5C1CA

Crystal structure of the pectin methylesterase from aspergillus niger in deglycosylated form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGDLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
molecule keywords Pectinesterase
total genus 111
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1cA00
1IB4A 4OZZA 2X6XA 2VBEA 4HWVA 4U49A 2O1DA 3VMWA 4OJ5A 4W8SA 1OFLA 1QJVA 4XNFA 2NSTA 1NHCA 3LMWA 1O8FA 3VSUA 1GQ8A 2X6WA 1O88A 3VMVA 4MR0A 1QCXA 1PLUA 4XORA 1O8MA 2INUA 3B4NA 2EWEA 2NSPA 2INVA 4OJLA 3VSTA 2X6YA 2NTBA 4W8QA 2BSPA 1XG2A 4C2LA 3KRGA 2PECA 1JTAA 1OGMX 4XLFA 3JURA 3ZSCA 4NK6A 1DBOA 1OGOX 1O8IA 2X85A 1PE9A 1O8LA 4XM3A 2NZMA 2VBKA 2NT9A 1OOCA 4U4BA 4XR6A 1O8KA 4AVZA 2QXZA 2NTQA 1O8HA 1BHEA 4XQFA 3GQ9A 4XKWA 4XN0A 4Z06A 2VBMA 4YELA 3ZPPA 1DBGA 4EW9A 2QX3A 1WMRA 3GQ8A 4W8RA 4XMYA 3B90A 4XLCA 4MXNA 1RWRA 4OJPA 4OJOA 4Z03A 4XLEA 1O8DA 3GQAA 2Z8GA 2NT6A 1H80A 3GQ7A 4OZYA 4URRA 4XOTA 3EQOA 1KCCA 2O17A 4OJ6A 1O8EA 1HG8A 4XONA 4W8TA 3WWGA 2UVFA 3EQNA 2VJIA 1EE6A 2NTPA 3T9GA 1KTWA 1JRGA 4I84A 5C1CA 4XLHA 4NK8A 2QY1A 3GRHA 4XL9A 2X3HA 5AMVA 4Z05A 4YZXA 4YZQA 4YZ0A 2O0WA 1BN8A 1VBLA 1X0CA 3SUCA 1K5CA 1IA5A 1O8GA 1PXZA 3VSVA 2UVEA 2PYGA 4XLAA 1OFMA 4YEJA 2O04A 4YZAA 4PMHA 1CZFA 3FY3A 2O0VA 1AIRA 2ODLA 2IQ7A 3B8YA 1RMGA 4XOPA 3UW0A 1IDKA 1IDJA 1O8JA 2VJJA 4XKVA 4XN3A 5C1EA 1KCDA 1RU4A 2PYHA
chains in the Genus database with same CATH superfamily
1IB4A 3AK5A 1LLZA 3LJYA 2BM4A 4OZZA 2XTXA 3SQVA 2X6XA 4YEIA 2VBEA 4HWVA 4U49A 1QRBA 2J8KA 2O1DA 3VMWA 1QA2A 4OJ5A 4W8SA 1OFLA 1QJVA 1OFDA 4XNFA 2NSTA 1NHCA 3LMWA 1O8FA 1DABA 2VFOA 3NAWA 3H09A 3VSUA 1GQ8A 1QRCA 2X6WA 1O88A 2VFMA 3VMVA 4MR0A 1QCXA 1PLUA 4XORA 1O8MA 2INUA 3B4NA 2EWEA 2NSPA 2INVA 1CLWA 4OJLA 3VSTA 2X6YA 3SZEA 2NTBA 2VFQA 4W8QA 2BSPA 3RIQA 1XG2A 4C2LA 2F3LA 3KRGA 1TSPA 2PECA 1JTAA 1OGMX 4XLFA 4YC5A 3JURA 3ZSCA 4NK6A 1DBOA 3NB2A 1OGOX 1O8IA 2B0RA 2X85A 1PE9A 2VFNA 1L1IA 2V5IA 1O8LA 4XM3A 3SY2A 2XT2A 3JX8A 