5C1DA

Human ogt in complex with udp-5s-glcnac and substrate peptide (rb2l)
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
713
structure length
695
Chain Sequence
b'THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 275
structure length 695
sequence length 713
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5c1dA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5c1dA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1dA03
1KT1A 4Z5XA 2QN3A 2FF4A 2YQ8A 1E96B 5TMDA 2HR2A 4F3VA 2XPIA 4I2WA 4HOTA 3E3OA 3G2IA 3WAGA 1RZVA 3S28A 4N3BA 2GEKA 3LCAA 1E1YA 3RT1A 3CEJA 2AVPA 4U0UA 2GM9A 2P6PA 3UYLA 1HXIA 3KD7A 1NVKA 4AIFA 4MICA 3MV3B 4YVQC 5CHEE 3UYKA 3Q5MA 4NQ0A 4RG6A 2XEVA 4EQFA 1SXPA 1JEJA 4X7RA 1WV0A 4GA1A 1NOIA 2G9VA 2IUYA 1L5WA 1UZUA 2IF4A 5BW8C 3Q3IA 3GZ2A 4YNDA 4UQZA 2LSUA 5KJLA 3MTDA 2L6JA 2R66A 4PQGA 3MT9A 3T5TA 4UQXA 1L6IA 3BEEA 5JJ6A 2F9FA 2F3PA 4HLNA 1LWNA 3C48A 4EL0A 1H5UA 7GPBA 2ATIA 5GPBA 3E3NA 3PDNA 3AMVA 3CVLA 3BCUA 3GPBA 1KLXA 1J39A 4XI0A 2C2LA 3PE3A 4WNEA 3BD7A 1GPAA 2IV3A 4AY6A 3E3LA 3G2HA 5CCLA 3UPVA 4WNFA 4BQIA 3CEQA 3OKCA 2JLBA 2IV7A 4L22A 5FZQA 5EX3A 3NAZA 4RENA 1PN3A 2QFCA 1JIXA 2C0LA 1XC7A 2ACVA 3MV2B 3AS5A 1F6DA 3CUWA 4N3CA 1P4JA 3RJVA 4M60A 6GPBA 3QWPA 4ABNA 1F0KA 3RU0A 2ECPA 1V4VA 2PL2A 1OUVA 4J8FA 3ESKA 5DBKA 4RIIA 4N2QA 4U0ZA 2KCLA 3MRTA 4YVOA 4BQFA 3CK9A 4BTAA 3MBOA 2PQRA 5C1DA 3OY7A 2DBAA 4AMGA 2E2EA 1Z62A 3G2LA 3R9AB 3QWWA 3PE4A 4N5CA 2XA2A 3BD6A 2Q7FA 2QLNA 4F97A 1RRVA 3NCHA 5EX0A 5KJKA 3MRVA 5AYWD 4REMA 1GFZA 1NA0A 4GYOA 4RBNA 4EJ2A 3CKBA 1WAO1 1WUTA 2UY1A 3ULQA 3MTAA 3L79A 1GGNA 4JA9A 3LPZA 4B94A 2F3QA 2JJMA 3HBFA 4GYWA 2YHCA 2MHKA 5G04C 1B4DA 1FTYA 4RIGA 1PC2A 4N3AA 5D0OD 3GW4A 3ZHEB 1IIRA 2I6HA 3EBOA 2VGXA 2C9ZA 3RSCA 4UI9K 4XIFA 3S7FA 1PYGA 3CV0A 1FU7A 1LWOA 4G2TA 4WACA 8GPBA 3LY9A 4XI9A 3COPA 1HZ4A 2VQ2A 3Q4AB 3AS8A 3QOUA 1IYGA 5JJ7A 3AS4A 5ARFA 3CV3A 4I9EA 3T3HA 4ME2A 1Z6PA 2H1FA 2IEGA 3H4IA 5FZSA 3NPAA 3H4TA 1SXQA 1Z8DA 3DDWA 3T3IA 4GZ3A 1YGPA 2SKCA 1P2BA 3NC4A 4RELA 1NA3A 3MTBA 4N9WA 2UWJG 1PNVA 4MI9A 3VTXA 1HH8A 2C4MA 2NC9A 1GPBA 2O6LA 1M5RA 1P2DA 4FZRA 2HY7A 1FA9A 2GW1A 3IEGA 4HWGA 3OTHA 1QM5A 4WUYA 3GZ1A 4G2VA 3OXLA 2KATA 4Y6CA 2QRPA 2VG8A 3MRXA 1ZU2A 5BNWA 4CGWA 1P4HA 3TG4A 3D1JA 2XCIA 4H7YA 3S0JA 3Q47B 5A6CA 2HO1A 4RIHA 4EKEA 1L5VA 3KAEA 4AM9A 3FWVA 4UI9C 3FFLA 5HXAA 2KC7A 4G24A 4X6LA 3VDNB 3RKVA 2KS6A 2AV6A 4KBQA 5I45A 1W3BA 2XCBA 2XGOA 4BT8A 2QLLA 2QN2A 4GCNA 2C1XA 2KCVA 2SKDA 1K06A 4HOSA 3SYMA 3Q15A 1B89A 1UQTA 1WW2A 1JIUA 2IYAA 1ELWA 3QKWA 4MRAA 1KT0A 4Y6WA 3NF1A 5M72A 3MS2A 2QRGA 3LYAA 4GYYA 3QKYA 1XL0A 4LEUA 2LNIA 1Y6GA 3NP7A 5G04J 2SKEA 2ACWA 3LY7A 4GCOA 3URZA 3MSCA 2PRJA 4GPBA 4NEQA 5IKOA 1C8KA 3T3EA 3DZCA 5DIZA 3OTIA 1AXRA 2WTXA 1RZUA 2X0FA 5LCWC 3RHZA 3MT8A 2GPAA 4BFCA 4WNGA 4RG9A 3CEHA 2PQ6A 3T3DA 3G2JA 1WW3A 3C4VA 2R60A 5ARGA 1XKXA 3HBJA 3CUYA 5HQ8A 2WQHA 4IN3B 3SZ7A 1JG7A 2VSYA 2V5FA 1IXYA 2BFWA 3TSAA 3RO3A 3S7BA 2QN1A 2XA9A 1WM5A 2F3SA 2PQNA 2QN9A 4KYOB 1XV5A 3MS7A 2GPBA 4NRHB 4YI5A 2AZDA 4F9FA 4X7MA 4NESA 2JZCA 2ZB2A 1Y8ZA 2FO7A 4M83A 3O3CA 1TJCA 2FBNA 2R5SA 4HOUA 2UY1B 4LEIA 4I1AA 3MT7A 4CTNA 3ASDA 3CEMA 4YI3A 3CVPA 2C1ZA 4GZ6A 2XGSA 2GEJA 1L5QA 1NZNA 2X0EA 3OXFA 3ZPJA 2FF5A 3GUHA 1XL1A 2X0DA 3C4QA 2LSVA 2PYDA 3ZHEA 5FJYA 4WNDA 4UI9J 1GG8A 1L5RA 5EKQD 5KJNA 1JIVA 3ASFA 2FFRA 1EXVA 4W6QA 3DDSA 3EDTB 5ENZA 3RIBA 5JTUA 3ZCTA 3EBPA 1A8IA 5TMBA 3G2NA 1QZ2A 1O6CA 3VDMA 4AMBA 3L7DA 3ZCUA 9GPBA 3Q3EA 1P2GA 2HYZA 1A17A 3E4BA 3D0RA 1ZBPA 3CVQA 5IKPA 3ZFWA 4M7PA 4WHMA 2AMVA 1FCHA 5JTTA 4A1SA 4EL5A 3TAXA 4MI3A 3KS2A 4MHOA 4KQ2A 3L7BA 3MKRA 1FTWA 2PZIA 1ELRA 1P29A 3VUFA 2XCCA 1NZFA 4KQMA 1NZDA 3HYMB 2BGTA 5D01A 3ASGA 3D0QA 4UQYA 2C0MA 4O6FA 3U3WA 2BISA 4I2ZA 4GA0A 4GA2A 1L7XA 4G26A 5LCWJ 3VUEA 3S2UA 1PSWA 1JG6A 5KJMA 3BCSA 4JL0A 2OFFA 4I17A 4EKYA 1K08A 3S29A 1E4OA 2GPNA 3CK8A 3CKCA 4GPKA 2VSNA 4BTBA 3WADA 1FU4A 3U4TA 3SYRA 4X7PA 2Y4UA 3UQ3A 1XNFA 2VYIA 3MEKA 3WC4A 4MHSA 4J0UA 2XMPA 3ASHA 2Y4TA 1FU8A 4LDPA 3S7DA 2J9QA 4KXKB 2XCUA 3IA7A 3CUTA 2G9QA 5DXFA 1FC0A 4BWRA 2Q6VA 3OKPA 1Z6QA 1ABBA 3T7DA 2ASVA 4AN4A 5FTPA 3UUXA 3OKAA 4RIEA 1FS4A 4U04A 5DLDA 3CUUA 3WXXA 4CDRA 4CTOA 1QQEA 1KTIA 4MI6A 2WPVA 3ZCPA 1WUYA 1P4GA 3ZGQA 3G2KA 2F3UA 3QHPA 3OXGA 2AW3A 1Y8MA 3JYSA 2QN8A 3TG5A 2OOEA 4G25A 2GT1A 1YA0A 3CUVA 5CCMA 4N2SA 4F96A 2FEZA 5D00A 3SF4A 1BX3A 3MS4A 4JHRA 2QNBA 3QDNA 1IHGA 4CGVA 1C8LA 4YUAA 3ZCSA 2PRIA 2P58C 2G9UA 3BEOA 3ZCVA 2VCHA 3L7CA 2R4UA 3GYZA 1AHPA 2IEIA 2YJNA 2QRQA 1FTQA 5G05J 1Y6FA 2VGYA 3N71A 5TVGA 4HORA 1C3JA 4I9CA 3S7JA 5LQDA 3BD8A 3FP3A 5JJTA 3MA5A 2QLMA 1GZ5A 3TOVA 1QKJA 2QRHA 3OT5A 3OY2A 2FETA 1GPYA 4J8EA 3L7AA 2XGMA 3TGOA 2X6RA 2PYIA 4G23A 2R4TA 3O48A 4CTMA 3MQFA 3NP9A 3ZCQA 3K9IA 4GZ5A 2GJ4A 1WV1A 2KCKA 4WADA 1VGVA 3T3GA 1C50A 3ZCRA 2IFUA 4JA7A 2VGXB 3CVNA 3QWVA 3VTYA 3Q3HA 3LKUA 1NOKA 4N39A 5FZRA 5D0QD 3HBNA 2IYFA 3CK7A 4FKZA 4APOA 4G1TA 3LY8A 5A7DB 4AY5A 1EM6A 2XA1A 5BT1A 2QZSA 3HBMA 3L01A 3S27A 3RSZA 4W9RA 5G05C 2FI7A 3ZN3A 4QLBA 2ONDA 2R68A 5HI7A 2BGUA 4BQEA 2X6QA 2QRMA 4U0SA 5DU2A 1L5SA 3NB0A 4KQ1A 1NOJA 4RIFA 5TMEA 4U07A 1YA6A 3FROA 1HLFA 4J8DA 3Q49B 1NLMA 5FT9A 4HOQA 4H7XA 1P5QA 2IW1A 4NC9A 2BUGA 4BT9A 2H1HA 1XOIA 1UQUA 3OTGA 2VCEA 3BCRA 3RO2A 3IAAA 3BDAA 2QN7A 3CX4A 2G9RA 3DD1A
