5C1DA

Human ogt in complex with udp-5s-glcnac and substrate peptide (rb2l)
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
713
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 275
structure length 695
sequence length 713
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5c1dA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5c1dA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1dA03
3S0JA 4MI6A 3FROA 1NZDA 4EKYA 1NZNA 1A17A 3QDNA 3CUUA 4GPBA 1W3BA 3RHZA 1FCHA 2X6QA 5DBKA 4KYOB 1HH8A 4IN3B 2FEZA 4B94A 1PNVA 3MT9A 1QZ2A 2QFCA 5DIZA 3TG5A 1KLXA 1L5WA 2FF5A 3PE3A 1F0KA 5ARFA 3Q49B 4JHRA 3LCAA 5TVGA 1Y6GA 3LYAA 5LCWC 3S7DA 4AY6A 1JIUA 2PRJA 1JG6A 3JYSA 3BDAA 3HBMA 3L7AA 1XC7A 3FFLA 2C9ZA 3G2KA 2QRQA 4LEIA 1XV5A 3GYZA 3UUXA 1P4JA 1ELRA 3OTHA 2YHCA 2QN3A 3S7JA 3HBFA 2IEGA 2AW3A 4H7XA 3SYRA 7GPBA 3MT7A 1P2GA 3ZFWA 5ARGA 3CVPA 2HYZA 3RSCA 4UI9K 5DU2A 4RIFA 2BFWA 3U4TA 2C1XA 4UQYA 1L6IA 2FO7A 1JIVA 1EM6A 1L7XA 2C0LA 4WACA 2QRPA 2C4MA 4YI5A 3MS2A 1NA0A 3RKVA 3CK8A 1C3JA 3Q4AB 3PDNA 2BGUA 4M7PA 2GJ4A 2F9FA 1NOJA 3WADA 1K06A 3QKYA 2IFUA 2QN2A 3MRXA 3BCRA 3G2LA 2WTXA 1WV1A 4G23A 1PYGA 4ABNA 1FU4A 4RIHA 4LEUA 2X0FA 1IIRA 2H1HA 3NP9A 3OKPA 2ATIA 4J8FA 4RG9A 3VTXA 1B4DA 3KS2A 4CTOA 3S2UA 1NZFA 3G2HA 3VUFA 3N71A 1GGNA 1SXPA 3IAAA 2IV7A 3TGOA 1KT0A 3DD1A 4X7PA 5EX3A 4AY5A 1P2DA 1Z8DA 2KCLA 5HQ8A 1JG7A 3KAEA 2Y4UA 1ELWA 2IV3A 3T7DA 4EL5A 5G04J 1RZUA 1Z6QA 1PN3A 1P2BA 2PZIA 3AS8A 3DDSA 1XL1A 4UI9C 4YI3A 1EXVA 1UQUA 5ENZA 3MTDA 4XIFA 5A6CA 2VGXB 2QRHA 4RELA 3CX4A 2PQNA 3MV3B 2SKEA 3L79A 4KBQA 5BNWA 5BW8C 3HYMB 3MSCA 2XA2A 2JJMA 1F6DA 3CV0A 2R4UA 2QLMA 3NB0A 5EKQD 4U04A 8GPBA 3TG4A 4CTNA 4WNDA 3CUYA 2R4TA 1C8LA 3QWVA 5KJMA 3URZA 1NOKA 3H4IA 4AN4A 2Q6VA 5LQDA 4GZ5A 4J8DA 3OTIA 3O48A 3COPA 4QLBA 3S7BA 2AZDA 4U0SA 1ABBA 1NVKA 3L7CA 3DZCA 3L01A 4UQZA 1QKJA 4W9RA 2XA1A 4RIIA 1VGVA 5TMBA 1E1YA 1OUVA 3QWPA 4KQMA 1XKXA 2OOEA 3NCHA 3VDNB 1KT1A 2GPAA 3CEHA 3ZCTA 1XNFA 2KCVA 1IHGA 4GZ3A 3OKCA 2V5FA 1GZ5A 3S29A 3SZ7A 4BFCA 1HLFA 2ECPA 1C50A 1GFZA 4JA9A 1JEJA 4LDPA 3UYKA 3HBNA 4I2WA 2XMPA 3RIBA 4FKZA 3ASFA 3ZCRA 4KXKB 2HY7A 1GPBA 3D0RA 5DXFA 2GM9A 4GA0A 1V4VA 4PQGA 3T3GA 4WHMA 3ZCPA 2KS6A 3ASHA 3TSAA 4X7MA 1P5QA 3RSZA 2XCIA 2JZCA 1FU8A 5I45A 5G04C 4ME2A 5D0OD 3C4QA 1SXQA 3IA7A 1LWNA 4UI9J 5IKPA 3PE4A 4U07A 4NC9A 2WQHA 2QNBA 3G2JA 5FZRA 2SKDA 4NEQA 3OKAA 3ZCUA 5GPBA 4NESA 3BCUA 4MI9A 3GZ1A 4F97A 4GA2A 4G24A 2IEIA 2QN8A 3LPZA 4UQXA 3WXXA 4EJ2A 4WADA 2VGYA 2GEKA 3GUHA 4N9WA 3GW4A 4CGVA 2L6JA 5HI7A 4BT9A 3S7FA 5D01A 3TAXA 3NP7A 4N3CA 5G05J 1L5RA 4RENA 2O6LA 3E3NA 3UQ3A 1L5QA 2KATA 2WPVA 1YA0A 2IYAA 2X6RA 2XGSA 4I9CA 3CKBA 5D0QD 4REMA 4AM9A 2PQ6A 3EBPA 4MHSA 1FA9A 4MHOA 2XCUA 3CUWA 1L5SA 3ASGA 3ESKA 5D00A 4APOA 5FZSA 1AXRA 3FP3A 2BISA 3O3CA 2ZB2A 4Z5XA 1FC0A 3E4BA 4N2SA 4GCNA 3U3WA 5CCMA 2PRIA 2X0DA 1HXIA 2QN9A 5FT9A 4N3BA 4CTMA 3CV3A 2MHKA 4N2QA 3MRTA 4GYYA 5JTTA 1P4GA 2GPNA 2GPBA 4I17A 3WC4A 5JJ7A 2SKCA 4X7RA 5HXAA 1P29A 3R9AB 5JJ6A 3BEEA 1K08A 2XCCA 5IKOA 3NF1A 1WW3A 3C48A 3CVNA 3QWWA 1WM5A 3MV2B 2HO1A 4GCOA 4HOUA 2PYDA 4J0UA 1P4HA 4F9FA 3ZCSA 4AIFA 1E96B 2C1ZA 4U0UA 2FBNA 3CK7A 1JIXA 2R66A 3Q3HA 4M83A 2VCEA 9GPBA 4BWRA 4G2TA 1XOIA 4YVOA 4FZRA 2Q7FA 3EBOA 2AV6A 2BGTA 2FETA 2G9UA 3HBJA 2FI7A 4EKEA 4CGWA 3ZCVA 2DBAA 3DDWA 4KQ2A 4HOSA 2AVPA 2Y4TA 4F3VA 3AS5A 4N3AA 2G9RA 4BQFA 3UPVA 3VTYA 1FTYA 1WUTA 5TMDA 3OY2A 1NOIA 2VQ2A 3AS4A 4HORA 2BUGA 4AMBA 3MA5A 2QRGA 4BQEA 1B89A 2R60A 2VCHA 4HOQA 2XA9A 4YNDA 1FU7A 2VG8A 2XEVA 5G05C 2R5SA 4RIGA 3BCSA 3KD7A 4BT8A 4G25A 3G2NA 3QKWA 2PL2A 2P58C 3LY7A 2H1FA 1Y8MA 1FTWA 1L5VA 4HLNA 1FS4A 2UY1A 2QZSA 3RO2A 3T3EA 2PYIA 4WUYA 1NA3A 4WNGA 3E3LA 4I2ZA 3NAZA 4I9EA 1IXYA 3CEQA 1Z62A 3MT8A 2QLLA 1ZU2A 3OY7A 5A7DB 1HZ4A 4RBNA 3BD7A 5JJTA 1IYGA 1XL0A 1BX3A 3BEOA 4MI3A 5TMEA 1PSWA 2F3UA 4HOTA 2YJNA 4GYWA 3T3DA 4F96A 1UZUA 2C2LA 2ACVA 3NPAA 3G2IA 3L7DA 1C8KA 3IEGA 1QM5A 2LSVA 2E2EA 3EDTB 4GPKA 2FFRA 2XCBA 4Y6CA 3MTBA 3AMVA 5FZQA 1A8IA 3CEJA 4O6FA 1WAO1 1LWOA 3OXLA 3H4TA 1Y6FA 4I1AA 4RIEA 1NLMA 3ZHEB 2HR2A 2AMVA 4RG6A 3TOVA 4X6LA 2IUYA 1PC2A 2IW1A 3K9IA 3MTAA 2LNIA 2C0MA 2XGMA 3MS4A 4A1SA 2P6PA 2ASVA 4Y6WA 2F3SA 2R68A 2F3QA 5JTUA 3T3HA 4BQIA 3UYLA 4L22A 3VUEA 4U0ZA 4MICA 3CVLA 1WUYA 2QRMA 2OFFA 4M60A 4YUAA 2GW1A 5KJKA 5FJYA 2I6HA 5KJLA 1GPYA 3GPBA 4EQFA 3MKRA 4KQ1A 1WV0A 4JA7A 3MEKA 2GEJA 3NC4A 2IYFA 5KJNA 3CUTA 3S27A 1YGPA 3FWVA 1YA6A 1O6CA 4GYOA 5EX0A 5AYWD 1WW2A 2G9QA 3MS7A 3ZN3A 4EL0A 2F3PA 3LY9A 1M5RA 3CK9A 3SF4A 1RZVA 2PQRA 4G2VA 5LCWJ 2QLNA 2J9QA 3OT5A 3ZPJA 3BD8A 2GT1A 3S28A 3Q3IA 2G9VA 2VGXA 3ASDA 2KCKA 3D0QA 2QN7A 3WAGA 1RRVA 5DLDA 2XPIA 3Q5MA 2XGOA 3RO3A 1H5UA 3LKUA 1ZBPA 1QQEA 3L7BA 5FTPA 3Q15A 4G1TA 4GA1A 3OXFA 2QN1A 1FTQA 3BD6A 5BT1A 2ACWA 4W6QA 3OXGA 1GPAA 3D1JA 6GPBA 3MQFA 3T3IA 4G26A 4BTAA 3CUVA 4N5CA 3ULQA 2UWJG 3ZGQA 3RT1A 3T5TA 4GZ6A 1AHPA 2FF4A 5CCLA 2LSUA 2UY1B 1GG8A 4JL0A 4WNFA 1TJCA 2NC9A 4NRHB 1KTIA 3MRVA 2IF4A 4H7YA 3QOUA 4J8EA 4HWGA 4XI0A 2YQ8A 3CKCA 3RU0A 1UQTA 3Q47B 2VYIA 1Y8ZA 3SYMA 5M72A 3LY8A 4WNEA 3QHPA 3VDMA 3OTGA 3CEMA 1Z6PA 3ZHEA 2X0EA 5CHEE 2JLBA 1J39A 3C4VA 5C1DA 4N39A 4NQ0A 3CVQA 1E4OA 3MBOA 4MRAA 4XI9A 3E3OA 2KC7A 4AMGA 3ZCQA 2VSNA 3RJVA 3Q3EA 2VSYA 4BTBA 4CDRA 3GZ2A 4YVQC 2ONDA
