5C1DA

Human ogt in complex with udp-5s-glcnac and substrate peptide (rb2l)
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
713
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 275
structure length 695
sequence length 713
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5c1dA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5c1dA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1dA03
1NOIA 3L7CA 2Q7FA 4HORA 5A7DB 2VQ2A 3BD8A 5JJ7A 1Y8ZA 3RKVA 2VYIA 3ASGA 5HQ8A 1NLMA 3NC4A 2GW1A 3BCSA 1P4GA 1WV1A 1WUTA 3O3CA 5CHEE 3PDNA 5D0OD 3WAGA 3CK9A 3QHPA 2QLMA 4A1SA 2KCVA 3LKUA 2IV7A 2VGXB 3S7JA 3KS2A 4X7RA 1FTYA 4REMA 4UI9J 3RO2A 1WW2A 5D0QD 2SKDA 2L6JA 4U07A 1FU7A 2YHCA 2KC7A 3RSCA 3BDAA 3Q3HA 1FU4A 3OY2A 2QLNA 3GW4A 5DBKA 3CUTA 1P29A 3ZCVA 3UPVA 5BNWA 2HY7A 4Z5XA 5FTPA 2HYZA 4IN3B 4KBQA 3C4QA 5KJMA 5CCLA 4N3CA 3CK8A 1XV5A 2GEKA 5FZRA 3T3DA 1GPAA 4XI9A 2YQ8A 3ZFWA 4G1TA 4EKEA 3FWVA 4MHOA 2ONDA 2AMVA 3D1JA 1XL0A 3MTAA 1A17A 5FT9A 3RU0A 2GEJA 5ARGA 1P5QA 5ENZA 4AN4A 3CK7A 1EXVA 2F3PA 4N3BA 3CVLA 3VUFA 3VTXA 1GZ5A 2FF4A 2QFCA 5FZQA 4LDPA 3S27A 2UWJG 5D01A 4F3VA 1Y6GA 2BGUA 3CUVA 3QKYA 4GYYA 5GPBA 4J0UA 4G25A 2MHKA 4GZ3A 2FBNA 2H1HA 2X0EA 3LPZA 1QM5A 2QN7A 4BT8A 5FZSA 3NPAA 4N9WA 3AS5A 1PC2A 5BT1A 3S2UA 4JL0A 1J39A 5M72A 2I6HA 4AY5A 1FA9A 4WNFA 1Z6QA 5HXAA 2WTXA 3MKRA 3Q15A 4MI6A 4I1AA 4ME2A 1YGPA 4N3AA 1C50A 1NA0A 4APOA 2IEIA 4HWGA 2VCEA 2F3UA 2PQ6A 4GA1A 2GPNA 4AMBA 3RO3A 3SYRA 4KYOB 1XKXA 4F9FA 1KT0A 4UQYA 2PZIA 4L22A 1UZUA 4YVQC 2VSYA 4RIGA 3ZCTA 1L5VA 2XA1A 2P6PA 4I2ZA 1RRVA 3NB0A 3HBJA 3IEGA 4YNDA 4NC9A 3ZCSA 3S7FA 5EX3A 3S7DA 1Z8DA 4EQFA 4B94A 2ZB2A 3NP7A 4U0UA 3WADA 4M7PA 1P2BA 3D0QA 4MICA 3ZHEA 4MI3A 3CVNA 3VDNB 4GZ5A 4RIEA 5AYWD 2XEVA 2AW3A 3D0RA 3H4TA 4RENA 2WPVA 1JG6A 2IYAA 4N5CA 3MT7A 1GFZA 1JIVA 5LQDA 5JJTA 3CEQA 3CX4A 2C1XA 1GGNA 3QWVA 3ASDA 3OY7A 3CEJA 3ZCQA 3DZCA 4X6LA 2HO1A 2XMPA 4F97A 1WW3A 2BISA 2QZSA 4KQ1A 3ZCRA 5KJLA 3VUEA 3CKCA 1B4DA 4F96A 1NOKA 3CEHA 2JZCA 3S7BA 2G9VA 3MTDA 4WHMA 1A8IA 2G9RA 2XCUA 5DXFA 4FZRA 4J8EA 4N2SA 2UY1A 1TJCA 1JIUA 3BD7A 2YJNA 3SF4A 4I17A 1KTIA 3OT5A 2QNBA 1P2DA 4GPKA 2C4MA 2QN3A 2XA2A 3ZN3A 1NZFA 3Q3EA 2SKCA 4AMGA 3N71A 3CVQA 1KT1A 4MI9A 2FEZA 5IKPA 4HLNA 4CGWA 4GYWA 1IYGA 2PRIA 2QN9A 2QRGA 3MRVA 3E3LA 5TVGA 2DBAA 3GPBA 3CUWA 1L7XA 1NOJA 1WV0A 3FROA 1HXIA 3OKAA 1SXQA 4BTBA 3E4BA 1K08A 4G23A 3DD1A 3RT1A 3L01A 4PQGA 4LEIA 2AVPA 3NP9A 5TMDA 4YVOA 4BQFA 4G2TA 5BW8C 3SZ7A 4BWRA 1UQUA 1HLFA 2IUYA 2FO7A 2ACVA 4BQEA 9GPBA 2LNIA 2XCBA 2ECPA 3K9IA 3ZHEB 4YUAA 4EKYA 2X6RA 3MRXA 1PYGA 4BFCA 3T7DA 2FETA 4BT9A 1NZDA 2R60A 3HBFA 3ZPJA 4WNDA 3TGOA 3TSAA 2V5FA 3U4TA 4J8FA 3MEKA 4HOUA 3URZA 2IW1A 4MRAA 2XPIA 3PE4A 4N39A 4NQ0A 2Y4TA 2XCCA 4M60A 1C8LA 2XGMA 1GPYA 3KD7A 2QRMA 2C1ZA 3MQFA 1FCHA 4AM9A 4N2QA 2GPBA 3JYSA 3NCHA 1H5UA 2BGTA 3PE3A 2PQNA 4GCOA 2JLBA 3MRTA 2OFFA 5LCWC 3C48A 3LCAA 3MV2B 5I45A 4I2WA 5JTTA 3AMVA 1RZVA 1HH8A 3CUUA 3QOUA 3ASFA 2VSNA 1E4OA 3CKBA 4UI9C 5EKQD 1ELWA 2IV3A 3RIBA 3FFLA 3OXGA 4RIIA 3U3WA 4U0SA 2R4TA 5JTUA 2F3QA 2OOEA 3CEMA 2AZDA 5TMBA 2IF4A 2R66A 1ZU2A 5FJYA 2F3SA 1PN3A 1FTQA 4J8DA 4AIFA 5LCWJ 1L6IA 3L7DA 1XNFA 3MT9A 2QRQA 2FF5A 4YI3A 3LY8A 2QN8A 1SXPA 1PNVA 5DLDA 3L7BA 2XGSA 2SKEA 1K06A 3G2JA 3BCUA 4G26A 1Y6FA 1RZUA 4W6QA 3ZCPA 5TMEA 1LWNA 2FI7A 3NF1A 1JEJA 1ABBA 2ATIA 1YA0A 1PSWA 4X7PA 5DIZA 3UYKA 3WC4A 2XA9A 1YA6A 2AV6A 4GPBA 5D00A 2IFUA 1W3BA 4Y6CA 1XL1A 2R68A 1LWOA 1QZ2A 3L7AA 1GG8A 3MA5A 4CDRA 3CVPA 4GZ6A 3NAZA 3T5TA 3QWWA 8GPBA 3EDTB 4GA0A 2QLLA 2KATA 1P4HA 4CTOA 3OKPA 4WADA 2PQRA 3EBOA 4KQMA 3GZ1A 2LSVA 3BEEA 3FP3A 1ELRA 4NRHB 3TOVA 3GZ2A 4O6FA 1C8KA 4WUYA 1GPBA 1L5RA 2IYFA 3UQ3A 3G2NA 2VG8A 3T3IA 3OTHA 4U04A 2NC9A 2C0MA 4RG6A 5HI7A 1XC7A 4JHRA 4I9EA 3S0JA 1V4VA 2GM9A 4LEUA 2GJ4A 2GPAA 3HBNA 2X6QA 2HR2A 3QWPA 1EM6A 3VTYA 4FKZA 1Z6PA 3CV0A 2O6LA 3MS7A 2FFRA 1BX3A 1L5SA 4H7XA 2Q6VA 3ZGQA 4KXKB 2XCIA 4YI5A 3QDNA 3BCRA 3E3NA 4RG9A 3S28A 1NA3A 2R4UA 1WAO1 2F9FA 4WACA 1OUVA 4GCNA 4GYOA 3MTBA 3LYAA 3DDSA 1KLXA 2G9UA 4HOQA 2IEGA 4XIFA 3Q5MA 3R9AB 5EX0A 3BD6A 2Y4UA 1XOIA 2X0DA 2JJMA 2LSUA 1B89A 2ACWA 1Y8MA 4W9RA 4GA2A 4JA9A 4NEQA 3OTGA 5C1DA 3TAXA 4UQZA 3G2HA 2C2LA 1FU8A 1UQTA 2X0FA 3UUXA 2BUGA 3G2IA 4EL0A 1IXYA 4X7MA 2R5SA 2WQHA 3T3EA 3G2KA 3IA7A 3MV3B 1JG7A 2PL2A 1FS4A 2ASVA 4RBNA 4Y6WA 2XGOA 2GT1A 2VGXA 5KJNA 4RIHA 5DU2A 5G04J 3GYZA 4BTAA 5A6CA 1IIRA 1P2GA 4AY6A 3Q3IA 3ZCUA 3TG5A 4XI0A 3MSCA 1L5QA 4WNEA 3MBOA 4HOSA 3COPA 3MS4A 4RIFA 3LY9A 1JIXA 7GPBA 5G05J 4G2VA 4HOTA 1F0KA 4KQ2A 3VDMA 3BEOA 2BFWA 2PRJA 4G24A 2PYDA 3Q4AB 3L79A 4EJ2A 4UQXA 4NESA 1E96B 3EBPA 3C4VA 1C3JA 1QQEA 2J9QA 4CTNA 3RSZA 3T3HA 3TG4A 3G2LA 1ZBPA 4M83A 1QKJA 3SYMA 4WNGA 5G05C 2QN2A 3S29A 3AS4A 3GUHA 3LY7A 1FTWA 2G9QA 1HZ4A 1VGVA 3ESKA 4CTMA 5ARFA 4I9CA 3OXLA 2KCLA 5CCMA 3O48A 2QRPA 3T3GA 4EL5A 2E2EA 2UY1B 3Q47B 3RJVA 4UI9K 4ABNA 3KAEA 2PYIA 1AHPA 2P58C 3OTIA 4RELA 3E3OA 3CUYA 3HBMA 2H1FA 1WM5A 1M5RA 3WXXA 2QRHA 3RHZA 1O6CA 3OKCA 4U0ZA 1FC0A 3UYLA 2VGYA 3ASHA 2QN1A 3CV3A 2VCHA 3DDWA 4CGVA 1E1YA 3QKWA 4BQIA 6GPBA 1P4JA 2KS6A 3H4IA 1F6DA 3IAAA 3AS8A 2KCKA 3OXFA 3Q49B 4QLBA 2C0LA 4H7YA 5G04C 5JJ6A 3HYMB 1WUYA 1AXRA 5IKOA 1IHGA 1NZNA 1L5WA 2C9ZA 1Z62A 3MS2A 4JA7A 5KJKA 1NVKA 4MHSA 3ULQA 3MT8A
chains in the Genus database with same CATH superfamily
3G82C 3C6XA 3ZDXB 4ZALA 4KSCA 4S05A 3JPWA 1EAYA 3P0HA 2DERA 2QAGC 2FO1E 3JALB 3VJKA 4Z4EA 3I5PA 3UGJA 2VQ2A 1ACLA 2VYIA 2G28A 4IP0A 1HG1A 4R9RA 4CM4A 4GX2A 4O3FA 5GVSA 3RS5A 1PL8A 1Y8QA 2R5WA 2BM0A 2HO5A 3L22A 4FQ5A 2ETAA 2ZRNA 3Q9UC 3HPQA 1G3IA 5BT9A 2PNJA 2OHHA 1MNAA 1QVWA 3FW1A 2ORED 3LVFO 4LBVA 1IU9A 4RABA 4MJ3A 4QECA 3SC4A 4CKBB 3CK9A 4CKXA 4GEGA 1PGQA 1CNEA 4OHXA 5EIXA 4C7VA 1VGRA 4B9AA 1GV1A 1KSJA 1Z29A 2WIBA 5EZSA 3OX1A 4KZ0A 4ZO8A 2IV7A 3BSSA 3AB7A 4AYTA 4D41A 3MKQB 4E21A 3OE1A 4A16A 2C9YA 1UPBA 2NTEA 4PGFA 1UQRA 4WKOA 1ICEA 4CMIA 5BXQC 2HNAA 5JVDA 2XB2A 5E9JA 2SKDA 2L6JA 2C29D 5IC6A 3U4GA 3L40A 2P4SA 1W5TA 5LKRA 3CINA 1Z4KA 1NXVA 1WOMA 2EF1A 2VRCA 5ITZB 5KWSA 1XDUA 1A9TA 2L0TB 3O8OA 3UCXA 3HNPA 4UXJA 1NTRA 2PSDA 3E7PA 3VR4A 4RVBA 1E7YA 2ZPTX 3E23A 2GUWA 1CZRA 1HSZA 1XU4A 3QPBA 4PLZA 3UQYS 1IY0A 3T7AA 3DR3A 2UVDA 3VR0A 4CF7A 5IFLA 5H3LA 3IH5A 1Q0ZA 5BV2P 3WGUA 3QWIA 3CC8A 3ET4A 3CK8A 3FUKA 1XV5A 4GR9A 4Y2JA 1ZCJA 1DUVG 2FEAA 3CZ5A 3RBAA 4BQPA 1QWOA 5DNUA 1FLVA 1A50B 3WDKA 3MUFA 3X1XA 2Y6UA 2FJEB 5BY2A 3FUTA 3QPDA 1JDNA 3CCBA 5FI1B 4D4IA 2RB5A 2ZB3A 1JF8A 1XAHA 3WYDA 3PR3A 2OEPA 2C4WA 1HK7A 2Y05A 3GNLA 3BF8A 3HB0A 2WIGA 1IQUA 3T52A 2MR6A 3VUFA 1E32A 1GZ5A 1Y3IA 3GGOA 1EWQA 3NG1A 3CVUA 4Q1FA 2UWJG 2JPDA 4BNDB 3DBSA 3OZDA 2BFPA 2PA3A 4REQB 3K15A 1UEXC 4F9GA 3B78A 3DOFA 5FBZA 3ROXA 4KMMA 4K9LA 5EUBA 3A2MA 5JQGB 1Q16A 2NQ8A 3NHBA 3K0KA 1UC9A 4JBGA 4MUEA 5E6RA 1N1GA 1F4LA 2NVOA 3F1KA 1T8WA 4ZIRA 4DBLC 3LPZA 4EELA 2QBYA 2IHBA 4NBUA 1FX1A 3TR6A 4CL8A 2C9DA 2AG1A 4Q3DA 1OI7A 3EAGA 5DFAA 1KO8A 3SEZA 2C4KA 2ZVQX 3GLGB 4HQKA 4MZDA 5L4SA 1UJCA 2QA5A 2DFNA 4WBNB 3AF6A 3ND5A 4R1PA 1MOPA 3Q15A 3EFOA 1NN1A 4QO8A 1F0NA 2I9CA 1YGPA 3OOJA 4YJ3F 5EJMA 2XYRA 1N2HA 2RHGB 3DLBA 3ZDEA 4G5QA 4HRVA 1UC5B 2Q0QA 4ZANA 3TUJC 1YRHA 1HLGA 3HZOA 3S7ZA 3ANYB 2O2HA 2VCEA 4J7XA 3EF0A 4DMRA 1FE8A 2E4UA 4KBGA 5EWJA 4AP2A 4PRKA 3AW8A 4EI2A 4YTEA 2GPNA 2FW0A 2XZPA 2CNOA 2VSOA 1ZK4A 3OEWA 4F9FA 1E3WA 4I3FA 4ZT3A 4WJLA 2PZIA 5EQDA 3LP8A 3FZEA 4TMTA 5AKKA 5AK5A 4DWWA 1W4ZA 1JCRA 1JPUA 1NL4A 1H1DA 2Q5FA 2LWIA 1N95A 3AG6A 2WMNB 3HI4A 4OEHA 1E9AA 2C84A 2CZQA 3U7QB 3U4AA 4E3WA 1GGHA 3IQWA 3H3XA 2AOTA 4MUNA 3QX8A 1G20B 1BW9B 4DJFC 1Q1ZA 4DLXA 1ZIOA 1PTKA 4LDJA 2PKRA 1NJFA 4W7SA 4FSXA 4WRRA 4EMBA 5GZ3A 2D06A 2Z2IA 4GZDA 4R8KA 2A9QA 3PFBA 4D8WA 3ZU7B 3CVNA 1HDCA 2VAPA 3GX1A 1SHJA 1M8GA 5IG2A 3MD0A 3T5CA 4B84A 2ACEA 3B9RA 3LC7O 3OE7A 1JG6A 4DRYA 5B58C 1OIWA 4JB2A 5CYGA 3AL0C 5ANRA 2K5UA 1K27A 2AFHB 4DX6D 1EUDB 5ALGA 3V79K 4B4VA 2G71A 1EEHA 2QUJA 4JI8B 3ESDA 2DBZA 2QIPA 2IVZA 4M0DA 3VNAA 2VYQA 2C4TA 5G0WA 3NBAA 5F7ZA 1TQHA 4DANA 1WDKA 4ZKEA 3WV4A 4D0LB 3Q10A 4TYNA 3BL6A 5DVZA 3DT6A 1BCSA 1ZN2A 1II0A 4PSVA 4RLFA 1WMEA 3F5FA 1XDBA 5A5DA 2BISA 1KGSA 2LUOA 2E49A 3DL2A 1TF2A 3GAAA 3OVMA 5BQPA 4LRZA 1RTTA 2ATCA 4DDTA 1O0CA 4QLOA 4DZRA 3CEHA 1YCGA 1AQYA 4D3DA 3HRHA 2O52A 3KTOA 1AZLA 2ANBA 4XW2A 3O47A 4BMPB 1ZVJA 2QZJA 4D6XA 3PZ1A 2NACA 4PINA 5AVZA 1BDBA 1FFSA 2IHZA 3O6VA 5DXFA 3Q7QA 1APBA 3UAGA 1T4CB 3ED5A 2AR7A 3V4FA 3LWNA 1WVGA 2GYYA 3EVEA 4XJTA 1N34B 2AVDA 3SF4A 3VR2D 1KTIA 2WWIA 5IF9A 2V65A 1RKUA 1R8JA 1FBNA 3B52X 3GJ5A 1N4SA 3GUUA 1W36C 3R3YA 4RQTA 1M34A 4LZNA 3LTNC 4FONA 4GAEA 2TYSB 3VZDA 3CVQA 2Y4NA 4C2BA 3LJ3A 2W83A 1FFWA 3STYA 3NVDA 1W2GA 1A9YA 3WKEA 5J4LA 1DX4A 2MDTA 4DMHA 5DWDA 3E81A 4I81A 2XTMA 5GGYA 2ETXA 3VKWA 4GSLA 4Y9UA 4NNPA 1U1IA 1BXZA 1L7XA 2PL5A 1WW8A 3UZUA 4G23A 1O54A 2PCJA 5LQNA 1ZAKA 4K3VA 3BSFA 3JZIA 3LD9A 1MT0A 4C48B 2AVPA 2SCUA 3NP9A 5FA5A 4YMVA 4B3BA 2BEWA 1PDWA 2WM9B 5CX1A 1RRCA 121PA 1Z5VA 3C39A 3GZSA 3C8MA 3FLMA 2F1IA 3SFVA 1LUAA 3ZV6A 2PVPA 2Z2KA 4JVNA 1TNOA 2E5WA 4ISBA 5KKCA 1NMZA 2KQUA 1POXA 2B2CA 4JR1A 1NHGA 1J2YA 5G3ZA 4M9CA 1H22A 1RXEA 3PREA 2FPMA 1WU7A 2PUVA 2SECE 1CQJB 4GI3A 2HV8A 4HFJA 1NJ5A 4LYYA 4IIYA 4HRXA 4N5HX 4L6IA 1N7GA 4XB1A 4EY8A 2PD4A 5FWYA 1ECPA 3JVUA 3TZ6A 5DZSA 2HMYB 3U4TA 1EVJA 2IDMA 1KP2A 2O1SA 2XPIA 1LD3A 3GFBA 3WKBA 3DNPA 3EQZA 4F1PA 4R5MA 4V39A 5GP1A 4ARAA 3WHLA 1M2VA 4ZI2A 2W2TA 2HHJA 5E95A 3FH0A 3BGIA 3HB5X 2O7NA 3MMPA 3FKSA 2WXLA 4KV7A 3EUEA 4U2BA 2ID9A 2O3TA 3PGXA 3ST7A 3TGWA 4FE3A 2P1ZA 4ID3A 2WIKA 5IFKA 1GGVA 4OMCA 4FYKA 4DUPA 1UOEA 4TSFA 2Y67A 4LF7B 1QIEA 2AE2A 4ABYA 1R9MA 3NT4A 1A8HA 4ER7A 2WB2A 2FKNA 3GG2A 3QOUA 3SK1A 3A26A 3LPAA 1E4OA 3G5LA 4B4DA 4B89A 2WSYB 3SJAA 3W1EA 2WWFA 1AF7A 1VBKA 4GPAA 4EOGA 5L53A 2H6GA 3IPAA 4R7GA 1YK1A 4V1CB 1R37A 2IF0A 3P0FA 5HJ7A 3HBLA 2IF4A 1FRQA 3AQ4A 1MJGM 1FP4A 2R66A 1UN9A 2PD3A 3KYJB 1PN3A 4HAZA 4JIGA 3UFXB 4JI7B 2DF8A 2XPYA 1FTQA 3ITKA 1GQQA 2R2LA 4UVDA 5E4YA 3WISA 5KVAA 2FG6C 3OLWA 4E6PA 4MS4B 2R86A 1X8KA 1IJKA 2QN8A 2ZB8A 4D80A 2AG8A 1YMPA 1CB0A 1SVUA 2CF5A 1GYPA 