chains in the Genus database with same CATH superfamily
4G1UC 2ZE8A 2WWIA 5DHSA 3LCAA 1EK6A 4U00A 4C01A 4JMPA 1FPQA 1K6JA 3M3PA 1T4GA 2G9VA 5D66A 5FUWA 3OJEA 3WSTA 1UF9A 5AW7A 2RC6A 2OCXA 2ZCVA 4BQPA 1KLXA 1IY9A 2DF8A 1OKKD 2PZLA 3PIDA 3K70C 3HEMA 3M34A 3O4GA 3LLMA 3I1IA 4DDTA 4C05A 2PKYX 3NBFA 4Q94A 1B73A 4M49A 1F0KA 1FUEA 4L6CA 2O7VA 1OUVA 4Q15A 2RG8A 2HTFA 1A7KA 2V6JA 1JECA 3KYCB 3O2QB 5IMSA 2G40A 4MUHA 5FOXA 1GGNA 5CNJA 4P35A 3OZEA 4Y18A 4GTVA 4GMXA 4G5XA 2VDUE 5E4YA 4X95A 5EVJA 3C3RA 3Q3CA 1YF3A 2FRXA 3PSAA 1WF3A 3H4TA 3GFGA 2YXLA 3H0KA 4K88A 4AJLA 4GMJA 1EX7A 1G6KA 3K09C 2CSXA 1CY0A 5KDLA 2ZI3A 4W5TA 13PKA 4H7DA 3PTLA 1G16A 3KB1A 4Q12A 3DWFA 1GR1A 1DWOA 3CMMA 1DKNA 1SNYA 2JIMA 2WXRA 5HDBB 2JFXA 4F6RB 1R8QA 1VXRA 5HS4A 2A4KA 4XDZA 2H7YA 4TYYA 4DQ0A 1U9ZA 1FYWA 4PQEA 3BFVA 4A8JA 2JLZA 1IPEA 4Z3KA 3H6GA 5B2ZA 1BE0A 1LTXA 3FPJA 4FCCA 2QTMA 3N8NA 2OO5A 4B8WA 3C45A 1E3SA 4LXUA 3PD1A 1NBWB 1P8JA 4TS1A 3FTVA 2O48X 5SICE 3B6KA 1X94A 3SQOA 2NNLD 1LV7A 1UW4B 2VZ9A 3VNAA 1LF5A 3M9WA 3DTVD 4HNUA 2OKGA 1XT6A 1OREA 2PZBA 5AW6A 4RY8A 4PZPA 1FVFA 3IDOA 4FW8A 1RJEA 3MAAC 4U2GA 4QLOA 4NI5A 4PFKA 2CHGA 4X1YB 3BMCA 2Y9MB 4RPCA 3WBFA 3RV3A 3ZFWA 3B6EA 3L4EA 4WHMA 3KQUA 1U5BA 3BIJA 3FEXA 4MI3A 1JJIA 3CKYA 2IHUA 2WAXA 5AR1A 2GHTA 2CWWA 1E6EA 3CU5A 4D79A 3EIQC 1UPXA 3IHLA 1V6CA 4DIEA 1OAAA 4B7ZA 4K9LA 3SYRA 4JLPA 3EE6A 3EGXB 1CB7A 3F2VA 1WF6A 4GTSA 3CRMA 1VM6A 2PIAA 2XW6A 4I99A 2VLBA 4COKA 4MTCA 4C21A 5KYUB 1NNSA 4CTOA 1KTIA 2Z3ZA 3ESBA 3OQBA 4NBKA 4NHEA 2TMYA 3ZE9A 2NZWA 4ARUA 1EUYA 2JZNA 1O96B 3W5AA 2NZJA 4L2YA 3UIOC 1J33A 3FKSA 4B74A 2A9JA 2A59A 4F84A 2O3QA 1DIAA 4RKFA 4OXNA 5BSKA 3FCYA 1ZH8A 4RPIA 4DUIA 4OLBA 2R00A 1FFSA 4WLOA 5JYBA 3NHSA 3P0FA 3TD9A 1JHVA 2BF7A 4K6CA 3K9GA 5A62A 2OXEA 2VF4X 5A6SA 5JI3E 4OSEA 1CZUA 1ISRA 1ZOSA 3EMDA 1SCIA 3UT5B 4M0KA 5KYXA 3VR2A 4EB6A 3RADC 3CK7A 2WSBA 1FW8A 2C0PA 3ZNOA 3BILA 4OP3A 4G56A 2XB6A 4DG9A 4LE0A 5GZ1A 2C2XA 1YAHA 1SA5A 3D7NA 1V9SA 4QPNA 1TW3A 3ZKAA 5KKCA 2I22A 1QJCA 5BQPA 1GQRA 1BU8A 1R0RE 5HQ3A 2AMYA 3PVCA 2WVJA 4JLAA 4JQCA 4EFKA 2SBTA 1K3ZD 4ZV4A 4UWGA 3D4OA 2FAXA 2R03A 2GKOA 1OCOE 3B6ZA 1BH6A 4ILIA 4IMIB 3TJPA 4TTSA 4RM2A 4YMLA 2MTBA 4PQGA 3W6UA 4HDNA 1XQ6A 1UEXC 1CRPA 4TL6A 2PANA 2IV3A 3W3AH 2I7DA 3C6YA 4JKIA 5JPDA 1Y1LA 1S89A 2H11A 1M1YB 2Q29A 4HLUC 3P97A 2QNRA 5JSUA 1FNSA 2PS9A 3KT8A 4QELA 2ZJOA 2PL2A 1R0ZA 4LYEA 1UOEA 2J0EA 3AL3A 4HSGA 3AESB 4E88A 2IWHA 3TR0A 1TTTA 3A36A 2W2QA 1BH2A 4MYSA 1LUAA 3UGJA 1AF4A 4HDMB 2E4WA 3FR8A 2XNKA 2UY1A 1EK0A 3AF5A 4NYMR 4LY0A 3COYA 1VIAA 3D8BA 4HVAA 3SC6A 1DO0A 3BWDD 1SOWA 5C8DA 1I2ZA 3B36A 5GJVC 1D8EA 3HM2A 1QIGA 3EY9A 1WNFA 2WI8A 2XYQA 1QPBA 3GT3A 4AY4A 2NV6A 4DPLA 5DI9A 2BGMA 3CG0A 5AIJA 1SQMA 1P17A 2KBFA 4JBLA 4E5YA 2OHIA 1DG9A 1M2VA 5A4FS 1CU1A 4F5DA 3TTUA 4BGEA 5JCXA 2VG8A 5EXDA 5FQOA 4IRUB 4DMLA 5FYDA 4L4XA 4NACA 1UXHA 1Y5IA 1D6MA 4EOGA 4BKMA 4EG5A 2YMMA 4ENWA 5FWAA 5MFZA 2Q1UA 3WHLA 1NMSA 3BQNB 1R6UA 4UYKA 1MH9A 2AJCA 1AKYA 1CZOA 3OZSA 4G0WA 3A2KA 3R7WB 5FJJA 4X1OA 3URZA 4UUNA 1HT0A 3RS7A 2GPAA 2ZJ4A 2HLHA 5DNYB 1EGHA 3IYLW 5K0NA 4A2PA 1XZEA 4DADA 5IXJA 3WGUA 3GAZA 2VDWB 3NZEA 3NR2A 3OIUA 4PBSA 4FD2A 3HGTA 2PFKA 2A1IA 1QRUA 2FBNA 3CZQA 2LVBA 5JAIA 4Q9DA 2O06A 2WOOA 2H54A 5LYJF 4F1JA 3AP2A 1OX6A 1XRSB 4MUAA 2ZT8A 1YI0A 4FB4A 3I2IA 3F6QA 4FLEA 5FUQA 2BY4A 3T5MA 2FZCA 4YMIA 1R6VA 3L7BA 3PZ2A 1JH8A 4Y2TA 3RIHA 1LTQA 3NLLA 4GOOD 1Q0SA 4UTPA 4B2PA 3DAGA 1XUOA 3L9TA 2E1RA 2L17A 1EWYA 4EKYA 1HK7A 1DAEA 4YAKA 3QVOA 4P93A 5HKOA 2XWPA 3THXB 3F5SA 1RJ9B 3CVVA 3PC8C 3F5QA 2IU0A 4M21A 4AD8A 2QAJA 1NW3A 3G79A 5KTSA 1Y9AA 4OHZA 3TNFA 3QF7A 4Z4IA 3RSGA 4WNAA 4CLEA 4HFRA 5KOIA 4B44A 4PGGA 2FEZA 4DLZA 3WB2A 4DR6B 5BP7A 4BQNA 4FS8A 5LMNB 1PBNA 4WVLA 4XUGB 1SELA 4OKIA 2GJKA 5DSTA 1J0BA 2IP4A 1JDNA 3SEAA 1P2SA 5JJTA 2R05A 2EKQA 2BCGY 4WUTA 2FKAA 2I80A 1E1RD 3HYLA 1KP9A 2DSNA 4CTMA 4P22A 2GJ4A 2V7EA 3BIXA 3QVVA 3LKUA 3H2YA 4UNNA 1T5TA 4W7IA 4OF4A 1C9MA 4FLHA 2J0UB 2G1AA 1OB2A 1XZ8A 3H5IA 4B3XA 4DLTA 3CIAA 3UH1A 4MB2A 2O7NA 4IJWA 1I4LD 4TVKA 2QMUA 4LOHA 4MLDA 2A86A 4WN9B 3I45A 3CX4A 2I4MA 2X6JA 2FJUA 3I2YX 3SPXA 3UAGA 3GLTA 3HXEA 3ROZA 4WGGA 4HAIA 2BUAA 2WMYA 2IBMA 4EZLA 2C20A 2H2GA 4RG6A 1UT5A 2NADA 4JLKA 4JITA 1AZSC 2E89A 2CLDX 1GUYA 3KJXA 3HA2A 2QMHA 3K4HA 3PRJA 3C48A 1GLNA 2GYVA 2Z4SA 1WQ4A 5T4EA 3GV0A 3TLAA 1XC7A 1N9ZA 4B87A 1G8SA 2GAOA 5FO0A 5C5IA 2CNBA 1QXSA 5HOQA 3K0FA 4URWR 5T57A 1HE2A 4EVIA 2GHIA 2Z98A 3L0YA 5CRIA 4PX2A 1IFXA 1Q3HA 1EVQA 3GVXA 4JUAA 4FYIA 2FU5C 3OD5A 5CB0A 4RX1A 3OF2A 5DZSA 1RAIA 2IY9A 4OKSA 1QNLA 2A1TR 2XUJA 3KYDB 5JJ7A 1P6UA 3AS4A 2ZIWB 4G5FA 2HR1A 4MWTA 2IKQA 1MXFA 3RVQA 2RAFA 5FULA 1AIPA 2G6TA 3BWXA 2QRPA 2PH3A 1PNRA 3CCFA 3RG2A 2W5UA 3I2FA 4QGHA 2QYTA 8OHMA 