5C1DA

Human ogt in complex with udp-5s-glcnac and substrate peptide (rb2l)
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
713
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 275
structure length 695
sequence length 713
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5c1dA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5c1dA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1dA03
2R4UA 3UYLA 3UPVA 1B89A 2H1HA 2O6LA 3RHZA 3E4BA 3QWWA 1NA0A 2WQHA 3T3HA 1PC2A 4PQGA 3NCHA 2UY1A 3AS8A 3D0RA 1GPAA 2QLMA 3COPA 3CV3A 4F9FA 1KTIA 3DDWA 4BTAA 2AW3A 3MSCA 2NC9A 4GA2A 1LWNA 2C2LA 1NVKA 2E2EA 2OFFA 3BCSA 1GPBA 1P2BA 5BT1A 1Y8ZA 3L01A 3G2JA 3PDNA 1XL1A 3C4VA 3TAXA 4F96A 4N3BA 1FU8A 3MS7A 1L5SA 3RO3A 1W3BA 4O6FA 5FTPA 3GZ1A 2C4MA 4RIGA 1HH8A 1TJCA 4AIFA 5TMDA 1UZUA 2WTXA 4AY6A 5CCLA 1C3JA 3WXXA 3VTXA 4WNFA 3MRVA 2XCUA 3ZCSA 2LNIA 1WW3A 1JIXA 3MRTA 1JIUA 4GYYA 2FEZA 1A8IA 1NA3A 2KATA 4U07A 1NLMA 2C9ZA 3CUUA 3HYMB 3AS4A 3UYKA 2J9QA 2VCEA 1BX3A 3RSZA 1P4JA 1L6IA 2QN8A 3L7DA 3Q15A 3ZHEA 3CKBA 3NP7A 3MA5A 1UQTA 3OY2A 4HLNA 3WC4A 4L22A 4RIFA 5LCWJ 5C1DA 4CGVA 2ECPA 5D0OD 2YJNA 5I45A 1Y8MA 3PE4A 2ZB2A 3C4QA 3CUYA 4I2WA 3NP9A 1K06A 3LPZA 4N39A 3CK7A 3FWVA 4N5CA 4XIFA 4WHMA 2PRJA 3T3GA 4AM9A 1GZ5A 4U0ZA 3MQFA 2R4TA 3Q49B 2IYAA 1L5QA 3CX4A 1P4GA 2FF4A 2KCKA 5FJYA 1EM6A 2X6RA 3DD1A 4WNGA 5D0QD 9GPBA 1K08A 3S7DA 3MTAA 1L7XA 4UQXA 3OY7A 3T5TA 1V4VA 4I9EA 2PL2A 5BNWA 1P29A 2GJ4A 2XGOA 3JYSA 5LCWC 4REMA 3RJVA 1XC7A 2F3SA 2I6HA 2PRIA 2IF4A 3RKVA 1LWOA 1XNFA 3OKPA 3E3NA 5JTUA 4HORA 3GW4A 3KS2A 1P2DA 2X6QA 2F3UA 2AV6A 2R66A 1Z6PA 3OTGA 3VDMA 1JIVA 2OOEA 4RIEA 4U04A 2XA1A 3G2HA 3T3EA 2FI7A 3OXGA 1P2GA 3MRXA 3O3CA 3HBJA 2ATIA 1RZVA 3LYAA 4G26A 2VGXB 3MTBA 2L6JA 4A1SA 5DBKA 3S7BA 3R9AB 3E3OA 4M7PA 2JZCA 4GZ3A 3CV0A 4JL0A 2LSUA 4NESA 3ZPJA 1Z6QA 3UUXA 5LQDA 3QKWA 4WNDA 4KYOB 5IKPA 4Z5XA 2XA2A 3CUVA 4KQMA 3MT7A 3O48A 5EKQD 3QWVA 2XPIA 3CEQA 3IEGA 3BCUA 1NOJA 3S28A 2IEGA 5ARFA 4MI3A 3LY7A 3TG4A 3RSCA 5DU2A 5JTTA 4F3VA 2SKDA 3URZA 4JA7A 3CK8A 3NB0A 4X7MA 3KD7A 4B94A 3MS4A 3LKUA 4IN3B 1C8LA 2R5SA 4YUAA 3ASGA 2VG8A 3MT8A 4G25A 3S0JA 2QFCA 2ACVA 3FFLA 3U4TA 2BGTA 3FP3A 3MV2B 4BWRA 4BQFA 4MRAA 2P58C 4GCNA 3RO2A 1NZDA 2QNBA 3FROA 1GG8A 3TGOA 3T3DA 4APOA 1JEJA 3VTYA 1L5VA 1B4DA 1FU4A 3BCRA 4G2TA 5CHEE 2GEJA 4RIIA 4AY5A 4Y6CA 3CEHA 4BT9A 3BDAA 1EXVA 2PZIA 5JJTA 5D01A 3ZCPA 2BUGA 2X0EA 3S2UA 4MHOA 3CVLA 4BTBA 3QWPA 2JLBA 1QKJA 4KXKB 2X0FA 5G05J 3H4TA 3MS2A 2QN7A 3HBFA 3RU0A 1FU7A 3BD6A 2QN2A 5A6CA 4HOQA 4W9RA 5DIZA 3OKCA 1VGVA 1GGNA 1J39A 4J8FA 4BT8A 1NZNA 3LY9A 2UY1B 2GEKA 3KAEA 2QRPA 5JJ6A 4YI3A 3ZCUA 3Q47B 5EX3A 3MT9A 1OUVA 2VSYA 4HOTA 4W6QA 2G9VA 2VCHA 5TMEA 5KJKA 5IKOA 2Y4TA 4EQFA 4GZ5A 3H4IA 4XI0A 3K9IA 2P6PA 4ABNA 3S7FA 5G05C 2C0LA 5CCMA 1AHPA 4MI9A 2HR2A 4G24A 4LEIA 2PQ6A 4NQ0A 2G9QA 3OTIA 2GPBA 2C1XA 1PNVA 1P4HA 3HBNA 1KT0A 1O6CA 2KCLA 5G04C 3LCAA 3OXLA 4EKYA 5ARGA 3OTHA 3EDTB 2JJMA 4CDRA 2F9FA 3EBPA 4GA0A 2WPVA 2KC7A 3SF4A 1HZ4A 3T3IA 3L79A 3MV3B 3Q3EA 3ZHEB 5JJ7A 3U3WA 3Q4AB 4KBQA 2R68A 4XI9A 4X6LA 3ASHA 2IYFA 2XGMA 3T7DA 3TG5A 1YGPA 2XMPA 3MBOA 1XOIA 2AVPA 3UQ3A 2F3QA 4EJ2A 1HXIA 4MHSA 2FETA 5AYWD 2YHCA 2QZSA 1ZU2A 2C0MA 3N71A 4KQ2A 3QOUA 3CUTA 4NC9A 5A7DB 5FZQA 3L7CA 2QN1A 3MTDA 3VUFA 2HYZA 2ASVA 1ELRA 2IFUA 1JG6A 1FTWA 3EBOA 2XCCA 4YI5A 4HOUA 1L5RA 4RG6A 4CTMA 1WV0A 3DDSA 5EX0A 3OKAA 4CGWA 1Y6GA 3GPBA 1IIRA 4G2VA 1PN3A 4CTOA 1C8KA 1KT1A 3CVNA 1FS4A 2GT1A 4J8EA 3VDNB 2HO1A 1WW2A 1XV5A 3IAAA 3S7JA 2G9UA 2FBNA 4G23A 4WNEA 3S29A 2PQNA 1A17A 1FCHA 3SYMA 4GA1A 5FT9A 3G2NA 4YVQC 1JG7A 2IW1A 3AMVA 4UQZA 3RIBA 3QDNA 2Q7FA 3MKRA 1E4OA 3IA7A 4EKEA 1E1YA 3G2KA 1FC0A 2XEVA 2VGYA 3CVQA 4NRHB 4GPKA 4AMBA 1ELWA 2IEIA 2F3PA 2VQ2A 4AN4A 3S27A 3BEOA 5TMBA 4YVOA 3CK9A 1PSWA 4WADA 3NC4A 4NEQA 4AMGA 5BW8C 3QKYA 3NF1A 1XL0A 4RIHA 3GUHA 2IUYA 4X7RA 4RELA 1KLXA 3QHPA 4M60A 5D00A 1FA9A 1Z8DA 4H7YA 3GYZA 2XCBA 5DXFA 5FZSA 3C48A 2ACWA 2QN3A 5HXAA 4JHRA 2VSNA 2C1ZA 4UI9K 2IV7A 1IHGA 4I1AA 3CEJA 2BFWA 3CKCA 3AS5A 2PYDA 3WAGA 4J0UA 1F6DA 1IXYA 2QN9A 3MEKA 3HBMA 5G04J 6GPBA 3L7BA 5FZRA 2SKCA 3LY8A 1UQUA 2BISA 2QRQA 5HQ8A 2XCIA 1PYGA 4GZ6A 3ZFWA 2DBAA 3CVPA 1QM5A 4GPBA 3BD8A 1WUYA 4HWGA 4ME2A 4X7PA 5KJNA 3RT1A 2LSVA 2Y4UA 5ENZA 3ZCRA 4EL0A 4Y6WA 3OXFA 1YA6A 8GPBA 2QRGA 3VUEA 4BQIA 2VYIA 2IV3A 3ASFA 2GW1A 2QLNA 4JA9A 3D0QA 4KQ1A 3ULQA 4FKZA 2PYIA 2QRHA 3Q3IA 4I17A 2YQ8A 1NOIA 1NZFA 2GPNA 4M83A 4MICA 1YA0A 5M72A 1WV1A 4CTNA 3Q3HA 2FO7A 4LDPA 3TOVA 2AZDA 2VGXA 5KJLA 2Q6VA 1NOKA 1RZUA 3NPAA 4BFCA 2X0DA 1H5UA 1RRVA 3ZCQA 4GYWA 3ZCVA 3ZCTA 2KS6A 2H1FA 4N2QA 1F0KA 2MHKA 4N3CA 2KCVA 3L7AA 1FTQA 3SYRA 1SXPA 1GFZA 4RG9A 4WACA 4N2SA 4GCOA 1IYGA 1C50A 3ASDA 1L5WA 2AMVA 4MI6A 5DLDA 3GZ2A 1QZ2A 1WM5A 4UI9J 3D1JA 5KJMA 2GM9A 4N9WA 1E96B 1ZBPA 3TSAA 3CUWA 4F97A 1M5RA 3SZ7A 4U0SA 2V5FA 2QLLA 1QQEA 3ZGQA 4WUYA 2UWJG 3ZN3A 2FFRA 4J8DA 1P5QA 2BGUA 4GYOA 1FTYA 1Y6FA 1Z62A 2HY7A 2QRMA 4RENA 4BQEA 4N3AA 1AXRA 7GPBA 4U0UA 2SKEA 3G2IA 4EL5A 1SXQA 4YNDA 1XKXA 3Q5MA 2R60A 2ONDA 3PE3A 4H7XA 4I2ZA 4UQYA 2G9RA 3E3LA 4UI9C 4LEUA 1ABBA 4G1TA 3CEMA 5TVGA 3BEEA 1GPYA 3DZCA 1WUTA 5GPBA 3OT5A 4QLBA 4I9CA 2FF5A 2PQRA 3ESKA 5HI7A 2GPAA 4RBNA 3BD7A 3WADA 1WAO1 3NAZA 2XGSA 4HOSA 2XA9A 4FZRA 1HLFA 3G2LA
