5C1CA

Crystal structure of the pectin methylesterase from aspergillus niger in deglycosylated form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGDLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
molecule keywords Pectinesterase
total genus 111
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1cA00
3FY3A 2NT9A 4YZXA 4AVZA 1OFLA 3T9GA 1H80A 1AIRA 4OJPA 2IQ7A 3EQNA 1BN8A 2NTPA 2QY1A 1OGOX 1RU4A 4W8RA 1RWRA 2X6WA 2VJIA 4OJ6A 1KTWA 2O0WA 2VBEA 2NZMA 3GQ7A 5AMVA 2VBKA 4XLFA 1EE6A 4YZAA 1OGMX 3B4NA 4XONA 4YEJA 4C2LA 4XN0A 4XORA 2PYHA 4Z03A 1DBGA 1GQ8A 3GQ9A 5C1CA 3VMVA 2NTQA 4EW9A 1VBLA 1HG8A 4XL9A 3B90A 4OZZA 3UW0A 1RMGA 3VMWA 3VSVA 1OOCA 1O8GA 4URRA 4YZ0A 4I84A 2O1DA 1O8FA 4XN3A 3EQOA 4W8TA 4XNFA 1O8IA 4OJLA 4W8SA 4W8QA 4XKVA 1PE9A 4XLAA 3GRHA 2QXZA 3B8YA 1JRGA 2INVA 2X6XA 1QCXA 2NSPA 3VSUA 4XOTA 3VSTA 1K5CA 4NK6A 2Z8GA 1X0CA 1O8HA 2VJJA 2PYGA 3ZPPA 1PLUA 2X6YA 3LMWA 1O8LA 1KCDA 4XLHA 3GQAA 4XR6A 2ODLA 3ZSCA 1IB4A 3JURA 2NSTA 1NHCA 4XM3A 2EWEA 1QJVA 1CZFA 1IA5A 2VBMA 4NK8A 1DBOA 2X3HA 1XG2A 4HWVA 3WWGA 1O8JA 2NT6A 4Z05A 5C1EA 4XOPA 1IDKA 1O8MA 1O8KA 2UVFA 4MXNA 2O04A 1BHEA 4XLEA 4Z06A 2UVEA 2QX3A 2O0VA 4XKWA 2NTBA 2PECA 1O8DA 4OJ5A 4XMYA 2INUA 4U4BA 3SUCA 1O88A 2BSPA 4YELA 2X85A 4YZQA 3KRGA 1WMRA 3GQ8A 1O8EA 4OJOA 1OFMA 1JTAA 1IDJA 4XLCA 4U49A 2O17A 4MR0A 4XQFA 1KCCA 4PMHA 4OZYA 1PXZA
chains in the Genus database with same CATH superfamily
3FY3A 2NT9A 3SZEA 3NB2A 4YZXA 4AVZA 1OFLA 4YCQA 2J8KA 1L1IA 1LM1A 3T9GA 1OFEA 1H80A 1AIRA 1QQ1A 4OJPA 4JRAC 2IQ7A 2XT4A 3EQNA 3SY2A 1BN8A 1EZGA 2NTPA 2QY1A 3H09A 1OGOX 4YEIA 1RU4A 4W8RA 3P4GA 1RWRA 2X6WA 2O6WA 2VJIA 1TYVA 1KTWA 4OJ6A 2O0WA 2VBEA 2NZMA 3GQ7A 5AMVA 3LJYA 3BH6B 2VBKA 4XLFA 2XTYA 3N6ZA 1QA2A 1EE6A 4YZAA 1DABA 1OGMX 3B4NA 4XONA 4YEJA 4C2LA 2BM7A 4XN0A 4XORA 2IOUG 2PYHA 4Z03A 1GQ8A 1DBGA 3GQ9A 5C1CA 2XC1A 1LLWA 1K5CA 4OM9A 2NTQA 3VMVA 2VFNA 4EW9A 2W7ZA 1VBLA 3SYJA 1HG8A 4XL9A 3B90A 5JLVC 4OZZA 2YUHA 1RMGA 