5C1CA

Crystal structure of the pectin methylesterase from aspergillus niger in deglycosylated form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
299
structure length
299
Chain Sequence
b'ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGDLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
total genus 111
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1cA00
2QXZA 1JRGA 3JURA 3VMVA 2EWEA 3B8YA 4XLFA 2X6YA 4OJ5A 4XLAA 2PYHA 4W8SA 1RWRA 1PXZA 1O8KA 1OGOX 4W8RA 3VSTA 4HWVA 1KCCA 1VBLA 3GQ7A 1WMRA 3SUCA 3T9GA 2X6WA 4YZ0A 1AIRA 1H80A 1IDJA 1JTAA 1KTWA 1IDKA 3LMWA 2X6XA 4XL9A 2NTPA 4YELA 4W8QA 2NSTA 4XLEA 1O8HA 4OZZA 4XOTA 4I84A 2NT6A 4U4BA 1QCXA 1HG8A 2INUA 4XQFA 3GQ9A 1O8JA 1BN8A 4XR6A 2PECA 1BHEA 3KRGA 5C1EA 4XONA 2O17A 1RMGA 4PMHA 4EW9A 4C2LA 2NTBA 1IA5A 2VBEA 1NHCA 3UW0A 2QX3A 5AMVA 1CZFA 4YZQA 4XM3A 1O8DA 1O8FA 2NTQA 2O0WA 2X3HA 1OFMA 2INVA 1O8MA 1O8GA 2NT9A 3GQAA 4Z06A 2X85A 4XN3A 4Z03A 4Z05A 3VSUA 1EE6A 4W8TA 2UVFA 2BSPA 1K5CA 2ODLA 1O8LA 3GRHA 3ZSCA 2Z8GA 1DBGA 4YEJA 2NZMA 4MR0A 2VBKA 1GQ8A 1O8IA 4OJOA 4XKWA 3VMWA 1RU4A 2PYGA 4YZAA 2O0VA 4XOPA 4XNFA 1XG2A 3GQ8A 1OFLA 4XORA 3WWGA 1KCDA 4NK8A 3B4NA 4XLCA 1PLUA 4OJPA 4U49A 4AVZA 1O8EA 1OGMX 1X0CA 4OJLA 4OZYA 2UVEA 3ZPPA 4OJ6A 2O1DA 1IB4A 4XLHA 1DBOA 4XMYA 5C1CA 3B90A 2VJJA 4XKVA 4XN0A 4NK6A 3VSVA 1PE9A 1OOCA 1QJVA 2NSPA 2VJIA 4URRA 2VBMA 4MXNA 2QY1A 1O88A 4YZXA 3FY3A 3EQOA 3EQNA 2IQ7A 2O04A
chains in the Genus database with same CATH superfamily
2QXZA 1JRGA 3JURA 1TYUA 3VMVA 1TYXA 3BH6B 3N6ZA 2EWEA 3B8YA 3N90A 5JMCB 2XTYA 4XLFA 2X6YA 4OJ5A 2XT2A 4V02C 1QRBA 2V5IA 4OM9A 4XLAA 1QA3A 2PYHA 1OFDA 4W8SA 1RWRA 1PXZA 1O8KA 1OGOX 4KH3A 4W8RA 3VSTA 5DNSA 2VFNA 4HWVA 1KCCA 2BM5A 1VBLA 3GQ7A 1WMRA 3SUCA 3T9GA 1KQ5A 3SQVA 2X6WA 4YZ0A 4YEIA 2QZAA 1AIRA 1H80A 1IDJA 1JTAA 1K4ZA 1IDKA 1KTWA 2G0YA 2J8IA 3LMWA 2X6XA 4JRAC 4XL9A 2F3LA 4YCQA 1WXRA 2XT4A 2NTPA 4YELA 4W8QA 2NSTA 4XLEA 3PSZA 4YFOA 1O8HA 4OZZA 4XOTA 4I84A 2NT6A 4U4BA 