chains in the Genus database with same CATH superfamily
3KUCA 5JMTA 1GZUA 1P8JA 1XHLA 3W3AA 1T1RA 2CV2A 3D8HA 3DDWA 4ENWA 4TVOA 3R7DA 1K8KG 3QYPA 2EOAA 4OF4A 4PNEA 1NULA 1P1FA 3AKZA 2IFTA 5JD6A 1IDN1 1TD9A 4HB0A 4C0AC 4FMDF 3B9BA 3MMZA 4P92A 3UQYS 2HQRA 1EXWA 4RZQA 1JIUA 4YQYA 1RJ9B 2GWRA 2QSZA 3C6YA 3KVYA 1KHTA 1EE2A 4CG0A 2JKZA 2IYAA 3SG0A 2JLQA 3B48A 3ZY6A 3DXFA 3Q5DA 1LPSA 1XZCA 3MUOA 5KTYA 5KVVA 1PJTA 2X8WA 5T67A 3ASOE 1I3CA 5KAPA 1H2WA 4EG6A 5JH7A 3ZYZA 4JUCA 4RW0A 5F35A 3QWVA 5FA5A 5GGXA 3TZHA 3OJEA 2JLYA 2R79A 2CV0A 3LY7A 5CLQA 1VL5A 4X7MA 1U81A 4XWGA 4A15A 1TAGA 5J90A 2CF5A 2KSQA 1RXSA 2BUAA 3GZ4A 2DUMA 2RJOA 3VAYA 1UK6A 2HCJB 1MJGA 3I45A 1O7JA 3FIUA 3F5MA 1L8XA 4Z8XA 4JVOA 2OO3A 4RTPA 3WAJA 5JU6A 4IIXA 3AXSA 3EDQA 3ZCXA 1QTNA 5ER9A 5LKAA 2VF8A 5E3IA 4FN4A 3W5UA 4D02A 2R03A 2WMDA 5BPFA 3VPFA 4JI8B 1Z15A 3VDXA 5I9TA 4N0QA 4YAOA 1HNXB 4TV9F 2IOQA 2PQ6A 2G7MC 2GBFA 5KOJB 1Q0QA 4ANWA 1GNVA 4QWMA 3WBJA 5AXCA 4TXPA 2HK7A 3VR2D 3CZ4A 3Q4AB 3T7JA 4BMSA 2E6UX 5CNKA 3IOBA 3ADPA 2H6HA 1HORA 2ID8A 3D8SA 2WG2A 2VUUA 1J00A 4E2YA 3UH1A 2DCPA 2GPWA 5CPBA 4AAYA 4TV8B 2HJRA 3K0AA 1I24A 1ORWA 4DHEA 2A6PA 3T7CA 1IN1A 4DIUA 3U1TA 2O5RA 1BE6A 4HI9A 4MEAA 4PSKA 1CNMA 2ZGGA 1SFRA 5DRYA 1PDWA 4CODB 2VTBA 2AYXA 1AS3A 1T43A 4UE6A 4JI3B 3TLCA 2HSDA 2CL0X 2GRUA 3QUQA 4I4NA 2NO7A 1DV2A 3JAMA 5A9TA 4DLVA 3BEOA 1FSGA 1J21A 2ZB8A 4WADA 3IT2A 4Q4CA 3GRAA 3TI7A 1BVUA 1P1HA 1W4CA 1DINA 1F9AA 5F5LA 3C8DA 1O94A 4JR1A 4WWHA 4GPTA 2XB8A 4XKBA 4M86A 1IXYA 3DWGA 4CLHA 1HYGA 5IH3A 3UPDA 1JG3A 3W9BA 2QI9C 2G80A 3ELWA 1HI9A 2EWWA 1M1NB 4EFLA 4GOLD 1E2HA 3BWVA 3OM0A 4O2AF 3KXLA 4NZNA 2IX9A 4MGEA 1JH9A 3BA1A 3OE1A 4FUQA 5BN1A 3CBQA 5LCXA 1O77A 4DQLA 1H2HA 3GVIA 2X3UA 4WCFA 3EMDA 1GPH1 3HI6A 2PVSA 1XCGB 1QDLB 4B8ZA 5C37A 1T36B 3S2AA 1M1YB 1ES9A 2HD4A 3KSMA 1SVIA 1ZOOA 1Z62A 2C8KA 1PGPA 4M6WA 3BGWA 5J5CA 3OIUA 4E31A 4LHYA 5KDDA 2Q5IA 2OCPA 1R5JA 2BEJA 1BSVA 1RXWA 1CQJA 3F1LA 4AEZC 3ID6C 3N87A 3UPVA 4DKXA 1O0CA 4EEZA 4FDVA 5LKRA 3RYHA 2H2AA 4Y6LA 3L6OO 3IQWA 4RAOA 1EUCB 1V1MA 5FQ6A 2CVOA 5I9IA 2OCXA 4EUEA 3ZBUA 6REQA 5BYBA 2O2SA 5F7JA 3JAKA 5E1DA 3BXHA 3CE9A 1NF9A 1R9NA 1RQXA 1NNI1 2E87A 4L16A 2XMDA 3JZAA 1PI3A 1PBNA 4RZ2A 5EKSA 4EI7A 4E2XA 1E8XA 5CDSA 2RAPA 4OD0A 3KAPA 4KVGA 5JAUA 4Q15A 1AS2A 1VB5A 2AJ8A 2O9JA 2FF4A 1X80B 3MTAA 1OH8A 1Y34E 2ST1A 5ALDA 4BNHA 4PW0A 3G1UA 2P67A 4YRKA 3KKKA 2V7QA 2YICA 2V7XA 4YECA 1XVUA 1SZCA 3QX3A 4Q3DA 4PS1A 2FZCA 3VU9B 3E9DA 1J0XO 4GTPA 3U6BA 5CNJA 2O1EA 1YD7A 1Z4QA 3OUUA 3NHKA 1JGTA 5AW3A 4TKUA 1KKMA 4L9SA 4IIGA 2CFUA 3U4GA 1YS4A 2C3UA 2QRKA 1CJTC 2MTBA 4M8IA 4J29A 1XK7A 4FB4A 1I3OA 2AI3A 2JFWA 2NM0A 1UDAA 4TTRA 2EFYA 5EJEA 4EH1A 1D1QA 1TZKA 4CIYA 1BE8A 1JG4A 3RQIA 3RWOA 2ZRLA 2GF9A 3UKRG 2OKGA 3PC6A 5BN4A 2IZ0A 2EFCB 3B7GA 1UEJA 5FORA 4P3NA 5CAEA 1SH7A 2ZU6A 3UKOA 3PUXA 3LBFA 4RF5A 5DHQA 4F3YA 1MB3A 5BR7A 3F47A 1COWD 3ABZA 3V46A 3L7IA 5LNK6 2V6BA 4PNHA 5EWJA 4X64B 1CQXA 2XDYA 5DX1A 1QV6A 2PH1A 4C3OB 1YRYE 4Y7DA 1FTGA 1GIAA 1HE5A 3LLUA 2V6MA 3HSYA 4MKRA 2G9QA 4AW9A 4EZKA 2DLDA 2HXSA 2OORC 3NV9A 1ULTA 3AJAA 1IN5A 3LUBA 1N7JA 4ZCSA 2QUIA 3ER6A 2ZUSA 1IEXA 1Q14A 2VTVA 3WI7A 2HK6A 3RB8A 4HPWA 4BFTA 3FTSA 4ZGGA 1ULAA 4M88A 5KSZA 1TGVA 4M8SA 2ZIFA 1JU3A 5KUTA 2YJZA 1XV5A 2VHYA 3BE4A 2XT0A 3G2NA 1P3JA 2IW1A 1U9YA 2OEWA 2H06A 4RK1A 1XTBA 4MLZA 1KSHA 5EESA 5D5HA 1ZI9A 1GRCA 3U49A 2PXCA 2XNSA 4F3CA 3VZQA 4DMMA 3LQ4A 1SUFA 1ZB1A 4GU5A 4R1TA 4GVPA 1B6SA 2H2IA 1J4AA 5L7WA 1Y9ZA 4RVGA 4CM9A 1MEOA 4U8YD 3AVVA 1C9YA 3ONFA 1KR2A 4NQRA 5J63A 1Z7BA 3Q8LA 1AF4A 4C1NA 3QP9A 3EHDA 4O8CA 5ENZA 3A4TA 1U7TA 2A5EA 2NOAA 2QLNA 1XJ0A 3K72B 2HSZA 4OP2A 5HOEA 2HCBA 3CN9A 4MO2A 1V5FA 1JJVA 2WFLB 4HDSA 3WICA 5HS0A 4BEJA 1WXEA 1ULZA 5JYEA 3DWLG 2PM8A 5CA1B 2KS6A 1PJ3A 4NU5A 3GWGA 5C4GB 2X7JA 4MWDA 3ELYA 2HWKA 1V16B 4G89A 2I4IA 2WINI 3S1LA 3TQOA 4XUDA 1J0BA 2HCTA 2XWSA 4U7JA 4PBSA 5BYKA 1S6YA 5FYDA 4DILA 1XVVA 2XT9A 1J8FA 3PTZA 3MMNA 2QZPA 3DH0A 2PGOA 3V9AA 3ZBPA 3UB4A 5JE8A 5AW9A 4U8GA 4XZ4A 1SXIA 3NKVA 3N0WA 5A7HA 5M29A 3CR7A 4G1BA 1CQPA 1YCGA 2JI9A 3BQ9A 3C4JA 1SD2A 1YHNA 2J3HA 1U7UA 1RWWA 1E6CA 3NWEA 2KB0A 2UUPA 1CIPA 4UVGA 1FDOA 4DPLA 1C7QA 1HRDA 2GXSA 4ES6A 3FBTA 1H2VC 3PZ4A 2ICAA 3OQJA 3P4XA 3UAGA 2ZB2A 5H83A 4OHYA 2QD3A 4MUJA 5B1AE 1RI2A 4B09A 4U0ZA 1AKTA 2ZJYA 3IAS1 4AJOA 1F1JA 1VRCA 2GWHA 2A8YA 1JLMA 2G3YA 2VK2A 1OQAA 3EC7A 3KK0A 4B46A 2X6HA 1ETUA 4EGJA 4GPZA 1VSTA 4Q3OA 1UODA 4P81A 4UBLA 2IS1A 1EK2A 2QJWA 3EEOA 3ZWWA 3UHFA 3OPXA 3ZU6A 4BLSA 4R0VA 4D9FA 1E1QA 5A4AA 4UTOA 3S28A 3OZCA 5JEEA 5IAOA 4EOGA 1HF8A 3MELA 5JISA 3CK8A 4UD6A 4US0R 2R8PA 2LE0A 4MYCA 1PVDA 1MX9A 2PO7A 3H1PA 2QNBA 3PNSA 4EHLA 4IGAA 4JKOA 3ZVKA 2ODNA 5ECYA 3A1WA 4OJKA 1A2OA 3BD9A 3GA5A 4QJBA 5MHTA 4LYEA 1VL8A 4JEUA 2ZZNA 1XROA 5GGYA 