5C1CA

Crystal structure of the pectin methylesterase from aspergillus niger in deglycosylated form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGDLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
total genus 111
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1cA00
4AVZA 2INVA 4Z03A 1O8HA 1X0CA 1OOCA 1KCDA 4XN3A 1RU4A 1H80A 2BSPA 2QX3A 4W8RA 4XLAA 2NTQA 4XLEA 1O8EA 1KCCA 3B8YA 2NT6A 2QY1A 1HG8A 1EE6A 4XMYA 3UW0A 1CZFA 5C1CA 2IQ7A 3B90A 2NTBA 4NK8A 1QJVA 3JURA 3VSVA 2X6YA 1DBGA 2NT9A 2NSTA 2PYHA 4OJOA 2X6XA 2QXZA 4W8QA 1O8KA 4XONA 3ZPPA 4YEJA 4XN0A 3VMWA 1IB4A 1VBLA 3KRGA 2ODLA 1JRGA 2EWEA 3GQ8A 1O8IA 4XORA 4YZQA 1PE9A 4OJPA 4XKVA 3T9GA 4OJ5A 1O8LA 4MXNA 2VBMA 1RWRA 2X6WA 3GQ7A 4NK6A 1QCXA 2PYGA 2Z8GA 4YZ0A 4C2LA 3EQOA 1PLUA 1IDJA 3VSUA 1OFMA 4OJLA 1XG2A 3WWGA 1K5CA 4XLFA 5AMVA 2O0VA 4XL9A 1O88A 4YELA 5C1EA 4Z06A 1O8FA 2PECA 3SUCA 3FY3A 4YZXA 1OFLA 2INUA 2NSPA 3EQNA 4EW9A 4W8TA 1O8DA 3VMVA 4XR6A 2NZMA 1NHCA 1IDKA 1DBOA 4HWVA 4URRA 4XLHA 3GQAA 4PMHA 4MR0A 4Z05A 2NTPA 3GQ9A 2O17A 2VBKA 3VSTA 4XLCA 1AIRA 1GQ8A 1O8GA 2VJIA 4XNFA 4XQFA 4OZYA 1O8JA 1OGOX 4I84A 2O04A 1BHEA 4W8SA 2O1DA 1WMRA 1JTAA 2VBEA 2O0WA 2X85A 3LMWA 3ZSCA 2VJJA 4XOTA 2UVFA 1OGMX 4U4BA 1BN8A 4U49A 2UVEA 4OZZA 4XOPA 1RMGA 4YZAA 1IA5A 3GRHA 3B4NA 2X3HA 4XKWA 4XM3A 1O8MA 1PXZA 1KTWA 4OJ6A
chains in the Genus database with same CATH superfamily
3LJYA 4AVZA 2INVA 4Z03A 3SYJA 1O8HA 1X0CA 1OOCA 2W7ZA 1KCDA 3SY2A 4XN3A 3N6ZA 1RU4A 1H80A 4YDTA 2BSPA 2BM4A 1QRCA 2QX3A 4W8RA 4XLAA 2G0YA 1TYWA 2NTQA 4XLEA 3LYCA 4YFOA 1O8EA 3BH7B 1KCCA 1TYUA 3B8YA 2NT6A 2QY1A 1HG8A 1EE6A 4XMYA 3UW0A 5JLVC 1CZFA 4KH3A 5C1CA 2IQ7A 2XT4A 3B90A 2NTBA 2J8KA 1CLWA 1KQ5A 4NK8A 2J8IA 1QJVA 3JURA 3VSVA 2X6YA 1DBGA 2NT9A 2NSTA 2PYHA 4OJOA 2X6XA 2QXZA 1TSPA 4W8QA 1O8KA 3JX8A 4XONA 2YUHA 4YEJA 3ZPPA 4YEIA 1K8FA 1OFDA 4XN0A 3VMWA 1IB4A 1VBLA 3P4GA 3KRGA 2ODLA 1JRGA 2EWEA 3GQ8A 1O8IA 4JRAC 4XORA 4YZQA 3H09A 1PE9A 4OJPA 4XKVA 