WBB A;  5KRT A;  1C1B A;  1MU2 A;  4DTP A;  1XNR K;  3RTV A;  3AVI A;  1LOT B;  4BE2 A;  3K5L A;  4F3T A;  1W9H A;  4FJG A;  3QLH A;  1X3M A;  1LWF A;  5CYQ A;  4Z4H A;  3BGR A;  1DLO A;  4FM2 A;  2HST A;  3ZSO A;  1IKX A;  3ZET B;  3VQA A;  4B9Q A;  3PY8 A;  3ZSZ A;  3NVM A;  3EE8 A;  3T1H K;  5F1X A;  1S1X A;  3TSP A;  3OS2 A;  3CCV N;  2RF2 A;  4Z0U A;  4A61 A;  2ITM A;  3RRG A;  4HCB A;  4IOX A;  1RT5 A;  3CCQ N;  2JLE A;  2E2O A;  5JVH L;  1DEJ A;  4PKH A;  3ENH A;  2YKN A;  1ZBI A;  1ZBU A;  3DLB A;  3K9J A;  4W5R A;  2ASO A;  2ZWH A;  1D5A A;  3D6R A;  4A5B A;  3O1B A;  4NXM K;  3DOK A;  4M42 A;  4O5F A;  2HMP A;  2O8E B;  3F2K A;  4FJM A;  4HWI A;  4DTS A;  5J2Q A;  3MEE A;  5M1N A;  3LWM A;  3OYK A;  1YAG A;  3THV A;  4CIE A;  3OHR A;  1WLJ A;  3EN9 A;  5EOY A;  3VEX A;  1IO2 A;  3C7N A;  4FLY A;  4H0V B;  3M3Z A;  1QQC A;  4CEE A;  3J7Z O;  3ZLJ A;  3RSE B;  4CHQ A;  3LP2 A;  1KLM A;  4JKG A;  4KV8 A;  3V9S A;  3WNE A;  4H5R A;  3NF7 A;  1C0M A;  1HLU A;  1VAZ A;  1Q9Y A;  3V9Z A;  1FW6 A;  1U2V B;  2E88 A;  3LM2 A;  4AM7 A;  4DV3 K;  4H0P A;  3R3L A;  3CQX A;  1JLG A;  3I33 A;  4BVP A;  3ZSQ A;  1X9M A;  4IOA L;  4CES A;  1JCE A;  2Q36 A;  4CGI A;  4H0X B;  4BY9 C;  3O9Q A;  4OGC A;  2HHH K;  4C8L A;  3KLE A;  3IG1 A;  3U8X A;  4JKE A;  3BF1 A;  4BRK A;  1YXQ A;  2BE2 A;  4NXN K;  4NB4 A;  4H4O A;  3AVM A;  4OO1 J;  2VWJ A;  5EY4 A;  1KQS M;  4IFY A;  4JS5 A;  4J8F A;  2KKZ A;  2A3Z A;  3BP8 A;  4G1Q A;  3GOI A;  4IZ9 A;  4FLV A;  4JRQ A;  2QM1 A;  2YCH A;  5C12 A;  4CJU A;  3VA3 A;  2NRW A;  4XH5 A;  1IBM K;  1FXX A;  5J2P A;  4CBW A;  3V9U A;  3E9P A;  3UKR B;  5JMV A;  2O8B A;  1NGC A;  3Q7C A;  1S1W A;  4O0I A;  4FJK A;  1JLC A;  3NF8 A;  3HBT A;  3MED A;  5T7B A;  3CME N;  3QEP A;  1LW2 A;  4DR3 K;  3VEN A;  1VQO N;  3J81 O;  4FJJ A;  4LF8 K;  1RCH A;  3ISN C;  5H1S Q;  2AP1 A;  4BRE A;  2WUS A;  3OA9 A;  4PKG A;  3SV3 A;  2D0P A;  3QIC A;  4E7I A;  4JKH A;  2P9P B;  2JWK A;  2NNW A;  2GBZ A;  5FDL A;  1KC8 O;  3LDL A;  4DFM A;  3T1Y K;  1NKB A;  3WXJ A;  2NZT A;  2VG6 A;  5CZ2 A;  4FPA A;  5ADX A;  4JHD A;  5FPD A;  4HHT A;  3TAE A;  2CGL A;  3TAF A;  1IG9 A;  1BQN A;  5FPE A;  4Y1D A;  5JS2 A;  2UU9 K;  1HNW K;  4H0Y B;  3RMA A;  4IDH A;  1JXE A;  4DTU A;  