2NZMA 2VBKA 3P4GA 1EA0A 2NT9A 1OOCA 4U4BA 4XR6A 1O8KA 4AVZA 2QXZA 1K8FA 1O8HA 1BHEA 2BM5A 2NTQA 1HF2A 2QYUA 2VFPA 4JRAC 4YFOA 3GQ9A 4XKWA 3DU1X 3N6ZA 4XN0A 4Z06A 2VBMA 2XTWA 4YDTA 4YELA 3ZPPA 1DBGA 1EZGA 1OFEA 4EW9A 2QX3A 5DNSA 1WMRA 3GQ8A 5JLVC 2J8IA 4W8RA 4XMYA 1QA1A 3B90A 4XLCA 4KH3A 4MXNA 1WXRA 2XT4A 5JMCB 1RWRA 1LM1A 3SYJA 4OJPA 4OJOA 4Z03A 4XLEA 4V02C 1TYXA 2XTYA 1O8DA 2YUHA 3GQAA 2Z8GA 2NT6A 2BX6A 1H80A 3GQ7A 4OZYA 4URRA 4YCQA 2G0YA 4XOTA 2QZAA 3EQOA 1TYVA 3LYCA 1KCCA 2O17A 3ML3A 4OJ6A 1QA3A 1O8EA 1HG8A 3PETA 4XONA 4W8TA 3WWGA 2UVFA 1KQ5A 3EQNA 3PSSA 2VJIA 1EE6A 4OM9A 2NTPA 3T9GA 1KTWA 1JRGA 4I84A 5C1CA 4XLHA 2IOUG 4NK8A 2QY1A 3GRHA 2BM6A 2X3HA 4XL9A 2XC1A 5AMVA 4Z05A 3BH6B 4YZQA 4YZXA 4YZ0A 2O0WA 1BN8A 1VBLA 1X0CA 3TH0A 3SUCA 1K5CA 1IA5A 1O8GA 1PXZA 3VSVA 1LLWA 2UVEA 2BM7A 2PYGA 4XLAA 2W7ZA 1OFMA 1QQ1A 4YEJA 2O04A 3BH7B 3N90A 4YZAA 3PSZA 4PMHA 1CZFA 3FY3A 1TYWA 2O0VA 4XQFA 1AIRA 2ODLA 2IQ7A 1K4ZA 4OPWA 3B8YA 1RMGA 4XOPA 3UW0A 1IDKA 1IDJA 1O8JA 2O6WA 2VJJA 4XKVA 1TYUA 4XN3A 5C1EA 1KCDA 1RU4A 2PYHA
chains in the Genus database with same CATH topology
1IB4A 4OZZA 2X6XA 2VBEA 4HWVA 4U49A 2O1DA 3VMWA 4OJ5A 4W8SA 1OFLA 1QJVA 4XNFA 2NSTA 1NHCA 3LMWA 1O8FA 3VSUA 1GQ8A 2X6WA 1O88A 3VMVA 4MR0A 1QCXA 1PLUA 4XORA 1O8MA 2INUA 3B4NA 2EWEA 2NSPA 2INVA 4OJLA 3VSTA 2X6YA 2NTBA 4W8QA 2BSPA 1XG2A 4C2LA 3KRGA 2PECA 1JTAA 1OGMX 4XLFA 3JURA 3ZSCA 4NK6A 1DBOA 1OGOX 1O8IA 2X85A 1PE9A 1O8LA 4XM3A 2NZMA 2VBKA 2NT9A 1OOCA 4U4BA 4XR6A 1O8KA 4AVZA 2QXZA 2NTQA 1O8HA 1BHEA 4XQFA 3GQ9A 4XKWA 4XN0A 4Z06A 2VBMA 4YELA 3ZPPA 1DBGA 4EW9A 2QX3A 1WMRA 3GQ8A 4W8RA 4XMYA 3B90A 4XLCA 4MXNA 1RWRA 4OJPA 4OJOA 4Z03A 4XLEA 1O8DA 3GQAA 2Z8GA 2NT6A 1H80A 3GQ7A 4OZYA 4URRA 4XOTA 3EQOA 1KCCA 2O17A 4OJ6A 1O8EA 1HG8A 4XONA 4W8TA 3WWGA 2UVFA 3EQNA 2VJIA 1EE6A 2NTPA 3T9GA 1KTWA 1JRGA 4I84A 5C1CA 4XLHA 4NK8A 2QY1A 3GRHA 4XL9A 2X3HA 5AMVA 4Z05A 4YZXA 4YZQA 4YZ0A 2O0WA 1BN8A 1VBLA 1X0CA 3SUCA 1K5CA 1IA5A 1O8GA 1PXZA 