2WW8A 3AUTA 1ULSA 3LZCA 5E1MA 3STUA 1FUUA 1Q77A 1VSVA 2WAOA 4H7KA 2FB9A 1U1GA 2CHUA 4G26A 3BICA 1HGXA 2QM0A 4RGVA 3EC2A 4PTLA 3OD5A 1GQFA 1ENPA 1LS1A 4X61A 3ETHA 1GU0A 3PC4A 3U9WA 4ZEOA 1B41A 5K3FB 5JCOC 4XUDA 4U7HA 4I19A 2VJKA 1J7KA 1KYTA 2G0TA 4X7PA 1KRXA 1R0RE 2GYWA 3PLRA 3K8YA 1XWIA 2B61A 2YXLA 3D5QA 4JSRA 5EY5B 2R84A 4WUTA 3SSMA 5LZ8A 2RKOA 4C0LA 4JLWA 4DZZA 2P0AA 4QYSA 1T13A 1CIPA 1TQDA 4RQAA 5EMHA 3RS8A 4EGJA 5BV8A 5IWAB 3QYAA 2UVQA 4CDRA 1F2DA 2OFWA 4RWEA 1V3UA 3D3WA 1ZC3A 3C3CA 1ISJA 3AU4A 3B1JA 2VUSA 1UM8A 4I9NA 4AUNA 1914A 2XNJA 1LI5A 3JYHA 4ZWNA 3ZWYA 4NBLA 1E7MA 3G7SA 3EX7C 5LNK6 4O60A 2PQRA 4WADA 3H04A 4O4IB 3TZBA 6Q21A 2PH7A 3GZ1A 2QRZA 3DWGA 4B4UA 1U0TA 1T4BA 1ELRA 1N57A 1AUOA 3RSSA 1MW9X 2RGCA 3UQ3A 1P7WA 1WIWA 2PJUA 3EOZA 2C92A 1JFLA 2WUDA 3ZKWB 1RI5A 4R3NA 2VPPA 1M72A 2JIOA 1ZN8A 3R6LA 4H4EA 5HP4A 3F4KA 4BFWA 1VL1A 4P3PA 3RRMB 4DBZA 1JHQA 3ZVKA 1POWA 1JLLA 4Q6BA 4KT6B 1ZD8A 2REOA 3B9QA 1VJ5A 1MAUA 3CU5A 4X1YB 4U0JA 1BDIA 2ZWAA 4V0LA 2J08A 2ZJZA 3ZNQA 4D7AA 1XTJA 4FDUA 3PHLA 2RC5A 1OV6A 1QVZA 4M99A 4QDJA 1QCCA 2A58A 3K1JA 3DSUA 4L3OA 2IYVA 4UXIA 5HDBB 3W4IA 1G3MA 1BDJA 3BIJA 4D9KA 2H54A 4FNAA 3CVJA 1F8XA 1E9VA 4NNJA 1EQUA 2FA9A 1KS2A 4FKZA 3L93A 4M8NE 4W5JA 3KDAA 5H9VA 2VF7A 3VSEA 1B23P 4RY2A 3T7RA 3K2EA 4RY0A 3WZ2A 2WJAA 2XD4A 1QYXA 2Q1SA 3PLNA 3W0LB 4FIZA 3GFQA 5JS8A 1DCKA 1ZL2A 1IHPA 1GR1A 1JKJB 2HIAA 1CJVC 2OCXA 3E7WA 2F2TA 3BE8A 1LF8A 1LSSA 5IF3A 2YINA 2W2KB 2P8SA 1GO2A 2J87A 3IOMA 5DO9A 4FNOA 4BMOB 4HNRA 3E3NA 4L28A 2A5DA 5FWNA 4FTWA 5K2MA 1WG0A 5ALOA 5E7JA 2H11A 4EY6A 1F5SA 1UP4A 3HUUA 3DDSA 1NTOA 1ZIDA 4Y2VA 4TQUS 3IVGA 1M74A 4NZ9A 1JHZA 4GMXA 2VDQB 4JGBA 3RAJA 1KXJA 4I5GA 4BN4A 4BVGA 1XB2A 4I99A 4DQXA 2ADOA 4FCCA 3Q5MA 5JS7A 2DETA 1N4QA 2HA4A 1NW3A 5JUWA 2ZUEA 3LECA 2R5NA 3RC1A 2ZRJA 4IUYA 3WRXA 1VZ2A 2I76A 3VC2A 4A3SA 3GQBB 2I55A 2NV2B 5TLSA 2E4AA 4NBNA 3NTQA 3ZU4A 3TAXA 4ACBA 3CXUA 5CG1A 2DECA 1F5NA 2IWRA 4C4YA 4QM6A 1H3EA 4MVYA 1WL8A 1AXEA 3C85A 3NFRA 3QW2A 5EE1A 3TOCA 3GA0A 4LV8B 3T3PB 4C78A 4I9GA 2JHCA 5CCDA 3BHJA 4EHJA 4W9MC 1B8OA 1SHUX 4YP1A 4ZDJA 2VWQA 3DL0A 1MB0A 1FS4A 3ZR4B 3GOHA 3AILA 1IIRA 1WDWB 1JTFA 1PUXA 1XRMA 3Q3IA 1FMTA 2XUZA 3HKEB 4RJTA 1NFQA 5IM5A 3RU7A 5IULC 2C2MA 1PUJA 2O5CA 2HOQA 2HRRA 1I3KA 5F5LA 5CAEA 1N54A 3LWBA 2XLCA 1Q22A 3HTXA 1UF9A 2HRZA 2WM3A 2BFBA 1MO4A 5C8VA 2D8AA 2AJCA 3J7AC 5BSUA 2JFNA 4KR9A 4RAQA 1U3CA 2X3MA 1YDMA 3QTLA 1PDOA 4BQNA 2XRFA 3RVLA 3VNBA 1YDEA 2DK6A 2X6IA 2WMOB 2F62A 1W44A 1XT6A 4FZJA 1WZIA 4XAQA 2VOEA 4NI5A 4UUCA 1RHMA 1B2RA 2AXNA 3AFIA 3DSRA 3NHKA 5I7UA 3UOAB 4C6TB 5AQ9A 2QL6A 3UJ6A 4F4CA 4PQRA 4MAMA 2PLAA 4OXYA 3OMLA 2AN4A 1C9MA 2FXVA 3CUSA 4GDMA 3RC9A 1NI5A 4U2FA 1NXQA 1VGVA 2BLLA 2CDCA 4LY9A 5AK6A 4DM7A 1HX7A 1CTQA 4ENWA 1E1RD 1VHWA 1LLFA 4G5OA 4JS0A 4UTZA 5LIRA 4WH0A 1JMYA 4M1KA 2GEFA 2XQIA 3K9NA 4IGKA 2Y1OA 5EZQA 3OEYA 5B3SE 2JC3A 3X44A 1AHPA 2P58C 4BFRA 2B5VA 5AWFC 4WGGA 1CW2B 2BJWA 3IURA 2A0WA 3AM5A 4GG1A 3K31A 5DHRA 1D6NA 1VIMA 2ECKA 4UD6A 3VTZA 2QRHA 5TIIA 3KAKA 3WGTA 3EIWA 3ZQKA 1E60A 1JAIA 1C7ZA 1OVGA 5BV0A 1SIUA 2OILA 2I34A 2D3TA 3CB4A 3EQ2A 3LPMA 2JAXA 1QYIA 3F9CA 1JLRA 4ESOA 3S2IA 1RJWA 3AERB 3H11A 1WSAA 3KVVA 3P27A 3AM1A 1WR8A 2IS4A 3D2BA 3TQOA 4EHKA 4UMVA 3NBXX 1RRFA 1DV1A 1VIAA 4Q9DA 4RUKA 4E07A 1ZA2A 4L9AA 2WAXA 1GKUB 4UOQA 2ZSFA 4CT5A 5LYJB 5KNBA 5IKOA 4GVXA 3ZU3A 1L5WA 2C9ZA 4X6UA 4NPCA 1Z62A 4CLEA 4BSXA 2HQBA 1BXGB 3DAYA 2L19A 4HMOA 4KFSA 4PWYA 3SGHA 3RREA 1L7BA 2EYQA 2C0QA 4ZA2A 4QXOA 2K87A 1HWYA 4G37A 2FSVA 4BU0A 4KQIA 1G3UA 2VHUA 4BP3A 2P6UA 4LVCA 2WA2A 2FWPA 5HF5A 5KJEA 4DV2B 4U2EA 2I7TA 3HP1A 3OZ7A 4C5CA 4EENA 3AI2A 1FUKA 3B8EA 4XCXA 1VG8A 4I1OB 2Q3MA 2V7UA 5DGCA 5DT2A 2I87A 3W6UA 4FILA 4CCAA 1M2GA 3V3TA 3Q1KA 4M37A 5IMSA 3GDWA 4A4DA 4TV8B 5F2NA 1ZSNA 1A82A 1QH1A 1PX0A 2W5UA 1K5DA 2XWBF 4K2AA 4LDAA 4UCQA 4WLNA 4YLEA 3ZE8A 4CM5A 3LKUA 1JJBA 1FYFA 2VJPA 4P53A 5L3SA 4Y6GB 2YQ4A 1YE5A 3S7JA 1SWWA 3AGQA 3CNOA 1USIA 3O03A 4LHVA 1A7UA 3EGDB 4BUJA 1B26A 1XRQA 4KSBA 3CVYA 5IM4A 2C7PA 1Q44A 1TTQB 4J8PA 1A3CA 1JHRA 1N9GA 3BDAA 4OB6A 4WDRA 1BS1A 2X4IA 1U0SY 4RL4A 3ZTYA 2VPYA 3CUTA 4DV0B 3ZVNA 3S68A 4B3RB 2H6IA 4MB0A 2UZAA 1W52X 4DQVA 3QNWA 2QU8A 3BS4A 3FH7A 2ATXA 2C96A 1U5AA 3JRWA 3LPNA 5I6DA 1MC5A 3HM9A 1N8TA 5JAOA 4U8GA 5IASA 1USKA 2RGGA 2XYVA 3HN6A 4G5XA 4BQQA 5JRDS 3F5DA 3R1IA 4IWNA 1HO3A 2QGNA 2XYPA 1YVRA 4QRHA 3D8SA 2CSXA 1MD9A 5CERB 2ZQYA 1IUKA 2BGGA 4UOEA 1EWVA 5B3JC 1F4PA 4QBIA 3SX2A 4OPMA 5HSGA 3HO8A 2AOUA 3WWPA 1ESDA 3KTAB 5CIQA 2ZIWB 5FZQA 2H4YA 3TFWA 4FT2A 4DPKA 4LDPA 2APJA 4GXNA 4OL0A 2N0SA 1A8PA 2GZAA 3GLSA 4NYIR 3VV2A 1NVBA 2YWRA 1HG0A 5AM4A 5FUXA 2Z5LA 3TLJA 5C80A 1X2BA 2RJNA 3EA4A 3G5AA 1D2RA 3IT3A 4K46A 4YONB 1T8TA 3DBLB 2VUHB 3VRHA 2H1HA 1OH5A 4MJLA 1W30A 4EABA 5FZSA 1TYEB 2J9RA 3WIUA 3FHCB 2EQAA 2PS0A 1X70A 4MBGA 3MGKA 2OORA 4CJXA 3K0BA 2QQEA 4A2QA 1EWRA 2WTAA 3DOOA 5LJLA 1T2CA 3GLTA 3P9SA 4G0ZA 5SZIA 1UADA 3KSRA 1N2EA 3MKRA 1N9GB 3WRYA 5DXAA 3EZ2A 1RR6A 3MELA 4YP0A 2ZSBA 1E3JA 3UMMA 4UYJB 