1NBIA 3WS7A 1I6LA 4REOA 4YMGA 5AXBA 4S1VA 3ISMC 5L95A 1KPHA 3PKJA 4RHUA 3FBTA 1QQBA 3ESRA 2KCVA 5I6DA 5BN5A 1KGDA 5FLKA 1ZN9A 1LV8A 3Q75A 4YXWD 1SIWA 4C48B 3QKYA 3ILXA 5KYTA 1E20A 4J8YA 1A2QA 2YJ5A 2SKEA 3B3JA 1KQFA 4JXJA 3QK7A 4E46A 1UBKS 2VPYA 4JLVA 3TTVA 3SF8A 4LIPD 2YZGA 4J8SA 2AOTB 1IXRC 3TLEA 3UFXA 3AU9A 1GSHA 1BXRB 3VM6A 1SXIA 2CJXA 4Q3CA 3KL4A 2IP2A 4JP3A 4HCJA 1D2EA 1O5IA 4EX7A 3DBHA 1H22A 5D3QA 3DJFA 4CMJA 4ER5A 1X3LA 4D9CA 2V7PA 2Z08A 1KAGA 1HH4A 2IUFA 1SQFA 3Q2KA 3I64A 5JJ5A 4TTIA 4B4VA 1X9IA 4CT0A 1YS7A 5K0LA 2AGVA 3C8DA 2IEYA 4P4GA 2DFTA 4K3UA 1QFZA 4HTFB 3IAS6 2VHWA 1PWXA 4FYWA 2HJRA 1OOEA 4E22A 3GOHA 2AN5A 3IQXA 4KNWA 4GA2A 4D4MA 1HBJA 2QVBA 4C7OB 5C32A 1XTQA 4ZEMA 4BTBA 1B74A 3GMDA 5DOVA 3KXDA 3B7SA 5JSZA 5DHAA 1HEYA 3KEMA 3WYEA 1NW7A 5BMVB 4N54A 1GQOA 3DBLA 2G0TA 5KQRA 3D8HA 5ALDA 1YZHA 4TWBA 1O8BA 5BWMA 1NVBA 3M3HA 3C74A 3R9WA 3JASB 4R2LA 2WQZA 3O4ZA 1O94C 1ZY2A 3MCXA 1JDUA 2PKQO 1OLUB 2O3JA 1O08A 2JC3A 5AI0A 1YIDA 4DLBA 1W34A 4I9CA 1QS0A 1YONA 1WVMA 3OQIB 4WZBB 1WLYA 3JD2A 1VLHA 2XGMA 2FQXA 2JASA 1KZOA 4QO7A 4E4RA 4HLEA 1YKGA 4LZNA 1OYWA 3VKVA 4R7TA 1CUUA 1RU3A 3ANNA 4JA7A 4G65A 3ELDA 2J3HA 2B61A 1WA5A 1PTKA 1JKFA 3QXSA 1OFUA 2NZ8A 2XA1A 1MNQA 4B3CA 2ADFA 3R3XA 3L7MA 3M5CA 3KSQA 5I7AA 1X1RA 5HWSA 3ZW7A 1IZZA 4D4LA 1ORRA 4LK3A 4ZVLA 5JROA 1FVOA 3FYUC 4EW2A 3N8DA 1P60A 1HC7A 3ZHCA 4RJ2A 4PGAA 1FP7A 3AG2E 3QU9A 3K6RA 3V8RA 2DFVA 1G9XA 3VR4A 4MV3A 5JC8A 1RZVA 4MXDA 3FD8A 4QKQA 1N75A 4EFMA 3KKMA 1QCCA 2H8KA 1KFKB 3LHSA 4KW7A 1WV0A 2KBEA 3SY2A 4CV2A 4YNDA 3MWDA 3A6ZA 1OT8A 3EWSA 1Y3FE 3CX7A 4H3KB 2AVNA 1A95A 4QT0A 2RHMA 1KAHA 1U8AA 2XHEA 3D5QA 8ADHA 4C1NA 4Q19A 5EQDA 2REOA 2OXTA 1NT2A 1JFVA 5IULC 2ACVA 3K1JA 1AHNA 3FKQA 3AM4A 1EXNA 2XOKA 3FNGA 4YAIA 3DHVA 3P27A 5IY5E 2ZIXB 1FMCA 4X24A 3MILA 1YB7A 4I5DA 2Z30A 3OLQA 4YLGA 1LQTA 2QRKA 4N4AA 2HN9A 2YHSA 1C30B 2V8OA 2DR0A 1LK7A 1LQUA 1Y4AE 2IJGX 1ESEA 4NP6A 2Y67A 1JEAA 4QRDA 1ZOOA 4W6ZA 2JBAA 2LAIA 4ZXFA 4CDNA 5IJ9A 2WQ6A 7MHTA 5ISMA 1QYDA 4DUGA 3CT4A 1TM4E 1REQB 2B37A 2OQVA 1HG1A 1Z2CA 2AJTA 4B3IA 4EPRA 2VUSA 4OQPA 1VPTA 5TPZA 2HXSA 2OM2A 3N2GA 1VL1A 3EIHA 4P82A 2XMZA 3JQGB 4BLOA 4FIDA 1JNYA 3DMRA 5ALTA 2B92A 3VKWA 3HQ4O 4KRXA 3A3YA 4II2A 4WERA 5FPYA 3QEKA 1IHOA 4G24A 4N5MA 2PL9A 1U28A 4EA6A 2KHZA 3RC1A 5LQRA 2R6DA 4DPRA 1RVDA 2EFGA 5KVVA 3C72A 3FZNA 3K2BA 5I9NA 1FPMA 3SF0A 2QJFA 3QFFA 1C8KA 4BFCA 1OF1A 3DWLG 4UPVA 1KJYA 4UU1A 4WEOA 5JRDS 3INNA 3W6PA 4YRSA 1RP1A 2BMWA 2FX3A 4ZCTA 4D8TA 5KC8A 1AT1A 4W4TA 4I50F 1TJCA 4M7OA 5K0JA 4IH4A 1HFJA 4P6VF 1IAVA 3MLBA 4RVNA 4FJZA 5L3RA 2H92A 1E6CA 1P2VA 4HPJB 5EUCA 1N5KA 5CTAA 3LJNA 1JBQA 4J6FA 1IAQA 3GROA 4BC0A 3HVHA 1DU4A 2C2MA 1JI3A 1TD9A 3GEGA 1KYTA 2PUWA 3NGLA 1RC8A 3QPUA 2NQ8A 2YWXA 1ONBA 3CLUC 1YB4A 2YYAA 4BETA 2O50A 1YU6A 4Z4CA 1FUIA 1PBTA 2QT0A 4EBBA 1VGRA 4XVRA 1TJYA 2GS9A 3BUSA 3HCEA 4I4CA 4QPDA 1PJLA 4ZT2A 1ABBA 2DY0A 3PNTB 4QTYA 1Z0SA 2I2OA 4Y2JA 2Q50A 3OHMA 4GBGA 3EQ9A 5CLFA 4Z9BA 2AWOA 1QNFA 1A9YA 1VI2A 2VTEA 5HF5A 3ID6C 3TVYA 3U6BA 3ZCVA 3Q11A 2R4UA 4MS1B 3WK7A 5EE0A 2WSSD 3K0SA 4BFVA 3SN6A 5CERB 4DMKA 2VHUA 4HRAA 3S6JA 1JAXA 5DP2A 3CZRA 2EX4A 3FUIA 5B57C 3T1YB 1RQ7A 4BU1A 5DWDA 4D41A 2NUTB 3GRKA 2PA3A 4MLPA 3WOVA 4J1SA 1V4NA 4FT2A 3N70A 3BS4A 3VTYA 1QP0A 2D4AA 3BE8A 4TMWA 2O52A 1K7EB 5FCDA 2XUQA 2OLEA 1QV6A 4LPSA 4DC0A 4DBLC 1JBEA 1JHAA 3H3JA 3VTZA 2NZUG 3IGFA 3AUXA 2JH8A 4G1VA 4X71A 1QVZA 1U7IA 2ZTSA 4NIMA 2VPWA 1N6KA 2Q3CA 3RS9A 3BXPA 2EL9A 1GCOA 2AVPA 1QBKC 1Z36A 1NVKA 3LWBA 4QUBA 4KDEA 5EI5A 1PYDA 1QANA 2VWGA 5JY1A 4CBVA 4DOMA 3A0RB 2X2PA 2I29A 4K0KB 3QM1A 3MTDA 4MUGA 4QYIA 5BSUA 4C0MA 5LQAA 4YCLA 3NTLA 3IBGA 5A7FA 3DZFA 4Q0MA 1RXUA 5FA8A 4ARZA 1OCCE 4FMBB 3V4ZA 3E3LA 2XKJE 2HT1A 3KFLA 3PXGA 4BE4A 1JGTA 3L6RA 4ZKDA 5KQMA 2CV1A 4EBAG 3BX1A 2D0DA 2D3TA 4DWOA 4OTZA 5ENVA 1IY2A 4AZ3A 4AZ0B 1ZD2P 3DLIA 1W6RA 2NXNA 3R0QA 2KLHA 1K6EA 3GRFA 2PD3A 4CM9D 1S70B 3PHBE 4NK5A 2C8LA 5I4CA 1GPKA 4CIVA 4WWNA 4V02A 1I6WA 5DV9A 4UDNA 3OT4A 1IB0A 3ZU6A 5HF9A 1W48A 1OKKA 5G1OA 3BL8A 1D1TA 3NBUA 1HURA 1LEHA 4XR9A 1KC3A 1MNAA 1NC3A 5BRJA 1VYUA 5HG0A 4AZTA 3HP4A 1W5EA 4QPZA 3SNHA 2Q45A 2XKKA 4YAJA 1U81A 2CXPA 1QFSA 3NIBA 2OCPA 3M7IA 1ZEJA 1M1UA 3TRDA 2ENWA 2CB0A 2YH2A 4QJBA 3VR4H 3T1NA 3X43A 2FUG1 2J45A 4L5IA 4X63A 3L84A 2O5EA 3TTXA 3JYPA 2H6IA 1IJFA 1Z4MA 4EHBA 4TXMA 4GM1A 4CF7A 3RRXA 1XK6A 3JXJA 4ZYUA 3OZRA 4ZT5A 2XCOA 4E2WA 5DM4A 2C00A 3EGEA 3MJCA 3WRXC 4B8ZA 4QHSA 2O9JA 3SZ7A 3CSUA 5A06A 2OB2A 3LCVB 5C31A 4F4DA 3TSAA 2F59A 2TSYB 1P33A 1GGVA 4INPA 5DRTA 1KAMA 4RV9A 3FNFA 1E8ZA 3FSJX 3LOPA 1RMTA 4L1KA 4FOSA 2WC1A 2QUHA 4EMUA 1KDRA 4RQAA 3QRWA 5EPUA 1ZP6A 4II3A 4M86A 1GIAA 2HE0A 2O8FA 3ZCUA 3NOXA 3CLRC 1PZNA 1IJBA 1PZXA 4C78A 3ZWPA 5TT1A 5NULA 1VC2A 3G0CA 3UPUA 5ILOA 2EWMA 2EW2A 3HP7A 3R23A 3N74A 4DILA 4DLSA 4LY3A 2FFJA 1M8JA 2B4QA 1QIKA 2WXIA 1E7UA 1RNLA 4UMEA 2ZS8A 2ABWA 4LBZA 1N7IA 1IVSA 2ZT6A 1AA6A 5FNVF 2JI7A 4X44A 3DTVA 4X92A 1NE2A 2F43B 4GPZA 4EHJA 3O93A 4MHSA 3CW2A 1YHNA 4S2EA 3ILHA 2YICA 2QP9X 5FYQA 