3I4FA 4HNAA 2X3MA 4A73A 4PICA 1VLZA 2ZATA 1LPAB 4OHKA 1PR5A 3KEQA 1U0JA 4PSAA 1KMCA 4MUHA 5AQ1A 2HFJA 2BF7A 2KJZA 4AY3A 1FMLA 2F48A 4A8JC 3TB4A 1PYOA 4RD1A 1EVIA 4PRKA 2Y69E 3DPIA 4TT8A 2C59A 3BSSA 3RF7A 5BWNA 2YJ6A 3KVOA 2XOEA 3SFZA 5IK2D 5C9ZA 5AVOA 1CZHA 5WRFA 1EX9A 4J75A 2JI8A 4DCJA 1SURA 2FCRA 2WHXA 3DEYX 1H8HD 4G8KA 1H66A 4LZPA 4XR4A 1L5RA 3R3UA 4CTMA 1F4LA 4J0JA 3S8MA 4QOHA 3FAZA 4JS0A 3Q11A 1M8FA 4PLGA 2X5GA 5K51A 2X7HA 4C4AA 4EZIA 1VDMA 2D74A 3IP9A 4G09A 2FSUA 4BEBA 1CUHA 2HIAA 1JEAA 4CMGA 1P91A 5B4VA 1AMUA 1P9OA 1X1SA 4A6PA 2RAUA 2GETA 1NF2A 2DVWA 3RHFA 2LIVA 3GGSA 4IIFA 3U81A 3G23A 4D9EA 4I8IA 3WAGA 4DLNA 2WWXA 1BDJA 4C14A 1WEKA 3LSTA 2IF0A 4XWOA 5CEDB 2QRGA 5FV7A 1VHLA 2B9VA 2V55B 1JFLA 1TYCA 4LOJA 5SY4A 3GZTB 3WK9A 2FO7A 4P6VF 5KJLA 3DC2A 5EFZA 5CIQA 1IM2A 1EJ0A 3ZCVA 3KJNA 1ZK2A 4ZU6X 4OKSA 1TT7A 3WYAA 4I1SA 2IEBA 3HNPA 2LVBA 4M1SA 4ZMRA 1FSPA 4HAVA 2PMEA 2IODA 3L0CA 5JY6A 3ENZA 3BGDA 1A9TA 2PXXA 2VDKB 3U31A 3ZQKA 2MMGA 4CV3A 2CG3A 3GIDA 3BGIA 1VMKA 2FUCA 1UAYA 3K0AB 2J9ZB 1GEEA 4QQNA 3Q79A 2YWHA 1K2VN 3GRUA 2QTWB 3JZFA 2D2IA 2Y1OA 2W2VA 3KKPA 3QE3A 6AT1A 4G5HA 1TJPB 2QSJA 4LRSB 2VTBB 5JW6A 4WN9A 2WU4A 2H11A 3GJSA 3WXXA 2P3LA 1S2OA 1FP7A 3A4NA 1GNLA 2PCJA 4M1KA 2CYAA 5C51B 5KDLA 3KAJA 2C9MA 4XPIA 2Q6KA 4L5AA 3THWB 1UKZA 3GEHA 3JW8A 3DMYA 1Z5SC 1JBQA 4DWWA 4Z4IA 2BZ1A 5B2EA 5A4MS 3OE7A 5TR9A 1ZL0A 3PPIA 2WSMA 1T3LA 1JHPA 4XR9A 4E1BA 3BUSA 4MV5A 4L27A 2XUDA 1KDOA 2VDLB 3EFOA 1YJAA 4IYJA 4Z4CA 3OXGA 1NY5A 2GAAA 5J4YA 1ZXLA 2BTOA 1PLKA 2L6JA 2WSIA 1OZAA 4PO1A 3GNLA 3LA6A 3BHIA 4WCFB 3UTDA 1KEZA 4KVFA 4JVLA 4LBVA 2JFYA 1Y4UA 4E14A 4WZ6A 4RVBA 3FLAA 4MWCA 1FRVA 2W2OA 1FP1D 4RQTA 2GZMA 5D6NA 3LRPA 4A3SA 1M6EX 3OJWA 3DSRA 4M6WB 3B9QA 4EZJA 4AYXA 4Z54A 3HCRA 3B3FA 2B37A 1CQJB 3HK2A 1D6JA 1YBMA 2D1QA 3OE4A 1L7OA 1IXRC 5CBOA 1I4OA 3NH9A 3EPPA 2QORA 3PDIA 3O95A 1WA5A 2DHEA 3RYHB 2AFHE 4GL2A 5LD2B 5BNFA 4BMZA 4ENVA 1V1MB 4LF7B 3STHA 3R7RA 3X1MA 1W19A 5ICGA 4AZ0B 3T5CA 3DCYA 4P82A 6REQB 1MB2A 3JAKB 4XASA 5F3WB 4MUBA 1TCVA 4B89A 1X1TA 3AVOA 1X74A 1QBQA 2VYFA 3G02A 5ENNA 3BIOA 4AJ1A 2XD4A 3NPMA 4E4YA 2FETA 1Y82A 3HYCA 3ZWVA 3AR6A 2CNLA 2EFEB 3OEHA 2X5NA 3KJGA 4CKCA 3O0TA 3B3AA 1CR2A 3EGXA 4QDOA 3PHHA 2IDKA 1W47A 5C8DA 1BGVA 4G2VA 3AJEA 2O2EA 5KVQA 2I65A 1I1OA 4QOJA 5FTNA 4YN3A 1TJ4A 1ZN2A 3IB6A 4IGIA 2VR1A 1W76A 3ZE7A 1DOAA 1SXJE 5A5EA 1R0YA 4GPAA 2OG1A 1NR5A 5P21A 2AG5A 1ODKA 3S2GA 4TKUB 2R2LA 1ID8A 2ECKA 5F5XA 4NIMA 2UAGA 2AWOA 1BMDA 4DZRA 1IHGA 3QE2A 3QTBA 2OEPA 2VJYA 1E5LA 1Z5WA 1GZ6A 1SHUX 1U7IA 4QFDA 1E0DA 4LV8B 4TXLA 3PREA 4ME2A 5BN4B 4A6XA 2CLCX 4B3FX 4D3ZA 1L4UA 5CAEB 3UKUG 3U9LA 2ZU6B 4EHNA 2VBFA 3NTXA 4QUDA 3NT4A 4D57A 3I3SR 5D87A 5KINB 3IGFA 4DLAA 5DM2A 1EP2B 1GW6A 5TDHA 1Z8NA 5EWJB 4ALLA 4JV5B 4RK6A 4GR9A 2VRWA 4A8JA 4Q7MB 2J07A 5K0EA 3LO8A 1YI1A 2NZXA 3COSA 4KH0A 3T7SA 2ZRGA 4MUKA 1ZI8A 2ZW9A 3GWZA 4UCFA 3NATA 1YO6A 2HDWA 3HH8A 2XIQA 4MVJG 4F5YA 4BZWA 3THOA 3D7MA 5EUQB 1PUXA 1YBVA 3CWCA 4L08A 4QXQA 2PTGA 3OIWA 2FJPA 1W1UA 2G07A 3SR3A 1HG2A 3P9PA 1HYQA 1GZHB 2WQHA 1L5NA 1XDDA 5EHNA 3I0NA 2C3MA 2QJRA 2ZG6A 4RHXA 2XRMA 4Q9IA 3DZFA 3UMSA 2FFAA 4O8ZA 3TRJA 4DUGD 3GJTA 5DTQA 1AKEA 2UVPA 4G56A 3KPYA 4ED9A 3V6MA 3AS4A 4U9HS 4K9OA 4QODA 1FLAA 2NU7A 3TRFA 1JBKA 4AULA 3RRMA 2P79A 3IV0A 2VTEA 5AHRA 4HLDA 1MO6A 4G0YA 1TEZA 1IBSA 3ZGYA 3X2EA 1IVSA 4TYPA 3LWZA 3E9QA 2FW7A 5CM9C 2H4HA 2EBUA 3SHQA 5K0BA 2P9FA 5AOCA 3RKVA 3GW4A 1KFEB 3H5AA 4ARSA 4KX5A 1MEJA 3GEBA 1SUCA 4HDSB 1Y48E 3K71B 4PFSA 3T99A 2FEXA 2H54A 4N0EA 1MBZA 3ZWQA 1AJEA 1OOEA 2A94A 1AY0A 3K1ZA 4LIPD 1K68A 2H6FA 4NJMA 4L3VA 3M6UA 5AQEA 2ZAGA 5C81A 2EG5A 1A4IA 1TZMA 4AURA 4X61A 5JNTA 1N94A 2NYUA 4YREA 1RXVA 4Y8VA 3MT8A 3U4TA 5EGSA 2D0PB 1GUAA 5CHEE 1H05A 1SBTA 3P2BA 3DJFA 1G98A 5CJJA 3DO8A 2AI1A 1OXBB 1CNEA 4J3FA 5JDIA 4RF2A 1WNFA 4NZMA 2B34A 1J8YF 4KAXA 2HXGA 2PX2A 3MJHA 4EHKA 1KU6A 5K4HA 4CMKA 4DLQA 4YV2A 1Z56C 3MEQA 1YJBA 1AS0A 1B8UA 1OXJA 4XUCA 3S44A 1ORIA 3NFYA 3WGGA 2FJDB 1VYTA 1O6GA 1DC3A 1G9TA 4UAUA 1Y9EA 3SR0A 3U3ZA 3BM5A 2CE2X 1YZNA 2EXXA 1MB4A 2W37A 4KBQA 1Y3AA 3VOBA 4ZIRA 1YWGO 8MHTA 2IYXA 3B7PA 4NU6A 1U0HC 1ELOA 2O05A 1FDWA 4HZIA 5EJ6A 1DAHA 3QU4A 3IKTA 4YAKA 3E9CA 4PAOA 3QM1A 3H7IA 3KWFA 3SHVA 3SYMA 4LE1A 1ZI6A 3VC2A 4DLOA 5E0OA 3IA7A 1SK8A 4W63A 4LVOA 1UR5A 2DWZA 5E9QA 4OQXA 1F6BA 3T5MA 5LYJF 1VE9A 4BZXA 4MKXA 4AXHA 4LG6A 2G4VA 3BB4A 3I0MA 4IPTA 4GF5A 1ZVVA 1FVOA 3ENQA 5IABA 3EUVA 1C0EA 1MO4A 3HKBA 4TZ6A 4GLBA 1IIBA 5I9LA 3SFYA 2KZTA 4RM3A 4LQLA 4H3SA 3ITEA 3PEFA 1YH3A 4AP2A 1QM5A 5BSHA 1GYRA 4DCCA 4QFVA 1U99A 4L95C 5LBIA 2NV6A 3VUEA 1K3UB 1J90A 5KQMA 1XAGA 2GUGA 2GPNA 4KQWA 3Q40A 1X2EA 2KE5A 4TZKA 3TWVA 3Q7IA 4GUDA 5B1SA 4M89A 5H82A 1E9BA 2O8CA 5E7QA 2VP3A 1IPHA 1E8DA 1A95A 1XMVA 3UINC 2PZFA 5CFRA 1ELKA 1DC7A 3IPXA 4HXFB 3I9V6 1LD8A 2FZ4A 3II6X 2QTRA 3NHAA 2AXUA 3HCWA 2FG6C 1SQGA 5TQ2A 1K6MA 4NPCA 1MC1A 4GPMA 2VT6A 1WMAA 3CHOA 1UF9A 1SEVA 1WVGA 5EKDA 4YRFA 3WV5A 4UI9C 2ZZKA 3ES9A 3H9BA 2WM9A 3LS8A 4JY7A 5HVNA 1XN1A 2P4QA 4MKHA 