1PGJA 4YUXA 1CJCA 5BMVF 4K28A 3J5PA 4BNNA 3UWSA 1RLIA 3WB9A 3L7NA 1DAKA 4PV7A 3BFPA 3UT0A 1NYRA 1YKGA 3FJOA 4UYJA 1HQDA 1PP4A 5L3SB 1AY0A 1OTHA 4XR9A 4ARVA 2JIPA 3KE9A 1QVRA 3D8NA 1UZMA 3HDJA 5JHGB 5IU6A 3DF7A 3SYRA 1BXRB 4G84A 4DQ0A 3QFSA 1DWPA 1UK7A 3P9ZA 4FFBA 1DE0A 2BTQA 3C2QA 2HHAA 2VP3A 3MPUA 5IY5E 2YHIB 4JOSA 4KN9S 5HUQA 3I8OA 1M67A 3X2FA 1TTTA 1WKBA 3K8QA 3Q40A 4RIGA 2V3CC 5BWBA 1TO6A 5AP9A 3U7FB 1CR4A 1RRVA 1VRCA 4O2BB 2OK8A 2X0JA 2XXBA 3SBEA 3GRCA 3BUAA 4GL4A 1ZN7A 2W2LA 4EB6A 2VH1A 2ZDHA 1FXSA 4Q03A 5LFAA 1TCVA 1YRBA 1XGWA 4Y0VA 5ALYA 3NU1A 2SBTA 4GRAA 3A1SA 4RH0A 1EAMA 3ZDCA 1NG1A 4DB2A 4KKVA 4F2HA 5CLHA 2XNDA 5LBIA 4CN9A 2X5TA 2WJ4A 3OE4A 5KX5A 1G5TA 5LYJA 1V7PC 3PC8C 4BP8A 1RC0A 4JELA 4D6YA 4HI8A 2GYUA 3DL7A 2VEOA 3INTA 3W2IA 2H00A 4HNTA 3BA6A 3DO8A 2VHQA 4HFMA 1T9CA 3PFHA 5FTKA 5HFAA 5JI2E 3A2KA 2CVHA 2CHQA 3TCNA 2Y1EA 1KF0A 4G2NA 3NVAA 2RCYA 2Y0DA 5A5EA 3HR7A 3HV2A 3DZCA 3EF3A 1N1MA 4LRWA 4A0SA 4XKCA 3C74A 3PJGA 3AF4A 3VAAA 1RXVA 3SCZA 2FQQA 1WW3A 4FDAA 1N33B 5TVKA 1GZUA 2FPKA 1GG2A 2IOFK 3KZXA 3TDMA 4S2EA 2CHWA 1UXOA 1EVKA 1JQEA 4GBJA 4MAFA 4YIKA 2IGTA 4QXRA 4J7AA 3AY7A 1KO4A 4WHMA 1HNWB 2JHGA 5BN5B 2AJLI 3UIEA 1IE3A 2O8BA 4Y2SA 1X6VA 5D3KA 3ISTA 3Q9NC 4N2SA 1JIUA 4DIFA 1E1MA 1VMAA 3CPHA 4LWQA 1G5PA 2HLPA 4DQDA 4EJMA 5ES4B 2R1TB 1NATA 1OXKB 1R2QA 1T3TA 2QT9A 2VNSA 4DX1A 1ULAA 3HP7A 1NDQA 1ZGCA 3G68A 2AKEA 1GZDA 3I28A 5EYLA 1UM9A 2J3IA 3MRSA 4BLRA 4QHTA 2FR8A 4GKAA 1SZCA 2GD1O 3H8JA 4A0HA 1JWGA 3D6JA 2O7QA 4BCDA 3HJUA 4C6TA 2VPZA 5K3BA 2Z2XA 3BMQA 3SIPA 3P94A 1K75A 4F2WA 4CLOA 2OC4A 4A5SA 2AEFA 4WCDA 4Z7OB 1RKBA 2JI4A 5FQOA 1W0JA 2EP7A 2Y71A 4G4SP 5DNDA 1RWPA 2XGGA 3FYUA 3C3RA 1K08A 2WPDD 4YDYA 2VAWA 4B8YA 4URVR 3JAKB 4O4JB 3VC7A 4LF5B 4HF7A 3DEAA 4M1WA 4RKQA 4F7DA 3NMUF 2VXBA 1LB1B 3ORRA 3IOBA 2I1QA 3CMCO 3DTNA 3IAHA 3MF4A 1ZOPA 4HG2A 1NUHA 4HWRA 1SRRA 4BCBA 1U28A 5P8WA 4EG4A 2ACVA 1YUBA 1JBEA 2V0CA 5DH9A 1YS2X 1XWFA 1DTSA 2ST1A 3BMNA 1Q83A 3HSYA 3KLMX 5HE9A 4YUAA 5AW4A 4DV6B 1ORRA 3O8NA 4D9NA 1N5IA 1C8BA 3KLPX 5G0TA 4YUVA 1BJKA 1ZAYA 1PJZA 4LXHA 1MOSA 1U3DA 3B48A 5G1PA 3U9LA 4WNDA 2P9GA 3MTIA 3TSAA 5JCPA 3VPBA 1DUIA 3O4GA 2AMLA 1USWA 2LAIA 1JEAA 1XLTA 4QICA 1L5LA 3ZIAA 1IBMB 2QENA 3AY3A 2JH3A 2ZBEA 3DLAA 3R0JA 1F12A 4O02B 5EWMB 3V7YA 2COKA 6PFKA 1P2FA 4HQFA 4KRYA 1I36A 3DWFA 3OCXA 1H5UA 1TM1E 1ZEMA 3KB6A 3NIWA 4P7BA 2ZBFA 3KZNA 5HMMA 3MRTA 3PQDA 1O3YA 1OB2A 4OXKA 5FTLA 1PL6A 2NQTA 1ZBQA 2C54A 3HIZA 5EEHA 1EDEA 1KARA 4BJ6A 2QAGA 1U2GA 2A88A 4MVXA 4OU5A 3ASFA 2GDZA 1J42A 3QM1A 4JASB 2AIRA 2Y0CA 3QMWA 3VR3A 2YMLA 2DHEA 4Y8VA 2FPLA 3FFLA 5LLSA 3LVQE 4MWEA 1G1AA 1NNI1 3KPWA 5HS6A 4JEUA 3D4OA 1W5BA 2CEAA 3EVDA 3QLTA 2RKBA 2IDZA 4IIHA 1ZU2A 1I9CA 4N3NA 4AP6A 1L7VC 4RKRA 3MGGA 3QU9A 3L6UA 5BXUA 3SYLA 4MRMB 3ZG6A 1ETHA 1V3VA 2IXGA 2OHGA 3L7DA 2TMKA 3E22A 3GCXA 1IDN1 2YWJA 4L8YA 1Z8NA 2VNJA 3KYDA 4M49A 1QZXA 3UK1A 5GJWC 3ETNA 4XUCA 4HH0A 3DBIA 5HRAA 1COWD 1T34A 2Q45A 3HCDA 4KQJA 2C9BA 1I2MA 3H5IA 4Q4HA 1PJBA 3TSYA 4BNXA 2VP6A 4R1NA 1OHHA 4NVRA 4C4TA 4D9IA 1I80A 3VH2A 2VQFB 4U63A 2DCPA 2ATVA 2B3DA 4CMJA 4MQFB 4HN4B 5ICGA 1PD0A 5KX5B 4MEAA 4MKZA 1S8FA 1YA0A 1PFYA 3PFKA 5JZVA 3VX4A 1HFKA 4BO3A 3E9QA 4GMFA 4ZRDA 3GJTA 1O08A 4A27A 2Y1DA 1E1DA 2BKGA 2E4ZA 3AQIA 2BRUA 3KUCA 5J23A 4BQRA 1ZXXA 1FFXA 3G2TA 4P22A 4UMDA 2BKLA 2X1VA 3MVEA 3MA5A 3HWX1 4BZXA 1YOVA 2CHXA 4GX1A 2W70A 4F12A 4TWJA 3QWWA 2BMFA 1PFGA 2X13A 3AL3A 3BL5A 5BNIA 5A5VA 2F55A 1E8OB 2BEDA 1GKLA 3PXDA 4WLFA 5B1DA 1NC3A 3I8SA 3L4SO 4KXNA 1WOYA 2B9EA 2F59A 4Q9NA 1QHFA 1MEJA 4UHFA 2CGEA 3LT1A 4IVQA 3QITA 3RVKA 3B5EA 1LK0A 1IY9A 3RUAA 3NHAA 4LDZA 1UT6A 4M3OA 3I9KA 5A4IS 5BPHA 1U8TA 3PVLA 3CB2A 1Q0PA 4JX9A 4ZCSA 2IYRA 2VBFA 1WE2A 2BGKA 3MCWA 5DCWA 3O7MA 1O9HA 3OQ6A 2GN1A 2DR2A 2XZLA 4MP3A 2H0QA 4XKJA 1QV6A 1J0CA 3QTTA 1FJ2A 1SD5A 3AL2A 4WWNA 5ED4A 1K3FA 1PR0A 3FRIA 4FZ3A 4FYMA 4LMRA 4PRLA 1KYYA 4FFVA 3KSQA 3T7IA 3WGKA 2Q3FA 2VIIA 5GADl 2EFCB 4PC3A 1G8PA 1YZLA 3NH9A 5LD2B 3RYFA 3BFKA 3MLEA 3N07A 5CFZA 1NXXA 1QE3A 1TRKA 3JALA 4DSNA 1GCGA 3GJ8A 3KB1A 3D1VA 3BU8A 2ZTMA 3RHSA 2H4ZA 1YQDA 3CLKA 2Q6OA 4XOIA 4D4MA 3S44A 4I8DA 4EFDA 1LC0A 1XPOA 2VPQA 3C1UA 1K4KA 4MYTA 2QX4A 2COEA 4OI1A 4CR7A 3WK6A 4NU0A 1ENZA 1EUYA 4ATNA 2W2QA 1NA3A 3S28A 3FUNA 4D9EA 2A92A 2HMAA 3BA1A 3FPJA 3O8QB 3U60B 1H5QA 1Z3XA 1OT5A 2YC4C 3MTBA 1Z34A 3SEFA 3K2BA 3ZGXA 1MVOA 4QM7A 2HQRA 4I5FA 4HOQA 1EM8B 2VUUA 3QFRA 3S8EA 3P9IA 5DBGA 2GRMA 4DDHA 4J1TA 4GTVA 1JIKA 2FTKE 2NNWB 3ZWCA 3E37A 4FHKA 1KVSA 1ZVMA 1U3VA 4M7CA 2O2GA 4J03A 1U8XX 1TPYA 2FMFA 2I8LA 4L95C 3ZZ1A 4I1PA 3A6DA 2PX8A 4O59O 4GR5A 4CQMB 1NVGA 1XF1A 5EJ9A 4R41A 4UPDA 5C1DA 5HR5A 2C9MA 2BKKB 5KNCH 4GC5A 4CNQA 3C3OA 3PQ2A 4EGQA 3DZBA 3ET5A 1QS0A 3H75A 3L9TA 1D0IA 4X62B 4H1WA 3ASNE 4RTQA 4ZREA 4DXHA 1YR2A 4V2UA 3R7SA 2MJLA 1F6BA 1AURA 1LI4A 5T67A 2JJ1A 4B0OA 1IYZA 5LR6A 1FEZA 2AG6A 1P7CA 2QMHA 4ZDWA 4ZOQI 5HRCA 4C29A 1ZLYA 2VGXA 2IU3A 3HB1A 1JFTA 5BR8B 4S1NA 3PEUA 3WGGA 3LF1A 3Q73A 4MKFA 1WPXA 4KTVE 4MV3A 3UHAA 1GQRA 2I66A 