5C1CA

Crystal structure of the pectin methylesterase from aspergillus niger in deglycosylated form
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGDLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
molecule keywords Pectinesterase
total genus 111
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1cA00
1OFLA 4XN3A 3UW0A 4NK6A 2QY1A 3B8YA 2X3HA 1JTAA 3GQ9A 3GQAA 3VSTA 1HG8A 4XLHA 2QX3A 3B4NA 1O8DA 3JURA 4HWVA 1O8JA 3EQNA 1VBLA 1RU4A 2NTQA 4URRA 1OGOX 4YZAA 3VSVA 4W8QA 1BN8A 3ZSCA 3SUCA 4OJPA 1O8HA 4OJLA 4OJ5A 2VJIA 5AMVA 4OJOA 5C1EA 3VMVA 1OOCA 2NTPA 3GRHA 1KCCA 1O8GA 2NSTA 4YZQA 4XM3A 4EW9A 1PXZA 1PLUA 4MR0A 4OZYA 1O8IA 1OGMX 4XKVA 2ODLA 2IQ7A 1OFMA 4YELA 4YEJA 4U49A 1O8LA 4XOPA 1IA5A 1JRGA 4XLEA 2X85A 4XR6A 2NSPA 3EQOA 2UVFA 1O8FA 3VMWA 2O17A 2EWEA 4XMYA 2O04A 1KTWA 2NTBA 4XNFA 4AVZA 1AIRA 4XOTA 2O1DA 1DBOA 4XKWA 4Z06A 4YZ0A 1DBGA 1WMRA 4W8SA 4XONA 4XORA 1IDJA 3GQ8A 1XG2A 4W8TA 2NZMA 4XLCA 2O0VA 2PYHA 2VBKA 4U4BA 4OJ6A 1QJVA 1RWRA 3WWGA 2INUA 4PMHA 4W8RA 2NT9A 4MXNA 4XQFA 2O0WA 2PYGA 4Z05A 4Z03A 5C1CA 4I84A 2VJJA 1EE6A 1O8EA 3VSUA 2PECA 1X0CA 2VBMA 4XLAA 1CZFA 1O8KA 1O88A 3B90A 1PE9A 4OZZA 1O8MA 4C2LA 2X6XA 1QCXA 1K5CA 2NT6A 1KCDA 2UVEA 4XN0A 3LMWA 1IB4A 4XL9A 4XLFA 1BHEA 2Z8GA 3FY3A 4NK8A 4YZXA 2X6YA 2INVA 1RMGA 2VBEA 3ZPPA 3GQ7A 1H80A 1GQ8A 2X6WA 1NHCA 3KRGA 1IDKA 3T9GA 2BSPA 2QXZA
chains in the Genus database with same CATH superfamily
1QA3A 1K8FA 1OFLA 1LM1A 4XN3A 3UW0A 4NK6A 2QY1A 2XTXA 3B8YA 2X3HA 3SY2A 1WXRA 2VFPA 1JTAA 3GQ9A 1EA0A 3PETA 3GQAA 3VSTA 1HG8A 4XLHA 2QX3A 3B4NA 1O8DA 3JURA 4HWVA 2W7ZA 1O8JA 4KH3A 3EQNA 1VBLA 1RU4A 2BM5A 5JMCB 2NTQA 4URRA 1OGOX 4YZAA 3SZEA 3VSVA 4W8QA 1QA2A 1BN8A 3ZSCA 3SUCA 1K4ZA 3AK5A 4OJPA 1O8HA 2J8KA 4OJLA 4OJ5A 2VJIA 5AMVA 2YUHA 1TYWA 4OJOA 3NAWA 5C1EA 3VMVA 4V02C 3TH0A 1OOCA 1QRBA 2NTPA 3GRHA 1KCCA 1O8GA 2NSTA 4YZQA 4XM3A 4EW9A 1PXZA 1TSPA 2XC1A 1LLZA 1PLUA 2VFQA 4MR0A 4OZYA 1O8IA 1OGMX 3NB2A 3SYJA 4XKVA 2ODLA 