chains in the Genus database with same CATH superfamily
3HXTA 3NIGB 4DSAA 1IXKA 4HQNA 2DETA 2F64A 2FWBA 4AMZA 4A2CA 3DPSA 3R3SA 3C5WP 1BU5A 3WYGA 1ZCBA 3AETA 4DR1B 1Y4DE 2QFCA 4ANVA 3F97A 1ZM3A 4GUDA 1DFGA 4YGXB 3H2GA 4UAGA 5JC1A 3KSBC 5KTPA 1XQ1A 3BB1A 3NQ41 4TM7A 4ATZD 4HTFB 3UMFA 4DIKA 4MTLA 1KZ6A 4ITUA 4HH3C 5JBQA 2H1LA 2QSJA 1HDCA 2GEBA 3UJ9A 1IDN1 1Z2EA 3HDGA 4HAWA 3VYRB 5I9TA 3MYVA 3CF4A 4HZUA 5DZSA 2WXJA 4M98A 1JKJB 5JVDB 2X15A 1RWVA 1GSIA 3I28A 1GN9A 4H6PA 4AB1A 4ZJPA 4XVUA 3G5LA 4KVZA 4QTXA 3H2KA 3WFIA 3WYEA 1OX4B 4F3YA 3U7HB 2A9VA 2DZOA 2BMDA 3OWOA 4F6RD 1KJ9A 4CT4B 2A1TR 2WJ6A 1LPPA 2DPYA 3H9EO 5JHAA 3FWZA 1DXYA 3ZFWA 1V54E 1ETHA 1LX6A 1UMDB 2W9XA 3IOCA 3SXUB 5EHGA 4GVXA 1K63A 4RIFA 3OD5A 3T4UA 5EZYF 1U2EA 1SBNE 3SS7X 1W5FA 1Q0UA 4QBFA 5E9AA 3T0GA 2G09A 3WBJA 2B8WA 1C9EA 3C3AA 4FI3C 3S68A 1ELOA 4ENUA 4JVOA 3O94A 3P1UA 2ZSUA 4I7EA 1NOJA 4MZDA 2ZT6A 4UNQA 3UIPC 2AXPA 1QE5A 3ORQA 4GECA 4K9NA 5GJVC 3WQSB 1E8DA 3GNTA 4JW1A 3KXDA 4GRIA 4Q6BA 1AD2A 1NVTA 5IVKA 5KOHA 1C4KA 1NBAA 2EIXA 3PEUA 5AHRA 4MUKA 3JQ7A 1VKJA 1LI7A 1KVUA 4DXDA 4ZZ1A 5AHXA 4K2HA 4HI0E 4RIHA 5IXYA 3MTEA 1G66A 4PZLA 4V39A 3L9TA 3A31A 1X0VA 3FHJA 2R6ZA 3FU6A 2YWDA 1KH2A 1YDEA 2A5FA 3OKPA 4NYMR 4TUYB 3OT1B 3RNOA 3T94A 3WMEA 1T9AA 4Z4GA 1Y7TA 1W5AA 1CNMA 1VYHA 4BX8A 2C20A 4N5MA 4CTOA 3C3MA 3DZDA 4Q03A 4J0DA 1T2NA 1NF8A 5IM4A 3F9CA 4KR2A 1TYAE 1C0KA 3O1JC 2PPVA 5ENPD 2CZCA 3PKJA 3Q3GE 2Q8PA 1O1RA 1UZLA 4Y0NA 4DV2B 1D9SA 3CT4A 4JV5B 5JT1A 5KYKA 3F7MA 1ZGHA 4G0PA 3ITEA 4QGAA 3WOHA 4YJ3F 2AQKA 2CV2A 1T0UA 3T7DA 1VHTA 5ER9A 4ATNA 5HUHA 4G0OA 2AW5A 2Q5OA 2Q5QA 5ECDA 1BH2A 4B6GA 4UZFA 1GKIA 2HK8A 4LXYA 3VU9A 2GRUA 2EQAA 1RQ7A 3LUPA 1TJPB 1C7JA 1ZGAA 1JMVA 2NSYA 4KT6B 1CUBA 1ZMXA 2GXUA 2NVWA 2QJWA 1B6RA 2O57A 3JU3A 5E6RA 5A5VA 5HOQA 1XB2A 2BM0A 3GGOA 1IYZA 2WJJA 2YX1A 4XFJA 3TM4A 2WAOA 3QA3E 1DKQA 3GF4A 2WFLB 1B0PA 2FK8A 3A7EA 3B20A 1NL3A 2WUFA 3NTVA 1AGPA 2QLMA 2VTEA 2XMZA 3D3NA 4K05A 5G4LA 1DMSA 2HMSA 5JPCA 3MCTA 3O5AA 3OM9A 1GL9B 4TRQA 4MRUA 2I9PA 3CH6A 3ZQ4A 4ZDJA 3QWVA 2DBZA 3GDOA 3QHAA 2OHIA 3KSQA 1GZ7A 1I1NA 1KK1A 3HDJA 4UNIA 3R7SA 2DE0X 1SHZA 2HPZA 4C4OA 3IERA 3SXUA 2Z2YA 3LVFO 2BFBB 4U0SA 3L7CA 1SQSA 1QPGA 2D62A 4NSNA 1ENOA 3KWLA 2OK7A 1L4NA 3Q10A 4C7VA 4PLFA 1YS7A 3HRKA 4J0HA 1WMAA 4JLUA 1PF7E 1TVCA 4AUNA 3TEJA 1TAUA 3JQAA 4RIIA 1WOYA 3TIIA 4D9JA 1K1BA 3MWEA 4TS3A 2OO5C 1I4TD 4KQMA 5AI5A 4KH1A 5J40A 1ORDA 1J8VA 5A6SA 1ZVQA 1ZW1A 2O2ZA 4ACKA 2QJTA 3P96A 1KO4A 1QB7A 2O5EA 3UA3A 2PYZA 3EXAA 2PH3A 1JHRA 5H80A 3ZCTA 2FSIA 1JSXA 4DNXA 3NBZC 1H05A 2ZRDA 1E5VA 4EFLA 4B0OA 5K0SA 6GPBA 3EAGA 4NXMB 2ETBA 4OQFA 2RHCA 2ZBQA 5LZ8A 3P52A 5KNDH 1Z7YA 3EGWA 1R74A 3AI3A 1L7AA 1CZKA 1UKEA 4FR0A 5FFNA 4ZCPA 3HYTA 5TJ9A 5BMVB 3FVTA 1M34B 1Z63A 1QMPA 1V3QE 3A2LA 2X8JB 1F38A 3HHEA 4PYOA 3LQ2A 4Y1RA 2WHPB 5I7UA 3CLSD 5JROA 1A69A 1EP3B 3QLUA 2IOSA 3JWHA 3KQYA 4BMSA 2XX3A 4Q9JA 2JFPA 5E2IA 3OIWA 4P53A 5DF1A 4PQGA 5BT9A 2XYPA 3OOHA 3L17A 1SBIA 3SBOA 5CA1F 1QRTA 4MB2A 1J0CA 4UEJA 3JQPA 3NATA 3VU0A 5ENQD 4RVUA 1CG6A 3OQIA 4DUPA 4KO8A 1ACMA 2HT6A 2IIVA 1C3EA 1OXXK 1RIIA 2ZSHA 3TL6A 3TSAA 1KFKB 3IIKA 2XCIA 3HZOA 3CHMA 4V03A 2X41A 1NJ8A 3IDAA 4OSEA 5FNZA 3UHJA 2Q1UA 5CEFA 1QYVA 1WP9A 5AQEA 3T3PB 4CMEA 3QJ5A 1WXFA 3NORA 3JAMA 2QD4A 3DPIA 1L8LA 4DILA 1F1BA 2OD7A 1VCOA 4RW0A 4NESA 2J85A 4OFBA 3GZNB 1T8PA 4KL8S 4XDHA 2X5JO 3HCFA 4ZGGA 3KR1A 4F3TA 2FRDC 4IO0A 1GZHB 1SVXA 3IHVA 2ANBA 3G0OA 1J09A 3H84A 3P4XA 4X60A 1QGOA 2VJOA 3Q7FA 2FOXA 1O5MA 3DV0A 3OE7A 1T3LA 2WLSA 2XHZA 3AKEA 2WXKA 3MJVA 3E81A 4H3KB 3PRHA 4IIXA 4XD7D 3R76A 5IKEA 1RZRD 2PWYA 5D01A 2QU8A 3A3KA 4TPKA 5CXUA 5KU7A 3W4JA 2RARA 5JCPA 4Z51A 4X91A 4C7KA 1E6CA 4W9NC 3W0LB 2OP1A 1IOZA 1GRVA 1TZJA 2WPVA 1A9SA 2GQ0A 5C3UA 5K3SA 1N36B 4C29A 4W5QA 5T3RA 2ZRHA 4R1MA 3RAPR 1ZJJA 4QUHA 1NC3A 2VHYA 4D9NA 4F8YA 1NM5A 1EM8B 2DFDA 3FH0A 3OEYA 2WWIA 4IJVA 1TA0A 3FPLA 1SMKA 2C07A 1U3DA 5G0SA 3KYJB 4YUVA 3TFWA 1FP7A 1V4BA 3OM1A 3AF1A 3ETGA 2E18A 3HXQA 3QFFA 2VCYA 1IHDA 2Z83A 3GU3A 1PVVA 2BI7A 1QKKA 3U9LA 4RDHA 4WA7A 4OI1A 1IG0A 1JWLA 4LZNA 1IUOA 1Y89A 2LAIA 1FFCA 1PJSA 3CUWA 3QUCA 1N1DA 1YRYE 4FIDA 4FFVA 4CF7A 3KEQA 1PUJA 4LWQA 3MTIA 1NYQA 4LSWA 2ZB2A 4NYJR 1TO1E 4PZEA 1TCVA 4RC9A 3CMCO 4DUYB 3MGKA 3PTZA 1ZSVA 4DARA 4OQ4A 1DAGA 4TWJA 2OD2A 1QO0D 4KTVE 4KRGA 3D4NA 3LBAA 1O54A 4Q15A 4ZT6A 1FQWA 3REQB 3VHQA 3FWKA 1KERA 1U7WA 1XRRA 3NHWA 4BO8A 3BTOA 2WU0A 2FSVC 2RG7A 1XMSA 1VZ2A 4NEHB 2H06A 3RVPA 4LJSA 3RVNA 2SKCA 2QG9A 1RI2A 4AYTA 1HK7A 2AFIB 2GK7A 5IMSA 4P29A 1CNFA 1MVLA 3LQRA 3IS3A 3PGA1 3DT9A 4ZOAA 3TD9A 3FPJA 1L5ZA 3L04A 5HUQA 1R0ZA 1WS6A 3A11A 4BTEA 1G1AA 3AG1E 1GLGA 1LA2A 3V2GA 1VL2A 4UMVA 4EMTA 1KAEA 3OLQA 2V9CA 1USIA 2PQ2A 1B15A 2JKVA 3OFVA 1Q12A 4IKEA 2JLXA 2FA9A 2FBNA 3AU9A 3WV5A 4MGZR 