1QCXA 1HG8A 1TYVA 2INUA 2XTXA 3PSSA 3GQ9A 4XQFA 1O8JA 1BN8A 4XR6A 2BM6A 1BHEA 1QQ1A 2PECA 3KRGA 5C1EA 4XONA 2O17A 4YC5A 1RMGA 4PMHA 1L1IA 4EW9A 2BM7A 4C2LA 2NTBA 1IA5A 3TH0A 2VBEA 1DABA 1NHCA 1QRCA 3UW0A 2QX3A 5AMVA 1CZFA 4YZQA 4XM3A 1O8FA 1O8DA 1K8FA 2NTQA 2O0WA 2X3HA 1OFMA 2INVA 1O8MA 1O8GA 2NT9A 3BH7B 3GQAA 2X85A 3H09A 4XN3A 4Z03A 3JX8A 3LJYA 3VSUA 1EE6A 3P4GA 4W8TA 4Z05A 5JLVC 1OFEA 2BSPA 2UVFA 1K5CA 2ODLA 1O8LA 3GRHA 2VFOA 3PETA 3ZSCA 2Z8GA 1DBGA 4YEJA 3DU1X 2NZMA 4MR0A 2VBKA 2J8KA 1QA2A 1GQ8A 2VFQA 1O8IA 2XTWA 4OJOA 4XKWA 3RIQA 3VMWA 1RU4A 2PYGA 1TYWA 2O0VA 3NAWA 4YZAA 4XOPA 4XNFA 2BX6A 1XG2A 1HF2A 3GQ8A 1OFLA 2W7ZA 4XORA 3WWGA 1KCDA 4NK8A 3B4NA 4XLCA 3SZEA 2VFMA 1PLUA 2VFPA 4OPWA 4OJPA 2BM4A 4U49A 1O8EA 4AVZA 2B0RA 1LLWA 1OGMX 2YUHA 1CLWA 1X0CA 3ML3A 4OJLA 1QA1A 4OZYA 2UVEA 3LYCA 3SYJA 3ZPPA 4OJ6A 2O1DA 1IB4A 4XLHA 1DBOA 4XMYA 1TSPA 2O6WA 5C1CA 3B90A 2VJJA 1EA0A 4XKVA 2QYUA 4XN0A 1LLZA 4Z06A 4NK6A 2IOUG 3VSVA 1PE9A 1OOCA 1QJVA 2NSPA 2VJIA 4URRA 3SY2A 2VBMA 4MXNA 2QY1A 1O88A 2XC1A 4YZXA 3FY3A 1LM1A 3EQOA 3EQNA 4YDTA 2IQ7A 1EZGA 3AK5A 3NB2A 2O04A
chains in the Genus database with same CATH topology
2QXZA 1JRGA 3JURA 3VMVA 2EWEA 3B8YA 4XLFA 2X6YA 4OJ5A 4XLAA 2PYHA 4W8SA 1RWRA 1PXZA 1O8KA 1OGOX 4W8RA 3VSTA 4HWVA 1KCCA 1VBLA 3GQ7A 1WMRA 3SUCA 3T9GA 2X6WA 4YZ0A 1AIRA 1H80A 1IDJA 1JTAA 1KTWA 1IDKA 3LMWA 2X6XA 4XL9A 2NTPA 4YELA 4W8QA 2NSTA 4XLEA 1O8HA 4OZZA 4XOTA 4I84A 2NT6A 4U4BA 1QCXA 1HG8A 2INUA 4XQFA 3GQ9A 1O8JA 1BN8A 4XR6A 2PECA 1BHEA 3KRGA 5C1EA 4XONA 2O17A 1RMGA 4PMHA 4EW9A 4C2LA 2NTBA 1IA5A 2VBEA 1NHCA 3UW0A 2QX3A 5AMVA 1CZFA 4YZQA 4XM3A 1O8DA 1O8FA 2NTQA 2O0WA 2X3HA 1OFMA 2INVA 1O8MA 1O8GA 2NT9A 3GQAA 4Z06A 2X85A 4XN3A 4Z03A 4Z05A 3VSUA 1EE6A 4W8TA 2UVFA 2BSPA 1K5CA 2ODLA 1O8LA 3GRHA 3ZSCA 2Z8GA 1DBGA 4YEJA 2NZMA 4MR0A 2VBKA 1GQ8A 1O8IA 4OJOA 4XKWA 3VMWA 1RU4A 2PYGA 4YZAA 2O0VA 4XOPA 4XNFA 1XG2A 3GQ8A 1OFLA 4XORA 3WWGA 1KCDA 4NK8A 3B4NA 4XLCA 1PLUA 4OJPA 4U49A 4AVZA 1O8EA 