3UW0A 3VMWA 3VSVA 1OOCA 1O8GA 4URRA 3PSZA 3AK5A 4YZ0A 4I84A 2O1DA 1O8FA 2XT2A 2G0YA 4XN3A 3EQOA 2VFQA 4W8TA 4XNFA 1O8IA 4OJLA 4W8SA 4W8QA 4XKVA 1PE9A 4XLAA 3GRHA 2QXZA 2BM5A 2VFPA 3B8YA 1JRGA 2INVA 2X6XA 1QCXA 2NSPA 2QYUA 1TSPA 2XTWA 4OPWA 4XOTA 4NK6A 3VSTA 1TYUA 1X0CA 2Z8GA 4V02C 3VSUA 1O8HA 2QZAA 2PYGA 2VJJA 1EA0A 1QRCA 3JX8A 3DU1X 3ZPPA 1PLUA 2V5IA 2BM4A 2X6YA 1TYWA 1O8LA 3LMWA 2B0RA 1KCDA 4XLHA 5JMCB 2F3LA 1TYXA 3GQAA 4XR6A 2ODLA 3ZSCA 1IB4A 3JURA 3PSSA 2NSTA 1NHCA 1QA3A 2XTXA 4XM3A 2EWEA 1QJVA 1CZFA 1QA1A 2BM6A 1IA5A 2VBMA 4NK8A 1DBOA 2BX6A 2X3HA 1XG2A 4HWVA 3WWGA 1O8JA 2NT6A 1HF2A 1WXRA 4Z05A 5C1EA 4XOPA 1IDKA 1O8MA 1O8KA 2UVFA 1OFDA 4MXNA 4YFOA 1LLZA 3BH7B 3TH0A 2O04A 3ML3A 1BHEA 3RIQA 4XLEA 4Z06A 2UVEA 2QX3A 2O0VA 3LYCA 3NAWA 4XKWA 1K8FA 2NTBA 2PECA 1O8DA 1CLWA 3N90A 4OJ5A 4XMYA 2INUA 2VFOA 4U4BA 1KQ5A 1K4ZA 1O88A 3PETA 3SUCA 2BSPA 4YELA 3SQVA 2X85A 4YZQA 3KRGA 5DNSA 1WMRA 3GQ8A 1O8EA 1QRBA 1OFMA 4OJOA 1JTAA 1IDJA 4KH3A 4XLCA 4U49A 2VFMA 2O17A 4MR0A 2J8IA 4YC5A 4XQFA 4YDTA 1KCCA 4PMHA 4OZYA 1PXZA
chains in the Genus database with same CATH topology
3FY3A 2NT9A 4YZXA 4AVZA 1OFLA 3T9GA 1H80A 1AIRA 4OJPA 2IQ7A 3EQNA 1BN8A 2NTPA 2QY1A 1OGOX 1RU4A 4W8RA 1RWRA 2X6WA 2VJIA 4OJ6A 1KTWA 2O0WA 2VBEA 2NZMA 3GQ7A 5AMVA 2VBKA 4XLFA 1EE6A 4YZAA 1OGMX 3B4NA 4XONA 4YEJA 4C2LA 4XN0A 4XORA 2PYHA 4Z03A 1DBGA 1GQ8A 3GQ9A 5C1CA 3VMVA 2NTQA 4EW9A 1VBLA 1HG8A 4XL9A 3B90A 4OZZA 3UW0A 1RMGA 3VMWA 3VSVA 1OOCA 1O8GA 4URRA 4YZ0A 4I84A 2O1DA 1O8FA 4XN3A 3EQOA 4W8TA 4XNFA 1O8IA 4OJLA 4W8SA 4W8QA 4XKVA 1PE9A 4XLAA 3GRHA 2QXZA 3B8YA 1JRGA 2INVA 2X6XA 1QCXA 2NSPA 3VSUA 4XOTA 3VSTA 1K5CA 4NK6A 2Z8GA 1X0CA 1O8HA 2VJJA 2PYGA 3ZPPA 1PLUA 2X6YA 3LMWA 1O8LA 1KCDA 4XLHA 3GQAA 4XR6A 2ODLA 3ZSCA 1IB4A 3JURA 2NSTA 1NHCA 4XM3A 2EWEA 1QJVA 1CZFA 1IA5A 2VBMA 4NK8A 1DBOA 2X3HA 1XG2A 4HWVA 3WWGA 1O8JA 2NT6A 4Z05A 5C1EA 4XOPA 1IDKA 1O8MA 1O8KA 2UVFA 4MXNA 2O04A 1BHEA 4XLEA 4Z06A 2UVEA 2QX3A 2O0VA 4XKWA 2NTBA 