1AX9A 3VR5H 3TF5A 1T35A 2XB9A 5KNCD 3T4EA 5JV5A 1SCQA 1ORTA 3OEHA 2G7ZA 1VSUA 2GPJA 2X0NA 3CKLA 1ONPA 3UWSA 5KUTA 3PLAE 5A5DA 3GZNA 1K6IA 3RYHB 3Q4GA 1ZMBA 3ZYQA 4TGLA 2RHJA 1UPCA 5K03A 2WHEA 6ADHA 3MTGA 3F6RA 4ZGWA 4BP1A 4A8PA 3RVRA 1E6LA 2EZUA 2QROA 4NNOA 5KYTA 2E4YA 1ND6A 2W4IA 3RU3A 1QUEA 4TX1A 1NT2A 3IRVA 4OQXA 1Z0DA 3QAQA 3AI2A 4TMYA 5TNXA 4LHZA 4KPYA 5D3MA 2L6BA 1K5GA 5HCUA 3C87A 4C08A 2QGZA 4EABA 1X80B 1WPXA 3GAFA 2CD9A 2CSUA 1GHTA 2L82A 5L9AA 4BQEA 1YT5A 1WG0A 3FETA 3WWYA 1KDTA 1RWQA 4LKRA 3E4DA 4RSRA 3WVNA 5EJ8A 4L8WB 5G05C 4NDZA 1MT0A 2I2CA 2VA9A 3A32A 4K87A 4L9SA 2Y1KA 3ES9A 2FLVA 3DUFA 3FMIA 2C3YA 2YUIA 3ITKA 4MH0R 3D8HA 3F1KA 3LY7A 5AJZA 1NZJA 2JA1A 2LD4A 4CG3A 1U5BA 3BILA 2NAPA 3HDYA 4CODB 4A36A 3RBAA 4MRRA 4DQUA 3BWMA 3GVIA 4PINA 3ULKA 4YYEA 1HOTA 2WIKA 4EDHA 2HB6A 5DGDA 2EKLA 4IX1A 4F84A 4DRXE 3D0OA 4JL5A 1OSNA 4OBBA 5AW1A 4JYBA 4M1EA 3T5MA 3ZE6A 4D44A 1GTMA 4LXTA 2EFJA 1PT6A 3MERA 3O8NA 1IIBA 1Q21A 5A7DB 4FYYA 1HDEA 4RF3A 3TFQA 3V1MA 1A9YA 2O4CA 3N05A 3VU3A 1T2FA 3T9DA 2PBRA 3NHBA 3BEOA 3GGPA 4LW8A 2EZ4A 2J5KA 4FCWA 1NBMD 3CNHA 1CYEA 4AP2A 1V8ZA 3R4VA 3OLVA 2OQRA 4QPCA 1B8OA 4G5GA 4TMWA 1A8HA 4P7FA 3WO0A 5FA8A 5E8JA 3BH0A 5CB4B 4LX8A 1OE0A 1Z36A 4MUNA 1IK4A 1VG0B 1ZCZA 3JPYA 3MTBA 2X22A 3KHSA 4DQKA 2IHBA 2CJWA 2COUA 1JLRA 1Z3YA 2IPNA 1EDUA 1RMYA 3CEJA 1Z08A 3MYYA 1QC5A 3UCXA 1RQLA 2Z6VA 2CHZA 1Y6FA 4RIEA 1U7HA 4M9ZA 4UTZA 5GVRA 2MU1A 5JNRA 4ZAWA 1T0PA 3NW9A 2EFGA 2FZLA 1OXBB 5KYGA 4EVIA 3V7WA 1RD4A 3JZMA 2IHKA 4WH0A 2ZAIA 4BGDA 1IY2A 3PGLA 4JP2A 4K5AB 2XGMA 3NAWA 1FDIA 2GZHA 3AVOA 3M6FA 4HNRA 1U3UA 2NO4A 1GFWA 2R68A 3O0DA 4OIMA 1IH8A 3LGXA 3WIBA 3AVXA 3VUEA 5L6MB 2VJKA 4LCEA 3CTPA 5ALUA 3AHIA 3NBYC 4EGCB 3DMYA 4FN4A 3PS6A 1V7ZA 1H0SA 2AMYA 4HJRA 4QU5A 2HW8A 4GE3A 1DQZA 2C4HA 1TF7A 3LC7O 3QZUA 4A6EA 1QG4A 3U4QA 2JIRA 3TOCA 4AW9A 3NNDA 2XNSA 3SXPA 2DFPA 1WOMA 2NO0A 4GLLA 3HTXA 1TUGA 3UV3A 6REQB 1NUHA 521PA 3FMFA 4KXYA 1KZ4A 3LDUA 3OJ0A 4CE6A 5AICA 3KYCA 3FBTA 3ADKA 3C8MA 1M5RA 1ZJWA 2PX6A 2ZITA 1M8FA 1B42A 3Q9LA 4IMRA 3F5DA 2OCDA 3R5FA 3ASYA 2AJCA 2EBWA 2NSLA 3CZ5A 1E2NA 3Q87B 1QQAA 3CG4A 1Q0QA 3A8TA 3CKYA 4D1YA 2CF5A 5IPFA 1PGQA 2BMJA 2B1IA 1U0EA 2FPKA 2GPTA 1VLMA 1TNBA 2NZWA 2PSJA 4P32A 3TB6A 2D8MA 1PJCA 5COAA 1AZWA 2ZP1A 4UVIA 4E5SA 1M6VA 5MFPA 5EHIA 1VG1A 4CM8A 4EJMA 1L7QA 1CU1A 1XYGA 3KJIA 4NIMA 1UIMA 5BOSB 3ABME 1AWCB 1Q3KA 2BFFB 2OP0A 4P3KA 4XPIB 4D96A 4ZU1X 4ALNA 3ZRHA 5BMOA 3K72B 2WWTA 3F6PA 3KU4A 2OUKA 4PZDA 1L2TA 1SUPA 5LIRA 1JB1A 2PWAA 1EJ2A 1ZN8A 3BSSA 3IP1A 4I9HA 3ZBQA 4U7PB 4YCNA 2X6FA 3H7IA 2OYRA 1O4WA 1T9GR 3MCXA 1II0A 1TMOA 4G26A 2HV8A 1LS1A 2L19A 2WUWE 3C7DB 3BE5A 3GJ0A 3RTEA 4E21A 1NIJA 4N5LA 2D7DA 5ENTD 4J43A 3WWOA 4DLAA 2YWXA 2QKYA 2Q4TA 3A6FA 3SZGA 1IN8A 1G3RA 4DT1A 1BRTA 4DA9A 2DWQA 4L76A 1AKUA 1G41A 2J7PA 3AF5A 2IF4A 4GWGA 4F46A 2BKKB 3QOUA 4MDFA 2ZKIA 2AN4A 4UQLA 2YQ8A 3HG7A 1GPUA 1VPDA 4HFRA 4KBFA 3K1JA 4KRYA 4FDAA 4I1IA 3RRUA 4ENPA 2LCQA 4JOQA 5BR4A 5HE9A 4MW5A 3OZ7A 4EG8A 1SY7A 5CEAA 3RKUA 5BYKA 3EVFA 4EO4A 4BJ6A 5DYNA 1IHOA 4QGBA 1Q15A 2YMLA 5JSYA 3B8EA 2E6KA 3CT6A 1UJNA 5CHEE 1TL7C 3PL5A 2BKLA 3AIMA 4G1MB 1T3TA 4LZOA 5C0OE 1SB8A 4A1OA 4NQ0A 4WW0A 1JJ7A 2NU7B 3ZWAA 2XSZD 1ZIYA 1AKVA 2Q5HA 3E3OA 3EVCA 3T8KA 1OY1A 2OV3A 4LBWA 4CKEA 1F9AA 2RKKA 3ITWA 4GOMD 3WNBA 1W8IA 3ZBUA 2FPSA 5FFFA 2VTDA 1NJFA 3RADC 3HVKA 3R9XB 1A9PA 4YRMA 4O1MA 3SPXA 2ZRGA 3EC2A 1K0FA 1FCHA 3LF2A 4E5PA 4I43A 4RACA 1FFGA 2KBEA 3KB2A 4Q82A 4LK2A 1ZL2A 1PKEA 3MB5A 1XDGA 2ZJYA 4QUJA 2QX6A 1L1QA 5ECYA 4GMLA 4TLEA 1YCFA 2IYNA 1CUFA 1C80A 4YUWA 2ZYGA 2ZFUA 2W8BA 3P9XA 4QOGA 1AQIA 1B73A 2JJQA 3LYAA 5H83A 4P0QB 3RU7A 2L2QA 3S7DA 4Q1AA 4IQ4A 1UWLA 2OBYA 3FBGA 4X3CA 4KK3A 1DAHA 1VPWA 3KBBA 3BF7A 3NB2A 2PX2A 4FC6A 4NULA 4HFJA 4NYIR 1W25A 3OZEA 4NMMA 2PNFA 2I9CA 1N2OA 1WHSA 2DU8A 4P3XA 4RJ2A 2F0YA 1IXZA 2X4GA 1OR8A 2R25B 1HDXA 2CFRA 5F3RA 4K5QA 3UPTA 3ZHYA 1RXIA 4R68A 4B1FA 1LI4A 3C24A 3KOXA 1GD1O 4LISA 2I33A 3G2PA 5JBNA 5TS2A 5ALZA 3FH8A 3CLUC 3PFNA 2NUBA 2JFOA 3D0KA 3W2EA 2F1RA 1DLIA 4IF4A 4KB5A 2CLSA 1UKCA 3BWVA 1VXRA 3QVOA 4JSYA 1MW8X 1VBKA 2AFIE 4I50F 3MS2A 1WLYA 4KFUA 5EMMA 1Z6XA 1C3JA 1XAJA 4MLZA 3LAWA 1NN3A 2WF9A 3NTLA 4ERNA 4TLBA 1P0IA 4LZAA 3STWA 2EZTA 1I9CA 1Y6ZA 2A8YA 4XQGA 1Y5IA 4O25A 4AJOA 3EUFA 4H1HA 4AJJA 3SK1A 4QTTB 4K9KA 1IOWA 2ZS7A 3DVAB 2QE7A 1A8QA 2YV3A 3EVZA 3WSVA 3O4ZA 2P5TB 4PYIA 1OZFA 2XPZA 2WM8A 4M37A 3O03A 3Q12A 4OQZA 2V6MA 3MELA 1G16A 4OM8A 2X0FA 3WGMA 1N5DA 4J75A 4UMEA 3EYWA 2NMVA 3H5TA 4MW6A 2YWBA 4RPJA 3LZ6A 2BCJQ 2Y76A 3M34A 1JQ5A 3GGDA 4U9HS 1VDMA 3QEJA 2VRCA 4XTCS 4CM3A 3DT8A 3WLLA 5JJCA 1OA0A 1GGNA 4Q3BA 2AG0A 1Y8RB 2GNPA 3A6JA 1VE3A 2UKDA 4HGZA 3BGVA 3ZWCA 3DSXA 2LDXA 2ZPUA 3ZDQA 4EVSA 2C3UA 4AV7A 1ZJ5A 4FBGA 2KCLA 5C8YF 2HYIC 1FLAA 5IJZA 3O9ZA 3VTKA 1ECLA 2PANA 4RA6A 4Y6LA 5AIBA 2QB5A 4BATA 4L5AA 3CJRA 1PLLA 4HGQA 4YQYA 2YZ7A 3IXQA 3I92A 4MKFA 4UI9C 5EHQA 1EXVA 3L6EA 4CFSA 3V8NA 1MR3F 3AF2A 3BTUA 1IVNA 3MTDA 3S8EA 1XZPA 1SQMA 5CH5A 5HF8A 1G8YA 1ZOOA 5LXTB 2J6BA 