3VSVA 2UVEA 2PYGA 4XLAA 1OFMA 4YEJA 2O04A 4YZAA 4PMHA 1CZFA 3FY3A 2O0VA 1AIRA 2ODLA 2IQ7A 3B8YA 1RMGA 4XOPA 3UW0A 1IDKA 1IDJA 1O8JA 2VJJA 4XKVA 4XN3A 5C1EA 1KCDA 1RU4A 2PYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IB4 A;  4OZZ A;  2X6X A;  2VBE A;  4HWV A;  4U49 A;  2O1D A;  3VMW A;  4OJ5 A;  4W8S A;  1OFL A;  1QJV A;  4XNF A;  2NST A;  1NHC A;  3LMW A;  1O8F A;  3VSU A;  1GQ8 A;  2X6W A;  1O88 A;  3VMV A;  4MR0 A;  1QCX A;  1PLU A;  4XOR A;  1O8M A;  2INU A;  3B4N A;  2EWE A;  2NSP A;  2INV A;  4OJL A;  3VST A;  2X6Y A;  2NTB A;  4W8Q A;  2BSP A;  1XG2 A;  4C2L A;  3KRG A;  2PEC A;  1JTA A;  1OGM X;  4XLF A;  3JUR A;  3ZSC A;  4NK6 A;  1DBO A;  1OGO X;  1O8I A;  2X85 A;  1PE9 A;  1O8L A;  4XM3 A;  2NZM A;  2VBK A;  2NT9 A;  1OOC A;  4U4B A;  4XR6 A;  1O8K A;  4AVZ A;  2QXZ A;  2NTQ A;  1O8H A;  1BHE A;  4XQF A;  3GQ9 A;  4XKW A;  4XN0 A;  4Z06 A;  2VBM A;  4YEL A;  3ZPP A;  1DBG A;  4EW9 A;  2QX3 A;  1WMR A;  3GQ8 A;  4W8R A;  4XMY A;  3B90 A;  4XLC A;  4MXN A;  1RWR A;  4OJP A;  4OJO A;  4Z03 A;  4XLE A;  1O8D A;  3GQA A;  2Z8G A;  2NT6 A;  1H80 A;  3GQ7 A;  4OZY A;  4URR A;  4XOT A;  3EQO A;  1KCC A;  2O17 A;  4OJ6 A;  1O8E A;  1HG8 A;  4XON A;  4W8T A;  3WWG A;  2UVF A;  3EQN A;  2VJI A;  1EE6 A;  2NTP A;  3T9G A;  1KTW A;  1JRG A;  4I84 A;  5C1C A;  4XLH A;  4NK8 A;  2QY1 A;  3GRH A;  4XL9 A;  2X3H A;  5AMV A;  4Z05 A;  4YZX A;  4YZQ A;  4YZ0 A;  2O0W A;  1BN8 A;  1VBL A;  1X0C A;  3SUC A;  1K5C A;  1IA5 A;  1O8G A;  1PXZ A;  3VSV A;  2UVE A;  2PYG A;  4XLA A;  1OFM A;  4YEJ A;  2O04 A;  4YZA A;  4PMH A;  1CZF A;  3FY3 A;  2O0V A;  1AIR A;  2ODL A;  2IQ7 A;  3B8Y A;  1RMG A;  4XOP A;  3UW0 A;  1IDK A;  1IDJ A;  1O8J A;  2VJJ A;  4XKV A;  4XN3 A;  5C1E A;  1KCD A;  1RU4 A;  2PYH A; 
#chains in the Genus database with same CATH topology
