5C1DA

Human ogt in complex with udp-5s-glcnac and substrate peptide (rb2l)
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
713
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 275
structure length 695
sequence length 713
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c1dA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5c1dA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5c1dA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1dA03
1OUVA 4LEIA 2XA1A 4BQIA 3CEMA 3TG4A 4HLNA 1P2DA 4CTMA 1FS4A 3RO3A 3S7JA 3OKCA 5DLDA 3EDTB 1A17A 2Y4TA 4MRAA 1AHPA 2QFCA 4GZ5A 4XI9A 1F6DA 3E3LA 3EBOA 3RKVA 3IAAA 1Y6FA 1JIUA 4EJ2A 3ASGA 2G9UA 4X7RA 3BD6A 1EM6A 4AY6A 5G04C 1L5SA 4NC9A 3ZCTA 2F3SA 4M60A 1ELWA 1ZU2A 4WNFA 3NCHA 2KCVA 5JJ6A 2KC7A 3CEHA 3BCUA 3VDNB 4RIEA 2Y4UA 1UQUA 4AN4A 2XGSA 3ZGQA 3ASHA 4J8FA 4NQ0A 1XKXA 3TG5A 2AW3A 1RRVA 2C9ZA 2PYIA 2PL2A 2SKDA 4H7XA 3OXFA 3CKBA 4UQZA 2ATIA 3G2LA 1NOKA 3NPAA 5FZRA 2XA2A 3CV3A 4F3VA 1Z62A 3NC4A 1E4OA 2C0MA 3E4BA 3GZ2A 3ASDA 3CUUA 1IIRA 1Y6GA 9GPBA 4YNDA 4N5CA 3G2KA 4WNDA 3MSCA 4CTOA 1HXIA 2C4MA 3H4IA 3QKWA 4NEQA 3RSCA 3URZA 3S7FA 3OKPA 3PDNA 3UYKA 5D0OD 3OTGA 3OXLA 2BGTA 3CUWA 4MI3A 2PQ6A 3NB0A 2GPAA 4N3AA 3UQ3A 3HYMB 1GZ5A 5CCLA 4GA2A 4U07A 1NZDA 1Z6QA 2BUGA 2YQ8A 1C8LA 1YGPA 2OOEA 3ZCPA 4JL0A 3ULQA 2VGXA 3OTHA 2XEVA 4MICA 4UI9C 1RZUA 4NESA 2FETA 3CVNA 4JA7A 2HR2A 1XL0A 2PYDA 5TMEA 4WACA 1A8IA 1ABBA 3S28A 1FU8A 2G9RA 4FKZA 2ASVA 2R66A 5EX0A 4G2VA 5ARGA 2QLLA 1TJCA 4APOA 4ME2A 2MHKA 4X7MA 3ZCQA 4CGWA 1FU4A 1KT0A 4NRHB 1KTIA 5FZQA 5A6CA 1O6CA 1Z8DA 3Q47B 1NZNA 3SZ7A 3S27A 3OTIA 3S29A 1NZFA 4I9CA 2X6RA 3MT9A 2QN3A 2VSNA 1PNVA 2QNBA 3AMVA 3T3EA 2IW1A 2QRMA 2ONDA 3NAZA 1L5QA 3GZ1A 3HBMA 4F97A 2Q6VA 1M5RA 2PQRA 3NP7A 2X0EA 1GPBA 3PE3A 2SKCA 3T7DA 5TMBA 4UQYA 5AYWD 2LSVA 3ZFWA 2FBNA 3SYMA 3FWVA 3RIBA 3CUTA 4AMGA 1JIXA 1C8KA 1FTQA 1XOIA 3U4TA 1XL1A 3D0QA 4RENA 1NLMA 3FFLA 1Y8MA 2GT1A 2QRGA 2GEKA 4H7YA 2QN2A 4KQ1A 2X0DA 1HLFA 1H5UA 3T3HA 4EKYA 3TSAA 4L22A 3ZCVA 3CEJA 4G23A 2F3UA 1HH8A 2GPBA 4BTAA 2LNIA 5KJNA 2F3QA 1IHGA 4GYOA 2BFWA 1WV1A 3UUXA 4GYYA 4YI3A 3CK8A 4F96A 4HOTA 4U04A 3AS5A 3GW4A 2XCUA 3BCSA 3MT7A 3Q49B 5LCWC 2R5SA 5JTTA 1GG8A 2G9VA 2IV7A 1IXYA 3C4VA 2VG8A 5M72A 2P58C 1XC7A 3NP9A 2ECPA 2WQHA 4RG9A 2R4TA 2O6LA 2ACWA 3BCRA 1AXRA 3ESKA 1WW2A 3OY2A 2BISA 1SXQA 3ZHEB 4UQXA 4BT8A 2GEJA 3QWVA 3GPBA 4GZ6A 4YUAA 1E1YA 3AS4A 3GYZA 1BX3A 1JG7A 4G26A 2ZB2A 3TAXA 3Q3IA 2OFFA 4WNGA 2PRJA 2R68A 1FU7A 2QN1A 4RIHA 4CTNA 1QZ2A 4U0SA 5KJKA 1FA9A 3S0JA 5G05C 1PC2A 3LY8A 3MKRA 3RO2A 1NOJA 2SKEA 4J8EA 2HY7A 4N3CA 4GPKA 1C3JA 1KT1A 4GCNA 1HZ4A 5KJMA 2AV6A 5ARFA 3ZCSA 2WTXA 2XCBA 2R4UA 5BNWA 1EXVA 4YVOA 3CKCA 3ZCUA 1JG6A 3O3CA 4BTBA 3MA5A 2GPNA 4Z5XA 4F9FA 3L7CA 1XNFA 2Q7FA 4XI0A 4RIIA 3RJVA 5JTUA 4G24A 5BW8C 3D1JA 5KJLA 5DIZA 2P6PA 1FTWA 3C48A 1QM5A 2KCKA 2KCLA 4FZRA 2VYIA 