2XOXA 3ZW9A 1DBPA 2KSQA 3U26A 4QDUA 3ZW7A 5I7WA 4V02A 3N8IA 4M54A 5E4YA 4ZAVA 4UUAA 2PMDA 5DCYA 5F7OA 3D7SA 2GRNB 2I1JA 2BHNA 2O2IA 2YRXA 4RF2A 4NV1A 3NB0A 3R3XA 1HC7A 4B3CA 3C6XA 4X0EA 3LLUA 5CIWA 5JRZA 4B4VA 4UUPA 1PX0A 1HE5A 3I9FA 2HCBA 2OUIA 2UYOA 3ESAA 4DMGA 4PLGA 2RG1A 4BHTA 3FLBA 1R0WA 4J8DA 2BEKA 4RHEA 3DSVA 1V1RB 3IEIA 2TMYA 1UZNA 4TV8A 5REQB 3SFTA 4B79A 3VJRA 4Y2PA 3PC8C 2PIAA 2WXGA 2UVDA 3SO8A 2BF0X 1JA9A 1PUIA 1ESCA 2B4TO 3E7XA 2ZG6A 3IVMA 5IC6A 1HX7A 4EBBA 4IGAA 1SHKA 1WY5A 1SU7A 2I2FA 2XA1A 2QHXA 4DCUA 3HIZA 3HVEA 1SN7A 4ES6A 2OB1A 2PBZA 2PUCA 4CTJA 2BE9A 1QK5A 2AI1A 2EZ8A 3MUEA 4M7RA 4UXHA 3TTYA 4DLTA 5C8ZA 1KHTA 1T2DA 3FIJA 1EFDN 4H0CA 1DTEA 1PD1A 1PUXA 2OFWA 1XNFA 3P9NA 3PITA 4WSOA 1H5QA 2J5QA 2V5FA 2XQJA 4Y2YA 4DSZA 4G8LA 1WQ4A 2WAAA 4KRXA 2VUTA 4DS3A 3WBFA 2NSJA 1GGHA 1ZJYA 3JQAB 3CVWA 3PNPA 1GFZA 3RFXA 1KKUA 1F5SA 1ZCAA 1DWUA 2IYVA 1RXEA 2A94A 2OCLA 3U3RA 1HORA 4A91A 4PU0A 1PAUA 2IHTA 3C45A 4JQSA 5H16A 4NK5A 1B8VA 1BE6A 3D0RA 1N75A 3V2XA 4TSKA 2BM8A 2R5NA 3L0CA 1P1JA 3A9CA 3EBLA 4QHTA 4D8YA 4NARA 2HJGA 5I9LA 4LG1A 4WHMA 4YRAA 3PJGA 1KAQA 1XEXA 3K09A 5DW3A 2GKGA 3OPQA 2FSGA 2XBUA 4OYSA 2G5PA 3PQFA 2RCYA 1AU9A 4MNTA 1QIJA 4RABA 5TGTA 4DDHA 3FNGA 3TSYA 4BCCA 1EM8A 1QHYA 2CDCA 3DKVA 3EIUA 4IEFB 2JL1A 3V1TC 3JAKB 1T0IA 4J4HA 2V6IA 4EQ6A 3NM5A 5FBHA 2J08A 3NLLA 1BE1A 2OKCA 4QQFA 1FFWA 2VTVA 4YRIA 1F14A 1SIBE 3W3AA 1SA0A 1SVWA 2F6RA 4PVDA 4E5NA 5DNWA 2XXAA 3BCUA 4KMMA 4EA8A 1E20A 1THMA 4QOJA 2O7NA 2QLFA 3MJCA 4P7GA 1A2BA 2XVXA 1R3UA 3KWFA 3L6UA 2X38A 4FR5A 5C4MA 3I9KA 2G4LA 3H9CA 3S70A 4UQXA 1T5IA 5KNGA 2ZQYA 5CAEA 1SWWA 5ANRA 4IV0A 3OJFA 1WG8A 3C3QA 2GYVA 1H2HA 2CYCA 2EW1A 5EJAA 1YS2X 2CE7A 1NQUA 1Q22A 4N3CA 3OHPA 1DEAA 5J9FA 3ISTA 2FW6A 2O2CA 4FGKA 4MWCA 4DMCA 2PX8A 2FAXA 4Y9SA 4F21A 4I5FA 2P5UA 2QSZA 1DBIA 5ERGB 3BXEA 5HFJA 5KNBD 4HC4A 1LGYA 2WJGA 2WVGA 3LTNC 4GSKA 4W7IA 1TMYA 3U4DA 3G0CA 2Z57A 3RF7A 3V9AA 3VNSA 2PT6A 3FTNA 5BSFA 3TIVA 1JPVA 3Q79A 5HTKA 5KO2A 2WJPA 3A06A 1K3ZD 1GPDG 5EMHA 4WI1A 2PKYX 1CZUA 3KOYA 3NOQA 3PHLA 2JIDA 1YS9A 3W9BA 5KTKA 4PS0A 4QUIA 1E18A 4MHOA 4AY2A 3AB7A 3EY9A 3KKZA 1T4CA 4LDJA 5DVZA 2VSXE 4GZDA 1T1RA 4UTXA 3SLKA 1OY3D 4BFTA 2Y8EA 4AZSA 3AUSA 4QDTA 2AUTA 2VP6A 3UCFA 5K8UA 3LHKA 1CLUA 1JLKA 4HEHA 2P68A 3AJAA 4G5YA 1EBUA 3QTTA 2Y77A 1CQJA 1ONOA 3UK2A 4PIVA 4CTMA 5DLEA 2C00A 1U8UA 2WYOA 2WWYA 3U3DA 1A2QA 2VPWA 5JTTA 5EN5D 4J49A 3SAJA 2CSXA 1CJSA 4OAVB 4CU5A 1DKMA 5LLDA 2IZ5A 4MQ4A 2A5YB 4C9BA 1XCBA 1QAMA 2XDYA 1YFLA 3WA6A 4MWDA 2GCNA 3U7QB 4ZQEA 2LCIA 4X3OA 1K08A 4DFDA 1T15A 3KVYA 4IIBA 1RTKA 4EUFA 4IUDS 1AKMA 4HH0A 5EIBD 2E4XA 3LLCA 3RROA 1FDUA 2GWHA 1A4RA 2YQZA 1ABEA 2HWKA 2WZBA 5TJHA 3LJKA 4QRHA 3MMZA 4HNAB 4U7GA 4LIPD 4IGIA 3T1OA 4BWGA 5CB6A 3F46A 5DJ5A 3OSZA 3J7TA 3RTCA 3R5SA 1KYVA 1UXOA 2ES4A 3B7WA 5I48A 4G2TA 1I1HA 4Q3LA 3ROKA 4S0XA 2ZM6B 1N2CA 5AVKA 4EHBA 3DBLB 4M0CA 1S8FA 3H11B 3ZHQA 1KVTA 3K70D 1UDRA 3B1WA 4INZA 1W6UA 3CUEF 4PCLA 1HI9A 2NYUA 1OLXB 3DEKA 1EH5A 3LVBA 1P0MA 4QLOA 2WJZB 4M3NA 1Z6TA 4AF7A 2WFLA 4Z4QA 5IN4A 5MHTA 1U31A 3ZLVA 1M5TA 1NVVQ 2XENA 2D2VA 1IM5A 2GN9A 3KKMA 1YJ8A 4R69A 4IHJA 4BB5A 2HBQA 2B34A 3UJ6A 3L8GA 4KIWA 4D9CA 3I9V6 1E3EA 2VJLA 1UBRS 3FUIA 4ANWA 1PD0A 3KD7A 4WOCA 2RJ3A 4YASA 4FE3A 5JZBA 1LI5A 1JMYA 3RTDA 1LVGA 3V4PB 4TYWA 2G9NA 1IQ0A 4EBFA 2IYTA 3K9WA 2PGNA 2DYSE 1XHEA 2EFCB 3ANNA 4N9QA 3QH4A 1Q50A 4APFA 1E3LA 1TDJA 5GM1A 5A7GA 1KXZA 3I0MA 3OOEA 1U9YA 4U96D 3H9JA 4X64B 3CVVA 3GHHA 4HDSB 1KEKA 4RPLA 4EENA 5C1BA 1E3QA 3A6GA 3RYIA 2PZ8A 1W87A 3VYVA 2JFUA 3WGOA 1GG2A 5KC8A 3J7AC 4XYGA 4ARIA 5EMKA 4BETA 4MV4A 3RIEA 4BBPA 2O2EA 5C4IA 4AP5A 1BA2A 5CLIA 2AR7A 4P31A 3NDBB 2OXFA 3IO3A 3Q9NC 1OUMA 4IIHA 1QOPB 3U66A 2PT7A 1QYMA 5G0TA 4ZJUA 1XL0A 4G86A 4UMDA 1K75A 4D4MA 3M49A 2ZJ4A 2WIDA 3QXGA 4HOTA 2I9KA 1G2QA 1MBZA 2AE1A 3FDHA 4EHNA 4IRXA 1EK5A 3FTWA 1YK0A 3AESA 1UZUA 4RGVA 3GUZA 2OXCA 3UANA 1VIMA 3I3SR 3QMWA 3OEWA 3NC1C 4XWOA 5HJEA 5MFZA 2AJLI 1KPSB 5T4YA 1YE3A 1RJDA 2FFRA 3JYHA 3ICOA 4PXAA 3RRYA 1F0NA 2DUMA 3X44A 1IHPA 1OJ7A 1USKA 2APJA 2AJDA 2KWIA 3ESCA 2NO6A 4TLDA 4UHKA 3RG8A 2WYWA 2YL2A 4M99A 4I4LA 2WUGA 4NCIA 1XJQA 5FZQA 2SHKA 4TWIA 2X8WA 4YJHB 3L7YA 3M6WA 2ETCA 1D9ZA 1Y5NA 2PS9A 3O2JA 1JTFA 1KOLA 3NX4A 5JI2E 2C94A 1HM5A 5GGYA 1QFMA 1BWPA 5CHEA 4AKSA 2SBTA 5TC4A 5THKA 2FYTA 3EUAA 4ZARA 1CQPA 5HFAA 4CT4A 1ORIA 1RI5A 4Q9DA 5EFOA 3ER6A 1CUAA 2MINA 1LV8A 4AP6A 1WULS 3JVVA 4RZIA 3GPIA 2XDQB 3HM2A 2LIVA 3QKRB 1W88A 5F5NA 3FTPA 4BBZA 1CKEA 1TUIA 5BV7A 1MH1A 1V5IA 2OV2A 1XTQA 2YHAA 3H9UA 3QWAA 4CLHA 2PGLA 2BWJA 4GMKA 5A5EA 5AVJA 4LJKA 3M4JA 3FCOA 1JAYA 3FYCA 5CCEA 4G07A 4IAOA 1IY8A 3NKFA 3HXFA 2DT5A 1DBSA 1DXHA 4OEHA 1GQRA 3B7UX 1KZYC 4EPVA 5J2UA 1YCDA 3CLUD 3TUJC 5FJYA 4O29A 2NO9A 1NTOA 5GZ1A 5JAHA 3MKRA 1D5WA 1X9GA 1LBQA 3HVHA 4KW7A 4KQ1A 5LP1A 1LF8A 4H7FA 4BQRA 2J7KA 3KALA 3NU1A 2PZAA 1SC4A 4A4DA 3PZDA 1W581 2Z2IA 2P1ZA 2B78A 1Z18A 4F12A 4LZPA 3FCAA 1MOSA 3VSBA 5C37A 1O6CA 2EG9A 2XKAA 3L41A 4HB3A 4QGHA 3KKPA 1HSOA 1NW4A 3LCJA 1YONA 