4OATA 3CUUA 5CT6A 4KUGA 2C4TA 2PNFA 1L7BA 3EQ8A 1WTAA 3Q7PA 3RFVA 1O57A 3TWUA 4YWHA 4UM5A 3W9UA 1D9SA 1TC2A 1T0UA 2OQ2A 1U80A 1WTCA 1CY4A 3A4MA 2V97A 4QXRA 2EWVA 4BV9A 2COUA 1A7UA 1A8UA 3IKLA 1B1CA 3QVJA 3HRKA 3C7TA 4MPRA 4EUFA 3JQ8B 4MYRA 3IMFA 3T5XA 3Q0EA 1G20B 2X41A 2Q7DA 1NPDA 2FPPB 3NP9A 5TQ0A 1X3SA 2QMQA 1J0CA 1S2GA 1SBQA 3LH5A 4BKOA 4OMFG 2OXRA 4JSRA 3D9LA 4G5RA 1EM6A 1Q5PA 3U16A 1A82A 3LOQA 4JLBA 2ZYAA 4U3JA 5CT4A 2CWDA 2XQIA 2BZGA 3E61A 1JXAA 4FWBA 3SKYA 5DF1A 2NU8B 1UKVY 4IX1A 3UJNA 5HIIA 2HLNA 5LQUA 1QUFA 3LBYA 3GAAA 3DD1A 2QUKA 1KORA 4F3VA 1RYZA 3E3OA 1ES9A 3QXGA 4X97A 5EQJB 1UBMS 1O54A 4HFNA 4HAWA 4BPRA 1YQQA 4HRNA 3W90A 3QLEA 4I1SA 4EQFA 4X7RA 4QOGA 4K0RA 4IQGA 4GPEA 3T5AA 4MW4A 3BWEA 1KI3A 3I04A 2HA5A 4ILHB 5B37A 5A1TA 4IDCA 2GESA 3TXMA 4CLOB 4IJ5A 2WZBA 3VV3A 5KSOA 4XCXA 2J07A 2Z56A 1Z25A 3NORA 4IINA 2F90A 2G77B 5EJ9A 1EVIA 1VJCA 1EDZA 5BN4B 3FU5A 3R9AB 1E2JA 3I1YA 4Y0AA 1B76A 3H0CA 3RI3A 3AKEA 2REXB 5KUTA 3EIJA 3TKAA 1Q7GA 4EJ2A 3O31A 2IITA 2GPYA 4N6NA 4D45A 3HXMA 5C1IA 5FQ4A 1ULAA 1N94A 2ES4A 2H6FA 1UPCA 4GNKA 1DEXA 3PEFA 4AG3A 3MGAA 2ROQA 1I4TD 2OFWA 5ANLA 3NPAA 5ER9A 4EUKA 4X45A 1NU8A 3HV0A 3RBXA 3KQPA 2CLSA 1EWTA 1TM7E 4G4IA 1EHIA 3X1YA 5DBFA 5EWMA 2OAQ1 3O1IC 4Z51A 3VC3A 1IEVA 2H0AA 3G1TA 2ONJA 3TCKA 3HDQA 1JSXA 1BYIA 1Y3HA 3WGOA 3OPYI 1ISFA 1PKEA 3UMFA 1IBRA 5I47A 2JAHA 2HI0A 1Q1BA 3A9WA 1TKAA 1QF6A 2IEAA 1FK8A 1ZJJA 3ZWQA 1YZGA 2FNAA 3QELB 2FI1A 5KZMB 4J1QA 2F1JA 3FWKA 2F9LA 5GGYA 4PC2A 2IS1A 2I99A 1B23P 4NKRA 3WP1B 2GM4A 3D9HA 4B35A 4NX2A 3OCCA 1VPDA 5IS2A 3HO1A 2IGBA 3M6VA 3PC2A 3CJRA 2BMFA 4LDAA 4HVBA 4CFYA 4D6YA 3GRYA 1UMBB 4B47A 4OH1A 3I6ZA 1DCFA 3L7OA 3L6EA 4LRQA 1L8LA 1KSGA 3FLMA 3DTNA 3TW6A 4OJNA 4AMVA 2UYHA 4LZPA 3OU7A 1DTSA 3A3NA 4BUCA 4EDFA 3MKRA 5A2QA 4CRWB 3Q8WA 2AMLA 1G5HA 3EU9A 3HNRA 1MUUA 2VTBB 5K3CA 1ESZA 3OPXA 4IMRA 1MP0A 1L7XA 4KXFB 3P2IA 2WNIA 1W2GA 2J6BA 2G25A 2V9PA 2XQGA 4M1ZA 4O3FA 2UZAA 3IEPA 3T7TA 4FNMA 2IU4A 2WJGA 1GZDA 3QXCA 3GJ8A 1A1VA 2I8AA 2DCMA 3THYB 1BC5A 5AJUA 4RWEA 4UM9B 2CHXA 2PZAA 2XVXA 4MEAA 4GX0A 4D3ZA 2OILA 5GIOE 4IKOA 2EGUA 2XDYA 3NEYA 1YOVB 4UQOA 3QWHA 4ER3A 3MRSA 2I8CA 5DOZA 4RZQA 2UXBB 1AHPA 3I2GA 2JABA 3LWDA 2VHXA 1FTQA 4A8HA 3IKOB 1QIHA 4NNPA 2QLMA 5BWLA 3U19A 5CIYA 2CJWA 2EARA 3LUPA 3GOQA 5BSWA 3IV0A 4BFLA 1IJKA 1DT5A 4ZU3A 1RMQA 3JQ9A 5U4XA 4Y9RA 5GJCA 2QAIA 3E23A 1OMOA 4IH1A 4MWOA 3NIFB 2QRVA 1EGMB 2CYBA 2DKNA 3AL2A 1CSEE 3FTDA 2DZDA 1QG6A 1IOLA 5THQA 5LUBA 3ZEIA 1ZMXA 5AOCA 2WIDA 5ILGA 2WP8J 1PDVA 3VSAA 4Q93A 2FPXA 1M5UA 2YV5A 1XXHB 1HT2E 2WJIA 3CLSC 4JT8A 4DLRA 2R2LA 2V6MA 3BHIA 4M9SA 2WB2A 1DMRA 5D85A 3D9MA 3O5AA 2A5UA 4LFCB 3IRUA 4B6QA 4HZUA 3L1HA 3PB3A 4HQDA 3KVNA 2ZP1A 1NR1A 3NNNA 5BUSA 2ILRA 1VKRA 4PQFA 4LRYA 3S2GA 1ORTA 4FDTA 5L3VA 2H1OA 1KI6B 3LX8A 1KR2A 4LYDA 3ESYA 2D59A 4RM3A 4QUIA 3DPIA 3JRWA 3KV3O 3RF7A 3A6PC 2BGWA 2EIJE 4OKNA 1GL3A 3QTLA 1E62A 1SG6A 1DRUA 3BUAA 4I5EA 5KO2A 4WVFA 2CL5A 4ZIRB 2QI9C 1UC8A 3SHOA 2ZKLA 4BDTA 3WX0A 3LYUA 3HXBA 1XELA 2K7ZA 1ACLA 3V2XA 2AEJA 3F1LA 4HO1X 3D7RA 2JLRA 4HEA1 2Q3MA 5TGZA 3V8BA 3V8EA 4CCSA 3UWPA 4I9EA 4MUIA 1YZYA 2ICAA 2HIAA 1T6NA 1JEQB 1OVGA 4G4SP 4Q1AA 3MF4A 4MAFA 4JASB 3P71T 4TSFA 4JGBA 3SBTB 1J0EA 1M76A 3FPAA 2LWIA 3WLOA 3Q6MA 3DZBA 4WY8A 4FK8A 3IURA 4CW7A 3MLAA 4JFRA 4LRWA 6Q21A 1PFUA 4IX9A 1JIUA 1S9HA 4EMSA 3ZXXA 1FSZA 4BRWA 5YASA 3OT1A 3HGQA 5U1PA 3KO8A 5EC8A 1II0A 3FDXA 5JNVA 1YS6A 3TNJA 2I7VA 4H16A 4HGQA 1RHMA 4QWWA 1T9AA 5AENA 3KUCA 3JZAA 3ZOKA 4KAFA 2WQ7A 2Y6VA 1DAFA 1CDEA 3KAPA 3WGVA 1ZCAA 2NU7A 4CG2A 2GZDA 2FWNA 3I3NA 4UZFA 3E30A 5KCMA 4LV6A 1BHSA 2Z8XA 1A27A 3L07A 3IQWA 4HNQA 3S68A 2D2IA 5IAKA 1E0DA 4CLRB 1HPLA 4HH1A 1JA9A 1P3DA 2BFFA 3HSYA 2XUIA 4YXWA 1QH0A 1DKMA 2ATXA 1C2TA 1TCAA 1SC1A 4K7JA 3CQGB 5I9MA 2HYZA 1ADCA 1TM1E 2VXBA 4M7PA 4MZXA 1Z12A 3VPCA 4HX2A 3HHEA 1BX1A 2MCFA 5FL7D 4CT4B 1RI1A 1TUGA 3GHYA 5BQOA 3HXFA 5DDIP 2VKQA 2AR7A 2PSEA 3AUUA 1QH9A 3TRIA 4P4TA 1RT9A 3TE6A 2GTHA 4EHDA 3R9IA 2VTDA 1SCBA 3GUVA 4OVKA 4KXKB 5COQA 1N33B 3UB3A 4E2FA 4PHFA 3O95A 1F8FA 1U0FA 1X7ZB 2CUTA 1CS0A 3Q10A 4IY1A 2AW3A 1G2PA 4CKEB 2QMZA 4NENB 3SZLA 2JAQA 2B4KA 1ZJ4A 5JAMA 5ENPD 3PR2B 1U1IA 4ZFHA 4BMXA 2B8NA 3VXKA 4PS0A 3T7RA 2ZSHA 3L8DA 4M3OA 1BPOA 1N8TA 5CH3A 1ZG3A 2BR3A 3RJTA 3SR4A 4G23A 3LJKA 3OBIA 4NDAA 4D2IA 3EXFB 3JVVA 2TMGA 4JBIA 2P9PG 3V42A 5F7XA 1S01A 1TPYA 2DJ5A 4EHHA 1E4VA 5L6LB 4BNKA 3W2HA 3DE3X 3LLCA 4WK4B 2XZTG 2E4AA 2WIBA 4DWVA 3BE6A 4FE3A 3HLTA 1UXOA 3MB5A 1F14A 4OQXA 1GPUA 2QC9A 4L3VA 4Y6SA 2WK1A 4LWQA 3IDQA 1HEIA 2FE4A 4DWWA 4D0GA 3HS3A 2CYAA 5GONF 4D3YA 4N49A 2AYZA 4K9DA 1KS2A 3NWEA 3AG1E 4YCAA 1GL9B 1XLUA 5KS2A 3NXKA 1BMDA 4UOZA 1Z3CA 3H2ZA 3EQZA 5FIOA 4JI5B 5IDXA 1WXDA 1SXJB 3Q9SA 4P0TA 1F4PA 4R3UC 1FFXB 1P8AA 3WDMA 2OGTA 2WF9A 3MV2B 2CXTA 3CZ4A 4M8SA 1XRLA 2HJVA 4ZCIA 3BWYA 2DXIA 1Z29A 1IOVA 3RWBA 2XSZD 4LJRA 4KQFA 2WU4A 3U4MA 1T0JB 2PT6A 4Q18A 3ZGOA 3WG7E 1QHSA 4EKNB 4WLUA 121PA 3ROPA 5CA1B 3M5DA 5JMTA 3OZGA 4FM9A 1A5EA 1SCKA 2OP0A 1W88A 4N5HX 4PSVA 4KO1S 2VPXA 