2PECA 1O8DA 4OJ5A 4XMYA 2INUA 4U4BA 3SUCA 1O88A 2BSPA 4YELA 2X85A 4YZQA 3KRGA 1WMRA 3GQ8A 1O8EA 4OJOA 1OFMA 1JTAA 1IDJA 4XLCA 4U49A 2O17A 4MR0A 4XQFA 1KCCA 4PMHA 4OZYA 1PXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FY3 A;  2NT9 A;  4YZX A;  4AVZ A;  1OFL A;  3T9G A;  1H80 A;  1AIR A;  4OJP A;  2IQ7 A;  3EQN A;  1BN8 A;  2NTP A;  2QY1 A;  1OGO X;  1RU4 A;  4W8R A;  1RWR A;  2X6W A;  2VJI A;  4OJ6 A;  1KTW A;  2O0W A;  2VBE A;  2NZM A;  3GQ7 A;  5AMV A;  2VBK A;  4XLF A;  1EE6 A;  4YZA A;  1OGM X;  3B4N A;  4XON A;  4YEJ A;  4C2L A;  4XN0 A;  4XOR A;  2PYH A;  4Z03 A;  1DBG A;  1GQ8 A;  3GQ9 A;  5C1C A;  3VMV A;  2NTQ A;  4EW9 A;  1VBL A;  1HG8 A;  4XL9 A;  3B90 A;  4OZZ A;  3UW0 A;  1RMG A;  3VMW A;  3VSV A;  1OOC A;  1O8G A;  4URR A;  4YZ0 A;  4I84 A;  2O1D A;  1O8F A;  4XN3 A;  3EQO A;  4W8T A;  4XNF A;  1O8I A;  4OJL A;  4W8S A;  4W8Q A;  4XKV A;  1PE9 A;  4XLA A;  3GRH A;  2QXZ A;  3B8Y A;  1JRG A;  2INV A;  2X6X A;  1QCX A;  2NSP A;  3VSU A;  4XOT A;  3VST A;  1K5C A;  4NK6 A;  2Z8G A;  1X0C A;  1O8H A;  2VJJ A;  2PYG A;  3ZPP A;  1PLU A;  2X6Y A;  3LMW A;  1O8L A;  1KCD A;  4XLH A;  3GQA A;  4XR6 A;  2ODL A;  3ZSC A;  1IB4 A;  3JUR A;  2NST A;  1NHC A;  4XM3 A;  2EWE A;  1QJV A;  1CZF A;  1IA5 A;  2VBM A;  4NK8 A;  1DBO A;  2X3H A;  1XG2 A;  4HWV A;  3WWG A;  1O8J A;  2NT6 A;  4Z05 A;  5C1E A;  4XOP A;  1IDK A;  1O8M A;  1O8K A;  2UVF A;  4MXN A;  2O04 A;  1BHE A;  4XLE A;  4Z06 A;  2UVE A;  2QX3 A;  2O0V A;  4XKW A;  2NTB A;  2PEC A;  1O8D A;  4OJ5 A;  4XMY A;  2INU A;  4U4B A;  3SUC A;  1O88 A;  2BSP A;  4YEL A;  2X85 A;  4YZQ A;  3KRG A;  1WMR A;  3GQ8 A;  1O8E A;  4OJO A;  1OFM A;  1JTA A;  1IDJ A;  4XLC A;  4U49 A;  2O17 A;  4MR0 A;  4XQF A;  1KCC A;  4PMH A;  4OZY A;  1PXZ A; 
#chains in the Genus database with same CATH topology