1FJXA 5EUBA 1KO7A 4HUTA 5HGXA 2CBXA 4LJLA 1C9EA 1TNZA 1HT1E 1JTFA 1NUTA 3D9LA 2WXKA 4GWGA 2IU6A 2DLNA 3MGBA 1SCJA 5H3CA 3PNLA 2BDUA 1HG0A 1ZD4A 4A91A 3C4VA 2VNHA 4MXDA 2JGJA 5ANRA 1BQEA 1TPZA 4M2LA 1ZKMA 1FYWA 5AVSA 2V4LA 3SGLA 1LF0A 3HUEA 4Q7KA 2QZ4A 1DQRA 4FGUA 1T5SA 4ILGA 2WSLA 1RYFA 1E2IA 4DCSA 3EU5A 1CKEA 3UIOC 4LS3A 1XDWA 1RRKA 5A3JA 2GZSA 3P1UA 1DKLA 1SZPA 3KTOA 4ZI5A 5FIOA 2V1XA 1GKLA 1TXGA 5K0FA 2WHYA 4YPVA 1OIWA 3UAWA 1XU4A 4PHHA 1FSZA 2XGOA 3IV7A 2HMVA 2PRIA 2CDBA 3A1SA 4Q3KA 1RAFA 2WHRA 4J1NA 2IBMA 5BV2P 2Q3JA 3TW0A 1N75A 2HSEA 4RTMA 2Z2XA 2J4CA 3VYUB 3FZQA 4QBGB 4CLDA 3JD1A 3QIVA 3N76A 1U0BB 2INGX 1LBEA 1BQ3A 5JATA 4MJ7A 2I7CA 3IXLA 4LGMA 4QEKA 4YJ3F 2NTNA 2CCGA 1Y80A 3EC1A 3V1TC 2ZYTX 3MS4A 4ARIA 4FMPA 3URKA 2IP4A 4UZSA 1LDNA 4M0CA 5EDSA 5K3BA 2MCFA 2WDPA 4QU9A 2QVYX 4M1MA 3EY4A 3K2QA 3LW8A 3DV9A 1DGQA 4GYKA 4MS1A 5FIUA 3ESAA 1ULSA 1CVLA 4YHBA 3S2SA 4GLLA 3R4CA 5HOQA 1N8TA 2V4UA 3RD5A 1Q11A 3PQ2A 4ADSG 1I13A 2XEHA 2AZMA 4RHUA 1N7IA 4KEAA 5CCDA 3VPAA 2HJHA 3LCUA 5HIMA 4XJVA 1AOXA 1TO1E 3OO1A 1VFPA 1KAQA 2YWEA 4QBTA 5ERYA 2IU1A 4J3NA 2OCLA 1T15A 4WN9B 1AB5A 2C95A 1E9CA 1HTBA 3JQ0A 3REFA 3SQDA 1QO9A 3ROQA 4RHFA 1I5OA 1LTKA 3M7IA 1GNPA 3VU9A 3PQ7A 2IC5A 5FTKA 3L79A 3QVLA 4XPIB 4QDJA 3HGMA 1SA5A 4GWKA 1BWQA 3ABKE 3NOVA 5HWSA 3VTKA 4QIHA 3A10A 4QYIA 3TLAA 5JS6A 2C98A 3WK7A 3CLUD 1JXAA 3GT4A 1IY8A 4NZZA 3FHOA 3MB5A 2FBNA 3S29A 4BO3A 5DIFA 1G8HA 5EJFA 1JE0A 1D4OA 1V25A 3EFOB 4GRAA 3D2AA 4LHXA 3U3OA 5FI5A 2QAIA 3ORQA 4OQYA 1N6OA 1J8VA 2DQSA 5A4JA 4AIIA 5TSDA 4F4FA 3P32A 4C5AA 2VNAA 1ZGHA 3CKCA 3ETGA 3PE6A 4QQIA 1AUVA 1SC6A 3FE2A 2HR1A 2X9GA 1AN9A 4JD2G 4G84A 1VSVA 4C29A 3LC7O 5B12A 5GAJA 4JUIA 3PDHA 1U9IA 4D3DA 4BQNA 3DR5A 2XXAA 1SM4A 4X90A 5K09A 4YP0A 5HRUA 3AYZB 5C34B 1T9GR 3JQBC 2PL5A 2W9JA 1CY7A 3B12A 2AZDA 3C1OA 3NPAA 4RORA 1H4QA 2EWMA 1QRAA 1EDOA 1NXVA 5DZSA 4E70A 3PDIB 4AKHA 2XKJE 3QE9Y 1P7PA 4TWAA 4C30A 3JD3A 1GFZA 2FR8A 4NBSA 2QNIA 3ASDA 4C01A 4A0GA 4DNXA 1BA3A 1OU0A 4MCAA 4NURA 5H70A 1KH3A 1OX4A 1ECCA 2QIOA 4QDZA 4DCOA 1N2GA 3C24A 2V3VA 2YXDA 1EUZA 1EI9A 4R4JA 4B33A 4DADA 4OX9B 1RYEA 4LVCA 4X9XA 1SOMA 4KXMA 1LLFA 5BSGA 1GPKA 2P41A 4IO1A 4UMDA 3G5MA 1GTMA 2A0UA 1OH6A 5FWNA 4CKCB 4I3GA 2JIDA 1OROA 3EGXB 4DTIA 3DSUA 1RLIA 4IGEA 3TNDA 2QLMA 4KQKA 4PCAA 1R7RA 3AI7A 1VE1A 1VYHA 1SY7A 1LSSA 3P9IA 5JAQA 4F1SA 2I2DA 4EBAA 3LECA 2LCIA 2V54A 2PGIA 3ZD9A 3TS1A 2IPNA 1QH8A 3SIXA 2JBAA 4QASA 2LZ0A 3DL4A 2OBYA 1TQ8A 4IQFA 1EDZA 3ECCA 4K9QA 4CQNA 2GZDA 3RVDA 4Q82A 1YDHA 1C7ZA 1TECE 1L4FA 5EHQA 3FR8A 4J2HA 1HG5A 4JEMA 5FTMA 1JLSA 1L4LA 2B0OE 3RR2A 3Q49B 2KCKA 4LV5B 4D0LB 1JEEA 5BRAA 1GGMA 4UPVA 5H3LA 2D2XA 3OCVA 3GK3A 2H65A 4CTJA 3LBYA 4ER7A 1KARA 2X1MA 4R1PA 4O4JF 4PHFA 4BV2A 4GGMX 1OCOE 3DD5A 3R20A 2G1JA 5DBKA 3ZDBA 5H80A 3MMSA 1TC2A 2FWIA 3IKJA 1G8KA 1AGXA 3H0EA 2EVWX 4YTEA 1L5YA 3WNVA 3KJIA 4A8JB 1NUAA 4DR2B 1N4AA 1RPTA 4B6JA 2Q2OA 2SKDA 2XNJA 3I52A 1MAVA 2A0WA 3G8BA 2DRIA 3Q7AA 4HVLA 3GFQA 2DF8A 4F2DA 4G2TA 1I5EA 4C3ZA 4GBJA 1IRXA 3NV7A 5FBVB 3HVJA 2KWIA 3RH0A 3KTDA 4E1AA 2XPCA 1JDPA 3RANA 3TW4A 3TF5A 4OMCA 2VKQA 2F8SA 5JCPA 4JIMA 3X2QE 4ALJA 4CIXA 1GDTA 3D9OA 3JQ9A 1NRIA 3ZWMA 4YR7A 3HYSA 1Z17A 4HDKA 4TMFA 1GM5A 1HT2E 2RHGB 4BJ3A 1U1FA 1D5CA 3Q73A 2PL3A 1EM8A 5E3HA 2EKLA 3U40A 1OXXK 3DDHA 4YA6A 4BUJA 1J2RA 1MNQA 2UVPB 4ND7A 4A3VA 3GMDA 2NU7B 1FFWA 3L6DA 3T7TA 2W6JD 4PYLA 3CVYA 2UZ0A 3RRMB 3EQ6A 3WAKA 5L6MB 4OBEA 4EO7A 1UXKA 3Q6MA 4DI4A 1RPZA 1JR2A 3A2LA 3RYTC 4BX0A 4FCTA 4LJKA 2Y1EA 3LUPA 5JSKA 3PR2B 3TTYA 3GJ3A 2AF3C 2C92A 4UUBA 2JJ1D 4ZMSA 3QOXA 2ZJFA 4D4MA 5FOXA 5EOVA 4Y1EA 2I3BA 2J49A 3OVMA 2Q7FA 2R4QA 4YDOA 4TRMA 1ZJJA 3U3KA 1KVQA 2C2BA 4KDFA 4UASA 5AJZA 4E5SA 2JK0A 5K3FA 1LLDA 4NJMB 1FDRA 2B6CA 1HV8A 5FAXA 3SYNA 3HVEB 1KR5A 4RHTA 2RHWA 4ZICA 2W58A 3RHSA 1H9AA 3KEMA 1JSXA 4D0SA 4BJ1A 2XCIA 1KJQA 3AM5A 1RWBA 4K28A 1YRWA 3DE1X 3UN1A 1CDEA 2HU5A 1SC4A 4ZO7A 4HB5A 1KK1A 3L9WA 1EBBA 4LVUA 2ZBPA 3OHSX 4X20A 1O1TA 2GI4A 2OCGA 2DSTA 1F2UA 4ZOLF 4K3VA 3EUWA 3O75A 3MJVA 1KMIY 1GUZA 1E8ZA 3AP2A 4B5KA 1SXPA 3DOUA 4L4YA 3ESXA 3L7MA 4XYBA 1PZEA 5ITVA 4D1YA 5EVJA 3V8QA 3KC2A 5JMOA 4BERA 2YVUA 2Z2JA 1IWOA 1DT3A 5EWLA 4B4UA 2G7ZA 2F8TA 3UWOA 4ZIRB 3KZVA 2RDMA 2OVBA 1AG9A 1NUHA 1MUUA 1AN0A 2REQA 1HLFA 4KLNA 2AC4A 4OHXA 1L7RA 4FLMA 3K7EA 1WABA 1SRQA 4TS9A 3RIMA 4CKBA 1PK8A 3F6YA 3NM6B 5ICEA 1QGAA 1ISMA 2OFXA 2Q3DA 3DFIA 4WUVA 3P5SA 4DDUA 4C9BA 3TWXA 3GDWA 3AINA 4MROA 4FYMA 1NLMA 5DNUA 2AWNA 3FF4A 1RAEA 3CSUA 3GUUA 4EJ6A 2VP0A 4N8EA 1UP7A 3CX3A 4W1PA 3KETA 1NR7A 2RHDA 3RADC 1P0FA 1B0AA 1Y8MA 3HKBB 1PZGA 3PS9A 4N40A 4WHMA 5AW5A 4O02B 1OV4A 4FGWA 1XJQA 3F49S 2KZTB 4XE0A 1E18A 3JQBA 1RJDA 4JT9A 2DULA 4M0DA 3UENA 2Q9CA 1CUEA 3PEYA 3MTGA 1EAMA 3WV4A 3FFBA 3PDJA 1UJRA 5CW2A 2XBMA 2NTEA 3EYWA 1LCIA 4WKCA 4E51A 3JWIA 3IKLA 5DXJA 3CHQA 2PJZA 4TTTS 3VH1A 2BR5A 2QJOA 3QKWA 4BUZA 1TYDE 5KBYA 3L40A 2O8CB 3TFQA 4QDUA 1T9GS 1THGA 2QP3A 4F3VA 2OCAA 4HH0A 1SUIA 3GROA 3JQCA 2FMXA 3NKLA 2J6CA 3HG0D 2QFCA 1LC3A 3F8TA 1BFDA 1LBIA 