3KD7A 3C4QA 2YHCA 4HORA 2IYFA 3GUHA 3CK7A 5D00A 2IV3A 3MTDA 2VSYA 3MEKA 4KXKB 4RIGA 3QOUA 2ACVA 4UI9J 2QLMA 2X6QA 1P4HA 3BEOA 4BFCA 4B94A 3D0RA 3R9AB 1F0KA 3LCAA 1QQEA 5C1DA 4GA1A 5LQDA 2YJNA 4BT9A 4I17A 3G2HA 4AM9A 4KBQA 5TMDA 4KQ2A 2KS6A 4W6QA 4N39A 3VUFA 8GPBA 3LY9A 3ZCRA 3JYSA 3WAGA 3HBNA 2IUYA 4X7PA 3E3NA 4W9RA 2VCEA 1P29A 4JHRA 3MBOA 3MS4A 4N2QA 2L6JA 2XGMA 3HBJA 3MRTA 2KATA 3CUYA 2GM9A 3G2JA 5FTPA 2AZDA 3T5TA 4I1AA 5HQ8A 1P4JA 2R60A 4G2TA 1FTYA 2HYZA 2JLBA 1NOIA 2C1ZA 4QLBA 4GCOA 4BQEA 1YA0A 2IEIA 2X0FA 1GGNA 3BD8A 5LCWJ 2FF5A 2IF4A 4U0UA 1UQTA 3VDMA 3KAEA 3U3WA 3MV2B 1LWNA 3SF4A 2IEGA 4O6FA 4ABNA 3L01A 5G05J 3MQFA 4WADA 1J39A 1P2BA 3QWPA 3RU0A 4I9EA 3L7BA 4KQMA 4RG6A 2V5FA 4WNEA 2G9QA 3VTYA 1FCHA 3MTBA 3CVPA 3UPVA 3L7AA 1KLXA 5DBKA 4HOQA 3O48A 4WHMA 2H1FA 1LWOA 2HO1A 2C0LA 3LKUA 4LDPA 5TVGA 3SYRA 7GPBA 3CVLA 4M83A 3Q4AB 2QN7A 4EL5A 3OKAA 3CV0A 4M7PA 1PN3A 3DZCA 2LSUA 3DDWA 1WUTA 4RIFA 3TOVA 2F9FA 4EKEA 1GFZA 1UZUA 5D01A 2VGXB 3CK9A 3OT5A 4KYOB 5FJYA 2IFUA 5IKPA 5BT1A 2PRIA 4Y6WA 5A7DB 3CEQA 4YVQC 1XV5A 2QN9A 1YA6A 1GPAA 4N2SA 2XCCA 5EX3A 1L5WA 3WADA 4Y6CA 4LEUA 2PZIA 2E2EA 4WUYA 4XIFA 3G2NA 3ASFA 2C2LA 2FEZA 3H4TA 1NA0A 4U0ZA 3LY7A 4IN3B 2QRQA 3CX4A 4MHOA 3TGOA 1WW3A 3LPZA 1P5QA 4AY5A 1B89A 2FF4A 3WXXA 2XCIA 4HOSA 3S7BA 5JJTA 3Q3HA 3ZPJA 2WPVA 2FO7A 2AMVA 3BDAA 3CVQA 3VTXA 4A1SA 4GA0A 4MI6A 5IKOA 3MV3B 2FI7A 3L79A 2XGOA 1PSWA 2PQNA 3AS8A 1L5RA 1WV0A 4RBNA 2GW1A 4UI9K 1V4VA 2FFRA 3T3IA 2UY1B 5FZSA 3N71A 3OY7A 4G25A 2JZCA 3QKYA 3T3GA 4N3BA 4J0UA 5G04J 3HBFA 3ZHEA 3L7DA 1C50A 5D0QD 2C1XA 1GPYA 1WAO1 4N9WA 2I6HA 2JJMA 3Q3EA 3QHPA 3CUVA 3IEGA 4J8DA 4MI9A 2QZSA 3DD1A 3OXGA 4PQGA 4MHSA 2BGUA 2DBAA 2QRHA 3FP3A 1VGVA 2VQ2A 1IYGA 1K06A 1E96B 3MS2A 1RZVA 3NF1A 2J9QA 4AIFA 1K08A 3QWWA 2GJ4A 3S7DA 3MS7A 5CHEE 4HWGA 3BEEA 4G1TA 1P2GA 3VUEA 5HI7A 5GPBA 3MRVA 3MRXA 3FROA 2VCHA 2IYAA 3RSZA 4EL0A 1NA3A 3Q15A 1JEJA 3PE4A 1P4GA 3T3DA 3RHZA 1L5VA 1WUYA 1PYGA 3RT1A 4X6LA 2VGYA 2QRPA 1FC0A 2QN8A 1QKJA 1ELRA 4CGVA 1L7XA 2XMPA 1Y8ZA 1NVKA 3EBPA 5DXFA 4RELA 3WC4A 1L6IA 4AMBA 6GPBA 4JA9A 5CCMA 3G2IA 4BWRA 3UYLA 5DU2A 1Z6PA 4EQFA 2F3PA 4CDRA 2AVPA 3QDNA 5HXAA 3COPA 2NC9A 3MT8A 1B4DA 4GZ3A 4YI5A 5ENZA 5JJ7A 3MTAA 2UY1A 5EKQD 4GPBA 3BD7A 4I2WA 4HOUA 1WM5A 2QLNA 4GYWA 3ZN3A 2UWJG 1JIVA 2XA9A 3DDSA 4BQFA 1ZBPA 2H1HA 3KS2A 3E3OA 1SXPA 3K9IA 5FT9A 4I2ZA 3Q5MA 3IA7A 2XPIA 3LYAA 1W3BA 3S2UA 4REMA 5I45A
chains in the Genus database with same CATH superfamily