 3FY3 A;  2NT9 A;  3SZE A;  3NB2 A;  4YZX A;  4AVZ A;  1OFL A;  4YCQ A;  2J8K A;  1L1I A;  1LM1 A;  3T9G A;  1OFE A;  1H80 A;  1AIR A;  1QQ1 A;  4OJP A;  4JRA C;  2IQ7 A;  2XT4 A;  3EQN A;  3SY2 A;  1BN8 A;  1EZG A;  2NTP A;  2QY1 A;  3H09 A;  1OGO X;  4YEI A;  1RU4 A;  4W8R A;  3P4G A;  1RWR A;  2X6W A;  2O6W A;  2VJI A;  1TYV A;  1KTW A;  4OJ6 A;  2O0W A;  2VBE A;  2NZM A;  3GQ7 A;  5AMV A;  3LJY A;  3BH6 B;  2VBK A;  4XLF A;  2XTY A;  3N6Z A;  1QA2 A;  1EE6 A;  4YZA A;  1DAB A;  1OGM X;  3B4N A;  4XON A;  4YEJ A;  4C2L A;  2BM7 A;  4XN0 A;  4XOR A;  2IOU G;  2PYH A;  4Z03 A;  1GQ8 A;  1DBG A;  3GQ9 A;  5C1C A;  2XC1 A;  1LLW A;  1K5C A;  4OM9 A;  2NTQ A;  3VMV A;  2VFN A;  4EW9 A;  2W7Z A;  1VBL A;  3SYJ A;  1HG8 A;  4XL9 A;  3B90 A;  5JLV C;  4OZZ A;  2YUH A;  1RMG A;  3UW0 A;  3VMW A;  3VSV A;  1OOC A;  1O8G A;  4URR A;  3PSZ A;  3AK5 A;  4YZ0 A;  4I84 A;  2O1D A;  1O8F A;  2XT2 A;  2G0Y A;  4XN3 A;  3EQO A;  2VFQ A;  4W8T A;  4XNF A;  1O8I A;  4OJL A;  4W8S A;  4W8Q A;  4XKV A;  1PE9 A;  4XLA A;  3GRH A;  2QXZ A;  2BM5 A;  2VFP A;  3B8Y A;  1JRG A;  2INV A;  2X6X A;  1QCX A;  2NSP A;  2QYU A;  1TSP A;  2XTW A;  4OPW A;  4XOT A;  4NK6 A;  3VST A;  1TYU A;  1X0C A;  2Z8G A;  4V02 C;  3VSU A;  1O8H A;  2QZA A;  2PYG A;  2VJJ A;  1EA0 A;  1QRC A;  3JX8 A;  3DU1 X;  3ZPP A;  1PLU A;  2V5I A;  2BM4 A;  2X6Y A;  1TYW A;  1O8L A;  3LMW A;  2B0R A;  1KCD A;  4XLH A;  5JMC B;  2F3L A;  1TYX A;  3GQA A;  4XR6 A;  2ODL A;  3ZSC A;  1IB4 A;  3JUR A;  3PSS A;  2NST A;  1NHC A;  1QA3 A;  2XTX A;  4XM3 A;  2EWE A;  1QJV A;  1CZF A;  1QA1 A;  2BM6 A;  1IA5 A;  2VBM A;  4NK8 A;  1DBO A;  2BX6 A;  2X3H A;  1XG2 A;  4HWV A;  3WWG A;  1O8J A;  2NT6 A;  1HF2 A;  1WXR A;  4Z05 A;  5C1E A;  4XOP A;  1IDK A;  1O8M A;  1O8K A;  2UVF A;  1OFD A;  4MXN A;  4YFO A;  1LLZ A;  3BH7 B;  3TH0 A;  2O04 A;  3ML3 A;  1BHE A;  3RIQ A;  4XLE A;  4Z06 A;  2UVE A;  2QX3 A;  2O0V A;  3LYC A;  3NAW A;  4XKW A;  1K8F A;  2NTB A;  2PEC A;  1O8D A;  1CLW A;  3N90 A;  4OJ5 A;  4XMY A;  2INU A;  2VFO A;  4U4B A;  1KQ5 A;  1K4Z