3RIQA 3T9GA 1QRBA 4OJ5A 1O8LA 1TYVA 2XTWA 4MXNA 2VBMA 1RWRA 2X6WA 5DNSA 1QQ1A 3GQ7A 4NK6A 1QCXA 2PYGA 2Z8GA 4YZ0A 4C2LA 3EQOA 1PLUA 1IDJA 2BM7A 1OFMA 2IOUG 3VSUA 4OJLA 1XG2A 3WWGA 1DABA 1K5CA 1WXRA 2VFOA 3TH0A 1K4ZA 5JMCB 4XLFA 2V5IA 5AMVA 1QA2A 2O0VA 4XL9A 1O88A 3BH6B 3NAWA 2XC1A 4YELA 5C1EA 4Z06A 1EA0A 1O8FA 2PECA 3SUCA 3FY3A 4YZXA 1OFLA 1QA1A 1HF2A 2BM5A 2XT2A 2INUA 4YCQA 2NSPA 2B0RA 4V02C 3EQNA 1TYXA 4EW9A 1EZGA 4W8TA 1O8DA 2XTXA 3VMVA 4XR6A 2NZMA 2VFMA 2QZAA 1NHCA 1IDKA 1DBOA 4HWVA 1LM1A 4OPWA 4URRA 3NB2A 3GQAA 4XLHA 2O6WA 4PMHA 4MR0A 4Z05A 2NTPA 3AK5A 2BX6A 3GQ9A 2O17A 3PSSA 2VBKA 3VSTA 3DU1X 4XLCA 1AIRA 1GQ8A 1LLWA 1O8GA 2VJIA 4XNFA 4XQFA 3PSZA 1O8JA 1OGOX 4I84A 2O04A 4OZYA 1BHEA 1L1IA 4W8SA 2O1DA 1WMRA 1JTAA 2VBEA 2XTYA 3SQVA 1QA3A 2O0WA 2X85A 2VFNA 3LMWA 3SZEA 3ZSCA 2VJJA 4XOTA 1OGMX 2UVFA 4U4BA 1BN8A 4U49A 1OFEA 2F3LA 2UVEA 4OZZA 4XOPA 3N90A 1LLZA 2VFPA 1RMGA 4YZAA 1IA5A 3GRHA 3PETA 3ML3A 3B4NA 2X3HA 4XKWA 2VFQA 4OM9A 2QYUA 4XM3A 1O8MA 1PXZA 4YC5A 1KTWA 2BM6A 4OJ6A
chains in the Genus database with same CATH topology
4AVZA 2INVA 4Z03A 1O8HA 1X0CA 1OOCA 1KCDA 4XN3A 1RU4A 1H80A 2BSPA 2QX3A 4W8RA 4XLAA 2NTQA 4XLEA 1O8EA 1KCCA 3B8YA 2NT6A 2QY1A 1HG8A 1EE6A 4XMYA 3UW0A 1CZFA 5C1CA 2IQ7A 3B90A 2NTBA 4NK8A 1QJVA 3JURA 3VSVA 2X6YA 1DBGA 2NT9A 2NSTA 2PYHA 4OJOA 2X6XA 2QXZA 4W8QA 1O8KA 4XONA 3ZPPA 4YEJA 4XN0A 3VMWA 1IB4A 1VBLA 3KRGA 2ODLA 1JRGA 2EWEA 3GQ8A 1O8IA 4XORA 4YZQA 1PE9A 4OJPA 4XKVA 3T9GA 4OJ5A 1O8LA 4MXNA 2VBMA 1RWRA 2X6WA 3GQ7A 4NK6A 1QCXA 2PYGA 2Z8GA 4YZ0A 4C2LA 3EQOA 1PLUA 1IDJA 3VSUA 1OFMA 4OJLA 1XG2A 3WWGA 1K5CA 4XLFA 5AMVA 2O0VA 4XL9A 1O88A 4YELA 5C1EA 4Z06A 1O8FA 2PECA 3SUCA 3FY3A 4YZXA 1OFLA 2INUA 2NSPA 3EQNA 4EW9A 4W8TA 1O8DA 3VMVA 4XR6A 2NZMA 1NHCA 1IDKA 1DBOA 4HWVA 4URRA 4XLHA 3GQAA 4PMHA 4MR0A 4Z05A 2NTPA 3GQ9A 2O17A 2VBKA 3VSTA 4XLCA 1AIRA 1GQ8A 1O8GA 2VJIA 4XNFA 4XQFA 4OZYA 1O8JA 1OGOX 4I84A 2O04A 1BHEA 4W8SA 2O1DA 1WMRA 1JTAA 2VBEA 2O0WA 