4RANA 5TQ2B 2ERYA 6YASA 1CD5A 1QYCA 4JFRA 3T1YB 3EZ6A 4B6GA 4WAUA 2I5PO 2WM9B 3KOXA 2J0SA 3THWA 1O87A 2HHHB 3WGJA 3OKCA 2HCRA 1INLA 3CMMA 4NNPA 2XTMA 1IPEA 1R0XA 1GHTA 3PNLB 1PW5A 1XZIA 2RK4A 5JJBA 2EL7A 3G9TA 1E6MA 1UAAA 5HILA 4RGYA 2DETA 4RKRA 2HX1A 1VJGA 5ANRB 1USUA 2GPBA 4JAVC 2QVZX 1TUIA 3PF8A 2DKOA 4RA9A 1PL8A 4CUZA 4A6EA 4F93B 4PYQA 1L4MA 4TYYA 5T8IA 2P75A 4UATA 5AHKA 1NT4A 1YTLA 4PDXA 2PMCA 3JS5A 2WWHA 3P71T 4MHSA 2GN8A 3LNTA 4DWJA 1QP8A 2WJPA 2IZ7A 1T9ZA 3FPSA 5CCBA 4NFYA 3QY0A 3W5CA 4DE5A 3DB2A 4N5HX 4AMUA 3ITNA 1LRJA 4BWFB 1T5TA 3FYCA 4GE3A 1C30A 4ZEMA 3WDKA 1C0KA 3BAFA 5EI5A 5JSQA 2BGWA 1EEXB 1F2DA 1K5GA 1FDSA 1JNXX 5ALYA 4UU1A 3RFVA 4AMGA 5DOZA 5E2BA 2JVKA 1N1EA 3V4OA 4XLTA 2QTZA 1Z68A 3PICA 4TL6A 1N0UA 5CVVA 1KIFA 4AMYA 2HJWA 4L4SA 4B6OA 1AUQA 4MW1A 3RGGA 4AZ0A 1OXTA 3UFXA 2QW0X 3S2YA 1SQ5A 4Q5IA 5IYZA 1H65A 1R27A 1OD6A 1ECPA 4UWLA 3F6EX 5DP2A 3JXJA 4MS1B 4BQIA 4GEKA 4U2GA 5ULLA 5I5GA 4G37A 4RH1A 2HLDA 2VZ0A 3CWQA 4UZEA 2G71A 4ACAA 1E7YA 1VI5A 3RC9A 2WXFA 2GD6A 1GDDA 2I9CA 1LVUA 1ISSA 4TV8F 4DBZA 1QIIA 4GR4A 4QM7A 1UK9A 1H2EA 2ZSAA 2X40A 3C7TA 3TIFA 1WB9A 3RLIA 5G02A 4CYMD 3HVHA 4ZGWA 3SYKA 4EGFA 3PWSA 4QYIB 5KTKA 3ZV6A 2H1HA 4DANA 3OZVA 3WB9A 4EG1A 1D0SA 1MTZA 2D2FA 3M89A 1HM5A 2OFFA 3BCSA 3QA9A 4N49A 5AHXA 2ZAMA 2VHQA 1SKMA 1M1XB 1V96A 1WSAA 4JVSA 3BE8A 2VI5A 1J8DA 3PQ4A 4F3TA 4OGFA 5DBOA 2W90A 5HS4A 2A7XA 5KQSA 1NF3A 4MUFA 3WBBA 4CN8A 3ZXYA 4PXAA 3S8YA 2FRVA 3HCDA 1GLVA 3CNLA 2XMSA 1ZR4A 5BNTA 3RFCA 1ZRSA 3S70A 4FM9A 2Z95A 4XIFA 3T3GA 2JDID 3V2OA 3H16A 3NW9A 4HYQA 2VPWA 3TSOA 2RHCA 4AJHA 4CV2A 3UAZA 4R2KA 4UQXA 4EHBA 2XXAB 5H3HA 3HE3A 4EF4A 5HZMA 3WO0A 1D4FA 3CISA 4L9RA 4R2MA 2N0SA 2ODTX 4KVZA 2YWBA 4V2IA 2MOWA 5IBRA 1GAJA 4OM7A 4R8VA 4BNFA 3VH4A 2H7VA 4EMBA 1A5ZA 2WJAA 4QUIA 4FFWA 3GFSA 2ZJ8A 3C6XA 4R8KA 2X9LA 3AUTA 4DB2A 3SHWA 4OAQA 4J1TC 2CXTA 1VE6A 1TZ2A 1L5LA 5BV1A 4KHPB 1OX4B 2LD4A 3C6ZA 3RVPA 3HJCA 3MYVA 3EHQA 2ZANA 4C4YA 2DUUA 5F1YA 5TY0A 3PHIA 3VPSA 1L4GA 5EXXA 5FPQA 5KIAA 2ADFA 1ZZEA 4N47A 2DZNA 2PT5A 4XYEA 2IYOA 3OQ6A 1F5SA 4HHEA 1MD9A 4HOTA 1NI3A 4YDHB 2H92A 2EW8A 4M46A 4E2FA 1IY1A 2BWJA 2IVFA 4HT3B 1N25A 2WSSA 1LX6A 1QH8B 1ML3A 2JBAB 4ZO8A 5ALVA 2PPVA 3E32A 5IY5E 1PQPA 1TW3A 2WI8A 5JJ7A 2ZUCA 4L6IA 1OTXA 4ESOA 2Y2UA 1Z47A 2JH3A 5KNBD 1Z74A 4DCUA 3TQCA 5TQ0A 3P2MA 3KR2A 3O03A 4CZ2D 5JD3A 3JX9A 1S5PA 4ENRA 3WRXC 3ZLJA 3IR5A 2R8ZA 4NV1A 4HWSA 2WP8J 3N8DA 3KYBA 1TTPB 2C57A 3T52A 3DL2A 2AB0A 2JIBA 2IP1A 1G7RA 1MU0A 2ZSBA 3C1UA 2WFZA 3NWJA 5I7WA 2W93A 9MHTA 3KFXA 1PTJC 3A04A 2C5AA 1FPPA 2FKAA 1TB4A 3W78A 2J3KA 2D0DA 2Q46A 4G97A 4JHXA 1S96A 2PZGA 1UK7A 1X13A 2FPGA 4KWCA 4NMXB 4HLCA 2BRUC 3KQTA 1M9NA 3T5DA 2GYWA 2R97A 2R7KA 3A14A 4D3XA 4C05A 3RT1A 4N12A 2NXNA 4Q47A 2IYQA 3LTEA 1YA6A 3BUAA 4OVVA 3FJYA 4AQYB 1SCDA 4YUZA 5JHHB 4RD2A 2C20A 4B2YA 1Z36A 4UJ5A 2WJZB 1ZZGA 5FFFA 1FYVA 3RVNA 3W7AA 3OD5A 5JMWA 2JLCA 4HDKB 3FHLA 1IG3A 2XIJA 2X5JO 3L7AA 2M98A 1KXJA 1U9CA 1OGIA 4QNRA 3L0SA 3NB2A 1EM8B 4XIIA 1MJ5A 5HFAA 5LWQA 2YJGA 1D9ZA 2W6CX 4S12A 1NVBA 4TRRA 5DGIA 2QD2A 4MI1A 2OY0A 4HPXB 4ZVNA 2N46A 1N5OX 2XNKA 1TM7E 4UEOA 5AJWA 2OAP1 3ELUA 4FPXA 3PP8A 2H00A 4R71A 1V7PC 3IVXA 2OZEA 1U80A 1ABBA 4XQGA 2A57A 1RBZA 3WADA 3K0KA 4LCBA 4DIBA 3ZYKA 4QUKA 2C29D 4M3NA 3OH8A 4K6CA 4BCCA 3NWOA 1J22A 4WCDA 1UOPA 1I9CA 5DYTA 1YB4A 2OTCA 3PDNA 3KQKA 4M7RA 1G3IA 3O3MB 1LI7A 5AI6A 1DSSG 4D6XA 4CKZA 5I4KA 1M2FA 3H65A 2E4ZA 5ICMA 1D4ZA 4YGYA 1ZHFA 2BGJA 5K3FB 1I9GA 2QUAA 5JAHA 5ES4B 4MQBA 3HTXA 4BP1A 4DX2A 1LFDB 3D4PA 4DIKA 3THSA 3ONDA 3B6EA 2ZIRA 3BG5A 3DE6X 1QFXA 3C1TA 1J1IA 3B52X 1USWA 3LWNA 2GCOA 2IOSA 2AFVA 5CT6A 2G17A 1HFAA 2W43A 3D1LA 5E3JA 4IJ5A 3KPWA 1N36B 1YS7A 5I7OA 3AKCA 4FD3A 4EG4A 1LI4A 3FTZA 3OTGA 2ZKLA 2XA1A 4X20B 3H1AA 2YHUA 2LAHA 5E1OA 1F2UB 3R9AB 3LXXA 3UK2A 3KWLA 3PC2A 4ZQFA 4TQ9A 1QK4A 4D3SA 4AQ7A 5J43A 3MWGA 4I1IA 4AU1A 3MYRA 5CNMA 5EIEA 2ZJ1A 5HE9A 2ZWAA 3AERA 5AH0A 4ZQBA 3NETA 4Y2PA 1EXMA 1LTHR 2CHFA 3EOBI 1NKVA 1Z37A 3CZCA 4BLUA 1DARA 1TM2A 1O08A 3AOGA 5EWLB 1A2QA 4DUZB 3I04A 1JSZA 2OP1A 4FFSA 3I58A 1W35A 2IEDA 4HEA1 2C99A 1Y5NA 3T7IA 1HYEA 1C7EA 3MS2A 1IOZA 4KUHA 2REQB 4QQ8A 3I34X 4YDRA 1EFRA 4N4AA 1Z0SA 3QFSA 3IVCA 2A2ZA 3ZDZB 1TYZA 2GDJA 4CUKA 3ZYLA 4Q3NA 3OPMA 4CKBB 1E3JA 2QAGC 4W6QA 1CQZA 4PS8A 4MS6A 3QBEA 1UJ2A 1QJCA 3SBEA 2PTHA 4C9BB 1W2HA 3KLNA 5DT2A 2YHBA 5CB0A 2F9FA 3OEYA 1FZTA 5B3JC 2R5FA 4L2IA 2NUAB 1UJKA 5B6JA 4LHZA 4GMHA 1UIRA 2RHLA 3V8NA 3K20A 4DABA 1UBCA 2ZR9A 1Z6GA 2XZDA 3FR7A 2HBRA 4LZAA 1Q1NA 1W5AA 3HVIA 2HHCA 1E98A 2PKWA 3D8TA 3AGPA 3QOYA 4PYMA 4BTLA 4B6QA 4MQUA 4CF4A 3W8NA 4DJTA 2UZAA 2C0PA 1Q19A 1U1DA 1XCOA 4XWKA 3CVWA 4BVKA 5DN9A 4FZVA 1PQ4A 5ITWA 3TU3B 5FTWA 1W8IA 4WNYA 2J0QA 3D3WA 2KM4A 2AN9A 4OFWA 4J1TA 4NRHB 3IUEA 4Q03A 3TM5A 4B81A 2OAGA 3TNFA 1MVNA 2AL7A 2IUYA 2QNRA 4RADA 4FFVA 5CH3A 5JDIC 2PWPA 2AZ4A 1E1CA 1M2NA 3CPJB 3N5CA 1XMPA 1BHQ1 1AK1A 3VM6A 3A6ZA 5ECGC 2W42A 4ONEA 4LXGA 1ATIA 4BP3A 1LZLA 1N52A 4F4HA 1R0KA 4PNZA 5TS2A 2V97A 2UYGA 4UM7A 1VZ2A 1TJ3A 