3ZWYA 5FAXA 2O8CA 4YT5A 4JROA 2YYZA 1GVNB 2FJEB 2WT9A 3PNSA 3E27A 1UADA 2FG6C 1FS4A 1YZLA 2UZIR 4JLSA 4PLWA 5E9JA 4YP7A 2CLMB 2CUKA 2F3TA 4FHJA 4KXUA 3ZGVA 4GWLA 2EKPA 3E3LA 1YC5A 3PU6A 4LXIA 2FTKE 1VLMA 4S1PA 4B4DA 3MCUA 4Q7KA 2HWWA 1WP4A 3WKBA 2FK7A 2GDZA 3H18A 4MVJP 2JHPA 4F1WA 3DLBA 2V9ZA 3PPIA 1PT7A 4I1MA 1AK9A 3LDFA 4FOTA 4TZ6A 3UAYA 5NULA 1QF7A 1W5FA 2OHVA 4KMMA 3RRMA 1VPEA 3BK7A 3U09A 1QP0A 5G04C 3HI4A 4XSVA 3FDXA 3FTEA 4RQUA 1KKLA 3ENQA 4BNDB 4M3OA 4PQRA 2Q2VA 5AKEA 5G41A 5B3JC 3L06A 1EVIA 2HCBA 2FEOA 3AG6A 1YHZA 3N2KB 2WMOB 4M60A 5AKKA 4C5CA 5MDHA 3U7GA 2I2FA 3PQ2A 4BKQA 5CMWA 3VBEA 2Z6AA 4Z4FA 2XHEA 1M1XB 2GYYA 2R96A 2Q9BA 2YL2A 2Z5FA 3WK9A 4DA7A 3DL2A 5CEJA 5TQ2B 5JH7F 3ZGQA 1EB8A 3AWIA 4UUMA 4X85A 2B99A 4RVBA 3K09C 4BU0A 4FC7A 2Z2ZA 5CGZA 2IEDA 4WXMA 4C4AA 4R7LA 2K6GA 4P4TA 3E22A 4UNNA 2GRNB 1UKCA 2QUIA 2YVKA 3Q7IA 1JQDA 1KEKA 4OYLA 3JZAA 4IYPA 1QGED 1SH7A 2VLIA 3LQ4A 4F3VA 1IIBA 3T7JA 1LI7A 4P81A 4W8GA 5EHZA 4YJ2A 4UMEA 3VDXA 2ZUVA 1M9NA 1BQ4A 3BSYA 4RTSA 3PXUA 4DR3B 4HDRA 4J94A 1EDUA 3G2KA 4TTIA 3G2WA 3G9UA 1N94A 4NEQA 5E95A 5JHHB 3A9WA 2NM0A 2IUUA 4BFTA 4Z1OA 3E5NA 3N74A 1AN0A 2WOJA 2ZVDA 3WK4A 3EA5A 1O94A 2J7KA 3GUZA 1F0YA 3RUHA 4DGQA 3F6QA 2J3MA 3QIVA 4I7EA 1MRSA 2QZPA 3R7WB 3A6LA 3BL6A 3D8UA 3V6LA 4F60A 3DLHA 4GU5A 4JI6B 1NTRA 2PSFA 3BSWA 4LYEA 3LNTA 1NZDA 1GTL1 2E5FA 2JFBA 3TG8A 1C8LA 3HUTA 3CEPB 4ANXA 1GKKA 3JPYA 4DEVA 5G40A 4XKJA 1OREA 5G55A 2M6KA 2MINB 3ICPA 4JBWA 1E9RA 4UXHA 1B14A 4MQUA 5K6TA 1JKJA 1RKUA 5ED4A 1VKOA 4O4LF 4RY2A 5ECYA 3HU2A 3CNLA 3RRMB 1CY6A 2Y1XA 3I39X 4XRRA 3WZ2A 3VTAA 1NGSA 2JLUA 3EVGA 4O4IF 3OZDA 1HYHA 3OMSA 1PFUA 4JBIA 4E5YA 2HLHA 5DP1A 4DIUA 2VK1A 5ARGA 1HFJA 5LYJA 5B58T 2JGFA 1HO8A 1ZJYA 3WY9A 3TEFA 1GPWB 3R74A 3GBSA 4D6PA 5TS2A 3WJAA 2R5WA 2NU6A 1USUA 1R1DA 1WCIA 3EXEA 4RMIA 4AURA 1T34A 2JJ2A 2Q62A 2Q3JA 3OTIA 3S27A 3WAJA 1YR1A 3JZIA 1CBUA 3PQ7A 3FUUA 4F1PA 3FNIA 3ZXXA 4ROSA 4BO2A 1MZPA 3DMGA 3DZIA 3H2BA 2ONDA 5C4GB 1KFCB 1T8YA 1G21B 1HMPA 3LLUA 3PRJA 4A73A 2BFDA 4HAOA 4L4ZA 2ZJ0A 1B16A 3P7MA 1YJQA 3BX1A 1W59A 2B8TA 1IXZA 1X92A 3B6IA 3K30A 4J0KA 4MB0A 1NI3A 3I2IA 4TRRA 2Z8ZA 4FHGA 4ZDIA 2XS8A 1AX9A 1G16A 3T5VA 2SKCA 2CW5A 3PHLA 3BE5A 3RCBA 2J0EA 3X44A 3FUVA 4HWSA 4UCFA 2DUNA 2C29D 2IBSA 3ZJTA 3ONLA 1EHIA 3QNMA 4JLJA 3ZYCA 3PEFA 1P61B 3Q6MA 4NICA 5GGYA 4H35A 1X7HA 1PGNA 1TQ4A 3OIVA 4K40A 1FTQA 1GTZA 1IYZA 1LZKA 1U8XX 2DLNA 5K0ZA 3SQWA 3VLEA 1POXA 1EA7A 3TEMA 3ZNOA 2EF0A 2WIDA 3D8SA 1XFAA 3B1XA 3FFLA 4FC8A 2GT1A 2Q5JA 2JGJA 4G8DA 2BV3A 2YN2A 4J1TA 4H7YA 2QLTA 2QMUA 2XDQA 5KTPA 4AQDA 1Z6GA 4M38A 2AXPA 2MSWA 1S8NA 3G1UA 1TO6A 5KWIA 4WVFA 1DIRA 1DU4A 4G0UA 1L8XA 1KEEA 2QBYB 1R9GA 1JXAA 2PZFA 3B5EA 3IERA 4HQKA 1P2FA 3I76A 2DQYA 4DJTA 1UBSB 2H63A 2RMKA 4N0EA 2PU5A 4E2ZA 1CP3A 1TO2E 2UZ1B 4WN9B 5CW1A 5K03A 2LVBA 3CKLA 3CK8A 1V39A 3CCFA 5KKAA 5FOQA 3O75A 2E6KA 3A58B 2VJQA 1YQXA 4FMBB 4MDFA 1CJVC 5AJHA 2RHJA 2OYSA 4KXNA 1YWGO 2G80A 4L5YA 4RS4A 4U02A 3VUFA 4BDTA 3UGQA 1R10A 2F8SA 3ME5A 4I4TB 3AR6A 4QGSA 5E6RB 5JTTA 1YZGA 2XF2A 3AU4A 2JIDA 1VJDA 3AYZB 5TF4A 4F2HA 3VM6A 3AFIA 1D07A 1SXGA 5HUJA 3VU9A 3QKSB 1IXYA 2FZVA 2EERA 3IEPA 4JLNA 1JNXX 1EXDA 2VPYA 1QTQA 2O3QA 1ZVVA 1FCJA 2A1TR 2GS9A 2JARA 1B0PA 2EFGA 4G56A 4YFVA 1L9XA 1YFKA 2VPZA 5DBGA 4AL4A 