1Z26 A;  2YNF A;  3TAG A;  2UUB K;  3ID6 A;  3RR7 A;  1YUW A;  1N36 K;  2P9L B;  2O8F B;  4PY5 A;  4BG9 A;  1WOQ A;  2X78 A;  1WB9 A;  2D0B A;  3MX5 A;  1WAF A;  3O3F A;  3O6W A;  3C94 A;  1XNQ K;  1IG8 A;  1UAX A;  2CGJ A;  1VRU A;  4O44 A;  5E84 A;  3A5L C;  4BRP A;  3SMP A;  2Y1J A;  1RT4 A;  3VF6 A;  4YOT A;  1QZ5 A;  3BY5 A;  1WBD A;  4JI4 K;  5AQX A;  3SPZ A;  3VQB A;  4DR7 K;  4KI4 A;  4FJL A;  2YHX A;  3AVF A;  2OPP A;  4B8C A;  4JI7 K;  1ZBF A;  2Z1H A;  2YJE A;  1K6Y A;  1TYQ A;  4DQI A;  4WQ5 A;  2EX3 A;  3CCJ N;  3H46 O;  3PX0 A;  5C10 A;  4A62 A;  3QIP A;  2KW4 A;  3CER A;  4CJ3 A;  4B1W B;  2IOC A;  1T03 A;  5HRS A;  3MN6 A;  3O08 A;  2HBL A;  1VQ6 N;  3LZJ A;  1W0H A;  3RMB A;  1LAV A;  4IEI A;  4NCA A;  4YOU A;  4OGE A;  1HJR A;  3CG7 A;  2OPS A;  4FJX A;  4JD2 A;  3QIO A;  3VA0 A;  3MDQ A;  2YNG A;  3OYC A;  1S1V A;  3DRR A;  1VQM N;  4K43 A;  5BPL A;  3DLR A;  3WXL A;  3T69 A;  4CJK A;  4OKJ A;  4F4K A;  5JLH A;  4B9M A;  4QS7 A;  1J9A A;  4C1N I;  4K25 A;  4DF4 A;  1K73 O;  2ATQ A;  4LFC K;  4JKF A;  3HP6 A;  2F8S A;  3WNH A;  4FCY A;  1MWM A;  4IOC L;  2P9N A;  4GVM A;  3AO3 A;  3AA5 X;  3D2F B;  4FJ7 A;  3VQC A;  3F73 A;  3RMD A;  1NOY A;  5HOO A;  4J2D A;  4W5O A;  3VQ8 A;  5KPR A;  1CZA N;  2GEL A;  1YT3 A;  5CHI A;  2QWM A;  1VSL A;  1X1P A;  4E89 A;  1I94 K;  4AM6 A;  5CYM A;  1N8R O;  3SAH A;  1TL1 A;  3CM6 A;  2D0C A;  5F2R A;  1SUQ A;  1TGO A;  4DFK A;  1GOC A;  2QWO A;  4LSL A;  1NJY A;  4KH6 A;  4A59 A;  5GIN A;  3KK3 A;  1C1C A;  3BDP A;  3ULE A;  2P9U B;  3ENO A;  4IFE A;  3A8Y A;  1LCU A;  3G71 N;  5AZJ A;  3C6H A;  1C0T A;  3H1Q A;  1GOA A;  1VQ9 N;  4JK9 A;  3MX2 A;  3SQ0 A;  3D2E A;  3PX6 A;  1GLB G;  4Y0W A;  4LH5 A;  3K2P A;  4DG1 A;  4B9L A;  5C2D A;  4DV2 K;  2G8I A;  2ZE2 A;  4FLZ A;  2HNY A;  1UA1 A;  1ZYQ A;  4FWL A;  4DU4 A;  4HTU A;  1VQ8 N;  4J2A A;  5HP1 A;  3NHG A;  1X9W A;  1F21 A;  1FKP A;  1QQO A;  3G25 A;  4CD3 A;  4Z4F A;  4LF7 K;  4CZM A;  3RR8 A;  3F9M A;  4CEA A;  1DKG D;  5HRO A;  5GAH P;  4B3R K;  3ENB A;  1U6Z A;  4I6M A;  1NGI A;  1IV0 A;  3PO5 A;  4BDP A;  4CIG A;  4GKJ K;  4IBN A;  4DQS A;  3OYI A;  3ZSW A;  2VYP A;  1L3S A;  1J5E K;  2HVI A;  3KLI A;  2QI2 A;  5CY4 A;  3AVG A;  3MEG A;  2NLX A;  5J1E A;  3DMJ A;  3U9D A;  2HNZ A;  1HUX A;  3FFK B;  4MLH A;  2P1J A;  1XC3 A;  3VGL A;  4YDU A;  5AQM A;  1Z25 A;  3CFR A;  4BRA A;  3A5O C;  4CJ4 A;  5HLF A;  4DQR A;  1BOT O;  2E2Q A;  1Q9X A;  3DXK A;  2HF3 A;  1BIU A;  3C7N B;  3CFO A;  5MLC Q;  1XHX A;  4DF8 A;  4FLU A;  2ETJ A;  1TL3 A;  3QFU A;  4JKG B;  4HUG A;  3KKS A;  4K8Z A;  4GNI A;  3CJC A;  4DS4 A;  1RTJ A;  3AA3 A;  3OS1 A;  3MWT A;  4Z94 A;  5AQV A;  4DR1 K;  2WON A;  4PUO A;  1SAZ A;  3CXC M;  2BH1 A;  4CFB A;  4FYD A;  4E3S A;  1IH7 A;  3SUN A;  4DQQ A;  4LF6 K;  3IDH A;  3WUH A;  1T6D A;  1NWK A;  4XH4 A;  1CZ9 A;  3K58 A;  4QCL A;  4IEE A;  4ISG A;  4KB1 A;  1M90 O;  4OLB A;  5BRE A;  2VCP A;  2YJF A;  1RT1 A;  3VEW A;  5AQH A;  3WNG A;  1BA0 A;  1IBL K;  4TSX A;  1L3V A;  4BR0 A;  3B6P A;  3OJU A;  4IJN A;  4CZF A;  3TAR A;  4CD1 A;  1NK6 A;  5C24 A;  4BGA A;  4JKD A;  2IVP A;  1ATR A;  3UKU A;  1RT7 A;  1J5O A;  4BQZ A;  3FZH A;  3ITH A;  1WSE A;  5IWA K;  2CH6 A;  4AQY K;  3KVG A;  4FWQ A;  4KPY A;  4FJ5 A;  1T05 A;  1VHX A;  3MN7 A;  1D9D A;  2VG7 A;  4DQ8 A;  1KXP A;  4KTZ A;  1NJI O;  3M1F A;  1IKV A;  1VSH A;  1JL2 A;  5BN8 A;  4U7B A;  3OS0 A;  4BRL A;  4CZE A;  3PLA A;  1X9J A;  3AVA A;  4HCC A;  4OPJ A;  3TAN A;  1CXU A;  3L2W A;  1EKE A;  2A42 A;  2D0A A;  2F7T A;  3JSM A;  4BWM A;  4DV4 K;  2D4W A;  1XWL A;  4JI8 K;  3O3G A;  2F9T A;  4FL9 A;  4CEC A;  5AQQ A;  3CMA N;  1VSK A;  1ATS A;  1VSM A;  2YHA A;  1RTI A;  4MO5 A;  4CZK A;  4AIL C;  1HMV A;  1SL2 A;  4CF8 A;  4CBX A;  4V19 S;  1QSS A;  3WXK A;  4YOX A;  1HYS A;  4CHN A;  3VET A;  4KHU A;  3LP0 A;  4BRN A;  1VQ5 N;  3AAP A;  5AQJ A;  4DR4 K;  1DGK N;  1TKZ A;  1TK0 A;  3IFR A;  2R7Y A;  1T3V A;  2I7N A;  3DLL L;  2UUC K;  4RTF D;  3HL8 A;  3KHY A;  1ZBL A;  1BL3 A;  3CJA A;  2ZM6 K;  5KPZ A;  3HST B;  3NH2 A;  5F0X A;  1KLN A;  2G8F A;  3J80 O;  4CI6 A;  2IVO A;  5KQ8 A;  1TUU A;  3OYG A;  3HK2 A;  1BQM A;  3THY B;  4FXD A;  4CJF A;  4FPB A;  1WN7 A;  1JXB A;  3QIN A;  2DTU A;  4M3W A;  3LPT A;  4X66 K;  1K8K A;  3V81 A;  3TWH A;  3DI6 A;  4LD0 A;  1TKD A;  2G8K A;  2FBX A;  1EO1 A;  2P51 A;  5DK5 A;  3AGR A;  4FWO A;  5KI6 A;  3QDK A;  5EU7 A;  2XO7 A;  3PV8 A;  3LZI A;  3CF5 L;  1TAQ A;  4LF4 K;  3G10 A;  2ZGZ A;  4DQP A;  3VQ7 A;  1SKS A;  