4KV7A 1CDDA 4GNKA 5T4BA 2OZVA 3OO1A 5U1PA 4WN9B 1CVLA 2XITA 1P61B 3EVNA 2GVNA 4H08A 1UDCA 4YWJA 1G17A 1V35A 3T5VA 4N76A 4DGQA 2B6NA 4Y2JA 4YMHA 2QTGA 1JYSA 5F4BA 1WUHS 3P0RA 3UXGA 4OLHA 2DKOA 4U7FA 5I8ZA 4ZI3A 4GICA 2XAAA 2QN7A 3VKUA 4MUBA 2XVYA 4C1BA 3FTUA 2VBGA 3AG4E 1XZKA 3AH8A 5KKAA 1JGTA 1ODLA 4TT8A 3OPYI 3BWXA 4V2UA 3OJEA 1GKYA 1F17A 3L7BA 5TPZD 4DCPA 1OZ0A 1USUA 4Z4IA 3UJBA 2IEAA 1CRZA 4G1TA 3S2YA 3USES 5JSQA 4PZZA 5BT1A 4I6GA 1UFVA 1SH7A 1S0UA 3AP3A 3TS1A 3SYLA 4KPEC 4NV3A 3OXGA 2ZI4A 1CJBA 1JPJA 3BTSA 1MJGM 1RQGA 1RE0A 3W2TA 1VMDA 2XT9A 1NBHA 3FYUA 3EFBA 5A1TA 3FTDA 3AF6A 3U39A 3JQ8B 2JJ8A 5B3KA 4DM3A 1PQUA 4BTAA 5IH7A 3IAS1 1L6RA 1BGWA 3M2TA 4Y9DA 4M9XA 3TPFA 2DHEA 2ZJ6A 3BBLA 4C0QC 3ZYZA 1D6JA 1YR8A 2QTRA 2R96A 3OKFA 4B6SA 4EW2A 3W90A 3WE7A 3QVXA 4B3IA 1Z0SA 4FZJA 2QZZA 1H2AS 1DARA 4ID9A 7AT1A 4FLHA 3MRVA 2HNKA 1ZUIA 3RAUA 3UI2A 3K5HA 2HRCA 1JDNA 2PO5A 1IBSA 4YJ2F 2V8SE 2CJPA 2GAIA 3JD3A 5M2QA 3IIEA 1G3QA 2OCXA 3Q47B 1OHHD 3ILSA 3T9CA 2GF2A 4HMPA 2XKBA 4F9EA 1CUWA 1EFHA 3QSGA 2JAQA 3FUFA 2WD7A 2WJHA 3VDMA 5I7VA 4DWWA 1FZTA 1EUDA 4AMYA 1X92A 3QUSA 4FZ3A 3P9IA 1XVUA 1Q1ZA 2AD5A 2JLAA 2VRCD 1M0SA 4HGNA 2EWMA 2YMPA 4N0PA 3CVQA 1D2AA 3BAZA 1FPQA 3Q8WA 1X8LA 2GGSA 2HQ1A 3OX3A 4EEXA 3J80A 4TUYA 3S2ZA 4TKZA 4MWSA 2IODA 3UGKA 5AQ1A 2IEZA 3GZ2A 2HYDA 2ZUDA 4BLVA 3FCCA 4E5UA 4EKYA 1MO3A 3U1BA 4TRJA 5EWMB 3VQTA 1A17A 1LB1B 4CQMD 1ENZA 4UTOA 3RYFA 4Z68A 1XZNA 4P98A 5BVGA 3BC1A 4CEIA 3UJ7A 3LWZA 3RHSA 3CJQA 4G1CA 3I2JA 1JDTA 3RVJA 2PXXA 3R09A 2RCNA 4CCWA 3VGPA 2DP4E 1V43A 3TVTA 5ARFA 3WLSA 2BHTA 4UD6A 5T6BA 3QMVA 4BGUA 1RYYA 5TVGA 1JX6A 4YMGA 4BGIA 3BIFA 1OGYA 1VMEA 1VYVA 1XRPA 3F67A 4HWTA 1W30A 2GCOB 1R4NA 3P9ZA 2BGRA 3AINA 1WE2A 3AM5A 4OTZA 2QRQA 3CNQS 2QVGA 1L5NA 3R7LA 4EGAA 2HA0A 1I2ZA 5T4EA 4WK0B 4DW8A 1JQEA 1RAHA 3CLSC 5EIAA 5JNWA 2AG5A 3GOQA 1QIEA 3P2MA 4NU8X 3U19A 2WWWA 3BKXA 3EXEB 3OQVA 1YZVA 3D6HA 1ADBA 4U2FA 1N9KA 4NCNA 1ZO8A 1H8EA 4CEHB 3HJAA 1FVHA 1D04A 1G5QA 1GGVA 1RPNA 4BEVA 3VNUA 3DR3A 3CVPA 1ODSA 1DSSG 2CW5A 4PZ9A 2JHGA 1ZZEA 4P4UA 1I80A 2Q1XA 1L7XA 2QSUA 1ZOPA 5COBA 3DSTA 1C1YA 1LU9A 1IRIA 1L4UA 3GVPA 5EPOA 5K0LA 1CW2B 2A90A 5F3WB 1EB9A 3EZXA 1SC1A 4RZQA 2BMAA 1E69A 3T38A 4DABA 3QX3A 5DNYB 5LX8A 3Q3VA 1LQTA 3PNYA 4HH4A 3PT9A 3DPYA 4NWIA 3I2GA 3U3XA 3IJEB 3BCRA 1H8HD 2ECOA 2JFHA 1MPTA 3B1ZA 2GEVA 4K6HA 3SG0A 3EYAA 5B12A 3BIXA 4L57A 3DOCA 2H2FA 2ZU6A 4YALA 2QD1A 4CCSA 5FLYA 2RMKA 4Z0PA 4OJKA 3INGA 2WE8A 1N0UA 3ETEA 1GGMA 2NV2B 3A1SA 3COZA 2YDXA 3QE2A 3KS2A 2FHSA 4OGGA 3MKQA 3ELDA 5BV1A 2JEKA 1BWSA 4WEQA 1NKTA 2C31A 1I0LA 5THXA 2RBEA 2R00C 1JI0A 3UFXB 2XZOA 3G1WA 1P4RA 4H7IA 3WYFA 4E08A 3RYHA 1KVRA 1MQ8B 3SM3A 4B7XA 2I65A 4ZDKA 4LERA 4KQGA 4TRNA 3V1LA 5HIIA 2CDNA 4MYDA 4MWZA 3RS7A 5HQ8A 2DHQA 2FUEA 4DJEC 4BYMA 1GPH1 2C88A 4XE5A 4BO7A 3ZY2A 3W5CA 3KEMA 3FNQA 4OBWA 1T2CA 2ZUEA 3DDSA 2R05A 3B38A 2R6JA 3F3MA 3PPYA 4LRTB 1F06A 4YI3A 2W43A 3NTXA 3DYVA 1CUDA 3VR3D 5BVHA 1HT1E 4KLZA 4LJ5A 5DN9A 1ZX1A 4U1RA 3STXA 5IHXA 5AOBA 1E60A 3DM5A 1I7NA 2ONZA 3H7AA 4W99A 3K70B 1YIOA 4Q7EA 3GFQA 1UZAA 4C5BA 2Q7DA 3R8FA 1UXIA 4DC9A 1KZGB 1QV7A 1VBNA 2GO1A 1E5TA 2WEKA 1WHTB 2Y68A 5DT9A 2H31A 2Q5CA 4TS1A 1Y7PA 1UAAA 5TT0A 4LV8B 3X1WA 3TZ6A 1VKRA 3K2BA 4CMBA 2AMFA 1UKAA 1E4YA 3C72A 2O48X 5J59A 5KVQA 4RORA 2H2WA 2QR2A 3VR4D 2Q9BA 5K8CA 3BH7A 5EZSA 3PNOA 1IZ0A 2I6FA 4FHDA 3ZVVA 2ZB4A 4U5XA 1EE1A 4HI9A 1A76A 1P5RA 1Q3TA 1SZDA 2VBFA 2XYVA 3A1NA 3IJ5A 4FDUA 3OTQA 3GYGA 2LCFA 4NMWA 3NBKA 4Y2SA 4YHBA 5EJ4A 3FU0A 1TNDA 4E4YA 1I7QB 4C6RA 1BCSB 3PWZA 4K9RA 4FHEA 4YP6A 1F8GA 1XRJA 2GK6A 3DNMA 4AZ3A 2NP7A 4D80A 2OTCA 1N7JA 4LS3A 1D2GA 1E1YA 2IA5A 2MT9A 2P9ZA 1XKXA 3RH0A 2J41A 4MRPA 4BDTA 2DWOA 5FJIA 3P32A 3SVLA 3QV2A 3FTFA 4MJXA 4N8SA 1OFHA 4K46A 1ZA1A 4N5HX 1MO5A 3AR3A 1V2GA 5JW6A 3GLVA 4UNPA 2HJWA 4OL9A 4UAUA 1E79A 5KQMA 2OR3A 5AXDA 1PU2A 3LV8A 1N3YA 2ECPA 2FNAA 3WLTA 1GIAA 1S01A 5EZYA 4PHCA 2XT0A 1ZIOA 4F5WA 1T2VA 1UFOA 1E2KA 2HA6A 4NZ9A 4JI6B 2F8YA 1W85A 1JQKA 3HSKA 1XZCA 3DFUA 4L4YA 2JA2A 2Q3LA 3U0BA 4AXXA 2GK3A 4FKZA 4LQDA 3RKRA 4E7PA 4E51A 4F6CA 5A2GA 1NDQA 2HY7A 3JXIA 1VE7A 1W59A 2YXEA 4GYKA 1PAQA 1IN1A 2C7GA 2HZBA 2BBOA 4MS3B 3C6QA 3RWBA 1EVJA 3ZVRA 5IAJA 3BH6A 4OYHA 3K6SA 4X6UA 4MVXA 1ZLYA 4O5OA 1TUBB 1PG0A 1LDNA 3JX9A 3P4YA 4BCDA 2O50A 4C89A 1X38A 2YFYA 4M9SA 2W6MA 3TCKA 4ZCIA 3X1JA 2HMWA 5BW8A 1QRSA 2GRAA 4DPRA 1BHQ1 2YHUA 4BVLA 1Z3IX 1TVKB 1UDAA 2WFZA 3SDSA 2CYAA 2PZGA 4ME2A 5D0OD 1H6AA 3OU6A 1CWUA 3FDIA 2FPIB 2WK1A 5FP0A 3ACCA 5ENRD 1SXQA 2H1WA 3NWOA 1VKZA 2RHLA 3ZYLA 3MJTA 4PFSA 3W1VA 1PFWA 4J0GA 4JXXA 4LXXA 3CIFA 2Q1TA 3FG9A 4UVDA 3WMFA 4CN9A 4CJXA 4NENB 5ARCA 4D8WA 4DC1A 2Y1LA 5J58A 2FQQA 4OAQA 1JI3A 3B6EA 5GPBA 3DSSA 1Y7IA 4DQXA 3EHNA 3C16C 3NR2A 4JUIA 4B0ZA 1VMAA 1QKIA 2OC9A 3IJPA 4V2IA 3JASA 2D8AA 4GA2A 1JQJC 2RAPA 1XLTA 2AUNA 3N07A 3VYWA 3WIOA 4MYSA 4UYKB 5AAOA 4HRLA 1RVV1 3LPZA 2B1JA 1NF3A 2PK3A 4RWEA 2WA2A 1Q7BA 2GD1O 3AWDA 1EGHA 4WL0A 4N9WA 1UEXC 4YT4A 2XD9A 2M1ZA 3B9PA 3HR7A 3ZZ1A 2X9LA 3SI7A 2G77B 