1L2TA 3GJZA 4X7BA 2GN2A 4BO6A 1SXQA 1CQJB 5CDSA 5FBHA 2F64A 1UC8A 2QUKA 3H83A 4QJ5A 4XARA 3RUAA 3ZHVA 1G3NB 1FVFA 1TNBA 4KPYA 1Z8FA 3D0OA 3AS4A 1QKIA 3ZW7A 1TIPA 3DKRA 1E5DA 3ESQA 5H3HA 2DZDA 2TMDA 3IUBA 1FVHA 2FMIA 2OFFA 2R68A 3FOEC 1ECBA 2H17A 2ZDQA 4QFCA 1I2CA 1ZGJA 2E4VA 2ORIA 3NM6B 4PR0A 4U0SA 4Y2TA 1USGA 1QMOE 1M1ZA 2H4HA 2XVMA 3CF4A 2JD0A 2FQQA 3CJRA 4QYWA 3T3PB 3PVSA 2DY0A 3WLNA 1NV8A 1R4NB 2Y05A 2A9FA 3NANA 4RD3A 4ALNA 2FXIA 1A9YA 1IFXA 2XKKA 3A1FA 1JCQA 3EY4A 2R25B 3L82B 1UK8A 2QNIA 1X2EA 4ND1A 3GLHE 1BMTA 2R79A 1PZMA 3ZDXB 5K0NA 4NFHA 1U5BB 4JJZA 5LYJF 3TWWA 2GZ3A 2CHXA 3QXSA 2W00A 4KJXA 5BO5A 1L7QA 1ZIXA 5U4QA 3ICEA 5JRZA 1D4ZA 2AN1A 1DQSA 1MAVA 2R4UA 3K9LA 3KHKA 3OEYA 3OI7A 3R3JA 4RVNA 4AW9A 1MFZA 4O4IA 3R5JA 3QKSA 1HE8B 4FOOA 4W8OA 3PNMA 3VPAA 3I73A 1T9CA 5FBQB 3RANA 1W5BA 3WISA 5KHLB 2Q7FA 4FWTA 2KJQA 4B31A 4OK5A 4L8YA 3IUQA 4JX8A 4KNYA 3DS8A 3PZBA 2OM2A 1XD2A 5K0EA 3U4CA 4BN5A 3UJNA 2B0OE 1JIKA 3VCXA 2M32A 4RHYA 4IRUB 1Z26A 1UWKA 2B0CA 2W6JA 3EDOA 3UAVA 1TE2A 1D1TA 1P9RA 1UDAA 2AUTA 1QYWA 2EFJA 3IT2A 4P7FA 1Z38A 4NNOA 1UODA 3EPRA 4US1R 2VUHB 3KD7A 4FOPA 3I9JA 4F4DA 1J07A 4KXFB 4HS2A 1T35A 4Q3LA 4X20B 3PE6A 4HORA 3SBEA 5SY6A 3E84A 5J3JA 2QBYA 3AK4A 3DTVD 1JMYA 5K3FB 4APFA 3AVPA 2L0TB 3MEKA 1I32A 2VT7A 1U9IC 3FUEA 3FETA 4MCIA 2Q2OA 2RI1A 3SHOA 5AW1A 4K9QA 2QLFA 2WG1A 5EOVA 1EDZA 2JGLA 4Q7LA 2X3YA 3BEOA 2G1UA 2C54A 1D6NA 1DTWA 3IDOA 3LC1O 5LA6F 3ZHSA 2R5NA 1QOPB 3EHRA 5C1DA 3WRXA 3R5KA 3NIGB 4DV5B 3M3PA 2TMYA 3MD9A 3IVAA 3FYUC 4RD0A 4BVAA 3HY6A 2GUWA 3ESDA 1YZQA 2IVZA 2R00A 2CDAA 3GRZA 1HF3A 4UYJB 3KQTA 1JR3E 3C14C 3LDUA 2WQ6A 2CFTA 5TC4A 4JHRA 1UJ6A 5IJ0B 3P2JA 4HH3C 4QPCA 5B7QA 1PR4A 4B35A 5AOCA 1VDYA 3TZLA 3ZH9B 3CVOA 3DVAB 2UUBB 1I7NA 2HU7A 1GT91 3T9KA 5HQ8A 2R3SA 3GDHA 3KU1A 1AHNA 1NJ8A 2WXOA 2NW6A 3KYCA 4NK5A 1GAEO 4I3GA 3RRBA 3SVZA 4EFDA 4HOYA 5CA1A 4BQEA 3TUZC 4OA8A 3U1VA 1LTQA 2GN9A 2JGRA 3QE2A 3F78A 3MRSA 4B6RA 3ZWCA 4EGFA 1NKTA 2ZRLA 5F1OA 4EZEA 1D2NA 3IAM1 1A8HA 3VLDA 3R3XA 5K3EA 2ZB3A 3ACBA 3F6BX 4HAVA 1OFTA 3DMTC 3PDJA 1EFPB 1CZLA 4YUVA 4MGHA 2O1EA 1YDWA 3QYFA 1YIOA 3GEHA 1E58A 1BOOA 1EI9A 1TVMA 3LTEA 1AMUA 1IVSA 4H7KA 4CBVA 5G05J 3DFIA 4CEIB 3MQFA 5B37A 3T5AA 1NYTA 1JDJA 4Q6BA 1I1QB 1GZDA 1T1IA 1ACJA 2P7IA 1C30B 3ON5A 5F52A 4UUCA 1ZM9A 2X9QA 4BRSA 1PYOA 2MYUA 4D96A 1NP6A 4LYAA 1QZZA 1UPTA 4M4SA 4BKMA 5K0BA 5JHGB 3WRXC 4WNEA 5D87A 3KEOA 1SVUA 1JSZA 1FCHA 1CW2B 2W8BA 1C4OA 2EFCB 1KLXA 5LFAA 2I1LA 3G8DA 3RAPR 1CUGA 3FHEA 1ZD4A 1QCCA 1F7VA 4O1MA 1I3CA 4MGIR 5KWJA 1EFAA 1LDMA 3O82A 3V4SA 2UAGA 4M8NE 1L6RA 3GGSA 4L1BA 1V2HE 2ORED 2GRMA 1C1YA 1PD0A 1X0XA 4FBLA 1U7DA 1J2TA 3R3YA 3ZIDA 3RAFC 5TPZA 1JAIA 4MP8A 3ESBA 1YAHA 4IHAA 1A5SB 4QOIA 1WUTA 3VR0A 4BVKA 2C8LA 2JVJA 5EXPA 1JR3A 2F9FA 5LP6C 4CF5A 3CRNA 1HQDA 1FPQA 5T6BA 5KBYA 3CLSD 1UN9A 3EC7A 1U5CA 5DN9A 1BVUA 1JAZA 2FPXA 4H1UA 4UHDA 