4MICA 4M87A 1T2AA 4XWAA 4GS5A 3KXPA 1RZUA 5IW8A 1E99A 3PGXA 2Q4BA 2FPSA 3LC2O 2D0OB 3ZCQA 2ISQA 1F0KA 5EG5A 2KCVA 5AIBA 2DJIA 4N6OA 5BMOA 1YMUA 3CX6A 3BREA 2XWQA 3TL6A 3QF7A 4UWGA 4TUYF 4RXMA 3VJMA 1NJ2A 4RA9B 3J80A 4MA5A 5CT9A 4KRYA 3CNQS 3Q5MA 2ZKIA 1A7AA 2WUVA 3PUVA 2R86A 2VL7A 4EPZA 2YDYA 2YWJA 3WRXA 4L8WB 4JBGA 2ZWOA 1M6YA 1Q44A 3JQEA 1Q0UA 2QGNA 2CXXA 4LDZA 1U7WA 3T4PA 1Y3DE 4FHKA 1WXWA 3AVQA 2FSGA 5JH7F 1TO2E 1HBJA 4HK4A 1YQDA 1C30B 2VPTA 4ZDWA 1WTCA 1VBMA 3VNQA 1EP1B 1OR8A 2EX4A 1PTJA 1OXUA 5HZGA 4K0RA 1X8XA 2UYYA 2OBXA 4QG3A 1TPYA 3L0YA 3D02A 4IVNA 4IWNA 2BVNA 2X8AA 5ESDA 3W8FA 1T29A 2BRUA 3B6KA 4HN9A 2HHLA 1YJQA 5AKKA 3OX1A 2IX3A 3MXTA 4BE9A 3O7MA 1UBJS 3QKSA 1U8TA 1G55A 3QUCA 4DBVO 5ADHA 2BUCA 4N5CA 3W3AD 4EFKA 4B0OA 4QOIA 4G9GA 2IEZA 1UL1X 6LDHA 3UFXB 3GVHA 1PV4A 5C8YF 1WM1A 5FWXA 5IYZB 1XA0A 1NBAA 2WNIA 3VZDA 3Q72A 5AHOA 4DBLC 2DY1A 2Y3IA 1SBCA 4NPAA 2BFEA 2IU3A 1UZAA 1RAGA 5FL3A 1S2MA 2VRCA 4X8OA 3LP6A 3AU5A 2O19A 3FDXA 4BY6A 4D74A 1SIWA 1OXMA 3ER8A 2QYTA 5DNYB 3LKUA 3RT9A 3AF1A 3K3PA 3DR3A 4RMIA 4TRJA 2IS2A 5HS6A 1PK7A 4FX2A 4V0KA 1SQ6A 4YR9A 1PG0A 1XU9A 2N42A 1UBTS 4AROA 1FP4B 2DQKA 1DZIA 4YAUA 2FLKA 2WM8A 4PTYA 5A6CA 3EXG2 3ZUVB 4F0JA 3FUKA 3GNSA 3S5JA 1PQWA 5IULC 3UXYA 1DS6A 1KY4A 5AVKA 2H5IA 1T13A 3MT9A 4F1PA 1NV8A 3G88A 1P7ZA 3VU3A 4PR0A 3GMTA 3BA6A 3LUHA 3S7FA 4ETIA 1SXGA 1O8CA 4X63A 4D4GA 1TF5A 4JVSB 5LMUB 3LHIA 4L1BA 5EIAA 3A11A 1HRKA 4BCBA 1QQAA 2WD8A 4J8YA 1CJBA 4I1OA 3JRNA 4HB2A 1TD1A 3K1AA 3NIBA 3CF0A 3SHTA 1Q16A 3OJ0A 2V6IA 2Q3MA 4XRRA 1JUQA 2B6HA 3VKWA 5KOHA 1W581 4M8LA 3ADDA 1NGSA 4E4RA 2WVHA 2IWRA 3KEFA 4KO4S 5EE3A 4FIZA 1YQXA 3S7JA 4UE3S 4OI4A 3HCNA 2OEVA 3QITA 1XN4A 1K8QA 4H7DA 4BZZA 4FGZA 4PPYA 1DVRA 5DBFA 4AKSA 2OK7A 2JD1A 2ZSKA 1OE0A 2JGNA 5BOVA 4NAUA 3GJ8A 3DMFA 4EJ0A 4GEGA 4OQMA 3EAQA 3C6MA 4BRUA 4C4SA 1U7ZA 2QN3A 3ANXA 1QE3A 3H97A 4RTRA 4G67A 4QTTB 1PV1A 1DO0A 4GO1A 4D8XA 2J5KA 1NVXQ 5KQPA 3C72A 1FSFA 1VPWA 3ORHA 4NECA 1OT8A 3QJGA 5GV7A 4FQ8A 1MJGM 1B8NA 2IL1A 2QAGA 4OQDA 3KZ1E 2NVOA 1T3GA 4GBMA 1KF0A 3CT4A 1O94D 5LC1A 1T4CA 4F4UA 4WZAA 3L93A 5B3JA 1G6HA 2YN2A 1RMQA 3FBGA 2VQ6A 2W6OA 3VKFA 4CLOA 3K9QO 4AZTA 1R5NA 3MHPA 2H3HA 1M0TA 5F64A 1FTYA 1M1ZA 4MK4A 2Q2NA 4BESA 1MCZA 1MOSA 4I8DA 1MA3A 3AV3A 1XD9A 4MAFA 3QQ5A 5FPSA 5F52A 2O52A 3O31A 5DW3A 1UKVY 1UPUA 3OJOA 4OP1A 4L0QA 1OH5A 3FEYA 4G5YA 1G21A 3AFNA 3D54D 3HVEA 3L3BA 4ZEWA 3WISA 5TQ0B 2HUPA 3SICE 1XA4A 1WB4A 4ENPA 2W8BA 4UAGA 3E4CA 4M0LA 1WUJS 1W93A 3F2IA 2J9RA 1XQYA 1V1RA 4DA8A 3RRXA 1JIXA 4LSZE 2WSYB 1U9IC 5KYVA 2WXNA 4MR7A 3GRZA 3VGPA 3NIWA 4HEJA 1GG9A 4ZQHA 1L7QA 4OI0A 2A35A 1E63A 1XCLA 4XM0A 4K1XA 3EZ2A 4JJ4A 1QORA 1SVWA 3WLSA 3KAKA 2FPGB 1HR0B 3QEOA 1Q77A 5HFJA 4BVHA 2WMYA 1N2JA 2FR8C 1D6NA 1A88A 1ECJA 5K9ZA 1P61B 4GKVA 4RDIA 3CW2A 3L6UA 1Y3HA 1UZNA 2WWVD 2R8XA 3C8HA 4PAQA 2QD5A 4K9SA 3Q88A 2ADMA 1H2AS 1Y9AA 1RIIA 3W2IA 4KQMA 1DEOA 1PBTA 1E4EA 3BBLA 1QYIA 5L7YA 1O95C 3M8KA 5K2OA 5AM3A 4UVHA 3FETA 2ZM5A 5E8RA 3V3KA 1VE7A 1DQPA 4DMGA 1V8DA 2KBEA 3D8UA 2XHEA 3VNSA 4UNQA 1SG9A 4BWRA 3NHZA 2QWXA 4UUCA 5E2IA 1W73A 4X1KA 2O3UA 1G59A 4Y0VA 2V7QD 5HF6A 5FQ4A 2VEOA 3TRKA 2GQ0A 1T10A 3S2UA 4B4VA 4JC5A 3E9YA 3PXUA 2Q4TA 1H4SA 4ZARA 4H7IA 1DJPA 2C4WA 1V5IA 3VR0A 4QYXA 3MWFA 3GYGA 4Q1FA 2Y05A 5A6SA 1P4RA 2NZ8A 3FTQA 1KOFA 1OBVA 4Z9BA 2Z6QA 3G2TA 5EXPA 1Z7WA 4QGBA 3RVJA 1Y4DE 5T4HA 2ZJ6A 1H6BA 1Z4KA 1B00A 1W85A 3BYZA 3TG8A 1ZBDA 2QK4A 2Q3CA 1V6CA 1W5BA 3MJ4A 4IIHA 1VKOA 3T9DA 1TQHA 1MDBA 1XQXA 3CLRC 1NTRA 1OB2A 5A4DA 2I55A 3PZ2A 2XW6A 3KUUA 4FMCB 4S1PA 1QB7A 3LVRE 5AO9A 5DNCA 3PG5A 2OHGA 2GCOB 4JNCA 1PN3A 2GEDA 1CVIA 4GI3A 2Y0BG 3AMVA 4NARA 4Q66C 1Z16A 4D4HA 1I94B 3G2KA 1GA6A 2XMRA 3KQSA 3HR7A 1ZG3A 2B4YA 3DBLA 3L49A 5CD9A 1R4ZA 3L7LA 4KQGA 3C2QA 1T2EA 3DO5A 3V9PA 5I4IA 2IV7A 3AERB 5HMLA 1MAUA 5FPHA 1RPAA 3FUFA 2PN1A 5COAA 1JIJA 4HRLA 2H2DA 5J2UF 2GH1A 4MDFA 2CNWA 1M0EA 3JQ9C 1UN9A 1PJ8A 1SRRA 2YWDA 1EINA 2P2NA 4KU4A 2CXSA 1C5KA 1XZHA 1E2FA 3PNOA 1X1QA 4GZ6A 1KQPA 2YIVX 2WJIA 2WK1A 3MD0A 2BKAA 7ADHA 1WMDA 2BFCA 2JNWA 1NQXA 5A5FA 2VHTA 1F2TA 5L53A 3H7AA 4FULA 2NXJA 3PXDA 3G9UA 5FA8A 3FMGA 2BH2A 5JXHA 2P90A 2PSJA 2L0XA 1UDCA 1WHSA 1RQLA 2QI9F 5JOQA 4CM9D 4M0MA 4TPKA 1S8NA 1QZTA 3UICA 3CZQA 3O8QA 3K2EA 1C81A 3HEAA 4IP0A 3TUIC 1IBMB 1PS8A 1JPJA 3BJZA 4WUYA 1ZRNA 4C6TA 5KS2A 2ZYHA 2ZWMA 2PX6A 4LQDA 5ARDA 4OVUA 1XTQA 2JA2A 4A2QA 5KO2A 4L2IB 4EL5A 4HC4A 4UKDA 1ZNQO 1DADA 4JT8A 4FT4A 2BMWA 1OJLA 2A30A 4NHOA 1I33A 3E3LA 1J8QA 4QUAA 1I2BA 1NASA 3V48A 4RBNA 2CFIA 4AKXB 1LV8A 3NC1C 2WIFA 3RC1A 3T8YA 3AU9A 2Q5JA 4YB8A 1E3DA 4E5DA 2QT9A 3KRTA 4F4CA 1WUIS 2ZK7A 3PNVA 4CM7A 4TTPA 4UTPA 4DSNA 4CLRA 4BGVA 1XEWY 2JRLA 4KN8A 1KSJA 2WFMA 1U2QA 4BN5A 3FOEC 2R62A 3D3WB 1BCSA 1JYFA 2FTKE 3V31A 1XXLA 2A4KA 1JR3E 3D0KA 2OE2A 2F55A 4FCVA 4WINA 1CUWA 4GTTA 1JNYA 1F0YA 3CIFA 4RIFA 3T4XA 5F1OA 4OCZA 1BPOA 3ZXUB 1C2TA 1E1CB 4W5JA 3QU9A 1IN6A 2J3JA 1SHKA 4OHMA 2AFIE 5HUQA 2FMUA 5CITA 2QY6A 3VQTA 4DTCA 1EAYA 2Q41A 9GPBA 4W99A 3FLEA 3C97A 3VLDA 2F43A 