2GRMA 5H0IA 2WHQA 1ECFA 1Z35A 2X6HA 4CMIA 4Q47A 2C7QA 3CF6R 1ZK3A 4OI4A 4P8RA 3M3HA 4ZXPA 3X1ZA 5IAKA 2D5CA 1FDSA 2EJWA 2FTKE 2WG0A 5AK5A 3H2IA 3PHGA 3UMGA 5DNVA 4EY5A 2YINC 1BJRE 1E6WA 3AHGA 1X7XB 3CRMA 3CKBA 4FEAA 4UOZA 1RCUA 2FPUA 4FFPA 4KFRA 5D0QD 5EJ9A 3LRXA 4OQDA 3KU1A 4PHFA 2JAUA 3V4VB 1P80A 2IYUA 5AW4A 2NX2A 1XALA 3KQPA 2OBFA 2II6A 5FBWB 1MF7A 3TW8B 1NAIA 1CJTC 2UAGA 4F6RB 2WIGA 1MW9X 5KYYB 3KLNA 1VB5A 3ESKA 2VZ8A 1PL6A 3ONKA 1U2DC 2OSBA 2W2KB 3C8ZA 3QVJA 4CRWA 1T2AA 4HP8A 3EE6A 2H5IA 4PC3A 3T95A 4E09A 1FRNA 3IV7A 3U37A 1F12A 2F17A 2D0DA 1BROA 1FXWA 1914A 3FSGA 4GPTA 5DE3A 5DM1A 4FN5A 1MMFB 2O9JA 3V1NA 1RMTA 4ZYYA 2JLRA 1DAKA 4JLKA 1N4RA 4PYRA 5KBYA 4Q05A 3NHZA 4N2QA 2KX7A 4PPQA 3KDPA 3OA2A 1F60A 3IOMA 4FCVA 4Q7LA 4HADA 1E32A 2GPNA 4XUEA 3DTYA 3TQCA 3UWKA 4AN0A 3BGIA 2MIIA 4FJ0A 3OOYA 3SKXA 1QH9A 3T4PA 3C3EA 1PZHA 3VR3A 3W05A 3N53A 2JPDA 4RY9A 4CV0A 4JI2B 1RBZA 2UVPB 3HCDA 3NF1A 3M5WA 1QIKA 2ZETA 2ZUCA 3ANSA 3MNFA 4HAIA 1TO2E 2VJDA 3GFVA 4C3UA 3KB6A 1PBNA 4J0UA 4IWXA 4HVAA 3FFTA 3NC0C 1EFCA 2E7ZA 3VR6D 1MRSA 1TM2A 1C2TA 1YZKA 2JAXA 2XVZA 3HKDB 3CK7A 2YW2A 3SDZA 3WNDA 5IFKA 1X1CA 3QFHA 1Z16A 1HFJA 2A33A 4EATA 3PUYA 4BWRA 3OJXA 4ZOBA 5FPTA 3DQPA 3ZHSA 2OFXA 3GLTA 4FZRA 1ESMA 4C88A 5EG5A 1ENYA 5BSUA 1NI5A 4BFVA 3QKSA 2IUEA 2FI7A 3RSFA 1VG8A 3RPEA 2GD0A 3H04A 3L3BA 1B93A 3TLAA 3UT5B 4QVIA 3QYAA 2XR1A 3GA0A 3LPNA 1FSSA 1T1GA 1XGKA 1XX6A 2YR0A 4JY7A 2E5WA 3UPVA 2JD0A 2JGEA 1DG3A 1Q0LA 2Z4RA 4HD8A 4QODA 4FMCF 1MN6A 2FSFA 2VNJA 1DIBA 3OQBA 2WMNA 2NP6A 1Y5RA 5T7BA 2WILA 1QIGA 2JBWA 1AH2A 4IY1A 4N12A 4R9UC 1P2VA 2UZ1A 3BQOA 4UNRA 1U3VA 3RO7A 4ZJZA 3WK6A 1VBMA 2A9FA 2F1IA 4AP9A 3WLEA 5KSZA 4RHUA 3GEIA 1K6MA 1DC6A 4ZOCA 3LKDA 3I58A 4BUCA 2QQ5A 5HIKA 1L0BA 3OX4A 2O23A 3EDYA 4AY4A 2XOEA 4WDQA 4L75A 1ZJ4A 2H1FA 3DEYX 2FXIA 4NNJA 4MRNA 4YUZA 4CEJB 1XEFA 2B25A 4YRZA 5A3RA 4Z49A 1E5XA 3QNMA 3UT0A 3CF2A 1ZWLA 5PNTA 1CEQA 2QZSA 3RO2A 3FTSA 1JR2A 3VHXA 2AMLA 1F6WA 2DBYA 2VXCA 5JZ9A 4RLSA 1P7VA 1LNZA 2LKCA 9LDBA 1EUQA 1K7XB 2VWQA 2RH9B 4PO1A 2A9QA 2QJFA 2UV8A 1DMRA 5FBLB 3RUHA 3ZS8A 1COWA 3PL1A 7YASA 5I8WA 2JH8A 2NO1A 4EB6A 3O4IA 3RHTA 4I9NA 3ZWQA 2FE1A 4DIBA 1PJTA 2CVQA 3FSRA 1TT5B 4YRJA 4FP9A 4OHPA 4C0KA 5AI8A 4CF5A 5JR3A 3Q98A 2Q7OE 3RSEG 1O87A 3HC7A 1T4MA 4OJMX 2O3SA 1H1LA 4AZ0A 4HWSA 3AJEA 5C5CA 5AVZA 1TADA 2LO6A 2VHVA 4W1RA 4GGOA 4ICIA 5HS0A 2BFDA 1B74A 1G5TA 1K8XB 3LL7A 5CDGA 1YFKA 3GUCA 4L2IB 2V5UA 4G8JA 4UU1A 2FKAA 2BEVA 4G56A 4YLGA 3L0YA 3VSCA 3AETB 1ANKA 3AMVA 4PW0A 4AS1A 3H3XA 4G0WA 4O6FA 3GFRA 4FFLA 3B7TA 1SVOA 3ASUA 2AHOA 4KSYA 1N4AA 4DTCA 4TKUA 1H2TC 3VISA 4ER5A 1Z6AA 3H4TA 1NLMA 1QGZA 1LFDB 1RYHA 1SCUB 2ZKLA 3DTNA 4C3VA 1W36B 3E7WA 4QOFA 1GUAA 1VG9B 2C9BA 9ABPA 3QVGB 2UXBB 1I5OA 1Y4AE 1D8EA 3P71T 2NTYC 2V58A 2OQIA 3EXG1 4TWRA 3FPHA 2IYEA 4I1VA 4PSDA 4A1SA 1IN7A 2QLTA 3ZEIA 3WL3A 4J0JA 1WXXA 1E90A 3RJZA 4AC9A 4DMKA 1VDYA 4F11A 1N95A 1EVQA 2JHFA 1WD5A 4MICA 5FKJA 5CT4A 4JD2G 3CH4B 3UUGA 2REOA 4EI2A 2G0TA 1JHAA 1ZK1A 3CYFA 2A4KA 3WLJA 1JEYA 4NI5A 5LOVF 4CMIB 1E0SA 4FB4A 2HF7A 3GPBA 3O31A 4UNSA 1O96A 4M8SA 3OF3A 2BKXA 2DWPA 5JAPA 3NC4A 3RANA 1WB9A 3D81A 5KJNA 2J9RA 1PQ4A 1P1HA 1Z4JA 4LOKA 1ZUWA 4ADSG 1E98A 3IE2A 5G53C 4ACBA 3HB7A 4DCGA 3I62A 5C2YA 2HWXA 5EX0A 1TCAA 2ZT7A 4LHSA 1SHLA 1JHZA 1O89A 3CR8A 3JPWA 4AUKA 4NLLA 1PGJA 3NHYA 1KC1A 1IBKB 2IBSA 2I7XA 5D5QA 2Z5FA 4ZIRA 3VOTA 4G2VA 3CHOA 2BFOA 2RK3A 5IW8A 5DHUA 2W6CX 4TL6A 4DL9A 1NI1A 2PH1A 3ZIAA 3BRSA 4QEZA 5EJIA 3Q3IA 3CHSA 1OLUA 1Z26A 3ETCA 5L7WA 5I7HA 1YNOA 5MGNA 2ORIA 1EGMB 3EJ6A 1QVRA 4GFDA 4WINA 3SEFA 5BUCA 3HJFA 4JEHA 2EINE 1GRQA 3Q0TA 4TTVA 1P9WA 3O26A 4IFIA 2I6SA 2CMHA 2HM8A 5IJAA 4CIDA 3RAJA 1TCUA 4A82A 1FXWF 1QWSA 3RASA 1GZVA 1YI0A 3H1PA 3L18A 5B7PA 3BD6A 2YIDA 3KZMA 5KAPA 1O9HA 3JATB 3FLAA 1GPAA 4HB0A 5TXGA 5HX7A 3FI9A 3CZMA 3NNNA 4IEIA 2CFTA 3UOAB 1JNRB 4N5IX 3UOGA 3PFCA 4BQOA 1LW6E 1H6DA 1I3KA 2P62A 3L0IB 1CJUC 5I9BA 1JHPA 5L3ZA 5KQPA 2X7JA 3K8YA 1A7UA 2ABWA 3I2YX 4DQVA 3DTTA 3QWIA 3F2IA 5JRDS 1VA4A 4BESA 2E4WA 4K9OA 1CDEA 1FJ2A 2N3ZA 3MJRA 1LPBB 4RMJA 3U62A 2Y1EA 2JVJA 2Q29A 3GZTB 3PR2B 2FVYA 4BVKA 4UCQA 3EGDA 2XS8A 2XLCA 2XWSA 2OO3A 2FJPA 3H9QA 1OFTA 4Q00A 4ZEXA 5AT1A 3ZD6A 3PUVA 5DTMA 3B89A 4HG2A 3R5HA 5K8LA 2BYTA 2QGFA 3EXIB 1F6BA 2OT3B 2FLWA 1U2GA 3NM4A 2K4NA 3IUSA 1Z4NA 4DCJA 4BO3A 2I34A 4DJAA 2QVXX 3GMDA 3L02A 2OLJA 4HATA 4ER3A 5IUKC 4J0FA 1J25A 3DQQA 3BX1A 4MS1A 1XT6A 1E7YA 4DA8A 5JMOA 1ZIXA 1XA3A 5ALSA 1MUUA 3M6XA 4UHEA 4A0RA 2Q3JA 1XU7A 3QBVA 4M1OA 3HN6A 2COEA 4YVFA 4F4CA 3IUYA 4XR4A 5IZCC 1KO5A 2P4EA 3LOUA 4QUEA 1U7XA 2G0AA 4W5WA 4DV7B 3TXMA 1LCIA 1K66A 4KHPB 3S3TA 2P2DA 4Y7DA 4IN3B 2FEZA 1JR3A 2PMFA 2WJVA 1XZAA 1QZ2A 1HDIA 1JJFA 1NJ6A 4L3OA 5AK0A 5IDXA 1KZOA 2DTDA 4OYLA 3C1TA 2I80A 1AQNA 1U80A 3BMNA 1LTXA 2H4ZA 2WB4A 4LOIA 4Y2GA 1U0NA 5DHPA 3HKDA 3PFHA 1QHGA 1DRVA 2VZLA 4DDTA 3COWA 4H1WA 1B2RA 3BDAA 4K6CA 3R7AA 1HE4A 1PJQA 2D2IA 1JFFA 2NXCA 3C5VA 4Y2TA 4C20A 1FP2A 1P7YA 1WETA 3QOWA 3AGPA 1YR2A 4FFMA 3LVQE 2PSDA 2W6JA 1E2PA 