2XT9A 2J4DA 2PXHA 4LY9A 3ASUA 4I2NA 4II7A 4O2BA 3F6CA 5KMGA 3T1HB 1P9NA 4Y6WA 1XVVA 3D4OA 3DMHA 3VOBA 3KKLA 4ER3A 5CFOA 3RHSA 2XWJI 3WADA 4B2IA 5BW4A 4MJ3A 2VJMA 1NI5A 3DONA 2P2LA 4PHCA 4DGSA 1DC2A 1O89A 2V4ZA 3ASFA 4HDOB 1JQ3A 1S2OA 5F7ZA 1U63A 1KDVA 3IUSA 4QQRA 3K6RA 5CW2A 3UJHA 3HCOA 3JWGA 2QQ0A 4QJIA 3WYDA 5CFPA 2IY0C 4DDTA 5JZ9A 3OQPA 3CX4A 2WZQA 3I1IA 5IHXA 1P5QA 3AKEA 3JU3A 2X0JA 3TVTA 4G1MB 1XQ1A 3WXXA 2HPHA 5FINA 3H19A 4HTAA 4E07A 1YDMA 3IT0A 3HO8A 2X6HA 3DOIA 3HLYA 3ISMC 2GQ0A 1M2OA 2H7YA 3EDRA 3LO5A 4GQBA 3ZDBA 5KC9A 4L9PA 2RK3A 3PF8A 1WD5A 2HHJA 4A1SA 2XT6A 3NBQA 4JSYA 4YRFA 3VLFA 4GZMA 3UXHA 2ZSIA 2EEPA 4NBLA 2ZAMA 1P1RA 3ILHA 2QI9C 2N42A 3HYSA 3IAEA 4GR9A 4HMPA 4TYQA 4XD2A 3THWB 5D8DA 1Z12A 3UM0A 2LKCA 3KOYA 5FNZA 4ZCMA 1IK6A 2BWJA 1QGUA 1K7YA 4Y18A 2FFRA 1QU2A 2BIFA 3ZHCA 1RYEA 2C57A 2B98A 2QL9A 2XYGA 1BW9A 2ZSHA 2SICE 3THXA 3AUSA 5CFNA 2MMCA 4G25A 2HLNA 6LDHA 3HYLA 3QNUA 1CR0A 4E12A 3OFSA 5JAQA 5FI1B 5HQ3A 3NHLA 4Q4LA 2Q8QA 2VQEB 4AVXA 4RMJA 5FA6A 5CJPA 1AXEA 1E63A 1HBJA 2BDUA 3EGXB 1YZTA 4BFZA 5HTOA 3W34A 3TINA 5JVDA 1OKKA 3L08A 1DBVO 3DD1A 2OZPA 1A4XA 4BNKA 1C81A 1PFGA 16PKA 3F46A 1T5DX 3CUEF 2QSJA 3QVUA 4Z2YA 4DIOA 3P2IA 1ZM4A 5AJVB 4CM5A 2NXWA 3A2NA 3MS2A 4JEMA 1KY2A 4P38A 5HQJA 3W9FA 4TLBA 3ILXA 4WA8A 2VRNA 1QC5B 5BSEA 5K0SA 1ZUNB 1UEXC 4HG2A 2B83A 1IAQA 2XECA 1KC3A 1E7UA 4C3VA 3DWFA 3JZDA 3MRXA 3HSSA 3HMQA 2WYUA 1J56A 4HYEA 3SE0A 4IWYA 2XWSA 1JEJA 2CMKA 3I9KA 4ZREA 3RS7A 3PE4A 1YCDA 2WFMA 1LDNA 1CJBA 1JJAA 2XTMA 2MU1A 3IXLA 1DB3A 3PUZA 1KDZA 2ID4A 5IC6A 4JHXA 4BUCA 1PYGA 1RKVA 1JEDA 4WK2B 2OGWA 1T0BA 1IXKA 1PFQA 2R6GA 4KLCA 2QZ9A 3APCA 1L7XA 2N47A 4RA6A 3RRJA 1LLDA 2WIJA 4IQ0A 3PZ4A 2JBAA 4NAVA 4YLEA 1L6IA 1KO4A 1RI2A 1YACA 1WUHS 5CCMA 2FPIA 2YIVX 3N2GA 3NZEA 2X19A 5HE9A 3UYLA 1VBFA 5JFOA 4ER6A 4GNRA 4FJZA 1AGPA 5ANLA 1E4EA 1MJHA 2AVPA 2B1GA 1C3OB 2B82A 3A27A 1AO3A 2ZRCA 3E7WA 3Q75A 1N7HA 4WFKA 4YMWA 2BW0A 3PRZA 4NATA 3NTVA 2C2XA 1TFRA 5AOXB 1FP2A 3AETA 3EEQA 3UOGA 2BTDA 2YJGA 3KBBA 4N7BA 4GYWA 4P4SA 4HRLA 2B4QA 3JS5A 1DCMA 4Q9NA 1QONA 4CIXA 3D3QA 4JJ7A 4JXTA 2VI5A 2VPTA 5LLSA 1M1NB 3KP1A 4JLVA 6REQA 3ICQB 1KYTA 1QLJA 4DT1B 2NO5A 2XR1A 1OE0A 3NBAA 3A9UA 4KR7A 1WY7A 2FE1A 2VT2A 1XAJA 2ZI5A 1KZOA 1OUVA 3R0XA 1XTTA 4A1GA 1QH8B 5CVJA 3LDAA 3W9YA 4M76B 4LV6A 1XK7A 4EMSA 3MPUA 2A92A 4PWYA 5DV9A 1DDGA 3E9EA 2WWYA 2COKA 2A1UA 2UYYA 5E2IA 3VR5A 5K09A 3AJEA 1X7WB 3CIAA 1YOBA 3V2GA 3GJRA 3KHTA 3DOOA 4KE7A 4YDEA 1J90A 1KRHA 2Z08A 2DQSA 2ZYWX 1TGYA 3DM9B 4RHUA 2VTBB 3EBOA 1U2VG 3A04A 5DTEA 3DBHA 1VPDA 1WEKA 3OQMA 5CBOA 1JEQA 1I7PA 1A5TA 3I5PA 4IIEA 5AIBA 2D7CA 5A9SA 2HREA 2RKWA 3D2AA 3R6TA 4TWAA 4YDSA 1QQBA 1JHXA 1E64A 3VR2D 1E8XA 1R18A 2O7NA 2ECFA 3CUSA 1RXCA 3USZA 3O9VA 4XX0B 4N8EA 1F06A 4LWOA 3EXFA 2H31A 1KU0A 1IRXA 2FKNA 2PKQO 3I04A 5AHXA 3L0OA 3QX8A 4ESOA 5B1EA 1GO2A 1F1JA 1GPH1 1XZQA 4NHOA 2ODWA 