4RDIA 3A3PA 1QUFA 1T5OA 4JN6B 2W6CX 5SICE 1W1UA 3SF8A 1X7ZA 1DLJA 4IXMA 3ZV4A 5KTYA 5IZCC 3I4FA 4JGGA 5F5XA 4B7ZA 1N5OX 1VDMA 2Z8ZA 2R87A 2QL7A 2NNLD 2PT7A 4QUDA 2BVNA 2UV8A 4KQ2A 3VR6H 4C6RA 4Z7JA 2OC9A 3CF2A 1QYRA 4KHPB 1D2AA 4I46A 4DPMA 3Q4AB 1R0BA 3L79A 4GPIB 4UQXA 3F4BA 2B34A 2HZ7A 1ZM9A 4B45A 3TX6A 5C18A 3G9QA 4FWTA 3DDCA 1QO0A 1V0JA 2V7BA 3PKZA 1RAEA 2FSHA 3JCZA 1II9A 2Q6TA 1HKUA 2I65A 3G7UA 2IEDA 3I9LA 2WZQA 3RS7A 1OILA 3SYMA 4DXDA 1I4LD 2A0FA 5CFLA 4QFVA 3PFIA 4KN8A 4KXFB 1G8KA 4GGOA 3C87A 4XPIB 1EP3B 2NZWA 5GGXA 3VR4D 1HG2A 1C2TA 4MPDA 2OD7A 5B7PA 5JSZB 1UWLA 3TB6A 4ER0A 2K7FA 2AC2A 4F3TA 5C7OO 1JAZA 4AMVA 1BKSB 4O6VA 2BJVA 4ZPXA 4A91A 1NBMA 3KAEA 2RE8A 1H4QA 1WPRA 3R5XA 1YFLA 1CUJA 1P1CA 3E61A 2HRCA 1R00A 2NYJA 1MVLA 3ISVA 2POQX 3KT8A 4DDUA 2JLAA 4C7KA 5CUQA 1H4SA 3KHSA 3GLIE 1PJ8A 2LIVA 3GZJA 4MQ5A 2B94A 5CEDB 1DAHA 4NBSA 3GP3A 5EKXA 1GPJA 3G0HA 2WAMA 1JR3E 1KBQA 1NAHA 2NGRA 1JR4A 3QJYA 1LBSA 2O2CA 4B85A 4GPD1 5REQB 1WBBA 5AESA 3FTDA 3IO5A 4BFZA 1GPWB 1L4BA 2UYQA 4QLBA 3HYLA 1AZSC 1E8OA 1O5TA 3ILXA 3AVQA 3LLVA 4ECAA 1A27A 3OPMA 1O58A 4RHTA 1N6LA 4IIJA 2QPOA 1Q7GA 1QYDA 3AG2E 1SHLA 4L0MA 3VO1A 1WB9A 2CYAA 3UWDA 1KFKB 1N8NA 2VL7A 3LLMA 3UH1A 3VPGA 5BOSA 3TBKA 4KREA 2F3RA 3W8NA 1IY8A 1ZNQO 2Y0EA 3JYQA 4WBNF 4CT4A 4A36A 4KLNA 1GGEA 4S2UA 2AS0A 3BXZA 4J16C 5ILOA 1IQPA 1O1TA 3PPXA 3SFTA 4A3TA 4DG8A 3ZXSA 4F5EA 1JFFA 2H08A 2WVGA 1DCMA 3NWJA 3PZRA 4FN5A 4IOKA 1E1KA 4QLAA 2H8GA 2AR0A 2ORWA 3FDIA 3OOYA 2P2NA 4P34A 4EHAA 1Z4JA 1QO7A 5LUBA 1S2LA 4D0RA 1DCFA 1W4RA 3LCVB 1TADA 3NORA 3FUWA 4IDQA 4N01A 2CUTA 5IUKC 3ROPA 4R5HA 4G4GA 4OX9B 4F46A 3ZWWA 4OJTA 1NURA 1OTYA 4DR7B 3KKMA 1W6UA 2BFBB 3GWZA 3OMXA 1AHHA 5JPDA 2BLNA 2O5EA 3H65A 2I7XA 1QCZA 3DZDA 5D0QD 3EDCA 1O95D 4EPTA 4F2GA 2WZBA 4YJ2A 3ENEA 4O4LF 2BEUB 3HR8A 3K9QO 5GONA 1LKZA 1NXWA 3VHXB 1N52A 3ESAA 1YL7A 1A2KC 2FG5A 4OLJA 3GLIA 5HKOA 3M2TA 5LZ9A 3ZNNA 1OJ7A 3V34A 2G8LA 4XX1A 3G2MA 3LCRA 1EFPB 1NU8A 3AF2A 1L5NA 4TSFD 4B7UA 1GPH1 2YIDA 3IB3A 1YZKA 2ECFA 3KOXA 3HA3A 1YA4A 4Q3OA 3JD0A 2M6LA 4CV0A 3U5ZB 1OOEA 4R3UC 1XX6A 3REOA 1G9TA 2FEWB 1KAHA 1B8PA 4DS3A 2GZHA 5J47A 1JILA 1H1LA 3FU5A 4ZDKA 3ZVVA 2Z08A 3JZDA 4KXQA 1X7WA 4Y9RA 5LXTF 1D2CA 2IYWA 5F21A 1E6UA 1TAGA 2OT3B 5LBTA 5T64A 4DLBA 3QENA 3MTAA 2P9BA 4GE0A 5K7SA 3V4LA 1DJLA 2AXUA 1S7CA 4JA2A 4BLWA 5ARGA 1W87A 3ONDA 4I50A 3VQTA 1Z2AA 4O4LA 4HNVA 3PFCA 1FVOA 4MARA 4F84A 1Z2NX 1QQBA 5ECDA 3H8SA 2ZXEA 4BO5A 1K3TA 4K5CA 1YI1A 4D43A 5MHTA 3DDHA 3NIDB 1IM2A 4IOLA 4FE4A 4WVLA 1L4GA 1WMDA 5BQ5A 4ZHQA 5BV1A 1SY7A 3E05A 1G7CA 1CUIA 1WMSA 3MG9A 5HF8A 4WN9B 3TM5A 2H9YA 2EF0A 2FPXA 1N2CE 3AEUA 4PC6A 4FU0A 1LZLA 2EKZA 2O8NA 2YHEA 5JXJA 4LFCB 1S2MA 2BV3A 3A8TA 3B9PA 4PYQA 3TBHA 4OBWA 5C0OE 4JLPA 1EFRA 1SXJA 2IKQA 1O94D 2X7JA 4JAVC 4XARA 1KE2A 4I4NA 3ZGYA 1E6EA 3CG4A 3KO8A 4L50A 4EI9A 1Z38A 4NFSA 3EHMA 4V02A 4RTPA 1HTTA 4LK2A 5CH5A 4M1MA 1CY8A 2Y93A 4MI6A 3PWKA 3ROGA 5IT9A 4L7VA 3WNQA 4CR8A 1Z4PX 1FNCA 3S2AA 1JQKA 4JOCA 4TXNA 4Z51A 1HNZB 2I6SA 2C8KA 4IIJF 4LUCA 3T0FA 1HDXA 3D6AA 1G5RA 1A9QA 4R2KA 4RXMA 4CLOB 5DBOA 3RG8A 3CVXA 1ISRA 1ZOSA 5K51A 5EC8A 2X5XA 3B2EA 2JIZA 4TS3A 2HU2A 3DB1A 4AMBA 4BO1A 1KQFA 4KYOB 2FMHA 1I0IA 3N2NA 1GRVA 3M4YA 4KX5A 1QJCA 3V2OA 3BGOS 3ESYA 1P1HA 1I2AA 4BB0A 3ZY4A 3VR3D 4TXJA 4ZEVA 3LHFA 4PN3A 1G38A 1JHVA 3UM3A 3BUSA 3IV0A 5K0LA 4CHTA 1M6NA 1ZJZA 2GRAA 4P1ZA 4JP8A 1VBNA 5CB0A 5MDHA 3FKSD 4OQEA 1H3NA 1T5LA 2RDMA 4HEA1 4ZVVA 3RG2A 4FYHA 3S7FA 5IMBA 3H1AA 3PXXA 5B1IA 1KEUA 2IITA 3TG2A 2PBFA 3I01M 4ZXPA 1HQKA 1P2BA 4CKEA 1OX6A 3ZHEA 1U0JA 2F9LA 2V9PA 4MICA 1FTSA 2B69A 4CQMA 4NONA 1TW2A 2DY1A 1TW3A 3JW8A 2P1RA 3KWFA 1KMQA 1DAOA 4ZKDA 1AIPA 1NVEA 1S1MA 2EWVA 5DCUA 2OE2A 3EG9A 1UXKA 3VV3A 3QHQA 2A9FA 4CU5A 1JIVA 3FRHA 4GMJA 4FDVA 1VKZA 4CHGA 3P4YA 4MJXA 3RFFA 4HP8A 5KS2A 2OBNA 1JDBC 1WZNA 3Q3GE 4LRTB 1C9DB 2YBEA 1KERA 5KWEA 4UM7A 2RBGA 2E1RA 5AQ7A 3EWSA 4EJSA 1EG2A 5JCXA 5EMJA 4F97A 2Q62A 1UBKS 3H5TA 5FV4A 1SXPA 5K99A 4UUPA 5FA8A 1Z0IA 1RI3A 4L4ZA 5JY6A 3P2KA 3GPLA 3G0DA 4ZCPA 4AJPA 4Z86A 1KJZA 4B3XA 1SM4A 4JI2B 2FW7A 3C6ZA 4X9XA 2BUBA 2YZNA 1UG3A 3L49A 4NE7A 1XRJA 4S1PA 5F1OA 4NS1A 3KKLA 5A7HA 1E59A 2WQZA 5KAPA 1KJJA 1Q6ZA 3ONKA 1E5XA 1JTEA 2WF5A 2P9CA 5KKNB 1U31A 1E3IA 2JFXA 3IODA 4MKHA 5B3LA 4J6FA 2WUGA 3VZRA 2MYOA 1BHSA 4FYIA 3O8OB 4R2MA 4AF6A 4ZCTA 4V38A 1TB4A 2JFOA 4HFRA 1HE5A 4ENQA 1XNRB 3U9TA 1OWNA 1W1WA 3ABZA 1QYCA 2PTHA 2YWGA 3NUQA 4X1YA 1E90A 3TQCA 3L6RA 3LTEA 5CITA 3QQ5A 2Z6QA 4G8CA 4DTCA 3X1MA 4HLNA 3VNVA 2XOXA 1P60A 3FTCA 1Q1AA 3KAQA 2FDRA 4RHCA 5FP0A 2DXIA 1CJMA 3WMFA 3HSKA 1HXIA 2Q2OA 2VJNA 1ETUA 3NUGA 5L3RA 4CYMA 4W5QA 3DMPA 3E2IA 5HGXA 2WTMA 5AKLA 4ABTA 3RT1A 1FZTA 3P1UA 2HA7A 4XR4A 1G3RA 1SH7A 2FJUA 1RPTA 2GGSA 4KYUA 5TMDA 3G89A 3UA4A 1IL0A 4BCCA 3Q6MA 1KI6A 1R8QA 2C4HA 2OHOA 1XXLA 1R5BA 4ZDIA 4G2TA 4UAJA 5EL0A 4I7EA 4PF1A 3B36A 3FLEA 5LB4A 1RYMA 2HAEA 1SKAA 1X14A 5DW3A 1J1UA 3ZHEB 2E4XA 4BMZA 1CRPA 4RMGA 1YFZA 4PCUA 4RDHA 5D6OA 3VH3A 4OA8A 2XB4A 1GAWA 3MWLA 4I2VA 4EPVA 5CURA 