1Q7Y O;  1LWE A;  4C8K A;  3AAQ A;  3U6F A;  2EHG A;  1N33 K;  3HPG A;  5J2N A;  4DV6 K;  4RW4 A;  3T7Z A;  3KD1 E;  4Q0B A;  4U67 L;  3VQD A;  3M8S A;  3HT3 A;  3E01 A;  3OBY A;  1Z6R A;  2QXL A;  5C0Y A;  1C6V A;  5SZT A;  3SV4 A;  3D0P A;  4CHP A;  3KLG A;  1TAU A;  2KZZ A;  4DWI A;  4MQ3 A;  1NK5 A;  1R0A A;  3AO1 A;  1E4F T;  4DSF A;  3RRH A;  4WFA L;  4DLE A;  3S3M A;  3CJ7 A;  4WQ4 A;  2FBT A;  3V6D A;  2GEM A;  3OTO K;  3ULD A;  4F2R A;  4BWJ A;  1U4B A;  3OYD A;  1K8A O;  4DV5 K;  4KO0 A;  4BR7 A;  5ADX H;  5FRO A;  2P9N B;  1XQS C;  3VGK A;  5M1F A;  4WE1 A;  2AA4 A;  2F8T A;  3QO9 A;  1TKT A;  4JI6 K;  1BI4 B;  1HYZ A;  4DMN A;  4CZG A;  3FZL A;  4WCE L;  4EIA A;  3THW A;  1RBV A;  4M3U A;  1KAZ A;  1G99 A;  1N6Q A;  4CW7 B;  3H08 A;  1NGD A;  2PAV A;  5LMU K;  2HBM A;  1QE1 A;  3SQ2 A;  3O9U A;  3VES A;  4C8O A;  4CHY A;  5KRS A;  4E7K A;  3HI0 A;  2VGN A;  2A1S A;  4HUE A;  4CER A;  1RDW X;  5AQN A;  4M41 A;  4I7F A;  4B1V A;  4NYF A;  4FK0 A;  1NGG A;  2QWN A;  1W2B M;  3OYJ A;  3MN5 A;  2KQ2 A;  3VPZ A;  4FW1 A;  4BE1 A;  4M3Y A;  4CJR A;  4H0T B;  4BC4 A;  3P38 A;  5AZJ B;  4CFC A;  4B1U B;  4KHQ A;  3ATV A;  4CF0 A;  4CJS A;  3D2E B;  2RHK A;  4JI1 K;  1BGX T;  4X64 K;  1SKW A;  4JK8 A;  3O5B A;  3VN5 A;  1RTD A;  1XC9 A;  3I0R A;  4W5T A;  3VMF B;  4QAG A;  4EHT A;  4CFA A;  3SZ2 A;  3QML A;  4CEQ A;  3B8A X;  3WEE A;  3UE5 A;  3K0S A;  1ATN A;  1MWK A;  3JS6 A;  1RNH A;  2OZS A;  5TKW A;  1FJG K;  1VQL N;  3SJH A;  4C23 A;  5CE3 A;  5AQZ A;  2QKB A;  1YI2 N;  1DT9 A;  3WXM B;  3HRG A;  3AO5 A;  4GMJ B;  4BRG A;  4RW7 A;  1JL1 A;  2EWS A;  1KCF A;  1A5V A;  3EKU A;  3ZEU B;  3ZX3 A;  4ILH A;  4KRF A;  2B6A A;  1Y97 A;  3Q7B A;  1QSL A;  2QWQ A;  3NGY A;  1W7A A;  1LV5 A;  3MXM A;  2FSN A;  4BE0 A;  1SQK A;  5JS1 A;  3A0I X;  3V1Q A;  3AVN A;  1VQ7 N;  1BIS A;  4LH4 A;  1MA9 B;  3QEW A;  1Y64 A;  3E1Y A;  2QTD A;  4UY8 O;  3KLH A;  4KHP K;  3TU5 A;  4DLG A;  3DXK B;  2XRI A;  1Q82 O;  4CZH A;  2BDP A;  3A5N C;  1Z05 A;  4E7L A;  1SV5 A;  1Q18 A;  3TR8 A;  1XUP O;  5JIC A;  3OYB A;  3SQ1 A;  2O8C A;  3NAE A;  1BO5 O;  1S5J A;  2V51 B;  5TKY A;  1VK0 A;  4CEB A;  1QTM A;  4JI0 K;  3QER A;  2NRX A;  2YHY A;  5A2Q O;  1UOC A;  4C8N A;  1JLB A;  4IJA A;  1GLJ O;  3T3F A;  2VG5 A;  3QNN A;  4BRQ A; 