2YIDA 4S04A 2CBGA 1JHDA 2FFHA 2IYUA 2ZDGA 2QBYB 4XW2A 2FXIA 1X80B 3KCNA 4R54A 2HQSA 3VZBA 1YS4A 2ZBPA 3ORSA 4E94A 1W6UA 3AILA 3IAHA 1JIJA 2N42A 3BA6A 3VVMA 2P2DA 1EFKA 4BFXA 5EPOA 1ZDMA 5HJ2A 4D46A 5FD8A 2ZQZA 1EP1B 4H1VA 3TZBA 3NTQA 2QNIA 2V0GA 1G5TA 1Y33E 3GLGB 5CFNA 4HEHA 5JXGA 2OHJA 5LZ8A 3ZW8A 5M72A 1NGSA 4FFOA 5DPMA 1EF1C 2IS2A 1MTZA 4P5EA 3EZYA 4HQKA 3DXMG 1U5CA 1LC3A 4XPZA 3UHJA 4FFRA 2ZYGA 3CNEA 4YQFA 3DHWC 5EYLA 5CB4F 3OQJA 1EAYA 3L8FA 1DBPA 3CLJA 3CO5A 2GTIA 2FUG6 1X9GA 4ANFA 5CEDB 1KMHA 3A6DA 4RE5A 1DC7A 1KI4A 3AR9A 2H7CA 4G0ZA 4L50A 5KHOC 3DJYA 3PEEA 2YYZA 5FI5A 4BMNA 2GASA 3RIMA 1W9HA 4DR1B 3TEFA 3E9NA 3ANYB 3COWA 1GU1A 3RTDA 2QAGA 3LC0A 5JH7A 4U8VD 2J3LA 2CUZA 3E4BA 4JJIA 2LXNA 3SZ3A 3RBZA 4JP8A 4DMGA 3CG4A 4YJ3F 2LP4Y 1JHYA 3PCRB 3I5AA 3IT2A 4EBAA 4JVSB 1WPXA 3V4OA 1YDMA 4RHCA 2HF8A 3NHFA 3R41A 2WYWA 3B5JA 2PZGA 3TXXA 1WNTA 3W1VA 3FMPB 4IW3B 1ISSA 2FP4B 1L0BA 3DSRA 5EOVA 5FI3A 2QTWB 4E08A 3AF4A 3BL5A 5HSGA 4X6XA 3V8PA 4AN4A 3STUA 5H8WA 1K6MA 3OPVA 3R3VA 2X0JA 5I3ZA 1HDCA 3QKSB 5B6PA 4Y2PA 1E0KA 2BP7B 4YA6A 1O1RA 3RRBA 1ZOIA 1ICEA 4YUAA 1RBYA 2JLUA 5KWVA 3AU8A 3EIWA 4RZHA 5KQLA 2M98A 3ASZA 3NANA 3TYXA 2C5EA 2CFIA 1C7JA 2J6CA 4JJ8A 4K3VA 4RJJA 2BSAA 4ZMBA 1S2OA 1XTRA 2Z5FA 1PI3A 4OUDB 3GJ6A 5FZRA 3BH0A 3GVIA 4NMLA 1NUUA 3JWEA 1SOAA 4EO9A 4Y0VA 5H02A 1UP6A 2FY8A 2YOHA 3B2EA 1YB1A 4KQHA 1ESMA 3FCOA 4IZIA 2IV2X 1YA6A 2IZZA 1HLFA 5E3JA 1NDQA 3QJYA 4Q24A 1PQUA 1TA0A 1Q84A 2ZVQX 2DLDA 1VKHA 4MV0A 3BG5A 2QMEA 3V8QA 1AWCB 2XQFA 4B6RA 1NA5A 1ZGBA 2JRCA 1CUHA 1YCGA 2WSSA 4Q7MB 1ZK3A 3B7PA 2YYSA 1V16A 3UAOA 1UN9A 3VR0A 2P9YA 3UWMA 2Q0QA 5HFJA 2WG1A 2CHWA 2ZBFA 1RRKA 4G2NA 4IIJB 2Z2JA 3IV9A 3CVLA 2VK1A 1MW8X 2GILA 4B8YA 1T2NA 3J80A 3OIDA 2IOQA 3OP1A 1U02A 5HTOA 4HRMB 5LMCA 2A7XA 3BXHA 3I9OA 1SPXA 1V39A 2ZUVA 3TR6A 3VYUB 2HQ1A 1IULA 3L82B 2PS1A 5CLIA 1SKBA 2NUPB 1W1IA 2Z2YA 5HK9A 4FEYA 2YHIA 3G2LA 1NVAA 2Z95A 5CBPB 1BIFA 4JYMA 1GFZA 5F23A 1ZM7A 3NTUA 3GFTA 4N5QA 2JJMA 3WGMA 2F62A 3GW4A 3RU2A 2FSIA 2C8KA 5E6RA 3RSCA 5BMOA 8GPBA 2WJZB 4KGXA 5E38A 2X22A 5ICCA 4CDMA 3R8FA 2JCVA 1SWWA 2WXLA 3LAWA 2IW3A 1QZTA 1MW9X 3UAWA 4MRMA 3PX3A 1VIMA 4TLBA 1ZNXA 2C42A 2WMDA 4B3MB 6CHYA 3CPJB 2GEFA 1SCUA 4MR7B 3DXKG 2KC7A 3W2IA 4GZCA 4WSOA 3U7QB 5SY9A 1BW9B 4HJRA 4U7JA 3O91A 1VE3A 1GDTA 2HBZA 4CM9A 5DYGA 2HJSA 5CEEA 4DLOA 3O3OB 4XEIG 1E59A 3MT8A 4O4HB 1ZGJA 3D6HA 2FDCA 2V5VA 3CEHA 5DTQA 5TARA 3HDTA 3L4BA 2B5OA 4D82A 3UUFA 3ZD9A 3TI7A 1YT5A 2IOFK 4IRXA 1N11A 4DKXA 1AK2A 2QN9A 4YI5A 2FUNB 5A0TA 3OCYA 4X7MA 2YDXA 4C7MA 4B0ZA 4GXNA 3T34A 2CNDA 1CRZA 3TW4A 3K96A 4IEIA 1Q0RA 2ODEA 2GJAA 5EYPA 5JQGB 4F56A 1HDIA 4BP8A 1YMPA 5JR3A 2WV7A 3H17A 4GLOA 2XWJI 2QZZA 3PQFA 2G7ZA 1W29A 3NC1C 5C5CA 3BN3A 4H4EA 1E2LA 2O2EA 1G19A 3IALA 5E2IA 4ARCA 3I0NA 3QU2A 3ZHOA 3JAWA 2ZU6B 2R02A 5TV2A 1GPMA 2PZIA 4ON9A 2QTFA 2VUTA 3ULEG 5HJ5A 1U28C 5J2UF 4WESB 1ZOLA 4B40A 3G02A 4Z8XA 3ZHTA 2NU9B 3S29A 3EGOA 4MV7A 1FZQA 3WGQA 3WADA 4PNEA 1UFKA 2H1CA 3HJUA 1MHQA 4GT1A 1Z6QA 3L22A 5DLDA 3EZ9A 4HRYA 3ZNGA 3K9HA 5SV2A 4JELA 1SKQA 1ZB1A 4TV9A 4I9HA 1GAJA 1EFUA 2WVHA 3VC1A 2PV0A 5JHAA 3OC6A 4NZMA 3OIYA 1BCRB 5T4HA 4P4SA 4ZHSA 1PT9A 3RRZA 2FLVA 3VPHA 3BEOA 2MYNA 3C3XA 4K5AB 4ATNA 2NTVA 2VJDA 3QF4A 1QH1A 1VBFA 5HS6A 4X3CA 3SWWA 1OBCA 1OBHA 1QDEA 4OFWA 4RS4A 4PRYA 4FDLA 2XUZA 1MT3A 4EHNA 2QS9A 3PHHA 2GCOA 4ZYWA 4AWXA 3LHFA 2NQTA 1OXKB 5ESXA 5D1NA 1RXVA 4W5RA 3TO5A 2IXEA 3HU3A 4XWWA 3G2WA 2UUOA 1W35A 2DGDA 3BCRA 3PUIA 4U5XA 1RQRA 1XTKA 2ZB7A 2EINE 4HOTA 4I2WA 1K6XA 3TRHA 2I2XB 4CUJA 1WHTB 2JIZD 4ZO6A 3H19A 2PRYA 2PSSA 3QMWA 2X2EA 1N2CB 2V3CC 3KZNA 3A70A 2F8MA 4HLNA 1N3IA 3MINA 1JIQA 4H0FA 3IH5A 4PTYA 4EL0A 1ZPDA 1EUDB 2OHFA 2WHPB 4KE8A 3JQDA 4LTDA 2AJ8A 4ZJPA 5LCXA 1GP2A 2ZVDA 1JCSA 3GEPA 2X5TA 1IMJA 1UXGA 2JFZA 1Y9DA 4K81B 5AHKA 5CT9A 3TD2A 5BSFA 4O4LA 5LNK1 5BVHB 1SG0A 1PT5A 3Q7RA 3RSHA 4O3MA 2G3YA 2A3RA 4AG6A 3HNPA 2P90A 5F1KA 1M75A 1U31A 3LO8A 1K8KG 2AOUA 1LWOA 4J0EA 3WNZA 4MWDA 3IBSA 2PCLA 1E9AA 1A9ZA 1W4BA 1BNCA 4AYXA 2AJBA 2C9CA 5K6RA 5D2CA 5KKAA 3UV7A 1SXQA 4BERA 4PEVA 1A76A 3B13A 3FDZA 2F9MA 2G07A 4IGEA 4HYYA 4MVWA 2O8EA 3UM0A 2CMHA 4B73A 2XF8A 3L08A 1GTL1 4AX8A 1DIHA 4URUR 2M9MA 4AKEA 4F5ZA 3GARA 1KS9A 1GNQA 4HEA6 4BLSA 4JYAB 2X2FA 3TMYA 1A2BA 2FMHA 3KHSA 1SBNE 3FTZA 3IULA 2OEPA 3ZXUB 1ZXBA 5G04J 1A69A 4A4DA 4CGYA 2A67A 1Y48E 2ZXEA 1FB5A 3SI5A 1LBEA 1YKSA 1KTVA 3L0PA 2BDEA 2RHJA 4DJTA 1L7OA 4QHYA 4UBIA 3PUZA 1U9YA 5F2KA 2CN1A 2ORWA 1T2VA 4BO7A 4WV3A 4FSHA 5CVUA 2I6FA 3PUXA 4TM8A 4UKDA 2AD5A 4CKYA 3GJYA 3KR0A 2X2OA 2P9JA 1DPFA 2I6UA 4O4IA 2EV9A 4OXQA 4XOIA 1G0OA 3UZUA 2F4NA 5JO0A 1L4HA 4QDTA 2QD5A 2K4NA 1DX6A 4BX9A 4GP7A 5IC6A 1DTWB 4A15A 4GX1A 5F4ZA 1MC4A 4UCXA 3PFFA 2PMEA 1XCBA 5TPWB 4NFSA 3DDSA 4AUNA 1GVNB 3PUJA 1UMCA 2XUPA 5FP0A 1CRWG 1WZUA 3Q3EA 2Q3JA 3ITEA 2HU2A 4HFJA 1R0YA 3ZHVA 2I2DA 1GU7A 3O84A 2JLWA 4YROA 4BDSA 2EKDA 3GJ0A 1YJXA 4C04A 4E15A 4BB9A 3O8QB 1XJ5A 1XALA 1XDGA 5E6SA 2J3MA 1H4TA 2A9VA 3DFFA 1E0SA 3R6WA 1KZ9A 4YBRA 4OM7A 1KY5A 3H16A 4RMIA 