1OGMX 1X0CA 4OJLA 4OZYA 2UVEA 3ZPPA 4OJ6A 2O1DA 1IB4A 4XLHA 1DBOA 4XMYA 5C1CA 3B90A 2VJJA 4XKVA 4XN0A 4NK6A 3VSVA 1PE9A 1OOCA 1QJVA 2NSPA 2VJIA 4URRA 2VBMA 4MXNA 2QY1A 1O88A 4YZXA 3FY3A 3EQOA 3EQNA 2IQ7A 2O04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXZ A;  1JRG A;  3JUR A;  3VMV A;  2EWE A;  3B8Y A;  4XLF A;  2X6Y A;  4OJ5 A;  4XLA A;  2PYH A;  4W8S A;  1RWR A;  1PXZ A;  1O8K A;  1OGO X;  4W8R A;  3VST A;  4HWV A;  1KCC A;  1VBL A;  3GQ7 A;  1WMR A;  3SUC A;  3T9G A;  2X6W A;  4YZ0 A;  1AIR A;  1H80 A;  1IDJ A;  1JTA A;  1KTW A;  1IDK A;  3LMW A;  2X6X A;  4XL9 A;  2NTP A;  4YEL A;  4W8Q A;  2NST A;  4XLE A;  1O8H A;  4OZZ A;  4XOT A;  4I84 A;  2NT6 A;  4U4B A;  1QCX A;  1HG8 A;  2INU A;  4XQF A;  3GQ9 A;  1O8J A;  1BN8 A;  4XR6 A;  2PEC A;  1BHE A;  3KRG A;  5C1E A;  4XON A;  2O17 A;  1RMG A;  4PMH A;  4EW9 A;  4C2L A;  2NTB A;  1IA5 A;  2VBE A;  1NHC A;  3UW0 A;  2QX3 A;  5AMV A;  1CZF A;  4YZQ A;  4XM3 A;  1O8D A;  1O8F A;  2NTQ A;  2O0W A;  2X3H A;  1OFM A;  2INV A;  1O8M A;  1O8G A;  2NT9 A;  3GQA A;  4Z06 A;  2X85 A;  4XN3 A;  4Z03 A;  4Z05 A;  3VSU A;  1EE6 A;  4W8T A;  2UVF A;  2BSP A;  1K5C A;  2ODL A;  1O8L A;  3GRH A;  3ZSC A;  2Z8G A;  1DBG A;  4YEJ A;  2NZM A;  4MR0 A;  2VBK A;  1GQ8 A;  1O8I A;  4OJO A;  4XKW A;  3VMW A;  1RU4 A;  2PYG A;  4YZA A;  2O0V A;  4XOP A;  4XNF A;  1XG2 A;  3GQ8 A;  1OFL A;  4XOR A;  3WWG A;  1KCD A;  4NK8 A;  3B4N A;  4XLC A;  1PLU A;  4OJP A;  4U49 A;  4AVZ A;  1O8E A;  1OGM X;  1X0C A;  4OJL A;  4OZY A;  2UVE A;  3ZPP A;  4OJ6 A;  2O1D A;  1IB4 A;  4XLH A;  1DBO A;  4XMY A;  5C1C A;  3B90 A;  2VJJ A;  4XKV A;  4XN0 A;  4NK6 A;  3VSV A;  1PE9 A;  1OOC A;  1QJV A;  2NSP A;  2VJI A;  4URR A;  2VBM A;  4MXN A;  2QY1 A;  1O88 A;  4YZX A;  3FY3 A;  3EQO A;  3EQN A;  2IQ7 A;  2O04 A; 
#chains in the Genus database with same CATH topology