1Z9BA 2Y4UA 5IN4A 1DJPA 3FPSA 3NPMA 1AT1A 4TYPA 3ASHA 2FUEA 4LZNA 5A3RA 1LRLA 4N40A 4XQ0A 3RRZA 2IZOA 2WRZA 4NR0A 4OXQA 2B5OA 4P93A 1M74A 4RPIA 3G2LA 3IEMA 4LCTA 1R5OA 3K5HA 4Q9IA 2C2WA 2ZRFA 1E1MA 4Q4AB 4YS6A 3MB8A 4ZCIA 5JO0A 2CMHA 1GAJA 2YDXA 2PD3A 2I33A 3LCVB 1O6ZA 4JJ8A 1I36A 3SEZA 4YV7A 3OWOA 1LLCA 2CVOA 4UM8B 3O03A 4LRXA 5L3RA 5HSGA 2ZIXB 1RMYA 2AFHA 4F8YA 3THYB 1NDQA 1T0UA 3MFYA 3CONA 2APJA 1OIWA 4A5OA 1Q17A 1LQTA 1NY5A 5IJ0A 3U80A 5SICE 1W4AA 1P0MA 4R0MA 2Q5QA 4XDYA 3PXBA 5F5XA 4C0QC 4LWQA 5FP0A 3NWPA 1RFGE 1RZRA 1XPRA 2VSXA 2GM4A 1JR6A 1GPMA 1TZCA 4J29A 4H31A 5FKJA 3JATB 1GD1O 1UP7A 2OL4A 3GDFA 5H83A 4EW3A 5EJ7A 5LD2C 1KL7A 5K8UA 2W7TA 3KM0A 1ID1A 221PA 3QTTA 2OOEA 1GNQA 3ZCPA 4BZZA 1E8DA 4D80A 4BB6A 1WA5A 3HKEA 3OX3A 4LRUA 4UI9C 3H2YA 5MGBA 1MG0A 3BA6A 3PPVA 5L3ZA 1KE1A 1L7NA 3A32A 4COKA 3EC2A 4JNCA 1JZTA 4E3WA 2E49A 3UK6A 1RC1A 4XB1A 3QXCA 1ADBA 3GWGA 1H2WA 1WRBA 2J5RA 1TJ4A 3RDPA 3IESA 4DTCA 4G2VA 2LBPA 1TA9A 3CQ9A 3EZ2A 4MV7A 3WB1A 4ZHQB 1OYVA 2G09A 1FX0B 1YZ3A 2OEWA 1XJCA 4HJRA 4JB2A 5JJCA 2FWMX 4CGWA 5B6PA 3D9QX 5IT5A 3TM5A 4A0SA 1Z8DA 2FPPB 4IVQA 5HMLA 1IVYA 2WWWA 1M2FA 4QULA 5LP6F 1Q12A 4W5HA 3EF0A 3HCDA 5KNGA 1NZFA 2IPOA 1QQ5A 2HXGA 2QY9A 3PIRA 4IBOA 3A05A 1ATZA 2IUEA 5I6DA 1PNVA 3IPXA 3NHYA 3TU3B 2IW1A 3UG7A 2XYVA 1P5JA 2ONKA 3VJKA 3ZS8A 3ZZ1A 2KMLA 5JQGF 1A7AA 4E30A 2QPLA 4GW3A 2HRRA 3UX4A 2OKCA 3BGSA 3HGTA 2GF0A 1T6YA 4FFDA 4IFBA 4KE8A 1PEDA 2C4WA 5A5EA 2KX7A 3ZV3A 3QX7A 1LX6A 2PSHA 1WR8A 1MTOA 1Q0QA 4HRVA 2ERYA 4QBGB 1YUNA 4KN8A 2EG9A 1QYCA 2QVYX 1S2NA 3WLSA 1J49A 3MUFA 4AUNA 3DRAA 5LA6B 1LRKA 3REFA 3BJMA 4LE2A 1U80A 3UAWA 1XU9A 3A1NA 3T3NA 1DXHA 5KYUB 4CMBA 5EGNA 1W52X 3NDRA 2B6CA 1TM1E 1XZPA 3EOBI 3GFPA 4DKJA 1S2LA 1Y1TA 2QRUA 5J59A 1DELA 5DM70 2EGHA 3LFTA 3OQVA 2J32A 3DHWC 3E22B 2WYIA 3ONWA 1T6NA 4TTSA 4UQPA 2QRZA 1II8A 5EP3A 3ZW9A 1KJYA 3HLKA 3PFNA 4D42A 4JJ4A 3VR4H 4MEJA 3RODA 3ZWBA 3U3MA 5C8YA 3QFCA 4D43A 1HT3A 4QKQA 3V7YA 4F4CA 3LS2A 1GQOA 1Z4IA 4C5AA 3D3MA 2Q3EA 2Z1MA 1A27A 4DPLA 4IV8A 4TRQA 1IHPA 3H5RA 1V26A 4K6GA 3PG5A 1S8OA 2ZJ6A 3VKFA 2CHVA 2L42A 1BDHA 1JT9A 3FUKA 2FEAA 1C4KA 5T3YA 4PTLA 5HCIA 4RD2A 1HDZA 5IJAA 1MX9A 1TTPB 4HNUA 3GO4A 1COZA 2KSQA 2YRXA 3RYFB 4GMDA 3RUDA 4GTPA 3N05A 1N3YA 3TRFA 4ZPJA 4IIXA 3K8YA 2IV7A 2GNOA 1J1UA 2F1KA 1Z0AA 3NBKA 1BD4A 1SXIA 2R4TA 3BTSA 4EECA 2BFAA 2I7CA 4ZICA 1EVEA 3O84A 3OY2A 4B34A 1PK8A 1ADCA 3X1WA 2AOTB 4UQXA 2GRPB 1UOHA 4IO1A 2PDAA 4X65B 4N76A 1QIMA 1DFGA 3WMWA 3U4HA 1SFRA 2O8CB 4QOHA 4DC9A 2P9PG 1R0KA 1NYRA 2FSVA 3GK3A 4D4GA 1YDEA 1FFAA 4WH0A 2OORC 4B3IA 4BNTA 1LDGA 3U3OA 5ENQD 5LBIA 2XTNA 4ZU6X 4DL9A 1EK1A 1BE6A 4P0PB 1GN9A 4CTNA 2I80A 5A7FA 2R6FA 3L8EA 3M4ZA 1FYEA 3OFNA 1IM2A 2RH8A 1I9GA 4OAUC 3B20A 4QRDA 2VS1A 1UM8A 3REQA 3HKCA 3MM4A 3BMNA 3JYHA 4UYJA 1MC4A 1CQIB 2C94A 2C4UA 5DYWA 3X1MA 4UXIA 3WK8A 1V1MB 2F37A 5AQEA 1E9SA 2VYNA 