5ED0A 2SCUB 4MIEA 4B33A 4GMLA 3M6UA 4L3WA 4KNVA 1DBVO 4NZMA 5ILQA 5CBNA 2X7XA 2ZIXA 1E6CA 4M86A 3G23A 1NRJB 4DIEA 3CCFA 4BFVA 3NR2A 5BRJA 3RRZA 2AQKA 2RGWA 3L6CA 4WMLA 3THSA 1RJ9B 2RSLA 1RC8A 3A4TA 5EJ6A 2IU6A 1NFRA 1T2FA 3SFYA 2MSEB 3QYPA 3S40A 5CT6A 3TIFA 1WHSA 1U5BA 4U6SA 3I01A 3SR4A 1FFHA 2G6BA 2XQFA 3QPVA 3HDHA 3HKDB 1ZVVA 4TM7A 1IN5A 4UREA 5K8IA 3I1FA 1NLFA 3H8WA 3I9V6 2I22A 4ML3A 4D3YA 4N03A 2XJ4A 5LZ2A 4FLMA 3PIIA 1KK1A 3ABRB 3N5KA 2X5KO 3LBYA 4QYXA 3IDQA 3DZFA 4HEJA 3C45A 1LTQA 3FD8A 4YS6A 3TQQA 3UK6A 3FCCA 3TECE 1C80A 2GO7A 2OOEA 2GBIA 2JH9A 3F1LA 3IV7A 3UCFA 3TPFA 2XVZA 3FVRA 4FHFA 2EIKE 4LECA 4L23A 1HZZA 4IBOA 4YK7A 1EK1A 2ODBA 4FGSA 1ZOLA 8ABPA 1E20A 5JANA 1JWBB 4NEHB 4X85A 4J07A 3DO5A 5FNVF 4P3KA 1TQ2A 5BSTA 3RTGA 2PH3A 3PZDA 4C22A 1NF9A 5M04A 1DEAA 1PJTA 3E8SA 3RK1A 1RZUA 4LZJA 4B3HA 3K35A 1QR2A 5EWLB 4YCMA 1VHTA 1H8EA 1LWNA 4OHOA 5ALPA 2Y8EA 2IQCA 4KDEA 5CDYA 4FN4A 2ADFA 3R7WB 3WOHA 5DIZA 1KVUA 1J1IA 2VJYA 3WC4A 1L4HA 1NW6A 1RKXA 5ICMA 3VYWA 1V3TA 3DMYA 3ADDA 1FFGA 3HVKA 4URKA 3LDFA 4EK9A 1C41A 1OFIA 2PDAA 4L5YA 5JD3A 4Q4DA 4XEIG 3LX4A 4BNIA 5CB8A 1DKOA 4AEZC 4NX2A 4R1SA 4YT5A 2BZGA 1MJNA 3FDHA 2P9ZA 1RACA 3DM9B 4NE2A 1RI1A 1IBLB 3NHLA 4IRUB 5SV2A 3W5JA 2QR2A 5B3JA 4O2RA 3CKYA 4ZFNA 4YP9A 3THYA 3FLAA 2F1RA 4CTOA 1Y1KE 4UEQA 1UANA 3HDVA 4E4YA 1U2GC 3FUXA 1P91A 4IR7A 1KGDA 4C0AC 2LSVA 3DHNA 2HB6A 2BMEA 3FMOB 2HH9A 3FWZA 1YVUA 3IHWA 1VE7A 3UTMA 7REQB 2HJSA 4NYMR 2PVSA 1RVDA 4U04A 4W1SA 4AICA 4IV8A 5LP6C 3EH1A 2WTBA 5HKKD 3DT8A 1YKFA 3MPOA 4RLSA 4X97A 1EBUA 1PRYA 4Z99A 2OXCA 5LD2C 3QSYA 2BSXA 1V4VA 1ZMTA 3L7JA 3ABOB 1RYBA 1O97D 3AKCA 4GO1A 1PT7A 4O4HA 2NXWA 2J0UB 1IC6A 2XVAA 3RAGA 1DLIA 3M9LA 5B4VA 4GXRA 1T6XA 1Q1GA 1KPHA 1Y1LA 2D1RA 2E4WA 1W93A 2JIDA 2X4GA 2ZJOA 3MINA 4WQMA 5FPSA 4Q4CA 2VYNA 3A6HA 3E22B 1A97A 1V5GA 1Z5OA 1ZQ1A 3DJFA 2R79A 3LUKA 5ELLA 4YR7A 4E51A 1EJ2A 1THGA 2OKCA 3MINB 1YZQA 2GBPA 3DLPX 4CCSA 4PZLA 3HB4X 2Q6IA 4JI4B 1QGYA 1PG5A 1O87A 3IP7A 4OGFA 3ZGQA 2CUNA 3GRRA 3L82A 4RJKA 1XQWA 3APCA 5EIFA 5IJ0A 4DUZB 2BEJA 2E55A 4NURA 1NJ2A 5EP1A 2EZ4A 4LNUB 3SYNA 1KEEA 1SVOA 2BZ1A 3QX9A 3IUBA 3H2HA 2XADA 3LYAA 1ZYUA 3R7DA 4S35A 1U4SA 1A5BB 3AERA 5KUTA 1KP9A 4W9NA 4MOWA 1QIJA 5HMLA 5CMWA 2XEDA 4ZAGA 5CB6A 2FOXA 3OM8A 1GZSA 4S04A 5IUNC 3TMAA 2GAFA 3AV3A 4JA9A 3G0BA 2QPTA 2R7MA 4J0FA 3LXXA 2ZYUX 2PGIA 2WJVA 3AETB 4HDCA 1NG9A 3ON5A 3FUMA 1LLQA 1ATIA 5EE3A 4TXRA 2UXCB 2X0NA 3AJAA 4G0QA 3IPLA 4QD3A 3ZUGA 5A9RA 2VA9A 2R5SA 4JZYA 1E3QA 3PKIA 3T94A 3FCSB 1PLKA 1KBOA 3GVPA 2HADA 4IINA 4XIGS 4ZO4A 5DGHA 3UT5B 4M0FA 3ZI0A 1MJHA 3AHHA 4Y6WA 4XGKA 2ZUSA 5KJNA 3JVVA 1F3OA 3C6BA 3OIYA 2UXDB 1KAOA 1UKYA 4JLDA 2CW5A 3K2IA 3ZEAA 4BJ3A 1CP2A 3T1VA 3D9NA 1AKWA 2QD5A 2IYNA 1K4MA 3D3QA 4HMQA 4WNEA 3JPYA 3PHJA 2WTUA 4HOSA 2JB9A 2R02A 1BQ4A 4TV8F 2C2GA 2Q29A 4JK3A 3LY9A 1SUCA 4ZO6A 4TN1A 1QV7A 5L3QB 4HEA6 4RZHA 3SICE 4DMKA 5CFQA 1DAFA 4LHEA 4N47A 3RC3A 3I92A 5T57A 3GEGA 2CXTA 4G24A 1EZZA 3MYVA 2QXUA 4BLQA 3COYA 3VKUA 4DNOA 3N0XA 4P86A 2V4MA 1ENOA 1PVVA 3BMQB 3RSZA 3FF1A 1CEEA 2BFNA 3RC2A 3JRXA 1TU3A 1PS0A 3A1UA 3L1HA 3MN1A 4XGNA 2ZRMA 2PXAA 1ZBPA 3JUEA 3O92A 3AI3A 2PX2A 1QBGA 4E5DA 4C05A 1KSFX 2A0YA 5LU9A 4FCTA 2ZGVA 1GQSA 5TXGA 2PE5A 3I2FA 4XB6B 2C7VA 2X77A 5CCMA 4PZPA 5LYJF 2QQ5A 1RAFA 3EWIA 5JO9A 1GTJ1 1TL7C 5IC4A 3DTYA 4UTVA 1TZJA 2JF0A 2R8PA 5FO1A 1MNQA 1C9EA 2ZRKA 3TXMA 1JKFA 1Z4MA 1UBOS 3DOJA 3C5HA 5AJVB 2IYLD 3JR7A 2F3TA 5CK4A 3RVJA 1SIOA 1I24A 3M6AA 4B76A 1Z9BA 3APDA 2DBVO 4GC9A 3ICCA 4GMHA 3N87A 1EHIA 2BM9A 1BMDA 4M36A 4UEKA 2ZUCA 3BAFA 3CT4A 3E3OA 4JITA 2H1FA 2Q3BA 2Z5FA 3OE5A 3WXXA 4ANVA 1JIJA 1TX4B 3DKIA 3CR7A 4ITRC 1DJQA 1AKQA 1L4KA 3OQIB 4LMPA 4OCZA 1BKDR 4RVSA 5HBRA 4DG9A 1TMGE 1ADJA 2ZSDA 2GHRA 3MAJA 3KYCA 4TL8A 1AN0A 2MYTA 2JKYA 3DDWA 5HZHA 1US8A 1ZU4A 2HUPA 3EWAA 3BHNA 2IYQA 1E94E 3H4IA 3LV8A 4IIVA 2FZGA 1Z8HA 3EDMA 3L1JA 4AJNA 3PT9A 5FLXA 4I1MA 2P2CA 2BPOA 4UNIA 3QELA 3CGHA 4LY0A 4UYKB 2DHCA 3IJRA 4KBYA 4OQPA 4RK6A 1X9HA 3J5QB 3U4IA 3TE7A 1NVKA 1QZZA 2WXJA 4YAKA 1PWEA 1B8VA 2RK3A 4JLMA 4N7RA 4DNXA 2IPXA 5JYCA 3ZX4A 5BSFA 4WXYB 3JQ1A 1MV8A 1QK4A 1DJPA 1DQYA 1NJGA 2C61A 2IRWA 2G1AA 2WD7B 4OQDA 1YWGO 4QTTB 3M6IA 5ALEA 1DC5A 1GZ4A 3EDOA 3PR1A 1L8XA 2H52A 3QWBA 1SXJD 2ZVDA 1FNDA 3FTPA 3MCUA 1NNSA 3E9EA 4QBTA 4YRPA 4DQLA 4IWXA 5KJ1A 4HQOA 1Q95A 1UWKA 1XMVA 3SIWA 4OTZA 2W93A 4WNYA 5D0OD 4PLVA 3TJMA 3U17A 5L51A 2IF2A 4I4CA 1GAEO 1OLUA 3GJZA 3L8GA 1C1YA 2ENUA 3O83A 1XF9A 4JB8P 1XP8A 3CN9A 2WU0A 1ZESA 2YVLA 4JGIA 1UJ4A 4HGNA 3WLIA 2WXGA 3IAXA 3VVBA 3KS2A 2YVKA 1XZAA 3VPXA 3ICOA 3M9XA 1ID1A 4R1TA 4TL6A 3I9JA 3MCZA 1OLSB 3UMGA 1FU7A 2OCKA 4KFRA 3D02A 4TSRA 4HUJA 2PGAA 1E9SA 1NR7A 4JFAA 3IJPA 1X1CA 2CXUA 5EJAA 3QZUA 5TPWA 2JIRA 5TS3A 3UPVA 1NQAO 4RA9A 4A03A 4NYMQ 2G9NA 3K30A 4UVGA 1E2IA 1OAAA 4XDGA 1DXQA 1R3UA 2CJWB 1SUDA 1ZMOA 3IQGX 1TTHA 4G5GA 1AP7A 1KI8A 4JHJA 1H6PA 1FSGA 3D3WB 2JBAB 3QFHA 1IOWA 2VHTA 5EE0A 4C20A 3LH5A 1AGXA 2PH1A 3D5TA 5COAA 4XWKA 4FGJA 2MCFA 3G17A 4HR7A 5DNCA 5KOIA 4EO7A 2OV4A 