2X85A 3LMWA 3ZSCA 2VJJA 4XOTA 2UVFA 1OGMX 4U4BA 1BN8A 4U49A 2UVEA 4OZZA 4XOPA 1RMGA 4YZAA 1IA5A 3GRHA 3B4NA 2X3HA 4XKWA 4XM3A 1O8MA 1PXZA 1KTWA 4OJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVZ A;  2INV A;  4Z03 A;  1O8H A;  1X0C A;  1OOC A;  1KCD A;  4XN3 A;  1RU4 A;  1H80 A;  2BSP A;  2QX3 A;  4W8R A;  4XLA A;  2NTQ A;  4XLE A;  1O8E A;  1KCC A;  3B8Y A;  2NT6 A;  2QY1 A;  1HG8 A;  1EE6 A;  4XMY A;  3UW0 A;  1CZF A;  5C1C A;  2IQ7 A;  3B90 A;  2NTB A;  4NK8 A;  1QJV A;  3JUR A;  3VSV A;  2X6Y A;  1DBG A;  2NT9 A;  2NST A;  2PYH A;  4OJO A;  2X6X A;  2QXZ A;  4W8Q A;  1O8K A;  4XON A;  3ZPP A;  4YEJ A;  4XN0 A;  3VMW A;  1IB4 A;  1VBL A;  3KRG A;  2ODL A;  1JRG A;  2EWE A;  3GQ8 A;  1O8I A;  4XOR A;  4YZQ A;  1PE9 A;  4OJP A;  4XKV A;  3T9G A;  4OJ5 A;  1O8L A;  4MXN A;  2VBM A;  1RWR A;  2X6W A;  3GQ7 A;  4NK6 A;  1QCX A;  2PYG A;  2Z8G A;  4YZ0 A;  4C2L A;  3EQO A;  1PLU A;  1IDJ A;  3VSU A;  1OFM A;  4OJL A;  1XG2 A;  3WWG A;  1K5C A;  4XLF A;  5AMV A;  2O0V A;  4XL9 A;  1O88 A;  4YEL A;  5C1E A;  4Z06 A;  1O8F A;  2PEC A;  3SUC A;  3FY3 A;  4YZX A;  1OFL A;  2INU A;  2NSP A;  3EQN A;  4EW9 A;  4W8T A;  1O8D A;  3VMV A;  4XR6 A;  2NZM A;  1NHC A;  1IDK A;  1DBO A;  4HWV A;  4URR A;  4XLH A;  3GQA A;  4PMH A;  4MR0 A;  4Z05 A;  2NTP A;  3GQ9 A;  2O17 A;  2VBK A;  3VST A;  4XLC A;  1AIR A;  1GQ8 A;  1O8G A;  2VJI A;  4XNF A;  4XQF A;  4OZY A;  1O8J A;  1OGO X;  4I84 A;  2O04 A;  1BHE A;  4W8S A;  2O1D A;  1WMR A;  1JTA A;  2VBE A;  2O0W A;  2X85 A;  3LMW A;  3ZSC A;  2VJJ A;  4XOT A;  2UVF A;  1OGM X;  4U4B A;  1BN8 A;  4U49 A;  2UVE A;  4OZZ A;  4XOP A;  1RMG A;  4YZA A;  1IA5 A;  3GRH A;  3B4N A;  2X3H A;  4XKW A;  4XM3 A;  1O8M A;  1PXZ A;  1KTW A;  4OJ6 A; 
#chains in the Genus database with same CATH topology