2CZQA 3AXSA 3PX7A 3ZGQA 1QSGA 3OEWA 3SQVA 3A9VA 5EWLB 2IUUA 3RRFA 2KZTB 1IHGA 3KQTA 2D1RA 3X2SA 5BQ3A 4C03A 2XAAA 2X7JA 2VP5A 2GBLC 3DTTA 5JALA 3O8NA 2WUGA 3PIIA 2HXGA 2FRVA 3LGAA 4UM8B 1YFJA 4N82A 5FV7A 3HXOA 5A9SA 4ERNA 1XZMA 2GJSA 1X7GA 4B7AA 4LHEA 3Q3HA 2BGNA 1G8HA 3GP8A 3T9BA 2JEZA 4EH1A 4YRCA 5ED0A 3IB3A 3A9SA 3KR1A 1KNQA 1JTEA 2H4JA 3ZZMA 4C7JA 1APBA 1Z5SC 5EKUA 2Q4EA 3IAM1 4WKBA 2P2YA 2B1QA 5DGDA 1ZH0A 2VSOE 4BRUA 4OB6A 1FY2A 4Q01A 2FN4A 1QCZA 5CD1A 2GBGA 4HGPA 3LZDA 2QOEA 3DLBA 2XODA 5DNWA 1T43A 2CCKA 2EGGA 3P4YA 1FX1A 3NI2A 1LI7A 2WZDA 3EVTA 4PRLA 3LPMA 4JC4A 4Y2SA 3MOSA 1L5WA 3QUBA 1R9MA 2LSUA 4YRRA 2EVWX 4B8AA 1MX9A 3DNFA 4ZVTA 4I4LA 1P1JA 3UWDA 2EQXA 1VYVA 1ZUWA 4YPOA 4HH3C 5CX1B 2OBNA 4ZOLA 3R5XA 1QRRA 2IBSA 1TTHA 1XTJA 4F92B 1FLAA 4ZU1X 3ZDRA 1QKKA 2XDWA 4BFTA 5CIWA 3ZEAA 2VSOA 4KVFA 1XVVA 2Q7FA 1EVKA 1F12A 4CUKA 1N57A 3UKOA 3TWRA 1GRVA 3FZEA 2DUJA 5HZKA 4NU8X 3FGOA 3OLVA 4Q16A 3EK2A 3QV2A 3DE6X 1NVGA 1XWIA 3H5LA 4DUYB 3VNQA 3KQWA 1J20A 2VHQA 2RH5A 2QTRA 4HUJA 4H6XA 1EVYA 3SYNA 4NH0A 4DXDA 4U2CA 5BSHA 2BKAA 1Z68A 1MC8A 2F1IA 1JEDA 2I9CA 3HCRA 4YGYA 4D4KA 2GB4A 4TROA 5CJJA 1ZU2A 1NXTA 1XEWX 1U90A 3F1KA 1KMCA 1OH7A 3VLFA 2I4IA 3M0EA 3M6LA 3FTQA 3UJAA 3Q15A 1EXMA 2CHQA 1YBFA 4BZQA 1CUJA 3A28A 3GZTB 1U5AA 3DAHA 2O6HA 1OIXA 1XLWA 4LXIA 1PJQA 1ZI9A 4WNGA 3HJTA 3R3HA 2XZTA 1XEFA 5E1MA 2EOAA 4BRSA 1XVUA 3DZHA 3WZ2A 1Y9EA 2GPTA 3D9QX 3O4IA 1NKTA 2JGIA 3OJCA 3W06A 7MDHA 4LTNA 3GRCA 3VZQA 4K9QA 4LEIA 1YRQA 3GJZA 3UT7A 4AI6A 2DPMA 5JATA 5JXWA 3QP9A 4Y67A 5DBGA 3LHDA 2ZGGA 5H9WA 3KQLA 2X13A 5EKQD 4P29A 3QBDA 1ZMOA 1TE2A 1JPVA 3I6QA 2GBIA 4Q7EA 5JWOA 3LL4A 4DMFA 2DEUA 4QBKA 5ALOA 3RBAA 1ZZGA 3A9CA 3F3YA 5IKPA 4UUOA 3JQBA 1M2OA 1KYIA 4C4TA 4MKIA 3NKVA 1V0JA 4PAMA 3JQ1A 1GAEO 4IUYA 4B43A 4WNYA 4GTMA 1IPHA 1YBMA 1WRBA 3H5VA 3FOZA 3AJ8A 4UCFA 2H1RA 1PJCA 3JQQA 1X1DA 2BBSA 1ZI6A 2J9QA 4CL8A 1TYAE 1NKSA 2VZ0A 1WY6A 5C1OA 2VEOA 1R3UA 3AEUA 4DJFC 3GC6A 3OZWA 3QU7A 3WQSB 2XQ0A 4GOMD 4NHOA 1TK3A 5KEIA 4GQAA 4RMNA 2WFLB 1ZR4A 1SQ0A 4ZVOA 2WMOA 1E8XA 1H2XA 2ST1A 4HH4A 4HDRA 4JR1A 5FL7A 3WGYA 3RRMA 3UUEA 1DO2A 5LXTA 3QV1A 3OZBA 4B2LA 3OY2A 2L0TB 1I3MA 4RNDB 3LDFA 1SUBA 4AS1A 1Z6YA 3MQFA 3QE4A 3C0KA 1K92A 5BSVA 2I2CA 2OV8A 1FSFA 3UJ8A 4ALKA 1O2DA 3SBSA 4LZOA 2PFSA 5LP6B 4V0ME 3FNBA 1J0DA 3OFSA 3I2HA 4PX5A 5KJ6A 3V2UA 2IUTA 5B4UA 2ID9A 3ESAA 4KDFA 4DQUA 1TTQB 4FINA 1TNDA 3DB1A 2NTNA 3AOGA 2A0KA 1PW7A 2D5BA 1BVYF 3PL5A 1PGOA 1K63A 3E53A 2V0NA 5LDHA 2F9FA 4UUAA 1F4LA 4M9RA 3VPFA 3H1BA 1IHDA 4TWRA 5KX5A 2ODWA 4TLDA 4A26A 4B09A 1P45A 5KTMA 3DAFA 4K8RB 4FDVA 3C8ZA 3PXXA 3DWEX 4H7HA 1JLHA 4V0MA 1RTTA 2ZM5A 1SZPA 3TJZA 1RCUA 3R0JA 1V4VA 1F2TB 2K6GA 1QC5B 2G0NA 1PEYA 3MWKA 5DM0A 1Y89A 1CQIA 3L6CA 2WTUA 2HREA 3RS0A 3JQ9C 4M8LA 5AYWD 4DLKA 4AJNA 2IIQA 1U99A 1I2BA 4IZHA 2HWUA 3UW1A 1SN7A 3P2MA 3EXG1 5KWIA 3PNLB 3TS1A 4D74A 3GP5A 1BJKA 3THWB 1XZHA 1C9DB 1UKAA 2C7BA 5B1IA 5C80A 1YRWA 2G63A 2PT5A 5KOHB 2VL7A 3OE5A 2QX8A 2MYOA 4AF7A 1A9RA 1GPBA 2AK2A 1Z4KA 2O3RA 4PF1A 3N9IA 3GZ1A 4A1FA 2HO5A 3KQKA 2ZWMA 2XSZA 2IRWA 4X6LA 1J0XO 2AV6A 2IPOA 2O7QA 5M7EA 3K73O 1MJ5A 1K8QA 1NI4B 3EFOB 2DYRE 10MHA 3SYMA 2ZYUX 3ET5A 4GMDA 3GF4A 1C3OA 4X84A 4Y8VA 2OBXA 3ML8A 4BNHA 4A8PA 2R59A 3IR6A 3DSVA 2KSQA 1XZLA 4NCNA 1ZGGA 2ZJYA 4L95C 3N2IA 3PDWA 4R40A 3PEUA 2I3AA 1SMKA 3DDZX 3QFRA 1NJ5A 4BLQA 5CH5A 4URXR 2HRBA 3FIJA 4LDRA 4I55B 3FCUB 2WT8A 1CDOA 4Y2HA 3KTAB 2AZDA 4NESA 1IHYA 3ICVA 4TXQA 1A97A 5TVKA 4C06A 3FBWA 1ZD1A 5BSTA 5JUWA 4L0MA 4LJKA 3LVBA 3TZKA 1CRQA 4QGGA 4UI9J 3K1AB 1H0RA 2WT9A 1BXKA 5AQ9A 2QD4A 2LUHA 6PFKA 2ZISA 4DM4A 3RFCA 1QB8A 3S7ZA 2LXLA 2DBZA 3SEZA 3IESA 3I83A 4MKGA 3A4VA 3Q85A 1HE8B 3D8UA 4ZPXA 4OK6A 2YMPA 1MIOB 1WW8A 2PKCA 4EYGA 2D3WA 3MHTA 1ZUD1 4E2YA 4HQ0A 3AM1A 3QMVA 1IEQA 4FR5A 3DE1X 2GTPA 3RSFA 4M98A 2H65A 3M6AA 2WA1A 5JA4D 3QVXA 1CR2A 4OB7A 3L0ZA 1JJBA 2WM9A 2UZ3A 3I34X 1XR3A 2WHXA 3EVGA 1HORA 3DDHA 3TG5A 1GSOA 4JI0B 3K9BA 4BUZA 1Y4ZA 3R0XA 3F6RA 5LD2C 3REQA 3OZCA 1AD2A 2B2NA 4MW6A 1Q1QA 1H8HD 3W2TA 5HRAA 5IYZB 3ROTA 3R7QA 2PEYA 1P4AA 4RVSA 2WLSA 1OC2A 5LLTA 2GZ2A 1LW7A 1D4FA 5F4BA 3V8MA 1NI5A 3S1AA 5I01A 4IDEA 2O7RA 3UINC 4GZLA 3IV6A 5E95A 5EIHA 2G8LA 5HR5A 2GF0A 4G5SA 5EESA 4LNAA 4GECA 1XJCA 5AM4A 3QUSA 3LBAA 2X6QA 2GETA 1C7QA 3OFVA 4RK6A 2EKBA 1DB3A 2ZRLA 4NS4A 5ALLA 3V7YA 3SFTA 3ZDCA 5K09A 1F9AA 1EINA 3NBQA 1ULUA 4ZARA 4FI3C 2IHNA 1DS6A 3ZWYA 4UDYX 2HMTA 1VL5A 2AEMA 4EQ6A 2B2CA 4WCVA 3EWIA 1ZGHA 4NV0A 1T5IA 2LNDA 3AVTA 1E92A 4MI1A 1T5BA 5D5HA 4FDAA 3ESDA 3L5KA 4M46A 4DCUA 3ZWMA 1R0BA 4A3TA 4LNUB 1NP7A 4EENA 4R16A 4W5JA 3RS8A 1V48A 4FFBB 5DGIA 2E85A 2Y1EA 1W0JD 3X0DA 4BJ3A 5P21A 4UYJA 3ZZUA 1H2FA 1QMPA 3P0EA 1KZGB 4I4TB 3TW8A 4M60A 2PFGA 1WWKA 3KD3A 4OQNA 1E6LA 1CD5A 2VUUA 2X8AA 1E3WB 4R05A 1A9PA 4DLPA 2Y1WA 4Y6RA 4AXBA 4EO7A 2H2FA 4ITRC 3L7KA 1RC1A 4IXWA 5IDYA 4FA6A 4D3XA 5E75A 2OWDA 1DQZA 2PV7A 2R25B 2O2DA 3EUVA 4F3NA 2OLJA 5BW6B 3OAWA 2ZDHA 2HNAA 4C30A 3KWLA 2Q3DA 2G28A 2O2JA 5ESWA 3B12A 4EY5A 2IEGA 2XEHA 3QQPA 2WSLA 