2IQ7A 1HF2A 2IOUG 5DNSA 1OFMA 4YELA 1EZGA 4YEJA 4JRAC 4U49A 4YC5A 1O8LA 2V5IA 4XOPA 4YEIA 1IA5A 1JRGA 4XLEA 2X85A 4XR6A 2NSPA 3EQOA 2UVFA 1O8FA 3VMWA 2O17A 2EWEA 3N90A 2O04A 4XMYA 2QZAA 1KTWA 2QYUA 1CLWA 2NTBA 4XNFA 4AVZA 1AIRA 3H09A 1TYVA 4XOTA 2O1DA 1DBOA 2F3LA 4XKWA 4Z06A 4YZ0A 1DBGA 1WMRA 4W8SA 4XONA 4XORA 2XTYA 2XT4A 1IDJA 3GQ8A 3LJYA 1XG2A 4W8TA 2NZMA 4XLCA 2O0VA 2PYHA 2VBKA 4U4BA 4OJ6A 1QJVA 1RWRA 3SQVA 1L1IA 4YCQA 3WWGA 1TYUA 3BH7B 3LYCA 2INUA 4OPWA 2O6WA 4PMHA 2BM6A 4OM9A 2NT9A 3N6ZA 4MXNA 4W8RA 1DABA 1QA1A 4XQFA 2VFNA 3BH6B 2O0WA 2PYGA 3ML3A 2XT2A 4Z03A 4Z05A 4I84A 5C1CA 2VJJA 2XTWA 2VFOA 1EE6A 1O8EA 3VSUA 2PECA 1X0CA 2VBMA 4XLAA 1QRCA 2G0YA 1CZFA 1O8KA 1O88A 1PE9A 1KQ5A 3B90A 4OZZA 1QQ1A 1O8MA 4YDTA 2X6XA 4C2LA 1QCXA 3PSSA 5JLVC 1K5CA 2NT6A 1KCDA 2VFMA 2UVEA 3PSZA 3LMWA 1OFDA 4XN0A 1IB4A 2BX6A 3JX8A 2BM4A 4XL9A 4YFOA 4XLFA 1BHEA 2Z8GA 3FY3A 4NK8A 1TYXA 3DU1X 4YZXA 2B0RA 2X6YA 2INVA 1RMGA 2VBEA 3ZPPA 3GQ7A 1H80A 2BM7A 1LLWA 2J8IA 1GQ8A 2X6WA 1NHCA 1OFEA 3KRGA 3P4GA 1IDKA 3RIQA 3T9GA 2BSPA 2QXZA
chains in the Genus database with same CATH topology
1OFLA 4XN3A 3UW0A 4NK6A 2QY1A 3B8YA 2X3HA 1JTAA 3GQ9A 3GQAA 3VSTA 1HG8A 4XLHA 2QX3A 3B4NA 1O8DA 3JURA 4HWVA 1O8JA 3EQNA 1VBLA 1RU4A 2NTQA 4URRA 1OGOX 4YZAA 3VSVA 4W8QA 1BN8A 3ZSCA 3SUCA 4OJPA 1O8HA 4OJLA 4OJ5A 2VJIA 5AMVA 4OJOA 5C1EA 3VMVA 1OOCA 2NTPA 3GRHA 1KCCA 1O8GA 2NSTA 4YZQA 4XM3A 4EW9A 1PXZA 1PLUA 4MR0A 4OZYA 1O8IA 1OGMX 4XKVA 2ODLA 2IQ7A 1OFMA 4YELA 4YEJA 4U49A 1O8LA 4XOPA 1IA5A 1JRGA 4XLEA 2X85A 4XR6A 2NSPA 3EQOA 2UVFA 1O8FA 3VMWA 2O17A 2EWEA 4XMYA 2O04A 1KTWA 2NTBA 4XNFA 4AVZA 1AIRA 4XOTA 2O1DA 1DBOA 4XKWA 4Z06A 4YZ0A 1DBGA 1WMRA 4W8SA 4XONA 4XORA 1IDJA 3GQ8A 1XG2A 4W8TA 2NZMA 4XLCA 2O0VA 2PYHA 2VBKA 4U4BA 4OJ6A 1QJVA 1RWRA 3WWGA 2INUA 4PMHA 4W8RA 2NT9A 4MXNA 4XQFA 2O0WA 2PYGA 4Z05A 4Z03A 5C1CA 4I84A 2VJJA 1EE6A 1O8EA 3VSUA 2PECA 1X0CA 2VBMA 4XLAA 1CZFA 1O8KA 1O88A 3B90A 1PE9A 4OZZA 1O8MA 4C2LA 2X6XA 1QCXA 1K5CA 2NT6A 1KCDA 2UVEA 4XN0A 3LMWA 1IB4A 4XL9A 4XLFA 1BHEA 2Z8GA 3FY3A 4NK8A 4YZXA 2X6YA 2INVA 1RMGA 2VBEA 3ZPPA 3GQ7A 1H80A 1GQ8A 2X6WA 1NHCA 3KRGA 1IDKA 3T9GA 2BSPA 2QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFL A;  4XN3 A;  3UW0 A;  4NK6 A;  2QY1 A;  3B8Y A;  2X3H A;  1JTA A;  3GQ9 A;  3GQA A;  3VST A;  1HG8 A;  4XLH A;  2QX3 A;  3B4N A;  1O8D A;  3JUR A;  4HWV A;  1O8J A;  3EQN A;  1VBL A;  1RU4 A;  2NTQ A;  4URR A;  1OGO X;  4YZA A;  3VSV A;  4W8Q A;  1BN8 A;  3ZSC A;  3SUC A;  4OJP A;  1O8H A;  4OJL A;  4OJ5 A;  2VJI A;  5AMV A;  4OJO A;  5C1E A;  3VMV A;  1OOC A;  2NTP A;  3GRH A;  1KCC A;  1O8G A;  2NST A;  4YZQ A;  4XM3 A;  4EW9 A;  1PXZ A;  1PLU A;  4MR0 A;  4OZY A;  1O8I A;  1OGM X;  4XKV A;  2ODL A;  2IQ7 A;  1OFM A;  4YEL A;  4YEJ A;  4U49 A;  1O8L A;  4XOP A;  1IA5 A;  1JRG A;  4XLE A;  2X85 A;  4XR6 A;  2NSP A;  3EQO A;  2UVF A;  1O8F A;  3VMW A;  2O17 A;  2EWE A;  4XMY A;  2O04 A;  1KTW A;  2NTB A;  4XNF A;  4AVZ A;  1AIR A;  4XOT A;  2O1D A;  1DBO A;  4XKW A;  4Z06 A;  4YZ0 A;  1DBG A;  1WMR A;  4W8S A;  4XON A;  4XOR A;  1IDJ A;  3GQ8 A;  1XG2 A;  4W8T A;  2NZM A;  4XLC A;  2O0V A;  2PYH A;  2VBK A;  4U4B A;  4OJ6 A;  1QJV A;  1RWR A;  3WWG A;  2INU A;  4PMH A;  4W8R A;  2NT9 A;  4MXN A;  4XQF A;  2O0W A;  2PYG A;  4Z05 A;  4Z03 A;  5C1C A;  4I84 A;  2VJJ A;  1EE6 A;  1O8E A;  3VSU A;  2PEC A;  1X0C A;  2VBM A;  4XLA A;  1CZF A;  1O8K A;  1O88 A;  3B90 A;  1PE9 A;  4OZZ A;  1O8M A;  4C2L A;  2X6X A;  1QCX A;  1K5C A;  2NT6 A;  1KCD A;  2UVE A;  4XN0 A;  3LMW A;  1IB4 A;  4XL9 A;  4XLF A;  1BHE A;  2Z8G A;  3FY3 A;  4NK8 A;  4YZX A;  2X6Y A;  2INV A;  1RMG A;  2VBE A;  3ZPP A;  3GQ7 A;  1H80 A;  1GQ8 A;  2X6W A;  1NHC A;  3KRG A;  1IDK A;  3T9G A;  2BSP A;  2QXZ A; 
#chains in the Genus database with same CATH topology