 3LJY A;  4AVZ A;  2INV A;  4Z03 A;  3SYJ A;  1O8H A;  1X0C A;  1OOC A;  2W7Z A;  1KCD A;  3SY2 A;  4XN3 A;  3N6Z A;  1RU4 A;  1H80 A;  4YDT A;  2BSP A;  2BM4 A;  1QRC A;  2QX3 A;  4W8R A;  4XLA A;  2G0Y A;  1TYW A;  2NTQ A;  4XLE A;  3LYC A;  4YFO A;  1O8E A;  3BH7 B;  1KCC A;  1TYU A;  3B8Y A;  2NT6 A;  2QY1 A;  1HG8 A;  1EE6 A;  4XMY A;  3UW0 A;  5JLV C;  1CZF A;  4KH3 A;  5C1C A;  2IQ7 A;  2XT4 A;  3B90 A;  2NTB A;  2J8K A;  1CLW A;  1KQ5 A;  4NK8 A;  2J8I A;  1QJV A;  3JUR A;  3VSV A;  2X6Y A;  1DBG A;  2NT9 A;  2NST A;  2PYH A;  4OJO A;  2X6X A;  2QXZ A;  1TSP A;  4W8Q A;  1O8K A;  3JX8 A;  4XON A;  2YUH A;  4YEJ A;  3ZPP A;  4YEI A;  1K8F A;  1OFD A;  4XN0 A;  3VMW A;  1IB4 A;  1VBL A;  3P4G A;  3KRG A;  2ODL A;  1JRG A;  2EWE A;  3GQ8 A;  1O8I A;  4JRA C;  4XOR A;  4YZQ A;  3H09 A;  1PE9 A;  4OJP A;  4XKV A;  3RIQ A;  3T9G A;  1QRB A;  4OJ5 A;  1O8L A;  1TYV A;  2XTW A;  4MXN A;  2VBM A;  1RWR A;  2X6W A;  5DNS A;  1QQ1 A;  3GQ7 A;  4NK6 A;  1QCX A;  2PYG A;  2Z8G A;  4YZ0 A;  4C2L A;  3EQO A;  1PLU A;  1IDJ A;  2BM7 A;  1OFM A;  2IOU G;  3VSU A;  4OJL A;  1XG2 A;  3WWG A;  1DAB A;  1K5C A;  1WXR A;  2VFO A;  3TH0 A;  1K4Z A;  5JMC B;  4XLF A;  2V5I A;  5AMV A;  1QA2 A;  2O0V A;  4XL9 A;  1O88 A;  3BH6 B;  3NAW A;  2XC1 A;  4YEL A;  5C1E A;  4Z06 A;  1EA0 A;  1O8F A;  2PEC A;  3SUC A;  3FY3 A;  4YZX A;  1OFL A;  1QA1 A;  1HF2 A;  2BM5 A;  2XT2 A;  2INU A;  4YCQ A;  2NSP A;  2B0R A;  4V02 C;  3EQN A;  1TYX A;  4EW9 A;  1EZG A;  4W8T A;  1O8D A;  2XTX A;  3VMV A;  4XR6 A;  2NZM A;  2VFM A;  2QZA A;  1NHC A;  1IDK A;  1DBO A;  4HWV A;  1LM1 A;  4OPW A;  4URR A;  3NB2 A;  3GQA A;  4XLH A;  2O6W A;  4PMH A;  4MR0 A;  4Z05 A;  2NTP A;  3AK5 A;  2BX6 A;  3GQ9 A;  2O17 A;  3PSS A;  2VBK A;  3VST A;  3DU1 X;  4XLC A;  1AIR A;  1GQ8 A;  1LLW A;  1O8G A;  2VJI A;  4XNF A;  4XQF A;  3PSZ A;  1O8J A;  1OGO X;  4I84 A;  2O04 A;  4OZY A;  1BHE A;  1L1I A;  4W8S A;  2O1D A;  1WMR A;  1JTA A;  2VBE A;  2XTY A;  3SQV A;  1QA3 A;  2O0W A;  2X85 A;  2VFN A;  3LMW A;  3SZE A;  3ZSC A;  2VJJ A;  4XOT A;  1OGM