#chains in the Genus database with same CATH homology
 1QQO A;  4CD3 A;  3C65 A;  3G25 A;  4JNE A;  1JJ2 M;  2Q1N A;  2P9I B;  1VQ4 N;  3QB0 A;  5EX5 A;  4CZI A;  5I9E B;  3EKS A;  4CZM A;  4GV9 A;  3F9M A;  1M1K O;  3CHW A;  1BUP A;  2BTF A;  3R8E A;  5CR4 A;  1DKG D;  2VGM A;  5GAH P;  1BWF O;  2F9W A;  3ENB A;  1X3N A;  1U6Z A;  4I6M A;  5ELZ A;  1NGI A;  1SS6 A;  1WUA A;  1KD1 O;  4R79 A;  3L4Q A;  3SMS A;  5KPT A;  5AQO A;  3ZET A;  4BR9 A;  2DPN A;  1EQY A;  3E9O A;  2OTJ N;  3TTD A;  3GBT A;  4M7Y A;  3KWG A;  1JCF A;  4A2A A;  3E9L A;  5GAE P;  2VYP A;  3ULE B;  3UKU B;  4M63 C;  5AQF A;  1YIT N;  2QI2 A;  3TTC A;  4FOI A;  2NLX A;  4NLB A;  1BDG A;  3VER A;  3AAR A;  3U9D A;  3VEV A;  1NGF A;  1HUX A;  3FFK B;  3GG4 A;  1QQN A;  4FWS A;  4MLH A;  4YDU C;  1XC3 A;  3UB5 A;  2P9S A;  3VGL A;  3BEX A;  4YDU A;  4RWT A;  1H1V A;  5AQM A;  5B8H A;  2PBD A;  4BRA A;  3A5O C;  3O1W A;  3P4I A;  1P8Z A;  1YJW N;  3NVK A;  1BOT O;  2E2Q A;  5BRH A;  3MWP A;  3RVC A;  4NO7 A;  1RGI A;  2P9K A;  3DXK A;  5M1O A;  2HF3 A;  3C7N B;  3IUC A;  3I56 N;  3CI5 A;  4FVU A;  3N4Q A;  5MLC Q;  1NBW A;  2Q97 A;  3CPE A;  3FZF A;  5AQI A;  1S3X A;  3QFU A;  2J4R A;  2WC9 A;  2FLO A;  4JKG B;  4K42 A;  4OPA A;  5EXW A;  3WQT A;  5GAG P;  4GNI A;  3CJC A;  5AQU A;  4GVE A;  4JAX A;  3W0L A;  3MWT A;  4Z94 A;  4RCH A;  2YI1 A;  3GE1 A;  4FWM A;  5AQV A;  1LOT B;  1SAZ A;  2ZJQ L;  3CXC M;  2BH1 A;  4L3Q A;  3O9S A;  4BR2 A;  3FLC O;  4I6M B;  1OKJ A;  4FWR A;  4XEI A;  1X3M A;  2GUP A;  2HST A;  4BC5 A;  4B9Q A;  3ZET B;  2A41 A;  3NVM A;  3EE8 A;  5F1X A;  3TSP A;  3F5T A;  3IDH A;  3LDN A;  3WUH A;  1YJN N;  1T6D A;  1NWK A;  2GWJ A;  2Q31 A;  2Q0U A;  4XH4 A;  5M1K A;  3CCV N;  1U2V A;  3KWI A;  4A61 A;  1RDU A;  2IVN A;  2ITM A;  1BG3 A;  4WFN L;  4IEE A;  3E66 A;  4ISG A;  4IOX A;  4XH1 A;  3CCQ N;  1M90 O;  3CJ1 A;  5BRE A;  2VCP A;  2YJF A;  2E2O A;  3H1V X;  4JEP A;  3VEZ A;  3VEW A;  1DEJ A;  4PKH A;  4QS9 A;  3ENH A;  2P9S B;  5E26 A;  4BRM A;  4E1J A;  5AQH A;  5FPN A;  3VGM A;  1BA0 A;  4MDB A;  4BR0 A;  3CC4 N;  1KAX A;  4IJN A;  4CZF A;  5BPM A;  4CD1 A;  4BGA A;  3L4I A;  4JKD A;  1D4X A;  3K9J A;  2P9K B;  2IVP A;  1ATR A;  4FWK A;  1KAY