 1QA3 A;  1K8F A;  1OFL A;  1LM1 A;  4XN3 A;  3UW0 A;  4NK6 A;  2QY1 A;  2XTX A;  3B8Y A;  2X3H A;  3SY2 A;  1WXR A;  2VFP A;  1JTA A;  3GQ9 A;  1EA0 A;  3PET A;  3GQA A;  3VST A;  1HG8 A;  4XLH A;  2QX3 A;  3B4N A;  1O8D A;  3JUR A;  4HWV A;  2W7Z A;  1O8J A;  4KH3 A;  3EQN A;  1VBL A;  1RU4 A;  2BM5 A;  5JMC B;  2NTQ A;  4URR A;  1OGO X;  4YZA A;  3SZE A;  3VSV A;  4W8Q A;  1QA2 A;  1BN8 A;  3ZSC A;  3SUC A;  1K4Z A;  3AK5 A;  4OJP A;  1O8H A;  2J8K A;  4OJL A;  4OJ5 A;  2VJI A;  5AMV A;  2YUH A;  1TYW A;  4OJO A;  3NAW A;  5C1E A;  3VMV A;  4V02 C;  3TH0 A;  1OOC A;  1QRB A;  2NTP A;  3GRH A;  1KCC A;  1O8G A;  2NST A;  4YZQ A;  4XM3 A;  4EW9 A;  1PXZ A;  1TSP A;  2XC1 A;  1LLZ A;  1PLU A;  2VFQ A;  4MR0 A;  4OZY A;  1O8I A;  1OGM X;  3NB2 A;  3SYJ A;  4XKV A;  2ODL A;  2IQ7 A;  1HF2 A;  2IOU G;  5DNS A;  1OFM A;  4YEL A;  1EZG A;  4YEJ A;  4JRA C;  4U49 A;  4YC5 A;  1O8L A;  2V5I A;  4XOP A;  4YEI A;  1IA5 A;  1JRG A;  4XLE A;  2X85 A;  4XR6 A;  2NSP A;  3EQO A;  2UVF A;  1O8F A;  3VMW A;  2O17 A;  2EWE A;  3N90 A;  2O04 A;  4XMY A;  2QZA A;  1KTW A;  2QYU A;  1CLW A;  2NTB A;  4XNF A;  4AVZ A;  1AIR A;  3H09 A;  1TYV A;  4XOT A;  2O1D A;  1DBO A;  2F3L A;  4XKW A;  4Z06 A;  4YZ0 A;  1DBG A;  1WMR A;  4W8S A;  4XON A;  4XOR A;  2XTY A;  2XT4 A;  1IDJ A;  3GQ8 A;  3LJY A;  1XG2 A;  4W8T A;  2NZM A;  4XLC A;  2O0V A;  2PYH A;  2VBK A;  4U4B A;  4OJ6 A;  1QJV A;  1RWR A;  3SQV A;  1L1I A;  4YCQ A;  3WWG A;  1TYU A;  3BH7 B;  3LYC A;  2INU A;  4OPW A;  2O6W A;  4PMH A;  2BM6 A;  4OM9 A;  2NT9 A;  3N6Z A;  4MXN A;  4W8R A;  1DAB A;  1QA1 A;  4XQF A;  2VFN A;  3BH6 B;  2O0W A;  2PYG A;  3ML3 A;  2XT2 A;  4Z03 A;  4Z05 A;  4I84 A;  5C1C A;  2VJJ A;  2XTW A;  2VFO A;  1EE6 A;  1O8E A;  3VSU A;  2PEC A;  1X0C A;  2VBM A;  4XLA A;  1QRC A;  2G0Y A;  1CZF A;  1O8K A;  1O88 A;  1PE9 A;  1KQ5 A;  3B90 A;  4OZZ A;  1QQ1 A;  1O8M A;  4YDT A;  2X6X A;  4C2L A;  1QCX A;  3PSS A;  5JLV C;  1K5C A;  2NT6 A;  1KCD A;  2VFM A;  2UVE A;  3PSZ A;  3LMW A;  1OFD A;  4XN0 A;  1IB4 A;  2BX6 A;  3JX8 A;  2BM4 