X;  2UVF A;  4U4B A;  1BN8 A;  4U49 A;  1OFE A;  2F3L A;  2UVE A;  4OZZ A;  4XOP A;  3N90 A;  1LLZ A;  2VFP A;  1RMG A;  4YZA A;  1IA5 A;  3GRH A;  3PET A;  3ML3 A;  3B4N A;  2X3H A;  4XKW A;  2VFQ A;  4OM9 A;  2QYU A;  4XM3 A;  1O8M A;  1PXZ A;  4YC5 A;  1KTW A;  2BM6 A;  4OJ6 A; 
#chains in the Genus database with same CATH homology
 4AVZ A;  2INV A;  4Z03 A;  1O8H A;  1X0C A;  1OOC A;  1KCD A;  4XN3 A;  1RU4 A;  1H80 A;  2BSP A;  2QX3 A;  4W8R A;  4XLA A;  2NTQ A;  4XLE A;  1O8E A;  1KCC A;  3B8Y A;  2NT6 A;  2QY1 A;  1HG8 A;  1EE6 A;  4XMY A;  3UW0 A;  1CZF A;  5C1C A;  2IQ7 A;  3B90 A;  2NTB A;  4NK8 A;  1QJV A;  3JUR A;  3VSV A;  2X6Y A;  1DBG A;  2NT9 A;  2NST A;  2PYH A;  4OJO A;  2X6X A;  2QXZ A;  4W8Q A;  1O8K A;  4XON A;  3ZPP A;  4YEJ A;  4XN0 A;  3VMW A;  1IB4 A;  1VBL A;  3KRG A;  2ODL A;  1JRG A;  2EWE A;  3GQ8 A;  1O8I A;  4XOR A;  4YZQ A;  1PE9 A;  4OJP A;  4XKV A;  3T9G A;  4OJ5 A;  1O8L A;  4MXN A;  2VBM A;  1RWR A;  2X6W A;  3GQ7 A;  4NK6 A;  1QCX A;  2PYG A;  2Z8G A;  4YZ0 A;  4C2L A;  3EQO A;  1PLU A;  1IDJ A;  3VSU A;  1OFM A;  4OJL A;  1XG2 A;  3WWG A;  1K5C A;  4XLF A;  5AMV A;  2O0V A;  4XL9 A;  1O88 A;  4YEL A;  5C1E A;  4Z06 A;  1O8F A;  2PEC A;  3SUC A;  3FY3 A;  4YZX A;  1OFL A;  2INU A;  2NSP A;  3EQN A;  4EW9 A;  4W8T A;  1O8D A;  3VMV A;  4XR6 A;  2NZM A;  1NHC A;  1IDK A;  1DBO A;  4HWV A;  4URR A;  4XLH A;  3GQA A;  4PMH A;  4MR0 A;  4Z05 A;  2NTP A;  3GQ9 A;  2O17 A;  2VBK A;  3VST A;  4XLC A;  1AIR A;  1GQ8 A;  1O8G A;  2VJI A;  4XNF A;  4XQF A;  4OZY A;  1O8J A;  1OGO X;  4I84 A;  2O04 A;  1BHE A;  4W8S A;  2O1D A;  1WMR A;  1JTA A;  2VBE A;  2O0W A;  2X85 A;  3LMW A;  3ZSC A;  2VJJ A;  4XOT A;  2UVF A;  1OGM X;  4U4B A;  1BN8 A;  4U49 A;  2UVE A;  4OZZ A;  4XOP A;  1RMG A;  4YZA A;  1IA5 A;  3GRH A;  3B4N A;  2X3H A;  4XKW A;  4XM3 A;  1O8M A;  1PXZ A;  1KTW A;  4OJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...