A;  2ASO A;  3I8B A;  2ZWH A;  3M5R A;  4JKB A;  3WQU A;  3UKU A;  4AF1 A;  5C15 A;  2GWK A;  3D6R A;  4A5B A;  2QA4 N;  3O1B A;  4BQZ A;  2A5X A;  3FZH A;  3CCM N;  1GLD G;  4O5F A;  1C0F A;  2HMP A;  2CH6 A;  2Q0R A;  3GDQ A;  1NGE A;  3KVG A;  3F2K A;  4FWN A;  4FWQ A;  4HWI A;  1MDU B;  5BRF A;  4ISF A;  4IXC A;  5M1N A;  3SAG A;  3SAF A;  1YAG A;  5AR0 A;  4BVO A;  2OAN A;  3MN7 A;  2CGK A;  3OHR A;  3EN9 A;  2NRT A;  5EOY A;  3VEX A;  3C7N A;  2E1Z A;  4H0V B;  1O13 A;  4DQ8 A;  3M3Z A;  1KXP A;  2HOE A;  1K8K B;  2IIR A;  2QW9 A;  3M1F A;  3J7Z O;  3RSE B;  1NJI O;  1IJJ A;  2QEX N;  1YIJ N;  3D7E O;  3L6Q A;  3IKM A;  2KLA A;  5BN8 A;  3FZK A;  4U7B A;  4BRL A;  1GLE G;  4JKG A;  4CZE A;  3UKR A;  1X9J A;  5BRD A;  3PLA A;  4H5R A;  5DM6 L;  1HLU A;  1VAZ A;  4PKI A;  1S22 A;  1NGH A;  3DWL A;  1U2V B;  1NGB A;  3DAW A;  2E88 A;  3LM2 A;  4AM7 A;  4FWP A;  4H0P A;  4BGB A;  2ZJR L;  5BR9 A;  3R3L A;  4YOY A;  1ILY A;  2A42 A;  3CQX A;  3I33 A;  4LC9 B;  4BVP A;  2F7T A;  4PHT X;  3C6A A;  4BR4 A;  4IOA L;  4PL7 A;  1JCE A;  2D4W A;  3S41 A;  2Q36 A;  3MMV A;  2RE2 A;  4EFH A;  4H0X B;  4BG8 A;  4DCH A;  2F9T A;  4FL9 A;  3O9Q A;  1YVN A;  5AQQ A;  3CMA N;  3FZM A;  3MN9 A;  1Q86 O;  1ATS A;  1K9M O;  3OBW A;  4MO5 A;  4CZK A;  1HPM A;  1ZXO A;  3U8X A;  5DM7 L;  2FSJ A;  3BF1 A;  4JKE A;  3O4W A;  4BRK A;  4IO9 L;  4QS8 A;  1YXQ A;  4NB4 A;  4NLC A;  5AQK A;  3AGK A;  1V4T A;  2NRH A;  4CBX A;  4OO1 J;  5JVH L;  3CC7 N;  4A2B A;  5EY4 A;  4EHU A;  3WXK A;  4YOX A;  1KQS M;  4J8F A;  2KKZ A;  2JWL A;  3VET A;  3P39 A;  3WXI A;  4BRN A;  1VQ5 N;  3AAP A;  5AQJ A;  1DGK N;  2A3Z A;  1QVF M;  3FE1 A;  4B1Y B;  3BP8 A;  3IFR A;  4CBU A;  2FF6 A;  3GOI A;  4IZ9 A;  1T3V A;  2I7N A;  3DLL L;  4RTF D;  2GTD A;  3KHY A;  2ZGY A;  2QM1 A;  2YCH A;  5C12 A;  2NRW A;  3CJ9 A;  3CJA A;  4XH5 A;  4BRD A;  3CPW M;  5KPZ A;  5AFU A;  2HBK A;  4CBW A;  3BUZ B;  5F0X A;  3E9P A;  3UKR B;  4BRI A;  3LM9 A;  2P9L A;  5JMV A;  1NGC A;  4CI6 A;  2IVO A;  3CCU N;  5KQ8 A;  3KZB A;  1ESV A;  3Q7C A;  1TUU A;  5AQG A;  5AQP A;  4F9O A;  2HF4 A;  3I55 N;  1GLL O;  1T6C A;  3C0B A;  3HBT A;  3FGU A;  4FPB A;  2ZF5 O;  4WF9 L;  3OW2 M;  3ZX2 A;  3CME N;  3CD6 N;  3VOV A;  2HBJ A;  3CCL N;  