2BFBB 1QHIA 3IDSA 5LNK6 2JFQA 1Q15A 3PI7A 4RDCA 3IUPA 2RCYA 1H1LA 4DLVA 1XNJA 1VJDA 3M1LA 1YK0A 1JR3D 4DLXA 1T9HA 1QHHA 2O14A 5E6UB 2X0KA 3RKVA 3JX9A 4EHMA 1OX4B 1VJGA 4A8JC 3BTUA 3ETJA 3QHQA 4GAAA 4HRXA 1DHTA 4U9IS 3N6RA 1BVUA 421PA 1ELWA 1UFQA 2M2IA 4NCXA 1I51A 2YN2A 4QT4A 2OO5C 2Y1DA 1JG3A 2B35A 4PLFA 1EX9A 2QE6A 3TE7A 2ZDQA 2EWWA 2JI4A 3ZG6A 4EDHA 3MXOA 1UIMA 4B4UA 1ICIA 3RWOA 5J5CA 1SPBS 5JS2A 3RWMB 1EE2A 3HCAA 2BFEA 4J0GA 1XX6A 2RKBA 4GBJA 4JDPA 3K0BA 3S2AA 1BFUA 2JFNA 2HBYA 1YV9A 2WKQA 3PICA 4H31A 4IUCS 1DG3A 4R81A 4UC0A 3RK6A 5D51S 1IUNA 5FWNA 1A04A 4MS4A 1JV2B 4LOIA 4AKTA 4W7HA 1RQXA 5DB4A 2G17A 1FCJA 3D8RA 4LG6A 1RM4A 1Z73A 2XTZA 4QJIA 5FR2A 4YK7A 2ZR7A 2ZTMA 1VJ0A 2IZ0A 3IR5A 3ISTA 2BDTA 4JLWA 4W5HA 2LDBA 5ARCA 1YR7A 2WDPA 2B7BA 1KSFX 3LCMA 3JRNA 4KOAA 5JWRA 3L5OA 4IQ8A 3KQQA 5LCWJ 2NSHA 2QTVB 4JL0A 2Y6UA 1SC6A 1Y6IA 5FO1A 1T9KA 1A50B 3MUOA 3ECAA 4Y6PA 5TJ9A 4Z2AA 4ETIA 4YO7A 1W93A 1E1RA 2NVWA 3VPSA 3NHKA 1TRKA 3TQHA 3NH9A 4DV1B 2W2TA 4D8UA 4GU5A 4RVOA 1QRSA 4UDXX 3WXMA 5EJGA 1R4AA 1JU9A 1MJNA 3IOEA 2R00C 1NQUA 1NX9A 1MH1A 1KZ1A 1TT5A 3N71A 4JBXA 2ALJA 3A7EA 4RL6A 1ENOA 3NH6A 5KTRA 3OEHD 4YPVA 2I2AA 4NU5A 3ABZA 1H2AS 4NMWA 1E3TA 4UHHA 3K9IA 1IH8A 3AG6A 2XYPA 1RP7A 1EHYA 3IR7A 3VDXA 4K26A 2NXEA 3ZX4A 2IYFA 4NONA 4CQJA 4YRBA 1S4QA 4IEFB 5ALHA 5EJIA 5HI7A 2D5AA 4G3XA 3JRXA 1R37A 4CL2A 2BL4A 1N8KA 1RRCA 4R1OA 3BZUA 1QTRA 4A03A 5HGXA 5IKXA 3M89A 4JIMA 1H9BA 1VE1A 1N1DA 5HFAA 1YZUA 2FW0A 3LFTA 4GI3A 4N3BA 1B26A 4ZI7F 1PR9A 2JEOA 2XPCA 3AM3A 3R76A 4B89A 1D8DA 2GEUA 1QKIA 4TL8A 2HUPA 1YULA 2R66A 2ZXWE 4Y2RA 4E2XA 3WMEA 1EQAA 3WRYA 3WP0A 4L5BA 3HG7A 2A0WA 1E1CA 1RXEA 5I5EA 4TXLA 4Y2QA 4M87A 4N5NA 1P0MA 3RRNA 5CD9A 5ICGA 3OQ1A 5CRUA 4MMXB 3A06A 2B7CA 2RG1A 4LVNA 1W47A 4RGYA 1U7PA 2Q8PA 3MQ2A 3H2IA 3TQCA 1UPAA 3OX1A 1NBEA 4V3CA 1N7HA 3OY7A 1UBHS 1ILWA 3ILVA 3VISA 1R10A 2B3DA 2JDID 3W5SA 4G11A 5I9IA 4RLHA 3RARA 2H4FA 1WUTA 3RU9A 2ZYIA 3D3MA 2R5FA 1DVPA 5HIMA 1AQ6A 1DXOA 3BXXA 3GI1A 2CLLB 1G8GA 4YAOA 4I5GA 4IQFA 2Q3FA 3QG5A 1HX8A 1P1RA 1UN8A 4E5DA 1FMTA 2XKAA 4UZEA 2VOEA 1CLUA 2RGWA 3QEMA 4Q4JA 4LOKA 4Q9JA 3MIIA 5I9LA 4YRMA 2QSZA 2R85A 1V5FA 2R7AA 2PKRA 2NSDA 2AZMA 3V8NA 1Q14A 4DS3A 4MLCA 2GZ3A 1QFYA 4X61A 2JIOA 5DE3A 1GXSA 2H59A 2ZSIA 2WUDA 3GGOA 2D2EA 1U8YA 4F3TA 1TKBA 3PZ3A 1AQYA 4XAQA 3LTEA 4EEKA 3OUTA 1L4GA 3JUIA 2H5JA 3IDAA 4BNGA 4OAOA 3JAKB 2GFQA 1PU2A 2QR5A 1T0BA 2V6GA 1U0RA 3FMGA 4LF4B 1FYFA 1A5ZA 4H1TA 5TNXA 4Q9AA 4HLCA 5CLJA 3AF1A 2WTXA 3C8HA 4WOBA 3RT7A 1L6RA 5FDFA 4L02A 4ZV9A 4FFSA 2Y1OA 1NXVA 4RABA 4F9TA 3UKDA 4MOWA 1NF3A 1GR0A 3PZBA 3LGSA 2W2VA 4UTZA 1Q7BA 1Z7BA 4QEZA 2ZPAA 1EM8B 2IYRA 3P5SA 3IS3A 1PZGA 4P7GA 3MUNA 2HIGA 5F78A 1OVMA 4F11A 2X7XA 4W9NA 4Q4LA 1Y1PA 1THTA 4PICA 3RYFA 1RHKA 1K98A 3AIOA 1C3XA 2Z57A 2HSGA 4C6SA 5BVGA 1JW9B 4BO3A 2BJHA 4OMUA 2IYZA 4DR2B 4LSWA 2JEKA 3CO0S 4ESEA 4NZOA 1BE8A 2CVZA 2J8SD 4HNGA 1IXSB 3OAAD 3TLZA 3ASGA 1SC4A 1J99A 5JARA 5CLHA 3AB7A 4DRZA 3ZDYB 5CDYA 4H6VA 2ZQ5A 5AOVA 5ICEA 4XSGA 1UXJA 1NLYA 2JGDB 4AF6A 3DXFA 3CZ9A 4LRTB 4D43A 2NO0A 2TECE 3A4YA 5DXFA 2EILE 2ASVA 3RCBA 4ARBA 1K5HA 2E48A 3K31A 5A4AA 3SE0A 2BI7A 4CL3A 4RAQA 1C8VB 1RYHA 1KOJA 2C5SA 1ZMBA 4ZRDA 3OZTA 5HBGA 4BGUA 1L4YA 1OW3B 2ZIAA 5BSEA 4BJHB 4DIKA 3RUFA 4DXAA 3V2GA 3ER8A 2E21A 2JVKA 3KU4A 1Z2EA 4EFLA 5F3RA 4Q3LA 1PE0A 4LSMA 3T3GA 3P1JA 2IFUA 4GAEA 4BVKA 4IGAA 3D6JA 4FKZA 4CQLA 2HQOA 2KE5A 3HYCA 5ALZA 1U11A 3AWDA 4OIMA 3TRJA 2ONDA 2ASEA 1H6CA 1OA0A 2GDZA 1UJ6A 5EHNA 4E2ZA 2QI9F 1X1QA 2VF8A 4L8WB 5DBOA 1KWGA 3FPKA 2HIMA 1F3LA 3V48A 5CT8A 2ZAGA 4YRZA 2WM2A 5K4GA 1G8FA 3UGTA 4X0EA 4L1BA 3EHRA 2JL1A 4B3DA 2L6JA 4DX5D 5DYNA 3DYVA 3C7KA 1E6KA 1UXKA 4BO0A 4R01A 1R88A 4CM7A 3SZGA 4Y9SA 3HBAA 4KQIA 1NMQA 4TKVA 1VIDA 2D13A 1AV7A 5ECGC 3R74A 3TG2A 4Q9IA 4MA0A 2BFDB 2JAPA 1ZU4A 1V95A 4CV0A 4UTRA 1GGJA 2XMCA 4JJ7A 3GX1A 3MRTA 4I9NA 4KXXA 3WAJA 4WK6A 1NZJA 4RA9B 2X76A 5J2TF 3CN7A 5TDHA 1Z5OA 4RH0A 1DEOA 2PY6A 2X40A 3LVQE 2CMKA 1IM8A 5FAKA 3RIGA 1ZLYA 4Q1VA 4CEIA 2ETCA 3KPVA 2BLLA 2ILVA 1QRTA 3GDHA 2I1VB 2CVOA 4KC0A 1SBIA 3BHJA 4A2QA 1WJGA 1F1BA 4BVBA 1M2HA 4DAOA 3PENA 1Y5RA 3N75A 1PHPA 1NUPA 2PQ0A 1KEZA 3GWZA 1Z82A 5CMLA 3UF0A 3EXHB 5EGNA 4YUVA 4NZNA 2A7QA 3GDOA 4GR9A 4MR9B 1WM1A 4ZJYA 5HXAA 5EJAA 1KK0A 3ZQJA 1V45E 2FDXA 4RV5A 3BWCA 5FNZA 3UMJA 1Z6ZA 3AKDA 1RRFA 4KN9S 1II8B 5IW8A 3HUFA 4AZWA 2Z9CA 1EG2A 3UUWA 1EKXA 2R1TB 5TF0A 1BN7A 4JLDA 3FZGA 1QOPB 2XTJA 1FLVA 4P3YA 1Y8RA 2FSFA 2Y8EA 1EWRA 5F7JA 1YL7A 1UBFA 2AE1A 4AU1A 1ABFA 1MX2A 4YDOA 3LVRE 1ATZA 3QYAA 4Z7QB 3NOOA 4N5DA 2BLNA 3F9IA 4RLSA 2HT6A 1O58A 4BP9A 2VQDA 5LP0A 3HKDB 4TTTS 4IYRA 5BQXA 3FB1A 4IIYA 1XZAA 4YRQA 2ORIA 4KIWA 2FPLA 4M37A 3APFA 2ZRAA 4N3NA 3DXZA 3LQQA 4HP8A 3ZDZB 2MHCA 4ZC1A 2PMFA 1C9NA 2FSSA 3CN9A 3FMOB 4EY8A 3ZCXA 4EZBA 3PF9A 2Q4TA 4JI6B 4LVOA 4MW7A 2ZGDA 2ZRBA 2PGIA 5E7MA 4D8VA 4GTQA 3EH1A 1PD1A 3HYMB 1FFYA 3P19A 4C0LA 4I17A 4MW0A 4HTAA 2VK2A 4RVGA 2RBGA 3P2OA 4BB6A 3F97A 2WYIA 4EF4A 3IA7A 4LCBA 3DEHA 3UPTA 1CR1A 5IN5A 4JENA 4P3OA 4ALNA 