5H7PA 4GPKA 1Z6ZA 1T26A 4MDYA 3CE6A 3F73A 3G6KA 4EG3A 4DF3A 2JLZA 2FPLA 1TD9A 3FI9A 3VFDA 1R9MA 2ORVA 2VHJA 1FPPA 2XB4A 3K94A 4G37A 3F1LA 1PBNA 3HP7A 3KBOA 3SJ7A 2D2IA 4IZHA 4WUTA 4QXQA 4BTBA 1FFBA 3V2HA 2QUZA 3EQ6A 1VXRA 1QFYA 4GTVA 4GOLD 2CVHA 3GJ3A 4NBTA 5I47A 5BYAA 2VPWA 4MUXA 3T9BA 4YC7A 3T1QA 5I7EA 4IMPA 4IRXA 1FTWA 2JVIA 2WXIA 4DAEA 3QF4A 2H7CA 4Q4HB 4DMHA 5ICGA 4FZRA 2IY9A 1T3GA 1EU1A 2XADA 3GLFB 4NY1A 1N2XA 4DQXA 2F1HA 1H1LA 4ILKA 1XB2A 1V1JA 4GOJA 4ZQFA 4I1SA 4GYJA 4FFPA 4FYHA 3TK1A 4TN5A 4LRSB 5I7OA 2ACVA 3KNZA 3LL7A 5LQSA 5JI2E 3KK0A 3R7AA 4M1KA 2HO5A 4QASA 2P75A 3G89A 2C59A 1DKNA 1J70A 3OZCA 2GRLA 1GGHA 3P0HA 4B82A 1AQNA 2AVNA 3T7KA 4HAUA 2WSBA 3KETA 3SNHA 2ZAOA 3ADKA 5KWSA 4AM9A 1KYVA 2O3UA 5E76A 2XMRA 3NFYA 4RZIA 1IM5A 2QKYA 2UUOA 3DNFA 3W6OA 4BV8A 3M4NA 4YPOA 4I1VA 2DWZA 1IK4A 3DVQX 2ZYVX 4HEA6 3NKLA 2IKSA 2YIJA 4TS1A 4C7XA 4GECA 4ZFNA 4BBZA 4YWHA 1VL1A 2C8VA 4N2QA 1K0UA 2R48A 3G2JA 3GAAA 5A3QA 2EP8A 2Q5FA 3SFZA 1DIGA 1R9NA 2NZVG 1Y33E 2FWBA 2VSFA 2ZIFA 3BTVA 3PR1A 1GNPA 1NOIA 1SUSA 4A3VA 3O31A 5COQA 5EG5A 1UP4A 4A2WA 1H2VC 1W9MA 1R8SA 3EXIA 3OWXA 2ZRIA 4IUBS 2X0FA 4C48B 5TJ9A 4D9IA 3DZJA 3Q40A 2X22A 5GJVC 2GTIA 2YJZA 4JU9A 4O59O 2FW6A 3UMYA 3V8NA 2P9LG 4JI1B 4NVRA 2UYHA 2ZKLA 3HXPA 2OV8A 5JROA 2HHAA 1SHZA 1NF2A 1GTG1 4M2LA 2V3WA 4M9UA 4QGBA 4Y0VA 1B8PA 1GRRA 3VDRA 4XDGA 4DSOA 3ZVNA 3H42B 4G07A 2AB0A 2DHQA 2I6GA 3MHPA 4R83A 4WCFB 3ZBTA 4A0FA 3RKSA 4KLZA 4BGDA 1E5XA 5E6RA 2QE6A 1PQPA 1QRRA 3WLPA 8ADHA 2HC9A 4ZOLB 5GTDA 3HCNA 4QYSA 3I0ZA 5CX4A 1W4LA 2OFOA 5TV2A 4IXNA 4AMZA 1IHDA 5CCEA 3PR2B 3UPVA 5DBKA 4FX2A 1F20A 3NDBB 4WOCA 2VSXE 3IEUA 4ARVA 3QJZA 2C0LA 3SD5A 1X1QA 2DKFA 2PMCA 3VU0A 1F2UB 4PINA 3W2EA 3LEWA 1JR2A 1GPJA 3GRYA 3DTYA 4B8AA 2QN7A 4YFYA 3R7LA 3D6JA 4D97A 1G20A 1GCUA 4IJQA 1T5IA 2ZM5A 1D8DA 3ECCA 4F2DA 2NZXA 1Z5SC 3LKZA 4JB3A 1YI8A 3GZJA 1Q1AA 1UIRA 4ND8B 2ZJZA 2CC2A 4ZXFA 2ZRDA 1IHBA 1UFVA 1P7PA 2BEJA 2ZS9A 4P9NA 4DPKA 2GB4A 5IDQA 3SX4A 3CK9A 4CDNA 3C39A 3FFBA 5DE3A 5JZOA 1QIFA 3K96A 3LCUA 3ZYZA 1U0BB 5B1HA 4XXHA 3KJFA 3MKQA 2CVQA 1IOZA 1FLVA 2Q7DA 5K0CA 1UK9A 2I3AA 3ZI4A 4KQJA 2XTAA 5MN6A 3WLEA 2FG7C 4YCNA 4JOCA 3U6KA 2YOHA 2HN9A 3ETLA 4Y6CA 1FLNA 3WIBA 4TWRA 2AOUA 3DMYA 5JNRA 1DQRA 2E2EA 4K0RA 3G2NA 4LK2A 2A5FA 3O91A 5KQPA 1WHTA 1KHTA 4Z51A 1FXUA 1TF5A 1PAQA 4U0ZA 2IHUA 3SG0A 3AL3A 2OA0A 1BI8B 1LU9A 4HRYA 3TNFA 4IEIA 3O2NA 2IK8A 1W8DA 1GZ4A 1C7ZA 2ATXA 1H22A 4B3DA 2WE8A 1K63A 3MWEA 1NX6A 3H16A 1GGFA 1ZI8A 4L4YA 2H48A 1T36A 3SEQA 3BDAA 3DQPA 1V35A 2H1WA 3A1WA 3S3TA 1QZTA 1W581 3ID6C 5C8YF 4HNAA 1XZJA 1L3IA 1IXVA 5CLQA 4KSYA 1X80B 4MI6A 3FBGA 5EMNA 4NIMA 3BWDD 3QAQA 2CBXA 3ML1A 4AJ1A 3UMGA 3VMFA 4JBLA 1QB7A 2WM3A 5F33A 3V7WA 4JC0A 3K9FC 1L7OA 3NEAA 5DHTA 1V4VA 2H08A 1GJRA 3A6EA 3SQOA 4A10A 4KXVA 4YCJA 1XZMA 4ZP1A 1C9YA 4CL3A 1V6AA 4P1ZA 4FCTA 2DLCX 1KPIA 4JKOA 4CM6A 4HWOA 3OD1A 