 1IB4 A;  3AK5 A;  1LLZ A;  3LJY A;  2BM4 A;  4OZZ A;  2XTX A;  3SQV A;  2X6X A;  4YEI A;  2VBE A;  4HWV A;  4U49 A;  1QRB A;  2J8K A;  2O1D A;  3VMW A;  1QA2 A;  4OJ5 A;  4W8S A;  1OFL A;  1QJV A;  1OFD A;  4XNF A;  2NST A;  1NHC A;  3LMW A;  1O8F A;  1DAB A;  2VFO A;  3NAW A;  3H09 A;  3VSU A;  1GQ8 A;  1QRC A;  2X6W A;  1O88 A;  2VFM A;  3VMV A;  4MR0 A;  1QCX A;  1PLU A;  4XOR A;  1O8M A;  2INU A;  3B4N A;  2EWE A;  2NSP A;  2INV A;  1CLW A;  4OJL A;  3VST A;  2X6Y A;  3SZE A;  2NTB A;  2VFQ A;  4W8Q A;  2BSP A;  3RIQ A;  1XG2 A;  4C2L A;  2F3L A;  3KRG A;  1TSP A;  2PEC A;  1JTA A;  1OGM X;  4XLF A;  4YC5 A;  3JUR A;  3ZSC A;  4NK6 A;  1DBO A;  3NB2 A;  1OGO X;  1O8I A;  2B0R A;  2X85 A;  1PE9 A;  2VFN A;  1L1I A;  2V5I A;  1O8L A;  4XM3 A;  3SY2 A;  2XT2 A;  3JX8 A;  2NZM A;  2VBK A;  3P4G A;  1EA0 A;  2NT9 A;  1OOC A;  4U4B A;  4XR6 A;  1O8K A;  4AVZ A;  2QXZ A;  1K8F A;  1O8H A;  1BHE A;  2BM5 A;  2NTQ A;  1HF2 A;  2QYU A;  2VFP A;  4JRA C;  4YFO A;  3GQ9 A;  4XKW A;  3DU1 X;  3N6Z A;  4XN0 A;  4Z06 A;  2VBM A;  2XTW A;  4YDT A;  4YEL A;  3ZPP A;  1DBG A;  1EZG A;  1OFE A;  4EW9 A;  2QX3 A;  5DNS A;  1WMR A;  3GQ8 A;  5JLV C;  2J8I A;  4W8R A;  4XMY A;  1QA1 A;  3B90 A;  4XLC A;  4KH3 A;  4MXN A;  1WXR A;  2XT4 A;  5JMC B;  1RWR A;  1LM1 A;  3SYJ A;  4OJP A;  4OJO A;  4Z03 A;  4XLE A;  4V02 C;  1TYX A;  2XTY A;  1O8D A;  2YUH A;  3GQA A;  2Z8G A;  2NT6 A;  2BX6 A;  1H80 A;  3GQ7 A;  4OZY A;  4URR A;  4YCQ A;  2G0Y A;  4XOT A;  2QZA A;  3EQO A;  1TYV A;  3LYC A;  1KCC A;  2O17 A;  3ML3 A;  4OJ6 A;  1QA3 A;  1O8E A;  1HG8 A;  3PET A;  4XON A;  4W8T A;  3WWG A;  2UVF A;  1KQ5 A;  3EQN A;  3PSS A;  2VJI A;  1EE6 A;  4OM9 A;  2NTP A;  3T9G A;  1KTW A;  1JRG A;  4I84 A;  5C1C A;  4XLH A;  2IOU G;  4NK8 A;  2QY1 A;  3GRH A;  2BM6 A;  2X3H A;  4XL9 A;  2XC1 A;  5AMV A;  4Z05 A;  3BH6 B;  4YZQ A;  4YZX A;  4YZ0 A;  2O0W A;  1BN8 A;  1VBL A;  1X0C A;  3TH0 A;  3SUC A;  1K5C A;  1IA5 A;  1O8G A;  1PXZ A;  3VSV A;  1LLW A;  2UVE A;  2BM7 A;  2PYG A;  4XLA A;  2W7Z A;  1OFM A;  1QQ1 A;  4YEJ A;  2O04 A;  3BH7 B;  3N90 A;  4YZA A;  3PSZ A;  4PMH A;  1CZF A;  3FY3 A;  1TYW A;  2O0V A;  4XQF A;  1AIR A;  2ODL A;  2IQ7 A;  1K4Z A;  4OPW A;  3B8Y A;  1RMG A;  4XOP A;  3UW0 A;  1IDK A;  1IDJ A;  1O8J A;  2O6W A;  2VJJ A;  4XKV A;  1TYU A;  4XN3 A;  5C1E A;  1KCD A;  1RU4 A;  2PYH A; 
#chains in the Genus database with same CATH homology
 1IB4 A;  4OZZ A;  2X6X A;  2VBE A;  4HWV A;  4U49 A;  2O1D A;  3VMW A;  4OJ5 A;  4W8S A;  1OFL A;  1QJV A;  4XNF A;  2NST A;  1NHC A;  3LMW A;  1O8F A;  3VSU A;  1GQ8 A;  2X6W A;  1O88 A;  3VMV A;  4MR0 A;  1QCX A;  1PLU A;  4XOR A;  1O8M A;  2INU A;  3B4N A;  2EWE A;  2NSP A;  2INV A;  4OJL A;  3VST A;  2X6Y A;  2NTB A;  4W8Q A;  2BSP A;  1XG2 A;  4C2L A;  3KRG A;  2PEC A;  1JTA A;  1OGM X;  4XLF A;  3JUR A;  3ZSC A;  4NK6 A;  1DBO A;  1OGO X;  1O8I A;  2X85 A;  1PE9 A;  1O8L A;  4XM3 A;  2NZM A;  2VBK A;  2NT9 A;  1OOC A;  4U4B A;  4XR6 A;  1O8K A;  4AVZ A;  2QXZ A;  2NTQ A;  1O8H A;  1BHE A;  4XQF A;  3GQ9 A;  4XKW A;  4XN0 A;  4Z06 A;  2VBM A;  4YEL A;  3ZPP A;  1DBG A;  4EW9 A;  2QX3 A;  1WMR A;  3GQ8 A;  4W8R A;  4XMY A;  3B90 A;  4XLC A;  4MXN A;  1RWR A;  4OJP A;  4OJO A;  4Z03 A;  4XLE A;  1O8D A;  3GQA A;  2Z8G A;  2NT6 A;  1H80 A;  3GQ7 A;  4OZY A;  4URR A;  4XOT A;  3EQO A;  1KCC A;  2O17 A;  4OJ6 A;  1O8E A;  1HG8 A;  4XON A;  4W8T A;  3WWG A;  2UVF A;  3EQN A;  2VJI A;  1EE6 A;  2NTP A;  3T9G A;  1KTW A;  1JRG A;  4I84 A;  5C1C A;  4XLH A;  4NK8 A;  2QY1 A;  3GRH A;  4XL9 A;  2X3H A;  5AMV A;  4Z05 A;  4YZX A;  4YZQ A;  4YZ0 A;  2O0W A;  1BN8 A;  1VBL A;  1X0C A;  3SUC A;  1K5C A;  1IA5 A;  1O8G A;  1PXZ A;  3VSV A;  2UVE A;  2PYG A;  4XLA A;  1OFM A;  4YEJ A;  2O04 A;  4YZA A;  4PMH A;  1CZF A;  3FY3 A;  2O0V A;  1AIR A;  2ODL A;  2IQ7 A;  3B8Y A;  1RMG A;  4XOP A;  3UW0 A;  1IDK A;  1IDJ A;  1O8J A;  2VJJ A;  4XKV A;  4XN3 A;  5C1E A;  1KCD A;  1RU4 A;  2PYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...