1PUXA 4TWIA 1A8HA 2UXCB 1UK6A 3IP1A 1MGOA 1NDUA 1N1GA 1QZXA 3B7GA 2JGLA 3FOCA 3IMCA 4CCAA 1VKOA 2ANCA 5BSGA 3DULA 4GGOA 3D1VA 1L5KA 2A8YA 4UULA 1D7OA 3LF2A 4E5UA 3EEQA 4GMHA 5FBZA 2VJCA 5HKAA 5F76A 4GE3A 1B6SA 5BR8B 4IFBA 4DZTA 2A78A 1V5IA 4XTRA 5FOWA 4P4LA 2WF7A 2VP3A 3EULA 1CUYA 3PRZA 1TMGE 2Y77A 3FMVA 4OP1A 3QUTA 2AUTA 4ZI5A 1L4LA 1FVHA 1IQ0A 1C1DA 3S27A 5GM1A 2L19A 3ZBQA 2MMGA 3HCWA 3VHRA 4O8ZA 4HK4A 3KBOA 3HY6A 2ON6A 4J8DA 3G1UA 3QJZA 3TZQA 3C3EA 4E3ZA 4PNPA 4KVOA 4HN9A 2XQKA 3OU6A 2QVGA 5ADUS 1XP8A 1YAJA 3AYZB 3JS5A 2MMCA 4G0OA 3KNZA 3CHSA 1H4SA 1K89A 2C9YA 4DUPA 5B1AE 1NOIA 3RD5A 4XEHA 1BRTA 3ZYLA 1ANKA 1SUIA 2IF0A 1FFWA 4RKRA 1XP5A 2J4DA 3PQDA 4B76A 3FPLA 3GNLA 2KLBA 3PNKA 1GPAA 2H4WA 3PX2A 1ZVVA 1DZ3A 2X7HA 2HWXA 2BTEA 1LW6E 3UJ9A 2G4LA 2AA3A 3NAWA 2YOGA 4BFSA 2XADA 3D31A 1RTKA 4YASA 5ENRD 3WTBA 4BTAA 5IBRA 4HVTA 4GLFA 5ALQA 2I1QA 3VU9B 3JWJA 3E9MA 3ULQA 3QBVA 3NS7A 2CY0A 1NWHA 5IUJC 2QL9A 3E70C 4L4RA 3LZ6A 1OXTA 3LT4A 1LBQA 2SECE 4R68A 1KK1A 5AJZA 3FOAA 2PX3A 1OIVA 2HOQA 5TS2A 4DGSA 1VI6A 1P7WA 1DJLA 2I6QA 3EUWA 4IF6A 1E8DA 2W4IA 2H1FA 3GG2A 4P4UA 4CM8B 1G5PA 4F4FA 3QNMA 4OJYA 3AERB 5FV4A 2XEXA 3WQRA 1K9SA 1Y8CA 4PBRA 2C7RA 3IEUA 1G60A 4X60A 2YFYA 4YMUA 2HNKA 2BR4A 4HNAD 4YX9A 1UWVA 5LMZA 2FXVA 4Z53A 1XMPA 4HOSA 4XQ0A 5FQ8A 3TAUA 4WXEA 2PGDA 1D4OA 4JI3B 4BQRA 2MR5A 3UG6A 1FDSA 2NU6B 4PS1A 3NHUA 3WV4A 3NVDA 2HCBA 3ZJTA 1QQ5A 3U40A 1VA5A 4QZVA 3VH4A 4X65B 4L3OA 1GQQA 2FPIA 2FO1E 3I39X 3OCWA 2VYVD 1J2TA 1YQUA 1FNBA 4PLGA 4NDNE 1YR8A 2BGIA 3DV9A 1FBNA 2HA2A 2VHEA 3SM9A 4EY4A 1N3YA 3C3JA 5C8ZA 4KLZA 2VP4A 2I6TA 2DH6A 3MWEA 4DVJA 2GN4A 4QDXA 4PGMA 2M63A 1BWQA 3A2LA 2P2NA 4OI0A 2B6NA 1ZC4A 1V55E 3L77A 1EX1A 4MP8A 5KYYB 2XUHA 3U80A 2AS0A 1GGHA 5K6TA 3U09A 5I51A 4K6KA 1NVVQ 4FYJA 2AW6A 1MX4A 3Q15C 1P0IA 4Q05A 3KEZA 2WYVA 3IXMA 3U4TA 1CJUC 4I9UA 4RTSA 3D3QA 5C8YB 1KJQA 4MNTA 3G7NA 4MW5A 4EYQA 4QXPA 3G8AA 4MW1A 1Y80A 3TXNA 4NV1A 1UWLA 3GXBA 2QN8A 5C4GB 1I3CA 4TKUB 2O8CB 2C4NA 1LI4A 3BL6A 1LBHA 1MAUA 4JKYA 2A0UA 3DR3A 2PX4A 4ZHQB 2O4UX 5C46F 4ZMRA 4AJOA 2XCLA 2TS1A 3WDLA 1TECE 3PXDA 3VAAA 3G0BA 4DB2A 2I66A 4W1PA 1KEPA 1MKYA 3MX3A 2GKSA 3QBJA 2OZPA 3V32A 4PWYA 4YP6A 3QVLA 1R6BX 1WUIS 2Q9BA 1FFCA 4EB8A 3V4VB 2W6PA 3LWNA 3EWAA 4F4UA 2QRMA 3I8SA 2EIHA 1IY1A 3Q0TA 2R7MA 3C7DB 3BG0B 4GVLA 3OLYA 4OM8A 2VCEA 3DO6A 2Q21A 4U2BA 1XG5A 4Q6WA 2WMNA 2G6BA 2PZEA 2ZVJA 3H87A 1X7WB 3VKFA 4O60A 3ZDEA 1H8HA 4ISBA 1OXJA 2ZB8A 4GOJA 5KI6A 3HKCB 1LTHR 1KOGA 5D84A 3FU3A 5DCUA 4A36A 3A6EA 1SVWA 2OK7A 1PEAA 3CUKA 1Y4DE 3VMFA 4JI2B 1TK9A 2IQIA 3JU3A 2Y1CA 1PF7E 2VHTA 3VLEA 2TRSB 3TQRA 4KQ6A 3IMKA 4YDWA 2OCLA 1GQFA 1DZIA 3QLJA 3P9ZA 3BIFA 3AS5A 1F5SA 1DINA 5LB4A 2IBTA 1MX3A 4TMXA 3MPUA 1Y6JA 1D5CA 1E9SA 5BV1A 1O9BA 2B1RA 5KC9A 1WQ1R 2JCXA 3OQ6A 3UT6A 1KL7A 2VEDA 1HSZA 2B6CA 4J90A 4KTTE 3I6MA 3E3MA 4IEEA 5LA6A 1FQKA 3VYSB 4WKGA 3BAZA 1BWPA 4D8YA 1ETHA 3RIXA 2CJFA 2WF5A 4PLYA 1V11A 3RJ9A 1O4WA 3SM3A 2W2LD 3BEDA 3VO9A 5LOVB 4WT7A 5FBRB 4K40A 3UQZA 3TSWA 1W0JA 5BW5A 1W5TA 4MI9A 5FTJA 3ZGVA 1ZUIA 2BFCA 3EUEA 2V3VA 5KWDA 3VTAA 2GNOA 4JWKA 3RC2A 3RAUA 2HO1A 4L4UA 3M6UA 3Q8LA 3EHQA 3EW9A 4KB5A 3QPBA 3P94A 4FOLA 3DC7A 2R8BA 1KT0A 1TM5E 4HX9A 4YDQA 1LNSA 4LECA 2IYLD 3HVUA 2RJ3A 3TQFA 1EIZA 4PE5B 5C1BA 3GW8A 2JCYA 3BRSA 5AW8A 2WU3A 1N2JA 3CNLA 3R4CA 1DCTA 4HUTA 2CEKA 4C4RA 4FHZA 1TEHA 5EZYF 2ZIEA 3AFOA 1AQJA 3S7BA 1LPPA 3T7KA 3O8LA 2O4CA 4MLZA 2HDHA 3NBNB 3WB1A 4C89A 4OA5A 2AC7A 2V6BA 3HFJA 1UOOA 2QX6A 3L41A 2Z8YM 1AZWA 3SK0A 3GUHA 5KU1A 1CXZA 4HGOA 1OFHA 2BM8A 1M7BA 4S1OA 3MCWA 4RXMA 1E9RA 2ZW9A 2VR1A 4X41A 4XPIA 4DX2A 4A16A 2VHJA 2QTTA 1EYZA 5K3BA 1JKJB 2EATA 4Z4EA 4LC1A 4JC0A 1N0VC 4IDNA 1R8SA 1F48A 3WLMA 2LDXA 2IDJA 4GWLA 1NZDA 4V0NA 5FI1B 4DIUA 1Z39A 3WLHA 1KFBB 3I2JA 3AKYA 2XJ4A 4EJ0A 3T61A 1FFGA 1GTJ1 2Z5VA 2JJ2D 2GRPB 2V8SE 1BHQ1 3WTCA 1M2KA 3ZHUA 3HRHA 3LT5A 4AURA 1VCNA 3UCFA 3BMQA 1M8KA 3MUEA 2F3UA 4DN6A 3JYSA 3LQRA 2GCEA 4UAUA 1H0KA 4AS3A 1QE5A 3B48A 5B3JA 9LDBA 2VT6A 1CR0A 1ZGAA 5DNAA 1YTLA 3DFKA 2NMVA 2CXQA 5BRNA 2C2OA 2CD7A 3CNNA 4LXXA 3AKCA 4HQRA 1T5LA 1GZ5A 1JP7A 2X6RA 3ETHA 4JXKA 4EPTA 2ZYWX 5GY7A 1FYXA 4WWHA 1E98A 3TQQA 4XVQA 2WNSA 2Y0PA 1RYBA 3LLSA 1XEXB 4TTAA 2YHUA 3PGXA 1G7CA 2P0YA 4QDKA 1HE5A 5EA2A 3H6KA 4AROA 2Q1YA 2IHKA 2BMAA 1BE6A 3UMMA 1KVUA 5IKMA 3A3OA 4XIGS 1Z2PX 1FLDA 4MULA 2GM9A 3UYLA 4AK9A 4HWOA 3RHFA 5KNCD 2ZM6B 3EC1A 3MLEA 1UPFA 3OEHA 1NYRA 2X42A 1U2ZA 1CJBA 2J4BA 3MT9A 4X20A 4TYNA 2F3PA 5ADWA 3DCJA 2RHCA 5I7WA 1E6WA 3RVRA 3WA7A 4OHVA 3WWZA 3J81A 3CISA 3ZKWA 5FRDA 5L3SA 3B20A 3CEQA 4H3SA 5CFLA 4UE2A 1YRHA 1MG0A 3OFJA 4AC9A 3H04A 2W9XA 3EDYA 1LZLA 2G1JA 3L0DA 4L8FA 2BH2A 2ECPA 4N65A 1X8JA 1O0CA 1UJJA 3QWWA 4N5CA 3EX7C 3QU5A 3DEOA 1UOQA 1WKCA 3BKWA 1E77A 1LX6A 2Z1NA 1Z08A 3LUBA 1HYQA 1QQAA 4MQLA 2Q2OA 3QLVA 3ZUPA 4O2BB 3SMQA 4G2TA 4RMGA 5CA0F 3CLVA 4CWAA 4AL4A 1Z6TA 4WIAA 4JXZA 4BKUA 2OCYC 4YALA 4GZ3A 1C1XB 2BD0A 1TMOA 3L8MA 5K2MA 3BERA 5CCXA 4TV8F 4JBNA 4IFIA 4L51A 2VK8A 2YIVX 4MR8A 5C35A 2CFZA 3G89A 3PHJA 4Y1GA