2IQCA 3I4CA 3ROTA 1HG1A 5EIFA 4CKBA 5A9SA 2AXQA 5GOTA 1Z56C 2FSVA 1ZEMA 3RV4A 2WYUA 1OTXA 1PR2A 3BSFA 4Q3AA 2BHRA 5AJVB 1IQUA 1XRQA 2FJUA 3WWEA 1K7YA 1YCSB 1LLFA 3HCRA 4UBNA 4G65A 5CNIA 3TLMA 4GUAA 3K6JA 4L5IA 1AC5A 3ER9A 3NEJA 4ZO4A 1XJ0A 3CX7A 2Q6IA 3F74A 3E5MA 1UADA 4RJJA 2WFMA 1U0RA 4X1YB 1PR3A 3SC6A 2XMSA 3BGDA 3JQAD 3QY0A 4URFA 4YIHA 4D25A 2RSLA 2DULA 3W6UA 4RU1A 4XKCA 3BZUA 4TKLA 4BQSA 1PR6A 2PM7A 4WBXC 1Z5UA 5DB4A 4AT1A 5KWEA 1W4AA 4QOEA 4LG6A 4FONA 3H8VA 5J4LA 1P0CA 3EZ7A 4TXNA 3UAOA 3DGFC 3A2NA 2A2ZA 4JK3A 3AEQB 4EFMA 4PY2A 1U0HC 1PRYA 3OIDA 4XFDA 1OWNA 1WV1A 2FZCA 3HCAA 3IBCA 2P9TA 3DLHA 1PYGA 3MEQA 1KI3A 2VAXA 4NAVA 4Q4LA 3FCSB 5DYYA 3PWTA 1ZW6A 3WLHA 3GXOA 2OSVA 2RGXA 4AJ1A 3C3OA 3HMQA 3VJMA 3VTAA 2X8AA 2Z2XA 4EGJA 4O3MA 4FYVA 4C0XA 1E66A 3NI2A 1W76A 4MW1A 1SOAA 2W98A 2ZJ5A 2EL7A 1D0SA 4Q4JB 4J1TC 4R7LA 3P0EA 5DK6A 1RC8A 4FHGA 2O3JA 2PAFA 3I53A 3PNTB 1D5CA 1FXSA 3LQ4A 2IV7A 3T06B 3V7YA 4JOBA 4CUJA 3P9SA 4AY5A 3CZRA 2RHHA 3PNQA 2NUTA 1H2UA 3SJAA 4JBXA 1AUPA 3VLFA 3P19A 4FNGA 1JV2B 1QO9A 5AW5A 3G17A 4EL5A 5C1OA 2R7NA 3MUNA 4L95C 3KZXA 1U7TA 3ASVA 4G0MA 1L7NA 4ZVVA 4DV6B 1J2RA 1FP1D 3F96A 2HWYA 1NG9A 1GLNA 4UFOA 1I7DA 4M38A 4XYMA 2BW0A 3H99A 4KGVA 5IDWA 1HL3A 4BNMA 1K4MA 1TLLA 2A7XA 2PQNA 5G40A 3EPLA 5A71A 2WMOA 2X77A 3B3AA 4HEJA 2GNOA 4OLAA 1NFRA 4OHKA 4HDNB 4E1AA 3MSCA 4YP7A 3PC2A 4KN5A 4Y2HA 3OQHA 3NBNB 3T61A 5LOVA 2VJCA 1YBMA 1WDLA 2HF2A 2V7VA 1T5LA 2WSSA 3L8MA 1BKDR 5IKMA 5IM5A 5TDHA 1H2VC 1IEVA 2FZ5A 2QTNA 4C06A 3SEQA 1WDYA 1SM4A 3H0EA 4NCKA 4ZMRA 1CUGA 4XWGA 4PC7A 5DM4A 5KJMA 3K0SA 3PZ3A 4OXIA 2Q9AA 3MGGA 3G13A 4TUUA 4ZHQF 2XTJA 3VSEA 2P9NG 1SCKA 1Y42X 3D1VA 1ZRSA 1CQWA 2OCYC 4NCBA 3O6VA 3IKLA 1I6WA 2JGDB 3ZHBA 3AR5A 4FKBA 3FWHA 3DMHA 3T7AA 4WAFA 5JCXA 5DNCA 2IZ1A 4YPFA 1E59A 3T1VA 4UQZA 3QBJA 4HWKA 2ZI3A 3FFXA 2VHXA 1UK8A 1BVRA 2FDRA 5EZ6B 4TTQA 1RJGA 1YU6A 5BRAA 1OMOA 2GZAA 2SCUA 2XF8A 5BV2P 2H16A 3JSXA 3OZBA 5E76A 1W1IA 1MFZA 1UKZA 1W0KA 1SFRA 1B8PA 1HLPA 2I29A 3DHNA 5FHQA 2IS2A 1UOOA 3CEHA 1IHGA 3CRW1 3K0FA 4HRAA 3B2QA 5CFZA 4BFCA 3IODA 1TM3E 2B37A 2JD1A 3UXMA 4EO7A 2JEOA 4KIGA 2JH9A 1K1EA 1X7ZB 1C50A 3SHVA 4HS2A 2FUKA 1VSTA 3OTNA 4Q94A 4P9NA 4W1PA 4EI9A 4GTVA 2O8VA 4JOSA 1QQ7A 5CW1A 5HKOA 4CETA 3HBAA 4TYNA 3QUTA 3IKVA 3RTAA 1DEKA 2M32A 3ZCRA 1X1QA 3M5DA 3ONFA 2ZI5A 4KWEA 4MR8A 4R16A 3GLKA 4HNAD 2H18A 5CHYA 3QEBZ 4QRDA 4IFBA 1R8QA 2EARA 1M1YB 3IP3A 5A5FA 2PVSA 1R9NA 3KSUA 1LPNA 4EW6A 4DCSA 1J42A 5FX2A 1RBMA 5BSTA 5JAMA 2OEWA 1AHNA 1GYRA 4HXIA 1B0UA 2G70A 1NNUA 4QO8A 5DWQA 5JXGA 5IKXA 1NHGA 4C0SA 1BS1A 2CXRA 4QTYA 4XFKA 3G02A 1T6YA 4YCMA 5G04C 5AVXA 2VYNA 1ODIA 4QDXA 5JALA 4PO3X 4CKBB 5JMTA 1VJRA 4K3VA 1TD1A 2FEKA 3MINB 4MLPA 3PLRA 5EI5A 2V7XA 3S44A 2IUFA 4LHXA 4CBVA 1KE1A 5TRTA 4F2DA 1C8BA 5IKPA 3RS2A 3AEKA 1V55E 4HUJA 3KDSE 3OEHD 1EFVA 5KHOC 4WCDA 1YE8A 1DJQA 1M2VB 2ZR8A 4KI0A 2O14A 5COQA 5DISB 3UTDA 2GF9A 3IR6A 3VHRA 4HVTA 4YV2A 2H5JA 3DVQX 4XEUA 2V0GA 1DCFA 5BPHA 2OV6A 3Q75A 4MRSA 3OQOA 1V8FA 4MA0A 4UE6A 4WASA 5E0OA 2HO5A 3Q7AA 1BWRA 3AVUA 5LYYA 2B4AA 1YZGA 4JHLA 4CGVA 4A27A 1XCGB 4MV6A 4EF4A 4TSRA 1VYUA 3G49A 4NJEA 2NZUG 4PM4A 3REOA 3WGQA 2G71A 1A4UA 3PQDA 5HQ3B 2HSDA 4OHCA 4Y98A 2KXPC 1DIGA 3B2NA 3O2NA 4OHMA 4W5RA 1OVMA 2VHWA 3ELWA 3KQVA 3W4KA 1IB6A 3D8NA 3T35A 1JXOA 4HVLA 3IESA 3PF8A 2CXSA 7REQB 4N01A 2IYAA 3DYBA 3UJCA 2IGTA 4ILIA 1ODCA 4S1TA 4H59A 2QW1A 4BN5A 4D7AA 2DR2A 3BJRA 2R8ZA 3DKKA 1W19A 3NT5A 4P7KA 5PGMA 3WRYC 2A84A 4UYJB 4M0PA 2ORVA 3U49A 3UICA 4L2LA 1ZRMA 1MJ5A 2RIRA 1ZCJA 2MMGA 4WWPA 1B43A 1TGVA 1V8OA 2PQ6A 3MB8A 2I4TA 4GBGA 3EQ6A 4OBXA 3K0EA 1OPXA 4OY3A 5BURA 4JBHA 4Q7QA 1SKQA 1Y7HA 4WLOA 4EX6A 1RM0A 3GMSA 4HB5A 1YU9A 4FC7A 3N58A 3FWPA 4ZAYA 4PS3A 2VT3A 3DE3X 5DTEA 4R0MA 1VI5A 2BISA 2H00A 1UPAA 4G0ZA 1YR6A 4A0FA 2YJ4A 4JQCA 3JXJA 4K5CA 4K9SA 4MVJF 3O84A 4DM7A 2WLTA 4HRYA 3NDIA 4NX2A 2OE2A 3VPBA 1TD9A 4PGFA 5EVCA 2YNMC 2F00A 4BNIA 2EBFX 2B7LA 5ENOD 2G17A 2ZYTX 3B51X 3OU2A 4MKXA 4O2AA 5CTAA 4UWKA 3BMOB 5J4YA 5DXJA 2XCSB 3NGLA 4IDQA 1C1DB 3R9AB 3GQBA 4N03A 4Z9YA 3WV4A 4DLPA 3PC7A 1KIAA 1ZJZA 2TSYB 3GWGA 4GT1A 3AQIA 5G3ZA 1IXVA 2C3PA 4Q1BA 3ZJTA 4A2PA 3QLVC 1T6XA 3QWWA 2BY4A 1N4PA 2FLKA 1NU6A 2WXMA 1DWOA 1XD8A 2HREA 4UULA 3ERCA 5AHOA 2P9PG 1K92A 2ZK7A 2PPLA 2VAWA 4C6HA 4EHDA 1GPLA 4BJ5A 4HXYA 2YS6A 4OUDB 3D5TA 5FOSA 4E2FA 1JR6A 3G5AA 3TZEA 3V4OA 2GCPA 4FGUA 2HPAA 4UUOA 2O8NA 1I3OA 1N1MA 1VJGA 4D97A 1DC4A 3AVYA 5FQ4A 2WTUA 4M4SA 1D7OA 5G02A 5CDFA 4QYIB 2IXTA 2EOAA 1NVFA 3EBOA 3GDHA 4TV3A 1GT6A 1EQUA 2AV6A 1OWMA 3BREA 5LMNB 4RHXA 5KYUA 3IP6A 4I2VA 3KCQA 2VSFA 4KIUA 5FQNA 4UATA 4AG6A 5JDCA 3OQMA 2P6NA 2QYTA 3K32A 5FA6A 4JFAA 5EXXA 1HR0B 1KDPA 4F3VA 4KITB 3L0SA 4M9UA 2G9RA 2YS7A 4OQQA 1UMBA 1VLZA 1UPFA 3DFKA 3C3XA 1VQ1A 1AMUA 3EFOB 1U2VG 3D6NB 4BLQA 5F1PA 1UXJA 2WIJA 1ADJA 1OHHA 5J47A 1IE3A 3LQQA 4LGVA 1V11A 2PS1A 3JRXA 2N9UA 3FFAA 1OFUX 4PFJA 1XAHA 1D3AA 4XSVA 3Q41A 3GEBA 4FX5A 1N6LA 3E30A 3AYXB 3SQNA 4EFKA 2WB2A 5I9NA 5ICMA 4RESA 4R05A 4QUBA 2HK7A 5K05A 3I9V1 1VL1A 