 2QXZ A;  1JRG A;  3JUR A;  1TYU A;  3VMV A;  1TYX A;  3BH6 B;  3N6Z A;  2EWE A;  3B8Y A;  3N90 A;  5JMC B;  2XTY A;  4XLF A;  2X6Y A;  4OJ5 A;  2XT2 A;  4V02 C;  1QRB A;  2V5I A;  4OM9 A;  4XLA A;  1QA3 A;  2PYH A;  1OFD A;  4W8S A;  1RWR A;  1PXZ A;  1O8K A;  1OGO X;  4KH3 A;  4W8R A;  3VST A;  5DNS A;  2VFN A;  4HWV A;  1KCC A;  2BM5 A;  1VBL A;  3GQ7 A;  1WMR A;  3SUC A;  3T9G A;  1KQ5 A;  3SQV A;  2X6W A;  4YZ0 A;  4YEI A;  2QZA A;  1AIR A;  1H80 A;  1IDJ A;  1JTA A;  1K4Z A;  1IDK A;  1KTW A;  2G0Y A;  2J8I A;  3LMW A;  2X6X A;  4JRA C;  4XL9 A;  2F3L A;  4YCQ A;  1WXR A;  2XT4 A;  2NTP A;  4YEL A;  4W8Q A;  2NST A;  4XLE A;  3PSZ A;  4YFO A;  1O8H A;  4OZZ A;  4XOT A;  4I84 A;  2NT6 A;  4U4B A;  1QCX A;  1HG8 A;  1TYV A;  2INU A;  2XTX A;  3PSS A;  3GQ9 A;  4XQF A;  1O8J A;  1BN8 A;  4XR6 A;  2BM6 A;  1BHE A;  1QQ1 A;  2PEC A;  3KRG A;  5C1E A;  4XON A;  2O17 A;  4YC5 A;  1RMG A;  4PMH A;  1L1I A;  4EW9 A;  2BM7 A;  4C2L A;  2NTB A;  1IA5 A;  3TH0 A;  2VBE A;  1DAB A;  1NHC A;  1QRC A;  3UW0 A;  2QX3 A;  5AMV A;  1CZF A;  4YZQ A;  4XM3 A;  1O8F A;  1O8D A;  1K8F A;  2NTQ A;  2O0W A;  2X3H A;  1OFM A;  2INV A;  1O8M A;  1O8G A;  2NT9 A;  3BH7 B;  3GQA A;  2X85 A;  3H09 A;  4XN3 A;  4Z03 A;  3JX8 A;  3LJY A;  3VSU A;  1EE6 A;  3P4G A;  4W8T A;  4Z05 A;  5JLV C;  1OFE A;  2BSP A;  2UVF A;  1K5C A;  2ODL A;  1O8L A;  3GRH A;  2VFO A;  3PET A;  3ZSC A;  2Z8G A;  1DBG A;  4YEJ A;  3DU1 X;  2NZM A;  4MR0 A;  2VBK A;  2J8K A;  1QA2 A;  1GQ8 A;  2VFQ A;  1O8I A;  2XTW A;  4OJO A;  4XKW A;  3RIQ A;  3VMW A;  1RU4 A;  2PYG A;  1TYW A;  2O0V A;  3NAW A;  4YZA A;  4XOP A;  4XNF A;  2BX6 A;  1XG2 A;  1HF2 A;  3GQ8 A;  1OFL A;  2W7Z A;  4XOR A;  3WWG A;  1KCD A;  4NK8 A;  3B4N A;  4XLC A;  3SZE A;  2VFM A;  1PLU A;  2VFP A;  4OPW A;  4OJP A;  2BM4 A;  4U49 A;  1O8E A;  4AVZ A;  2B0R A;  1LLW A;  1OGM X;  2YUH A;  1CLW A;  1X0C A;  3ML3 A;  4OJL A;  1QA1 A;  4OZY A;  2UVE A;  3LYC A;  3SYJ A;  3ZPP A;  4OJ6 A;  2O1D A;  1IB4 A;  4XLH A;  1DBO A;  4XMY A;  1TSP A;  2O6W A;  5C1C A;  