5K09A 3CHOA 4LA4A 2B1QA 4M8IA 3RO7A 5EZYB 1M6HA 3RTAA 4NHOA 5A71A 4B6GA 1I6MA 3ZOZA 5ARBA 5D5HA 1K6MA 5DYTA 4ALMA 1R5JA 4X45A 4EY5A 2M1XA 4AN4A 2GFQA 3U3KA 3CK7A 1V71A 3R4CA 1T2DA 1Z7YA 3NKVA 3AUSA 3PNBA 2FGJA 1HM5A 3DKKA 1JXOA 4MUKA 2R9VA 3Q9SA 1QGUA 1QUEA 4JJ6A 1UPTA 2NO5A 3NTXA 3TS1A 1GOTA 2OO3A 3DQZA 3EUWA 1XQ1A 3ABQB 5CXXA 4U9HS 1QHHA 1VDYA 1NQXA 2A90A 5EYPA 1LFDB 1NBWB 3FNIA 3UW3A 1OUMA 1L7RA 2MSLA 4BO8A 2Y68A 1FCJA 2FBNA 2RH5A 1BZYA 3FX2A 4K8RB 4RF2A 3ZE2B 2O0JA 2ODAA 3P0EA 4Q37A 3E18A 2HN9A 3NPAA 1L7QA 2YHSA 4MYSA 4N9WA 4NOLA 3RIGA 5JFOA 3R7QA 4RPCA 3SBOA 1P6XA 1GZ7A 1XAIA 2HEGA 3V7FA 1O5IA 4WNFA 5LZ7A 1LBQA 5HXAA 2WTXA 2AXZA 3L1VA 1MA0A 1RAHA 2VJBA 3GRZA 1A1VA 4LZOA 2XNKA 4PSKA 4CCYB 4ME2A 1B0AA 1PJQA 2IQIA 2P9QA 1W76A 3EFBA 3KCNA 3NRCA 3KWMA 2IWHA 1ZH4A 2ZBPA 4YRJA 1ZJJA 5DLQC 1SW6A 4KRGA 1QH9A 4IKEA 3W2TA 2GGFA 1X9IA 1FPPA 1QYWA 1YRWA 4OH7A 5INTA 2CHFA 3HVUA 3ERCA 1RLTA 1T5BA 3OZEA 4D9GA 1E4YA 1GNPA 2OOKA 2J07A 3EIHA 3O1IC 5HF6A 4QTYA 5JOQA 3IQDB 4OM7A 1ODCA 2ZB4A 2DJIA 2JGNA 4XDHA 4D3FA 2R6GA 4YRQA 2V8SE 1YB7A 5EJEA 3PJEA 2BN4A 1JR3D 1O1YA 3LT0A 4L07A 2PY6A 1VJCA 2I67A 4BBZA 2VSYA 1U7TA 3BWDD 2GLTA 1KC1A 1U7XA 2A9KA 1VCMA 4G8DA 4O2AB 4O25A 2X1LA 1J20A 1EDZA 2YY7A 2A1UB 4HUQB 3TXXA 4C0JA 1C0KA 1WCWA 3M82A 3RC8A 4PAMA 4CEJB 2HGZA 4MUFA 3BWCA 2O4CA 4WESB 4B71A 5EX3A 2EQXA 3VLDA 3ZKJA 1M83A 2EGUA 1EJ0A 3DHYA 3QKSA 2CB9A 4Q7KA 2YV2A 3W78A 3SZOA 1Y7PA 3T35A 3WADA 2XF8A 1Q21A 1JDBB 1PJLA 4MRVA 3W3ZB 5J2UF 1DC2A 3QE0A 4PIVA 3VDNB 4RIEA 5GWXA 1YOVB 3BPSA 3PQ4A 2I91A 2XUIA 1FT2A 1KEWA 1KZ4A 1H2AS 1YZGA 1ISSA 2G80A 4M7RA 3GV0A 4R4JA 4ZYWA 3Q7FA 5J40A 2DAPA 1GGNA 2C4NA 2H85A 2Y4OA 2QZAA 4RLYA 1D8AA 1H8ED 2ZUWA 3QOYA 4S0ZA 5GJCA 3GD5A 3D7SA 1QIHA 3ZZNA 1Z7WA 4IHQA 1D9XA 2QXYA 1JXQA 1LNSA 2TMGA 1G21B 4RESA 2LRHA 3ZDRA 2CMFA 3L04A 2CLEB 3ZX5A 3VCXA 3Q5GA 2AI3A 2QAIA 3OEHD 2NXNA 3RS0A 3RWOA 3T9EA 1FTNA 3CKCA 1N8SA 3K71B 2Q2QA 3IDZA 3PXUA 2H5EA 4NEGA 421PA 1FQKA 4MV7A 2A1IA 4OQFA 4KXVA 1SEVA 2A5FA 2Q99A 4P4UA 1IZ8A 1KJQA 4OFXA 3OP4A 4L4UA 3R9KA 1JMKC 2AOTB 2IUEA 3GEMA 3OH8A 3ZBPA 3KQMA 1P5JA 1LU9A 4M9QA 4Q05A 4AMZA 2WILA 2Z83A 3B6ZA 2LVBA 4ESEA 5KZMB 4JJ7A 4MP6A 4PRYA 3WMXA 3EXG2 1X87A 4ZHQF 5JZ9A 3O3OB 3A4LA 3RIHA 3I8XA 3L3BA 2IBTA 2EBUA 3A27A 2H59A 4P80A 2VBIA 2O59A 4DLUA 4LYHA 1T6NA 4QFBA 2E7ZA 4K5AB 4G9EA 3TTWA 1HORA 3HCFA 4WW0A 2BEVA 4IJ6A 3VH1A 1KT1A 2FDCA 4EZKA 3BGSA 4BKPA 3JWJA 1V45E 2GZ1A 5IJAA 5KNDD 2QN9A 1SBZA 1FXWA 4RVOA 1SVMA 2XYQA 3F2VA 4DI3A 1JPJA 2POCA 1YBFA 4I3GA 2B82A 4RGBA 4E12A 3IKLA 4JIMA 1SXQA 4BTBA 1W581 5M5BA 2RSFA 2EKLA 3RE1A 4JR2A 4QL3A 5I7OA 1WVMA 2VNIA 3ZYCA 4X8HA 3BB4A 3W6OA 5AJXA 4AZSA 5JJIA 3QAQA 4Z6KA 3FMFA 5EG5A 3SZ7A 2D13A 4BX9A 5K3EA 2O8DA 1ONSA 2R00A 1IM8A 3F7OA 1GL9B 4G36A 3R8FA 4JLJA 1LJ8A 2GKOA 1I6KA 1YQXA 3SWWA 2ECPA 3KK0A 1A2OA 4DLSA 5GONF 2ZOSA 3QOWA 2ASEA 4YASA 1XZGA 4NMLA 4TMZA 4TRRA 2WWTA 1LLUA 4NAHA 1Z33A 4YECA 3CW8X 3W5AA 2HTFA 3NOCD 3TGOA 1USUA 2V58A 4NJMB 2CV2A 1IEVA 2V5FA 2WHYA 3URZA 1YVDA 3ZV3A 3IR5A 1WEHA 1CZOA 1C7QA 3LHKA 4EATA 2IZ5A 3REGA 1P9RA 2NVWA 2WKPA 2WU1A 3ASUA 3Q9NA 4BVJA 2E0IA 2RHJA 4CYMD 2P27A 2H17A 2UZ1B 4JEHA 4LSMA 5TJHA 3AU5A 1EJ6A 2HXSA 4RCVA 3OECA 1H2WA 1BE8A 4GMRA 5FO0A 2BF7A 4M21A 5JWRA 2CNKA 2O5VA 4HCJA 3VZBA 5T4YA 4YA6A 4OAUC 3HU5A 3PF9A 2VDWA 3HZRA 1NSTA 3P96A 2ISSD 2RBKA 2OCPA 1KOFA 1TIBA 1HH8A 4R2XA 4TWZA 4WKBA 1W5AA 4NWIA 1D6JA 1NNEA 4I43A 4IEIA 4IV5A 2OM2A 2KXPC 4I5DA 2DM6A 2WXKA 5FQ8A 3GB9A 1S63A 2I2BA 1IY1A 1HDIA 3HA5A 3HHEA 1JIIA 1ZUWA 1SQ5A 1JDJA 2NU9A 3ZYMA 2V3WA 1FFCA 3JQ7A 2E4VA 4YN3A 3L8EA 4P7KA 3WKCA 4KPUB 4H7FA 3LT2A 5CX4A 5EIBC 1SBTA 3BJZA 5A5FA 1TYZA 3U44A 3UPTA 1V2GA 1DKRA 3ACCA 5KJCA 1E9BA 1ONOA 2ETVA 1EEXB 2D5BA 3VU9A 1RWXA 2C8VA 3ACDA 4HB4A 4W8OA 2B3TA 2ZZMA 2GSWA 2ID7A 4O2BF 1VSQA 3F74A 4F45A 1W96A 3NHJA 4IGAA 3PUHA 1E1LA 1X1DA 3KR0A 3HY3A 3CH7A 1TNYA 2HI0A 2INGX 3IP3A 4OQYA 3WK4A 1I94B 4ZEMA 2ATIA 3NB2A 2PT5A 3A25A 2CNNA 4Q3NA 2JFFA 2FN7A 1MJ0A 1NT4A 1VJDA 2D00A 2V6BA 1T5TA 2WD7A 2WNIA 4NV0A 5A6SB 1CIJA 3GO4A 1TMOA 5AVKA 4IYRA 3I6YA 1OXUA 3FTZA 2WWHA 2IP1A 3D8TA 1CRLA 5CDTA 4XEHA 4DA7A 4LTDA 1V5WA 5ITZF 1B6RA 2FVYA 3CISA 5DOZA 3CVPA 1Y5MA 1AKTA 5D3MB 5E0OA 1TF7A 1AKEA 5DK6A 2GILA 2QK4A 4I14A 4JVSA 3T5VA 4FI3C 4N8SA 2I7DA 2QMQA 4H17A 5D3MA 2YHUA 4DV1B 3GUYA 5FL7A 5JD6A 1RQRA 1LDGA 2ZIVB 4NMHA 3NEYA 4ZAYA 5ES3A 2WEKA 1FQJA 2JBHA 4MDYA 2ZFUA 1D2GA 5K8TA 4FDMA 2CHEA 3T5AA 4HI0E 1YRAA 4NH0A 3GCDA 4ROSA 2NC9A 5PGMA 1C3EA 4JOQA 2DWUA 2O48X 2OORC 1XC7A 1UKZA 2B2XA 2V98A 3A1CA 1KKMA 3AXSA 4CKYA 1RPJA 2CJXA 4JENA 3G6WA 3U7GA 2DG2A 2YYSA 2VN8A 2YNQA 4NP6A 1YB6A 2XECA 2GX6A 3GELA 5TPZA 1MO6A 1LGYA 3UGKA 1S4QA 3I2JA 2ZK7A 2M9MA 4PGAA 3PUWA 2ZRIA 5F2OA 2ZYSA 3HU2A 1DTWA 2FPPA 4GX5A 1R15A 2ZUVA 2WWGA 3JU3A 4YDRA 3GYGA 1U7HA 4ZP1A 4AKIA 1XMPA 3T9KA 1D0VA 2C97A 4U8VD 1UODA 2I99A 1T10A 2VA8A 3H2YA 3JVEA 3UJPA 3CV0A 1VE1A 1WMFA 3E3MA 1Q57A 2WY2D 3TJZA 3UHFA 1BX3A 3OPXA 1LPMA 3N0RA 3Q7PA 4DT1B 4G09A 5K3SA 1F4VA 2W2OA 5LQCA 4PX5A 