4WQMA 2NT4A 5AVUA 2X0RA 5B58T 3OOSA 1SG6A 3APFA 5DHFA 2MSNA 3BEDA 1Q1GA 5HKAA 3F9CA 1XFAA 3DHNA 3AF3A 4IVQA 4H27A 1UM9B 3K0EA 4IUDS 4EA9A 4KVOA 2FA9A 1U3GA 2GRMA 1O5OA 5EE9A 3KD7A 1LK0A 1S3GA 2HT6A 4RJ2A 3OSUA 3EU9A 1X86B 3ZW8A 3T5VA 2FJUA 3J5PA 5B3SE 1X8LA 4P1ZA 1AXGA 1K6EA 2Z8YM 2O8VA 2I9KA 3KVRA 3SO8A 4KXFB 1TTQB 5F9MA 3FPAA 2XODA 1F6WA 2XE4A 3GA7A 4JK3A 1E1QD 4KODA 4B0PA 1OKKA 5I8PA 4N5LA 2V0PA 2VAXA 4R9VA 1CZLA 3ADCA 4EQFA 2P11A 4QJ3A 1LF5A 3TCKA 2I7DA 3IUQA 1DC8A 3HXKA 4CG1A 3UM9A 4ZXPA 1ZICA 4CMCA 1D8EA 3T35A 2R5WA 4W7SA 4KR3A 2FWBA 3BT7A 3K09C 2WD9A 2R68A 2G1AA 1BS2A 5CRIA 2X4GA 1Q7TA 4XWWA 1R5OA 4V0OA 5K4AA 5BWLA 4PG6A 3QKSB 4D5GA 3TFWA 3O2SB 2FSIA 2BBTA 3OT1A 2PD4A 4FXOA 4RLSA 3RM3A 4GICA 4HNAD 2JD2A 4KPFC 1DTWA 4HATA 1YR6A 1NT2A 3ENKA 2PX5A 5FWXB 1MF7A 2X0IA 1C8KA 5E95A 1KAGA 2G9UA 1T8TA 2BYTA 2FDCA 1JJ7A 2NU6A 2NV0A 4HH1A 2BFEB 1NU8A 1LEHA 2AF4C 1YR8A 1O95A 5HK8A 5H8WA 4KGXA 1N5LA 4ZZ1A 1U90A 1M34A 5AUQA 2XAAA 4EPYA 3DBRA 2MSWA 5A4FS 1FPMA 4D9GA 1QU3A 3ZE6A 4NH4A 3V2UA 3D9IA 2XUOA 3CQGB 3DGEC 4GPD1 1E8YA 2VQ3A 2BISA 3TLYA 5IFKA 1CV2A 4QNMA 1PFKA 1AF7A 3I9OA 1QGUA 5ALRA 2Y4UA 3I42A 2OHHA 4J4BA 4YK7A 4GYJA 2IOYA 3AHHA 3PWTA 3WTBA 1QAMA 4MKGA 4DCGA 1PJ2A 5CMWA 4LJ6A 5C7OO 5ADUS 1P9WA 1OY1A 2VTKA 3AEXA 3BWBA 1UBRS 1PL0A 3UWDA 3OLZA 2ZSIA 3M2TA 4LJ4A 1Z63A 1BXGA 821PA 4O33A 3GIWA 2I7VA 1U2VG 4OXXA 2CD9A 3ZGQA 4HRXA 3GLVA 1NAIA 4M98A 4XFDA 3EQ7A 3LPMA 1SCBA 2HC9A 4JSRA 2JFBA 4I1OB 1KRWA 3AOEC 1ECFA 1F51E 3K1AB 3Q7FA 2I34A 4KSCA 2PA0A 6PFKA 2FR1A 3P8ZA 1NXTA 1WD5A 2YXNA 1NHGA 1O5MA 4C07A 4YMTA 3NYWA 2BSXA 2VSFA 2JG3A 5KOHB 4ZVQA 4TLLB 3E9RA 4PGAA 3QYAA 2PLFA 1ZO8A 2QG9A 5BVGA 5IF9A 3PQ5A 1XCPA 1SMKA 2ZJOA 3WRYC 3HDTA 4MMXB 2WAMA 1JB9A 1FTSA 4JP3A 2UZ4A 1UZUA 2Y1XA 1D4AA 4KIJA 4DGQA 2ODWA 2FHPA 3RK0A 1L6IA 4XRGA 2GRLA 3I2HA 2CJFA 3AIOA 1VGRA 2P2GA 3FYUC 2F0YA 3V80A 1FMCA 3B8HA 3CX4A 4MIOA 5E4TA 3WQHA 2ENWA 1OHHA 3ZZ1A 1JS1X 3C98A 3EZ7A 3P0IA 4YAJA 4UXJA 4Y2TA 1G3NB 2Q0HA 4QECA 2QAGB 2AV6A 5F1KA 3FNIA 3N6VA 4JP5A 1L8LA 3DAHA 2VKTA 4BASA 3BCHA 2WG1A 1T4CB 1NRJB 4WZAB 3CEQA 3QYFA 4G2NA 2I6UA 1NVVR 4KIWA 1RD4A 1WVIA 3IQZA 1TCBA 4JA7A 4Q02A 2QENA 1G0OA 4CLOB 3OE7D 4NEGA 4EFMA 1EVLA 5C5CA 3IEMA 2YRXA 4AG6A 3UCXA 2IYWA 2PQ0A 1CVRA 1I4WA 3FWZA 3L4EA 3BU8A 1SB8A 1Q0RA 3IDOA 2BKVA 2JLBA 4ZT6A 1TF7A 1G21B 2M63A 4AY4A 2VH1A 1OXSC 3ZE2B 1O97C 1J2TA 3LX6A 2W8BB 2G9VA 3KS9A 2NZYA 3SJ7A 2XBLA 1C3EA 5LU8A 4PWZA 1FCJA 1TN6A 1V1RB 3J81k 1BKSB 2D4HA 3KKEA 5FB3A 4MR7B 4RVUA 2IIBA 5ERXA 2VF5X 4KO1S 3FUJA 1QZUA 4MYTA 3ENVA 5B1DA 4CIDA 4Z7NB 1D8DA 4DHWA 1M83A 4YMWA 4IOMA 3WKCA 1QIFA 5IAEA 1QHGA 2RKWA 3GVCA 3FFTA 5AW8A 1ZC4A 4BTVA 5CX1A 4MB6A 5DCYA 2X9NA 5JS7A 2F17A 3IVRA 121PA 3C8MA 2MYOA 1FNMA 2GRRB 1RJWA 3R3ZA 3AJDA 3E7FA 1YDMA 4QOFA 4K03A 1DEHA 1DWPA 2K6GA 1QQ5A 1E4EB 1S9DA 1Z6ZA 3SX0A 2C1ZA 4UI9K 3OEHD 4G4IA 2FMIA 1MAWA 5EMKA 4I9HA 4P3XA 4PIVA 4D41A 4RVHA 2J5QA 4X1KB 4L9AA 3QVGA 4ZYYA 1NI4A 3GLHE 3OE5A 1RKQA 3VVCA 5DLQC 4HLUC 4JWKA 3SIPA 2NUAA 4GMLA 5HJ2A 1T2DA 4UHKA 1X87A 1Z2OX 2ZI4A 3Q3HA 4OOEA 1USIA 1P9NA 1FS5A 4MUNA 1T1SA 2FPWA 3WYNA 5LSAA 4QJ4A 5A6SB 1W52X 1YOVA 2F9MA 4N0PA 4BV3A 3DKKA 1K0FA 3K09A 1IQPA 1T8SA 1QFMA 3GNTA 4O4IF 1W85B 5B57C 2DPHA 1AV7A 2FFHA 2V3CC 1XRQA 4N6NA 2XEXA 1TMGE 1JR4A 2LGJA 2AUMA 3PFHA 4TKMA 1IJFA 2J5XA 4PQFA 3GGGA 2BFPA 4HLEA 1R8YA 2QLTA 4WNCA 3QUBA 1SZDA 2BFOA 2IHBA 1JPNA 1UBOS 2PX0A 2VJAA 4D25A 7AT1A 1BVRA 1EFKA 4UTVA 5IS2A 4Q7QA 3NOXA 5FUVA 3I4GA 2FZVA 4IIUA 4XVRA 5ALZA 3CV3A 4TSKA 1I0IA 2PWAA 5AKXA 1BEUB 2C2LA 5DNAA 3ZU2A 2VHJA 5B6IA 4PO8A 1GPWB 1UJ6A 3IOCA 1V43A 4FX5A 1PD1A 1O6FA 3TVTA 9ATCA 3DBLB 4WKNA 1KOJA 4X3OA 3WL5A 2QG6A 1YFZA 3FGPA 3VSCA 1L7DA 1L9KA 4JKIA 2TMYA 1J99A 4PS0A 5SZJA 4Z49A 1M5UA 1NW3A 2ECPA 2X2OA 2GRNB 3WLEA 1B14A 4HVTA 2EDAA 1AVTA 1Y3IA 3QMVA 3VA7A 4LI0A 3U5TA 4O59O 2H9AA 2BFCB 2RH4A 2ZPTX 3HRHA 3AR3A 5JBQA 3EGCA 3KS2A 3FZGA 4KMOA 1FQJA 4JQOA 2AN5A 4EVSA 1CUYA 2G0NA 2I62A 1F2TB 4BMVA 3HDYA 4DLLA 2G63A 4DMRA 3FU3A 2P0YA 4TLCA 1A9RA 2FXIA 1YJCA 4MP8A 3HCOA 2NSYA 1WHSB 3BHNA 5ECWA 1L1EA 3TTUA 2X2EA 3O8QB 3OZDA 3OPYA 3DWFA 2EP8A 3AOEA 4FP7A 1PTKA 1C8LA 2QRNA 4C6TB 3ONKA 1HFJA 3SEZA 3UMYA 4OY3A 4FW9A 2H2WA 1G4HA 3BCRA 4AY5A 5IJXA 4CPDA 4KACA 4N0DA 3X1DA 3H6GA 3HDXA 2WIKA 3Q0EA 4B4OA 2ZCUA 3QPBA 1GGHA 3IHLA 3WRYA 1MQ9A 3VPXA 4UD2A 1E7UA 4ECAA 1CJCA 4CLRB 1JKIA 4GSKA 1CZUA 1IUOA 1NVAA 2Z8XA 2JHAA 4F7WA 1HE3A 1KDZA 2FZKA 4P3PA 4UHEA 3OP4A 1BCSB 2BGGA 2C1XA 3H3JA 3FYUA 3P0HA 3OTHA 4K6KA 5FPPA 3EA5A 3P2KA 5B3LA 1KGDA 3NYIA 4IL5A 3DMTC 3H4VA 1WUKS 2QR3A 2R1ZA 1R0WA 2P4HX 3AG2E 2QKYA 3JWPA 4ATGA 4DPKA 3IUMA 4CM8A 3F90A 4LN1A 4PANA 2C0MA 3D5TA 1NQOA 3N2NA 5FP0A 1Z73A 3RIXA 4BSXA 3ZKWB 1AQIA 1L4YA 1RM5A 3W9GA 5BUZA 3SNXA 2J08A 1ZIDA 1V41E 4WLOA 4YRZA 4LFCB 4JELA 1FCHA 2CLEB 2F43B 2R7MA 1JG7A 4ZVTA 3CLKA 5D2CA 4MPJA 5MFPA 1FP4A 4J8PA 4U2DA 3FWKA 2WKPA 4BVEA 3WOVA 2ZETA 1ZM4A 3WDLA 5HF8A 3OFNA 3ZGZA 2P2DA 1W59A 4JBYA 3SC3A 5DXFA 3GLIA 5HXAA 4EENA 4DV3B 4DV7B 1M66A 4NZOA 4DRXE 