3B90 A;  2VJJ A;  1EA0 A;  4XKV A;  2QYU A;  4XN0 A;  1LLZ A;  4Z06 A;  4NK6 A;  2IOU G;  3VSV A;  1PE9 A;  1OOC A;  1QJV A;  2NSP A;  2VJI A;  4URR A;  3SY2 A;  2VBM A;  4MXN A;  2QY1 A;  1O88 A;  2XC1 A;  4YZX A;  3FY3 A;  1LM1 A;  3EQO A;  3EQN A;  4YDT A;  2IQ7 A;  1EZG A;  3AK5 A;  3NB2 A;  2O04 A; 
#chains in the Genus database with same CATH homology
 2QXZ A;  1JRG A;  3JUR A;  3VMV A;  2EWE A;  3B8Y A;  4XLF A;  2X6Y A;  4OJ5 A;  4XLA A;  2PYH A;  4W8S A;  1RWR A;  1PXZ A;  1O8K A;  1OGO X;  4W8R A;  3VST A;  4HWV A;  1KCC A;  1VBL A;  3GQ7 A;  1WMR A;  3SUC A;  3T9G A;  2X6W A;  4YZ0 A;  1AIR A;  1H80 A;  1IDJ A;  1JTA A;  1KTW A;  1IDK A;  3LMW A;  2X6X A;  4XL9 A;  2NTP A;  4YEL A;  4W8Q A;  2NST A;  4XLE A;  1O8H A;  4OZZ A;  4XOT A;  4I84 A;  2NT6 A;  4U4B A;  1QCX A;  1HG8 A;  2INU A;  4XQF A;  3GQ9 A;  1O8J A;  1BN8 A;  4XR6 A;  2PEC A;  1BHE A;  3KRG A;  5C1E A;  4XON A;  2O17 A;  1RMG A;  4PMH A;  4EW9 A;  4C2L A;  2NTB A;  1IA5 A;  2VBE A;  1NHC A;  3UW0 A;  2QX3 A;  5AMV A;  1CZF A;  4YZQ A;  4XM3 A;  1O8D A;  1O8F A;  2NTQ A;  2O0W A;  2X3H A;  1OFM A;  2INV A;  1O8M A;  1O8G A;  2NT9 A;  3GQA A;  4Z06 A;  2X85 A;  4XN3 A;  4Z03 A;  4Z05 A;  3VSU A;  1EE6 A;  4W8T A;  2UVF A;  2BSP A;  1K5C A;  2ODL A;  1O8L A;  3GRH A;  3ZSC A;  2Z8G A;  1DBG A;  4YEJ A;  2NZM A;  4MR0 A;  2VBK A;  1GQ8 A;  1O8I A;  4OJO A;  4XKW A;  3VMW A;  1RU4 A;  2PYG A;  4YZA A;  2O0V A;  4XOP A;  4XNF A;  1XG2 A;  3GQ8 A;  1OFL A;  4XOR A;  3WWG A;  1KCD A;  4NK8 A;  3B4N A;  4XLC A;  1PLU A;  4OJP A;  4U49 A;  4AVZ A;  1O8E A;  1OGM X;  1X0C A;  4OJL A;  4OZY A;  2UVE A;  3ZPP A;  4OJ6 A;  2O1D A;  1IB4 A;  4XLH A;  1DBO A;  4XMY A;  5C1C A;  3B90 A;  2VJJ A;  4XKV A;  4XN0 A;  4NK6 A;  3VSV A;  1PE9 A;  1OOC A;  1QJV A;  2NSP A;  2VJI A;  4URR A;  2VBM A;  4MXN A;  2QY1 A;  1O88 A;  4YZX A;  3FY3 A;  3EQO A;  3EQN A;  2IQ7 A;  2O04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...