1O5OA 2G63A 2OHXA 3IAM1 4O08A 1HT2E 3SC2A 4NDNE 5H9WA 5D6NA 2JLWA 5IT4A 3JQ0A 4TZ6A 5U9CA 2BFCB 3HVHA 4RD1A 4I50B 5DHPA 2QC9A 5FQ7A 5IM4F 2A7XA 2GB4A 4OP1A 5AI4A 3M6VA 4NDZA 1L5OA 2DUJA 2AGVA 2WMDA 5ADUS 2AFHA 3H11B 1B3BA 3COVA 1FMJA 1SVKA 3BSYA 4BV8A 4W5RA 3KYCB 3L1IA 5BNZA 5EX0A 3TRFA 3E9CA 2W6MA 2WFLA 3CIFA 2O2DA 1B89A 1FDWA 4O1MA 2R96A 3LRPA 2AI1A 2JANA 5D1NA 3H18A 2A59A 4UBNA 4IJVA 4OHVA 2O2YA 4B7CA 1SA0A 3DVRX 3DD5A 3SJUA 2RGBA 1M2VB 1IXVA 4E5VA 5CM9C 4UNRA 5ESRA 2QAJA 2PGXA 2XUJA 4DJEC 5LWHA 1V11B 2ZR8A 2V7QA 4YMWA 2B92A 3R5JA 3S2FA 2QX6A 4TX1A 2NO6A 3TOXA 4KQFA 5BWOA 1U8UA 5KCZA 1UJKA 1QRAA 2QT0A 3TZHA 4FMBB 1TU4A 3ISJA 3L92A 2PMCA 4DQKA 1E9RA 3LLSA 3SVLA 3DUFB 1V8BA 1Z36A 1YB5A 3ADKA 4BVKA 4H31A 5CM8B 2ERXA 1U2TA 4AY6A 2QRVB 1GCUA 5B1HA 4XI0A 4ZRMA 3QFFA 4XLLA 5JXHA 5D66A 1OV4A 2VS1A 2OESA 2HSZA 3K0CC 1G3QA 2CFZA 3QEKA 5JI3E 5F7OA 3MS4A 4P29A 1AG9A 2VYVA 3IVAA 4LJKA 3URMA 5AW6A 3CNBA 3GH1A 4BV2A 1D4OA 3B6EA 3WYAA 4EM6A 2C3MA 1DFHA 3KYDB 4J75A 5SZHB 4B40A 4KO3S 3OOSA 5CVUA 3RJ5A 4C9BA 4PAWA 4LV6A 1LPOA 1XTVA 5G4LA 1T3GA 4J1SA 1ST2A 2QTVB 3EBPA 3LDAA 5HIJA 4HQRA 3SHTA 3UHOA 2PZLA 1PW7A 3S81A 4XX5A 1PHPA 3OO0A 3NC1C 5P21A 4S3MA 1I5RA 4XDZA 2QPAA 1OXSC 2FSPA 4P93A 3STXA 2Z9BA 5BN3B 5BR4A 1PZFA 3FJ1A 4HDRA 1U3UA 1PI3A 3AS4A 4HGPA 4W9NC 3UAXA 4D9CA 2PX4A 4L57A 4DGQA 3U44B 4EMTA 3FYUC 3ZGNA 2PX5A 1QC5B 4DBVO 5C7YA 4Y9DA 5IXJA 5KNCA 3O48A 2PL3A 2P1DA 4MPJA 3I5UA 1S3IA 5CXSA 2WIDA 1TJFA 2JKVA 5E3HA 1FDVA 4OHZA 4QJ5A 1K9SA 2C2XA 3W3AH 1S2NA 2H1OA 3FTEA 4PXSA 3I6BA 4BO4A 1DWQA 1KDTA 2FU5C 4J0HA 1A0OA 4PM4A 4HDMB 2X38A 4KR6A 2AN3A 4G0OA 1WM5A 4GR4A 1UDCA 4O4LB 4RA6A 4UU0A 4KZPA 1JH9A 5I4BA 1WBJB 3M7IA 2QAGB 3ZEFA 1ITZA 1TZCA 3HXPA 3PK0A 4K9DA 2Z98A 5EWMA 3DONA 5CDFA 5JW6A 5K9ZA 3HRAA 1H94A 2VO1A 3DFFA 4H7EA 4LI3X 2YOHA 4D5GA 2ZYHA 1PR5A 2CL0X 2I3GA 3FGZA 4UNQA 4CKCB 2QJRA 2EVWX 2HDNB 4NR0A 3ER6A 1P4JA 1EVIA 2WTNA 3E5HA 3ZIMA 1KVRA 3OPYB 3MAAC 3QSGA 2EZ9A 4FMCB 4YYZA 4MYDA 4D3SA 1DRWA 3K32A 4BEPA 3LCUA 2Y0PA 2CCJA 3Q9LA 3FVQA 5FR2A 1ZSVA 2NXCA 1Q0QA 2CFOA 2ZSEA 4KITB 1N0IA 3DMDA 4JXKA 1MHPA 4HV4A 4JA7A 4TMKA 1JW9B 4W5NA 1TKAA 3C41J 5G4KB 4KDCA 4XD7A 4EA7A 1JUDA 2NIPA 3SBTB 1HYGA 1M0TA 4YMLA 4EX6A 3AIMA 3EGCA 4R8MA 3GPDG 2WWXA 1A04A 1HKHA 1NWCA 4A55A 1YS7A 3F9IA 3L7CA 4IIUA 3AHCA 2D1TA 3O21A 3ASVA 4IIEA 4QKQA 2VRNA 1Y8ZA 1E3MA 1VL6A 2YNMC 3D2CA 3LA6A 2GRLA 3SLGA 5EIBE 4PO8A 4YACA 3KJHA 4YDHB 1M6EX 3LE8A 2GPSA 3F73A 1E3LA 3O3CA 1D2EA 4AP9A 1V95A 3P5BA 3MFQA 5DCLA 4F1KA 4Z2AA 4YHHB 4EO4A 2QSUA 3A4NA 1RWNA 2CXRA 1MB3A 1NN3A 2D2XA 2E89A 2F17A 2PM8A 3O4RA 3GAMA 4GOXA 2DBQA 5AI8A 3SHWA 3TM4A 3HMQA 1Z8FA 1JZTA 1ZW6A 2HIGA 2P8JA 3MMXA 5DYYA 5U4XA 3T1QA 2DB3A 1O0SA 4JV5B 2M2IA 5HOQA 2I7CA 4QOSA 1EWKA 4ALNA 4DFDA 1HT1E 4BNWA 4ZYLA 1P2VA 2AD1A 2JI7A 2VDVE 3E9YA 2ZJ5A 3KVNA 3SS7X 1Z22A 3U39A 4YPVA 5CBPB 3VGPA 3IUEA 1FSZA 2O8FA 4JXTA 1F38A 4EHDA 1LD7A 4R16A 4KQKA 4LAFA 1WNFA 1E9FA 4MJ7A 4YJGB 3RT7A 5EQFA 1PJ2A 3KQWA 3ZHQA 2Y0BA 4MVJA 1LLCA 1T8UA 1XJ5A 3TNYA 2AB0A 2MMCA 5B1SA 3TPZA 4NCXA 4AJ1A 1ZHFA 3F3MA 3IIIA 4QPNA 4TN5A 1WCV1 2HJHA 5M7EA 3RSOA 4Y6OA 2BFFA 4D81A 1VPVA 1KR2A 5JLAA 2GERA 4CMEC 1K0UA 4DK5A 2FEPA 4E3ZA 1MFZA 5C8XA 2QUKA 3FNFA 2HHCA 1PQWA 5ESXA 4BKMA 1MG0A 3MXTA 1PJCA 1XA4A 4Q7LA 5ENZA 4CEIA 2PO7A 4KPEC 3DSSA 1E2GA 1WS6A 1E6KA 1N2OA 3B6KA 3E5MA 2NLOA 3LK7A 3OZAA 5JVDF 4G0VA 3PS6A 4GKVA 5D1HA 4Y6QA 1E3DA 4KAFA 1KR5A 1H3FA 3C3YA 3VI3B 1LSOA 3WWEA 3IRVA 4WY2A 5D01A 5FTWA 1EP9A 2ZU0C 1O2DA 5J2TF 4PGGA 5I3ZA 5GPBA 3DV0A 4DV7B 4WJZA 3EJ6A 3U2QA 4FQ8A 1TD1A 1L1QA 5G53C 2WQ6A 5DX1A 3FG9A 4E2FA 2DPMA 3GGDA 2O1EA 3CWZA 3B53X 5CYFA 1GVHA 2P30A 4AURA 3DH0A 1RVV1 1HV8A 2VHYA 3UNXA 3K8ZA 4PYNA 7AT1A 1NJ8A 1PKEA 3JY6A 4JWKA 5FBWB 1RJDA 3N7TA 4JI0B 1E8ZA 2OWEA 2VJDA 3H1TA 1KQNA 1R4ZA 3D7KA 1XD9A 5ITZA 1C0PA 3WIEA 1TU0A 1U1EA 4RLHA 2DCMA 4KFCA 3NATA 4N5IX 5IDQA 1Q3KA 4AK9A 1SAYA 3BCHA 3MTGA 3KTDA 3LGSA 4JI5B 2CMGA 2CLLB 3I37X 4MP8A 2EQBA 4MUGA 1FXUA 5I4KA 4KPYA 3QKRB 4GMKA 1KEVA 1A96A 3D9JA 4DPRA 1E1RA 1KU0A 1U9ZA 3ZWBA 3RO3A 1OLUB 1PEKE 5FWXA 4ZMRA 5A5GA 1TA0A 3A6GA 3RGWS 4AS3A 3BL8A 4LJ9A 2CL5A 1T8RA 3IEPA 4L22A 5JFGA 4ANXA 3T3OA 1EFTA 2B5OA 4ISCA 4XTCS 2GCEA 1VHDA 2X7HA 3CHYA 1ML4A 4FSDA 4M3NA 2FE4A 3ZJUA 1EINA 2TS1A 4DYHA 3DBLA 3L16A 3CM0A 1EB8A 4U8HA 2CB0A 4BRSA 1LDMA 1V6SA 1Z0JA 4NC9A 1IOVA 4MQ6A 3ZW9A 4RF4A 2ZS8A 5KNBH 2PIDA 1Y42X 4AD8A 3V1YA 1V8DA 4HS4A 2QZ4A 4TYPA 5K3AA 3ZIUA 5T6BA 5H70A 1MXFA 2C98A 5AYWD 4WWHA 5HG0A 3L4KA 2FZCA 1NSYA 3GT4A 4F53A 2R2AA 3ID6C 3FUHA 3LWDA 3BXFA 2WPVA 4JL6A 3OA2A 1U11A 3H0KA 3OPYI 2J8SD 2B1GA 3PDWA 3IEXA 3KJEA 2WU8A 3HXKA 4IO1A 4ZGBA 1MJ5A 2A9OA 3AESB 3OY7A 3HNRA 3D6MA 4F38A 3EQ6A 2F1OA 3B8HA 2EGHA 3A1FA 3GBPA 1N78A 4GVPA 1XD2A 4NXMB 2JHPA 1H66A 1YS1X 2Z5VA 1ZD4A 2P65A 4G86A 5A0FA 4WLVA 3DHEA 3FOCA 1R0SA 2HO1A 3B3QA 3PP8A 3VO2A 2GN9A 3R7LA 4UPEA 2OYSA 1B4DA 2HWKA 3IKJA 3PDIB 1ECGA 4FEAA 2RJ3A 3DE7X 3TSZA 3KEMA 4GLFA 1K89A 5EESA 2H4HA 3OETA 4KJZA 1MF7A 1X39A 2CXNA 2PSSA 4MWSA 5GM2A