1G98A 2Y4OA 4TTAA 4NYMQ 2ST1A 1XTVA 1YR9A 2V4MA 4J29A 4TV8F 3ASOE 5JAUA 3THWA 5B5SA 2Y27A 4UKDA 4JZYA 3IQIX 2RE8A 3VKFA 4JLAA 3IMKA 4G1UC 3I76A 2FEAA 3NOGD 2P3QA 4G81A 3SQLA 4DA0A 4EW3A 5K8TA 5K4HA 2HU5A 1YJ5A 2P77A 2YXDA 3GBVA 4LRSB 4LZWA 4PLVA 2AXUA 5DN6A 5I9MA 2OHFA 3W06A 3O1HB 3LX8A 3L82B 1NKSA 1DIOB 4G5RA 1SWVA 2NO5A 3EQ7A 4Q7MB 2QG4A 2PO7A 3S2SA 2A5GA 3PKZA 3KL2A 3RS0A 3C3CA 4CLEA 3PGJA 1IYGA 1R1DA 1M1NA 4HDKA 4O02B 4FQ7A 4MI3A 2EILE 2UUAB 3VX4A 2PCJA 4JHXA 4G5HA 2YJNA 1PJBA 3MLBA 1MPXA 3ZBTA 2PL1A 1SXJD 1WDMA 5JE8A 2VK4A 3I9JA 3HB1A 1ZH8A 4G4JA 2B4YA 2G80A 4JASB 3GRYA 1N52A 5FL3A 1PWYE 1P3JA 4YCJA 5L4LA 1RI4A 3BXHA 3FA2A 2QS9A 3A3NA 3BIOA 4ZDWA 1QF9A 8ADHA 3EDTB 1D8DA 1O7JA 1I2MA 1LDMA 1UC8A 2B1QA 2HMUA 1KQOA 2VUIB 1SQFA 1Z75A 3L4BA 4GO1A 5H68A 3VR2A 5BWMA 1QXSA 2YZGA 2V3WA 3IMFA 1LJUA 1SBQA 2H52A 3KKOA 4NK4A 2OV1A 4RLQA 1NW6A 1L5JA 1ZRNA 3Q8LA 1CRQA 3ILXA 2ET6A 1R18A 4F53A 4RM3A 4LV5B 4YAOA 1RYFA 1QCZA 1E1QA 2GERA 2GJSA 1QLJA 3TLXA 1PK8A 5IAEA 1SNYA 4R6WA 5AKJA 2C0MA 3IQDB 4MITA 3VPXA 3GCZA 3WLPA 1JWGA 2C9YA 4OU4A 1S3FA 4CPDA 3FTVA 4JX9A 1G8SA 4D4IA 4FULA 4JVLA 3UYLA 2IDZA 4JAVC 3SSMA 2J9FA 2NWQA 2A5LA 2GASA 1I4EB 2OZKA 2QRMA 2VP4A 3PXXA 4HVBA 4M60A 4O8CA 1LRJA 4I4TF 5HRYA 2VZ0A 4KGZA 1LLCA 1F8UA 3KVRA 2FOIA 3D9IA 4OLJA 4ZT3A 2I6HA 5G0WA 1BIFA 3PDHA 1BW9A 2CFZA 2D0IA 2RFLA 3P9RA 5LFAA 1Z8NA 2CCKA 2JVKA 5EXSA 2CV1A 4ALMA 4MB0A 1O95A 1RQRA 2J8SD 2VF2A 3KTAA 1KXJA 2ZUSA 2AXVA 1QIMA 1YJXA 2GEJA 3C4JA 3IAM6 3P0JA 2A0WA 4Q3DA 5KJ6A 3FZNA 2AXEA 3QE3A 1B6GA 2YZKA 1MZVA 4YAIA 5EE9A 4IKPA 2B7CA 5K8IA 3N76A 2MWMA 2G9QA 1FXUA 1IEXA 2B9VA 2PLRA 2VRWA 3TMYA 1L1RA 3LUDA 5EJ6A 1YUMA 2AOUA 4RZ3A 3DZHA 2IF0A 5ISMA 4HPWA 3I5MA 3ZBPA 3QVUA 1P0FA 2QGNA 2F3TA 2RAUA 3AEZA 5JC8A 1EXNA 4XJXA 2VGXA 2DSNA 3EEYA 5HKKD 2OVBA 5IJ9B 1HS6A 3HUUA 4MA5A 1H9BA 3D9PA 2Q6LA 2QV0A 5BN5A 1P17A 3QPVA 1H5UA 2ZVDA 2DX7A 2WYHA 5HZGA 3ORFA 3QFCA 4DMUB 4UDOA 2HLDD 4CLRA 4LKOA 2GHQA 1P7PA 2AOTA 1J9EA 2QMQA 4W6QA 3DE2X 3FPEA 4JB3A 4P4LA 3V1UA 1JEQA 1VLHA 4IXWA 3FOWA 3WLRA 1UAYA 1HURA 2M9MA 2X7XA 3JALB 3D1JA 3QKUA 4F92B 3MQFA 1V26A 3O2QB 4XGKA 4RFSA 5JZVA 2HIAA 4LHYA 4RO0A 2JFWA 3WIDA 4DG8A 1N2XA 3CUVA 4W4TA 4A9AA 2GR9A 2IZ7A 3FCYA 1T9HA 4IF6A 4GZ6A 1WO8A 4OGKA 4J1NA 1QZ3A 3DM9B 5C8VA 3LS8A 2H8KA 5ALJA 4AJLA 2HQOA 1QH8A 4UM9D 5D3QA 3K1ZA 3VPGA 1CR0A 3P2YA 1SGWA 3GPDG 4XI0A 3ABQB 1TX4B 5K3FA 1J1UA 3CKCA 3AU4A 2FMFA 3NDPA 4FVTA 1DTSA 1YACA 3HK2A 4P92A 3WI7A 4N8DA 3C5HA 1KY4A 4RSGA 4JZKA 3Q8XB 5HDQA 4ZVQA 4MV9A 3S2EA 3THRA 4LNAA 3HVEB 5A4KA 4LYGA 2B8JA 2ONJA 2Q3DA 3E33A 2PE5A 3I2HA 2FUNB 3EG5A 4AICA 1QDEA 4PQEA 1H3EA 1H2WA 3PR1A 4OFWA 2JI7A 4G4IA 3E05A 1E0AA 2H65A 1LJ8A 3PUZA 1JDVA 4M7OA 1HUQA 1P5ZB 1DEHA 2Q3BA 5AW3A 2IO3C 4GQAA 2KC7A 6PFKA 1YE5A 3O93A 1SZJG 4KQFA 5BQPA 4MI6A 2XNDD 4I1RA 4EG7A 4AURA 1NJ1A 3LIIA 2X14A 3VXKA 3NHMA 3CZCA 2X6QA 4LJ8A 5DBKA 1W36D 3WB2A 4NICA 4DIEA 4BERA 5A4FS 4YAJA 2ZGGA 1DBVO 3AERA 4Q1EA 4BE7B 2HT1A 2ZRNA 1JG3A 1NQWA 3WXMA 1F8XA 5EGNA 1ADYA 1TUEA 3VOSA 2IXAA 1NQTA 1PJ2A 3O4RA 5LXTA 3P20A 1EHYA 3LYUA 1JG6A 3SIWA 1KHHA 2QVYX 2UYGA 1R9GA 2C9ZA 2QMHA 3UHPA 4XAQA 5LYJA 4PHTA 3UUFA 2J4BA 3EZLA 3EIFA 4N3NA 4QELA 5J2TA 5FJJA 4UPDA 1LH0A 2QN3A 3S7JA 3QU2A 4I8IA 3I61A 3IILA 4G01B 2EX4A 4JN6B 1JEDA 4KDEA 1MEOA 3R0JA 3ISJA 3R77A 2IEDA 3SYRA 3LNCA 2DQZA 5JA4D 3O4JA 3DZBA 2JW5A 3LNTA 3KJNA 4XR9A 1RJ9A 1EXDA 4ISBA 2DB3A 5I9SA 1CQJB 4RK4A 1N2JA 4FZVA 1FJGB 1XDBA 1QSGA 3G9XA 1D0VA 1WSDA 1G19A 1V0JA 1FDRA 1G9SA 1LDYA 1QFJA 3IIIA 2YIMA 1H94A 5BWNA 7ABPA 1ZUNA 1JLSA 2C4MA 3I34X 3KBOA 1NA0A 1GPJA 2VNAA 2FEOA 1LY1A 3C74A 5CDYA 1JSZA 5H59A 4ZC8A 3W5AA 2H1SA 1AS0A 1LXCA 1XNRB 1ZD2P 5GONB 2V96A 1DOZA 1ZKDA 1YMPA 1R00A 2ODTX 3EQ9A 4BNLA 4HLLA 4B6JA 1IUNA 1GSHA 3IYLW 2QN2A 1YYHA 3NV9A 3MWDA 5GP1A 1EIZA 4OG2A 1CY2A 4N41A 1EZZA 3U4GA 3WLAA 2A4MA 1W6RA 4H1UA 1TN7A 2CWDA 3R6GA 4LEUA 3JWPA 4G37A 4HUQA 3CPJB 2RIPA 4M49A 2AYZA 5LOZA 2YJZA 2ZJ2A 4GWKA 3GLFA 4KR3A 1GKLA 1BI8B 2WT4A 3WR5A 1G42A 3CEPB 3ZWWA 1ZYUA 2P4HX 4EY3A 1NYRA 4M8KA 1PTKA 4B4WA 4EHHA 3G2HA 3KG2A 3VNAA 2Z1MA 2NU8B 3HV2A 3EC7A 3H1BA 3LD9A 4W5HA 2F2TA 3LX6A 5A04A 1L9KA 1SEVA 4PANA 4MS6A 2PKQP 1N34B 2XJ9A 3CN7A 1N7HA 1ORHA 2F67A 4RNCA 3OZTA 1G3MA 1UEIA 4TMXA 2EJCA 3DWEX 4U00A 5K1ZA 3K9CA 3SKYA 1Q95A 5LLTA 1RYDA 4RUKA 1Q6ZA 3NIFB 4URYR 3ZWDA 1T9CA 1UUFA 5AOXA 4PG6A 2D1SA 3KJXA 5B3LA 1XHLA 3DAOA 3NUGA 2RGAA 3ABIA 4H18A 3FEYA 1C7ZA 1Q19A 2V98A 2C2KA 2C2XA 3RC3A 3AG2E 1YB1A 3JWEA 1GQ2A 2OAGA 4O5AA 3THOA 5ADVA 1IRXA 3A05A 4X41A 1JPNA 4RDIA 1F6DA 1E0JA 1WSAA 2ATEA 5GY7A 5EKQD 4R1UA 5H02A 1FUYB 1AGXA 1ORRA 2IY9A 1WP4A 3W7BA 3PSAA 4YNBA 2J3HA 2OO5A 2XCLA 1FSFA 1QAOA 1W0JD 3FJYA 3KQQA 4EHIA 1MGPA 1L5MA 1WVMA 4QO7A 2AFRA 4R2MA 3RC9A 5IYZB 2FGKA 2Y0CA 4IYPA 1FFXA 1YQQA 3M1LA 3IP5A 4M21A 2AKEA 5CBPB 3Q2IA 4BUZA 4JX8A 1YI8A 2VJNA 3HFGA 3P94A 4V38A 3D64A 1G3UA 2IP2A 2G36A 1OYYA 3MWGA 4PG7A 1VP9A 2DJ5A 3OZAA 2XUAA 4HKTA 4OK5A 3N2IA 4TMTA 4BNFA 3SS8A 3UM3A 3OCVA 4JVSB 1PVDA 4PAQA 3QUBA 1FRZA 1QCDA