4GY2 B;  3VEN A;  1E4G T;  1K8K A;  1VQO N;  3CET A;  3RSE A;  4YOW A;  3VF2 A;  3HM8 A;  5H1S Q;  1BA1 A;  2AP1 A;  4BRE A;  3CCR N;  1YHQ N;  4EAH D;  3CCE N;  2WUS A;  1EO1 A;  3OA9 A;  4KBO A;  2FXU A;  4PKG A;  2D0P A;  3FR0 A;  3QIC A;  3O8M A;  4CZL A;  3AGR A;  3HOS A;  4FWO A;  2V7Z A;  1W97 L;  3QDK A;  4JKH A;  2P9P B;  3EZW A;  2JWK A;  2NNW A;  1KC8 O;  3CF5 L;  4BY9 C;  4G9Z A;  3LDL A;  1HKC A;  3WXJ A;  3G4S N;  2NZT A;  5KQD A;  2ZGZ A;  4FPA A;  1Q7Y O;  5ADX A;  4JHD A;  5FPD A;  2E20 A;  2CGL A;  1QZ6 A;  5AFU H;  3AAQ A;  5BN9 A;  3A5M C;  5FPE A;  1GLF O;  2E2N A;  3HSC A;  3W3D A;  2ASP A;  3KK7 A;  1NLV A;  3VEY A;  4H0Y B;  4H5T A;  4IWV A;  5AZI B;  3T7Z A;  4WYB A;  4CZJ A;  3R6M A;  4U67 L;  1ZC6 A;  4IDH A;  1HKG A;  3OBY A;  3ID6 A;  5GIP A;  1Z6R A;  2QXL A;  1YUW A;  2E2P A;  5C0Y A;  2I7P A;  2P9L B;  3AY9 A;  4BRO A;  1QVG M;  2V52 B;  1WOQ A;  4BG9 A;  1YJ9 N;  5EVZ A;  1GLA G;  3U9Z A;  4B1Z A;  4BC2 A;  4H03 B;  3MX5 A;  4DHY A;  5JLF A;  3PIO L;  3VF4 A;  3H3N O;  3O6W A;  4HTL A;  1E4F T;  1IG8 A;  1SZ2 A;  4FSV A;  3TTF A;  4WFA L;  3VTH A;  3CJ7 A;  2VWB A;  4WQ4 C;  3EL2 A;  3ZX0 A;  4KH4 A;  1TUY A;  4WQ4 A;  2CGJ A;  3MCA B;  2GEM A;  1VQK N;  3VTI A;  5E84 A;  4BRP A;  3A5L C;  3SMP A;  1K8A O;  1HKB A;  4YOV A;  3VF6 A;  4YOT A;  5LJW A;  4BR7 A;  5ADX H;  1QZ5 A;  5LY3 A;  2UYT A;  5GAD P;  5JVG L;  2P9N B;  1XQS C;  3VGK A;  5M1F A;  1V4S A;  5AQX A;  5AQR A;  4JK7 A;  3WT0 A;  2AA4 A;  5GIO A;  4H0O A;  1HJO A;  3G6E N;  2YHX A;  4CZG A;  3FZL A;  4WCE L;  4JHD B;  3DXM B;  4EIA A;  2FF3 B;  2YJE A;  1KAZ A;  1G99 A;  1TYQ A;  2KHO A;  4WQ5 A;  1BU6 O;  3CCJ N;  3H46 O;  5C10 A;  1RFQ A;  1NGD A;  2PAV A;  4DB3 A;  3EE9 A;  4A62 A;  2HBM A;  3GL1 A;  3O9U A;  3CER A;  4YOR A;  3VES A;  4B1W B;  5M1Q A;  2P9P A;  2YHW A;  3MN6 A;  5C2F A;  3D2F A;  4FO0 A;  3HI0 A;  3O08 A;  2HBL A;  2VGN A;  4H5W A;  4BRH A;  4BR5 A;  1VQ6 N;  1RDW X;  4MDA A;  2ASM A;  4PL8 A;  5AQN A;  2D1K A;  3QBW A;  4B1V A;  4IEI A;  3LDP A;  5AQT A;  3ZEU A;  1NGG A;  2QWN A;  3PIP L;  3N4P A;  4O8K A;  4GV6 A;  1W2B M;  4YOU A;  3MN5 A;  3VPZ A;  1YF5 L;  2W41 A;  4ILG B;  4IO8 A;  1QQM A;  1NMD A;  5AZI A;  3CQY A;  1C0G A;  4JD2 A;  4A57 A;  5AQW A;  