A;  1O88 A;  3PET A;  3SUC A;  2BSP A;  4YEL A;  3SQV A;  2X85 A;  4YZQ A;  3KRG A;  5DNS A;  1WMR A;  3GQ8 A;  1O8E A;  1QRB A;  1OFM A;  4OJO A;  1JTA A;  1IDJ A;  4KH3 A;  4XLC A;  4U49 A;  2VFM A;  2O17 A;  4MR0 A;  2J8I A;  4YC5 A;  4XQF A;  4YDT A;  1KCC A;  4PMH A;  4OZY A;  1PXZ A; 
#chains in the Genus database with same CATH homology
 3FY3 A;  2NT9 A;  4YZX A;  4AVZ A;  1OFL A;  3T9G A;  1H80 A;  1AIR A;  4OJP A;  2IQ7 A;  3EQN A;  1BN8 A;  2NTP A;  2QY1 A;  1OGO X;  1RU4 A;  4W8R A;  1RWR A;  2X6W A;  2VJI A;  4OJ6 A;  1KTW A;  2O0W A;  2VBE A;  2NZM A;  3GQ7 A;  5AMV A;  2VBK A;  4XLF A;  1EE6 A;  4YZA A;  1OGM X;  3B4N A;  4XON A;  4YEJ A;  4C2L A;  4XN0 A;  4XOR A;  2PYH A;  4Z03 A;  1DBG A;  1GQ8 A;  3GQ9 A;  5C1C A;  3VMV A;  2NTQ A;  4EW9 A;  1VBL A;  1HG8 A;  4XL9 A;  3B90 A;  4OZZ A;  3UW0 A;  1RMG A;  3VMW A;  3VSV A;  1OOC A;  1O8G A;  4URR A;  4YZ0 A;  4I84 A;  2O1D A;  1O8F A;  4XN3 A;  3EQO A;  4W8T A;  4XNF A;  1O8I A;  4OJL A;  4W8S A;  4W8Q A;  4XKV A;  1PE9 A;  4XLA A;  3GRH A;  2QXZ A;  3B8Y A;  1JRG A;  2INV A;  2X6X A;  1QCX A;  2NSP A;  3VSU A;  4XOT A;  3VST A;  1K5C A;  4NK6 A;  2Z8G A;  1X0C A;  1O8H A;  2VJJ A;  2PYG A;  3ZPP A;  1PLU A;  2X6Y A;  3LMW A;  1O8L A;  1KCD A;  4XLH A;  3GQA A;  4XR6 A;  2ODL A;  3ZSC A;  1IB4 A;  3JUR A;  2NST A;  1NHC A;  4XM3 A;  2EWE A;  1QJV A;  1CZF A;  1IA5 A;  2VBM A;  4NK8 A;  1DBO A;  2X3H A;  1XG2 A;  4HWV A;  3WWG A;  1O8J A;  2NT6 A;  4Z05 A;  5C1E A;  4XOP A;  1IDK A;  1O8M A;  1O8K A;  2UVF A;  4MXN A;  2O04 A;  1BHE A;  4XLE A;  4Z06 A;  2UVE A;  2QX3 A;  2O0V A;  4XKW A;  2NTB A;  2PEC A;  1O8D A;  4OJ5 A;  4XMY A;  2INU A;  4U4B A;  3SUC A;  1O88 A;  2BSP A;  4YEL A;  2X85 A;  4YZQ A;  3KRG A;  1WMR A;  3GQ8 A;  1O8E A;  4OJO A;  1OFM A;  1JTA A;  1IDJ A;  4XLC A;  4U49 A;  2O17 A;  4MR0 A;  4XQF A;  1KCC A;  4PMH A;  4OZY A;  1PXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...