4KFSA 1Z4OA 5AI4A 1TAQA 4HAUA 4YO7A 2M32A 1YAHA 5CGZA 1II8A 4BRZA 4ACLA 2V8OA 2BSAA 1UMKA 4WW0A 3ZRHA 1UJBA 1KWKA 3FTFA 1YYHA 1S0PA 4DVJA 2WU8A 3O2NA 3GAMA 4PZUA 1Q5PA 2WJHA 2AXVA 1NOKA 2CNDA 4DLPA 4IRMA 3ZCTA 4A16A 3ZNPA 1L7MA 1QCYA 1GUYA 3AU4A 4UI9J 1V8FA 3IELA 5K1ZA 2IXTA 4MRPA 1A76A 5IHXA 3HNRA 3LDHA 4HAIA 4OSPA 1WKVA 4BE4A 4HWPA 3W5BA 1W7AA 3W4JA 2P8JA 3RRFA 4KMRA 3H2IA 1IBLB 2Q3BA 1M74A 2OLJA 1IXKA 2P27A 3UW1A 5AVVA 3OT1B 3JRWA 2DHCA 3K6KA 1WZCA 1ND5A 3K9NA 1DTWB 2C9CA 4J90A 4I1PA 2WWGA 1YFKA 1NVKA 5JC8A 3ETLA 3R7AA 5KQGA 5LN1A 4HNSA 1VJ5A 3DUWA 1NJ1A 2NU6B 1IZYA 1R64A 5IDYA 4MYHA 1WCYA 2DEUA 1TTHA 5LP1A 1M34B 1XLTC 3QEMA 1Z39A 3KSBC 1N2HA 3DBRB 4KQFA 4IM7A 5FPYA 1YA4A 5J4LA 1NJ6A 2P1ZA 1ODTC 3ZDRA 2DHQA 5BY2A 1TU0A 1H5QA 1PT9A 5TS3A 4HLUA 1EFCA 1G20E 4R01A 1ODCA 2BFNA 2FUNB 1REQA 3DG9A 1KI3A 2J85A 1OREA 1RBYA 1NXSA 3EVCA 1QGUB 5KWVA 3LD9A 2QVCA 2B83A 4C0HA 2ZBEA 2ZJBA 4HORA 1JHRA 3P4YA 4ZQIA 4LXUA 4L78A 5FHRA 1U11A 1CUZA 1NM5A 2D5CA 2CXUA 3HA7A 2IKQA 3I1FA 5DULA 3MN1A 1A8HA 3O4JA 1Z6QA 3IV9A 2YHEA 4LNHA 1CHNA 3S7ZA 1BXGB 1M6NA 2DFDA 1IHPA 3MT7A 3U3MA 5A9SA 1VPTA 1MMFB 3C39A 4DDVA 3MWDA 2WZQA 3WMWA 3OT4A 4JENA 4LFAB 1M7HA 5ENDA 4MRAA 2F1OA 3WYFA 3ICQB 3AWIA 2J8ZA 1KBQA 1MRNA 3DMDA 1EXVA 3HYLA 3AF2A 1TIPA 1NYQA 3QXHA 1IK4A 1Q0LA 3HWRA 3EX7C 4LCEA 1MABA 1R12A 1QPGA 1N9KA 4PY2A 2QC9A 3SCZA 1T5IA 2E4VA 2XX3A 5BVGB 3HB4X 2ZS8A 3DL7A 4JC8A 3AF0A 3R7LA 1GVHA 3LL4A 3JYQA 3LPDA 3G8YA 3WKEA 1SUPA 3DQPA 1LTXA 5LMZA 4FOOA 2EKDA 4EW6A 2P4EA 3INRA 1P75A 1PHPA 4JHLA 5KMGA 2IELA 2DYRE 2XENA 1EH5A 4Q3BA 3GLUA 4YWJA 1KE2A 3SI7A 3USZA 4QL3A 3IODA 2AYYA 3N07A 1CIVA 3LHKA 4XIJA 4AKGA 3VBCA 2FPLA 1OFUX 2Z1MA 2A4MA 3HP7A 5HCIA 4QTZA 3TNYA 3VSEA 4YP9A 3AW9A 1XMIA 4AMBA 3BDVA 4R2WA 2D5LA 4MW0A 2W83A 2ODBA 1OAAA 3P96A 1C3XA 2RI1A 3UI2A 2VDWA 1VLQA 1WXHA 2POCA 5CDHA 3IIJA 3ILXA 1DL5A 3NTOA 3NOCD 1QX3A 5CMLA 4K86A 3HVUA 3PT9A 4MVJA 2C04A 3OIGA 4X7PA 3EEBA 5EKTA 3QBJA 4LE0A 4X8QA 3FX2A 4XSGA 4O2BA 5GQSA 4HNVA 3UMJA 1AGYA 1N5JA 3MUNA 3DKPA 1RYNA 2JFNA 4NBLA 4X92A 3PK0A 1ECBA 5ELXA 1QYMA 2OESA 1YS2X 3AVPA 3MSXA 5BW5A 1V4NA 4M1OA 5AVTA 4YGXB 4RMGA 5CA1F 2R1UA 3CY6A 3DMTA 3I6IA 3WVNA 1ZXBA 1Z4IA 1UBUS 2ZXFA 1JMYA 3L6CA 3VPCA 2HA3A 3Q10A 3A27A 2VJOA 5L9AA 4OUKX 2R2AA 1SJ9A 3KLOA 1TOAA 1LS6A 3HL0A 1ZOLA 2QX6A 5K8TA 4LRZA 4TLAA 3NHSA 2KBXA 1M10A 3AFOA 4QLBA 1EDDA 4Q7JB 3NAZA 1NVFA 3A9VA 2B1QA 1K0UA 1VYUA 1Q22A 1W48A 5FDFA 3OMXA 3C3DA 4GZLA 5BSVA 4U2BA 5JAOA 2JVIA 3HJGA 2JEKA 4GA2A 1PJRA 5CCXA 3IRVA 4XEUA 2GOYA 4F7AA 3F73A 3ZD7A 5CX1B 4MVJH 2WWFA 1M2JA 5CNIA 1LFAA 4UHJA 2RGGA 3DTVA 2LNIA 4TUUA 2EATA 5CK4A 2FWAA 4YQFA 2RGUA 4P2BA 4Z8YA 2JJYA 4R2XA 1F2VA 4U0KA 3OY2A 4WL0A 4AQDA 4D56A 2BIFA 3PFCA 3RKUA 4DX6D 4L1KA 4KR2A 4WSOA 3OLVA 2ZSUA 1XNQB 2EZUA 4GRDA 1KI7A 2HDOA 1TN7A 3QUTA 2D7CA 3EHRA 1MPXA 3F3YA 3STUA 1E5TA 2J0EA 4MPPA 1VPEA 2DC1A 5DXAA 1DX9A 3QVGB 4JNKA 1NI4B 5EJGA 4XB6B 4D8WA 1LWOA 3QG1A 3WYDA 2MYPA 4EYGA 1NSYA 1HH4A 4TL9A 4HGOA 1NI5A 4W4TA 2J09A 2FN7A 3UCEA 1ISIA 4YX9A 1JFSA 2WIGA 3FH7A 2JZCA 1J1UA 4HDAA 1XE3A 4M49A 1YOVB 1TKBA 3QTTA 1K6JA 1P60A 4MKIA 4JOCA 2X5KO 1JXOA 4FB5A 3M4XA 1EIWA 3PUKA 4V39A 2ADOA 1XTZA 4AKTA 2GB4A 4G11A 3CLRD 4RIIA 3M34A 1YL6A 4LC9A 1KA9H 1YK0A 4TZ0A 4UVDA 4MZXA 4ZO9A 1Q12A 3ER9A 4U7PB 3WWPA 1ZKDA 3U5ZB 3OZ7A 3ELBA 1T5BA 2XZTG 1BG6A 3DULA 3BJEA 3ASZA 1US8A 4DLBA 4JGBA 3LBIA 4LWZA 3AVUA 3LBAA 1A8SA 3KT3A 3G49A 1U0EA 1XLTA 5H68A 1YCDA 3HV2A 1GSIA 1R9MA 2PWYA 1XP8A 3K30A 5EJMA 3WGNA 3FRJA 3IC5A 3KB8A 4DOMA 3HP4A 1J9EA 4C4TA 3ZW3A 4RZHA 1ZP6A 4S35A 1QRDA 4MH0R 1EG2A 3E05A 1NQUA 3U3JA 4YRIA 3VNVA 1UM9A 4E33A 5EJ7A 4X3CA 2A78A 3HP1A 3PH0C 1NVDA 3I2IA 3ZJTA 3PXCX 4RD3A 1XHFA 4L5CA 4YIKA 1Y33E 5JVDB 1EBUA 2GA9A 1C0LA 5FBRB 1FS4A 2QZJA 1F17A 1M8KA 4Q94A 2GJAA 3P9SA 1RYDA 3G8CA 2QR5A 1P3DA 1CUXA 3VZCA 4EELA 5MF6A 1K89A 3T41A 1G7TA 3ZH9B 5KTRA 1Z8DA 5B1YA 4RZ3A 1OLSA 5ED0A 2ANBA 4R9SA 3OPYB 3NM4A 3I4LA 2YL2A 2GBLA 1FP2A 3L1UA 1JT2A 2XADA 1G38A 4FXPA 3E70C 1II9A 3IR6A 4GQBA 3DAYA 4N5DA 1JFFA 1RWQA 1T0PA 1E94E 1O9BA 4BQSA 1MP0A 2ERXA 4P5EA 3H86A 4UCQA 4PIMA 4UNNA 3KXIA 4EMSA 1DIOB 1QFJA 2O7VA 5L51A 2P2CA 1QYWA 4ZT5A 1S01A 3TOVA 5K8JB 2CUTA 3KLPX 2ECQA 4L76A 2GEUA 5BR8B 3ECSA 4A5OA 4YUWA 1XG5A 5CEJA 1KAEA 2AQHA 2AMVA 3SFXA 1V7ZA 3DMPA 3L22A 3W6PA 3KZNA 4UTRA 1UBLS 5EHXA 3OHMA 2YBDA 4AC9A 2J6BA 1QR6A 5EEGA 3FCYA 2UWJG 2R6DA 3FYUB 2HW8A 3E9EA 2GEFA 5AVYA 5BSEA 2XLBA 3IT3A 4EUSA 4YCMA 4B74A 4OB6A 1EWTA 3VR1A 3WGLA 7ABPA 2Y1WA 1SVOA 5TJHA 2YQ4A 4UQYA 3B1XA 4CM8B 4HBGA 1WDYA 3UV3A 4FQ7A 4RKQA 2C7VA 1OZFA 5BW6B 1FVFA 2FSFA 4BWVA 1ZCBA 1XZDA 2RHBA 1H23A 4H7EA 4FHDA 2XPZA 1B43A 4AECA 5JT1A 1KGSA 3B1YA 4K7JA 3WA6A 3MJSA 2OBBA 1CTQA 1Q3KA 4M9SA 1V3VA 2OLEA 1CEQA 1ZNZA 3JQDA 1SHTX 4OQ4A 3LPAA 2WVIA 3LDZA 3MCTA 2JIZA 5CLFA 3PNYA 2VAMA 5EJ9A 1P9LA 4IKEA 1TGYA 3GLIB 4CGVA 3V3TA 1XVTA 2E55A 2F8MA 3CUYA 1DMRA 2F37A 3G0IA 2LRHA 3L8EA 1CS0A 4TXQA 1MRZA 3BMCA 2HMSA 4GKKB 1QWSA 5HFNA 3SSNA 5IJ0A 1E2DA 1II8B 2ZUDA 3U2QA 3GLQA 4PZ9A