4H0T B;  3MDQ A;  2A40 A;  4BC4 A;  2A6A A;  2WFB A;  3P38 A;  4BRC A;  3JXU A;  5AZJ B;  1VQM N;  5FPM A;  4K43 A;  1P90 A;  5BPL A;  1S72 N;  4B1U B;  3WXL A;  3T69 A;  3ATV A;  4B1X B;  3SBT A;  1QHA A;  3D2E B;  2RHK A;  4ILJ A;  5JLH A;  5M1P A;  4QS7 A;  3SLC A;  4JK8 A;  4BC3 A;  3O5B A;  4WFB L;  4C1N I;  4K25 A;  2V7Y A;  2QWP A;  3MCP A;  3CCS N;  1K73 O;  1T44 A;  3VMF B;  2NRV A;  2P9U A;  4JKF A;  4EHT A;  4JKA A;  3SBG A;  2D0O A;  3TPQ A;  3SK3 A;  3H6E A;  3CC2 N;  2NRZ A;  2PFU A;  1J6Z A;  3O9R A;  3QML A;  1TYQ B;  3K9K A;  2GX9 A;  3B8A X;  5AQY A;  3WEE A;  4BRF A;  1VQN N;  3MK6 A;  1MWM A;  3UE5 A;  4IOC L;  1ATN A;  1MWK A;  3JS6 A;  4JN4 A;  5TKW A;  1VQL N;  3SJH A;  2P9N A;  1R59 O;  2CH5 A;  2FSK A;  4KH5 A;  4C23 A;  4FOE A;  5CE3 A;  3D2F B;  5AQZ A;  1YI2 N;  4DKW A;  1DT9 A;  1HX1 A;  3WXM B;  3ID8 A;  3HRG A;  3VEO A;  5HOO A;  3ZYY X;  4C1N K;  4BRG A;  3DXM A;  2EWS A;  3EKU A;  1NM1 A;  3ZEU B;  3ZX3 A;  4ILH A;  1Q81 O;  3NMU A;  3O9T A;  1CZA N;  5KPR A;  2GEL A;  5CHI A;  3Q7B A;  2QWM A;  2P9I A;  3R9P A;  2NRR A;  3H45 C;  2QWQ A;  4JD2 B;  3J8A A;  2E8A A;  4AM6 A;  3L0Q A;  4A5A A;  3U4L A;  3EO3 A;  4GV3 A;  2FSN A;  3IMX A;  1N8R O;  3SAH A;  3HOT A;  1SQK A;  1GLC G;  3A0I X;  3QBX A;  2WBN A;  3LDQ A;  3QFP A;  5F2R A;  3HTV A;  3HZ6 A;  1VQ7 N;  3CJB A;  5AQS A;  1MA9 B;  2QWL A;  3LL3 A;  4M7X A;  2QWO A;  3P31 A;  4MO4 A;  1Y64 A;  3E1Y A;  1NGA A;  1OVY A;  4KH6 A;  2QTD A;  4A59 A;  4UY8 O;  3TU5 A;  4MLE A;  2Q2R A;  5BPN A;  3DXK B;  5GIN A;  1VQP N;  2YX6 A;  4BQL A;  2ZJP L;  2OTL N;  3ULE A;  2P9U B;  2QWR A;  3ENO A;  1Q82 O;  4IFE A;  4CZH A;  3CIP A;  3A5N C;  1JCG A;  2E1Y A;  1Z05 A;  3O80 A;  1Q18 A;  3ATU A;  3A8Y A;  1LCU A;  4JKC A;  4OPH A;  3WEE B;  3G71 N;  1XUP O;  5AZJ A;  5JIC A;  3C6H A;  3H1Q A;  1VQ9 N;  3LDO A;  3H3O B;  4JK9 A;  1BO5 O;  3DJC A;  4CJ7 A;  4ISE A;  3MX2 A;  5LJV A;  4K41 A;  2V51 B;  3D2E A;  5TKY A;  1ZBS A;  1GLB G;  4Y0W A;  3M6G A;  3BF3 A;  5C2D A;  2NRX A;  1NGJ A;  5HL7 L;  2BUP A;  2YHY A;  4H5N A;  3TSQ A;  5AQL A;  2H3G X;  4FWL A;  3TSU A;  4IJA A;  4H5V A;  4O8U A;  1GLJ O;  4WQ5 C;  3R1X A;  1VQ8 N;  2W40 A;  4BRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...