A;  4XL9 A;  4YFO A;  4XLF A;  1BHE A;  2Z8G A;  3FY3 A;  4NK8 A;  1TYX A;  3DU1 X;  4YZX A;  2B0R A;  2X6Y A;  2INV A;  1RMG A;  2VBE A;  3ZPP A;  3GQ7 A;  1H80 A;  2BM7 A;  1LLW A;  2J8I A;  1GQ8 A;  2X6W A;  1NHC A;  1OFE A;  3KRG A;  3P4G A;  1IDK A;  3RIQ A;  3T9G A;  2BSP A;  2QXZ A; 
#chains in the Genus database with same CATH homology
 1OFL A;  4XN3 A;  3UW0 A;  4NK6 A;  2QY1 A;  3B8Y A;  2X3H A;  1JTA A;  3GQ9 A;  3GQA A;  3VST A;  1HG8 A;  4XLH A;  2QX3 A;  3B4N A;  1O8D A;  3JUR A;  4HWV A;  1O8J A;  3EQN A;  1VBL A;  1RU4 A;  2NTQ A;  4URR A;  1OGO X;  4YZA A;  3VSV A;  4W8Q A;  1BN8 A;  3ZSC A;  3SUC A;  4OJP A;  1O8H A;  4OJL A;  4OJ5 A;  2VJI A;  5AMV A;  4OJO A;  5C1E A;  3VMV A;  1OOC A;  2NTP A;  3GRH A;  1KCC A;  1O8G A;  2NST A;  4YZQ A;  4XM3 A;  4EW9 A;  1PXZ A;  1PLU A;  4MR0 A;  4OZY A;  1O8I A;  1OGM X;  4XKV A;  2ODL A;  2IQ7 A;  1OFM A;  4YEL A;  4YEJ A;  4U49 A;  1O8L A;  4XOP A;  1IA5 A;  1JRG A;  4XLE A;  2X85 A;  4XR6 A;  2NSP A;  3EQO A;  2UVF A;  1O8F A;  3VMW A;  2O17 A;  2EWE A;  4XMY A;  2O04 A;  1KTW A;  2NTB A;  4XNF A;  4AVZ A;  1AIR A;  4XOT A;  2O1D A;  1DBO A;  4XKW A;  4Z06 A;  4YZ0 A;  1DBG A;  1WMR A;  4W8S A;  4XON A;  4XOR A;  1IDJ A;  3GQ8 A;  1XG2 A;  4W8T A;  2NZM A;  4XLC A;  2O0V A;  2PYH A;  2VBK A;  4U4B A;  4OJ6 A;  1QJV A;  1RWR A;  3WWG A;  2INU A;  4PMH A;  4W8R A;  2NT9 A;  4MXN A;  4XQF A;  2O0W A;  2PYG A;  4Z05 A;  4Z03 A;  5C1C A;  4I84 A;  2VJJ A;  1EE6 A;  1O8E A;  3VSU A;  2PEC A;  1X0C A;  2VBM A;  4XLA A;  1CZF A;  1O8K A;  1O88 A;  3B90 A;  1PE9 A;  4OZZ A;  1O8M A;  4C2L A;  2X6X A;  1QCX A;  1K5C A;  2NT6 A;  1KCD A;  2UVE A;  4XN0 A;  3LMW A;  1IB4 A;  4XL9 A;  4XLF A;  1BHE A;  2Z8G A;  3FY3 A;  4NK8 A;  4YZX A;  2X6Y A;  2INV A;  1RMG A;  2VBE A;  3ZPP A;  3GQ7 A;  1H80 A;  1GQ8 A;  2X6W A;  1NHC A;  3KRG A;  1IDK A;  3T9G A;  2BSP A;  2QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...