3QUBA 3T94A 1ZJ5A 4EYSA 3K72B 5AK0A 2P6UA 5JANA 2C0CA 1DDIA 4PX3A 1P2TA 4MUAA 4DLLA 1GPYA 1W1WA 2OLEA 1LLUA 5CB4F 2I6HA 1AC5A 4ANUA 4CI9A 1RKBA 3F0TA 4PC3A 5DF1A 2FFQA 3R5SA 4BN0A 3FOFC 5BV0A 5I48A 3VNRA 3PEUB 2IDJA 2BMAA 3WB9A 3RUEA 1EEHA 5F4BA 1I5RA 3BRCA 3AJAA 3MF4A 1ZNQO 2XITA 1THMA 4DX5D 3EXHB 4Y2HA 1OH5A 5CCDA 3X1DA 4INZA 3QUCA 4DUGA 3HKBA 1F2UA 2D0PB 2MSCB 5ADUS 5E4JA 6AT1A 5AVQA 2VUUA 3HKDA 4GL2A 2P4HX 1W0JD 1K1AA 2GJ9A 2Q1UA 3FJOA 3FOWA 3JW8A 1HLGA 2CGEA 3ZJVA 3DC2A 1RXEA 3T5PA 4ZOLA 2MYTA 5ARDA 2QK4A 3KYDA 1AQYA 3RSZA 2WD7A 2FQXA 2P65A 5B2EA 5A2GA 3LT5A 3PZ3A 1FTSA 1Q83A 3ODPA 1KMMA 1KK1A 1M6WA 2QIPA 2WIGA 2QUJA 5KJEA 4I1OB 2QRPA 3GA0A 5EIEA 4BFVA 4L3WA 4IGIA 4YECA 2QN8A 1FVOA 2GVDC 1ONPA 4G0NA 2IZ0A 4CG0A 2ZJFA 5E75A 4P3NA 3ZE2B 4IZOA 3WNZA 4C9BA 4DPRA 3AR2A 1R0RE 3NDIA 1ZVQA 2P9TA 2FRXA 3GPLA 3QBVA 5EJAA 5HS0A 1PZNA 1KZHA 1NQAO 1NPYA 4HMOA 2RONA 4A6PA 2HK6A 4NBNA 1X70A 2XEEA 3DSTA 1UEJA 2IYQA 4JT2A 1H6AA 5KTMA 3WO0A 4DCUA 3UB3A 4GOOD 2CB0A 2QP3A 4FEYA 5CT5A 1LQ2A 3TDMA 1UWCA 3INYA 1PV4A 4E0BA 1PDVA 1UF9A 4BX9A 2WXJA 4B7UA 4D46A 2VTBA 3NHUA 4GP9A 3FOAA 3BRQA 4HBZA 1LK7A 2P35A 3B85A 3COYA 1FP1D 2P4QA 1P6XA 1SXPA 2PS9A 1XZDA 1H2UA 3G8AA 1SVOA 1NI4B 2IYPA 3H9BA 4QREA 4BMPB 3BAZA 5FT9A 3H11B 5HZKA 1ZCBA 2XPIA 3KKOA 2P27A 4A16A 5TX7A 5A02A 3PC8C 3KYBA 3OJOA 2IEAA 3HG7A 3OEED 5DGDA 3KZCA 1RWNA 1X7XB 3VSAA 2BKVA 3R3ZA 5EIBD 2QM0A 4IDAA 3U44B 1HXHA 2JFUA 3M33A 4NL4H 5F12A 3OKCA 4BNYA 5DLDA 1N5KA 1E7QA 2XDWA 1YR7A 4F12A 1HETA 2CVFA 4O3MA 2WSSD 4WE3A 3BB3A 1XCLA 3QVKA 5KQGA 4ZARA 3HK2A 2YXPX 3KZOA 4B2PA 3DJFA 4LQCA 4PQFA 3NX4A 1JIUA 4GF5A 1H1DA 4N7RA 4XYBA 1ZISA 2G08A 4L6CA 1EM6A 1Z2EA 2YV3A 4AY6A 3LUKA 1ZU4A 3PUJA 2HIMA 3HP4A 3OLQA 4JXJA 2GXQA 4AQ7A 2MR5A 1Z75A 3V2IA 5DWQA 3W5SA 3O1JC 3OCVA 1B6GA 4XYGA 1O03A 2V03A 1XEXA 3TNDA 3JYOA 1TLLA 1ELWA 1ZU2A 4C2TA 1O9BA 1R50A 2DH6A 4JIGA 4RKEA 3LHFA 4D1YA 3IB3A 4WBNB 3LFHA 1PJ8A 1UW4B 1KOJA 3QFTA 1JLMA 4AIRA 2CMFA 3ZKWA 1NDUA 4MGKR 1C0KA 1GZ3A 3S44A 3IUJA 5BRJA 2NLOA 4JWKA 5CHYA 3JRNA 4ZK2A 3EEOA 4B0PA 2ATIA 1KMHA 2BUBA 4C6TA 3R6GA 1HDEA 3U7RA 2HQBA 3P20A 5CVDA 4X1IA 4KPFC 3ZPXA 3KAPA 4LBWA 5DT9A 3VPHA 3A14A 4KN9S 2KBXA 3CZAA 4DLPA 3UUWA 1SWWA 4AKSA 1OTYA 1ESNA 4E5UA 5JBIA 4L0CA 4YNDA 1R4MA 1JB1A 3EDCA 3C7DB 3WKDA 1DNPA 4V0SA 1IB6A 1WQ3A 1Q77A 3RSCA 3OKPA 3UJBA 4IHQA 3NETA 2W42A 3CJTA 4LXHA 5EE0A 5CG1A 4X0EA 1BFDA 2FE4A 2R1TA 3EAGA 4EI9A 2BDEA 3LZCA 1S1MA 4OYSA 4YUZA 1M6YA 4CGZA 2PQ6A 3CGWA 3LCCA 5K7SA 1WXIA 4Q3CA 2OG1A 3EGXA 1QFXA 2X5OA 4IZ6A 4U9HS 4C6TB 2Z09A 4GA2A 4QFMA 4Q96A 3IBEA 3WTBA 3KVOA 2X1MA 1YGPA 1RADA 1NQTA 1UBOS 2VNJA 4UHHA 2R9VA 2I34A 2AQHA 1ODCA 5SZJA 4U7EB 4QLAA 2XUHA 3T9DA 3T38A 3G0IA 1QX3A 2H57A 2VIIA 4ZC1A 1XTVA 3ZUGA 3CVNA 1LSOA 2HR2A 1BI7B 2ATVA 2JIZA 1KJNA 3FB1A 1TU0A 5A5DA 1WBBA 2VOJA 3PEVA 1YKSA 3KALA 3UCEA 5EE3A 3S28A 4POOA 2YS6A 2R751 1E7RA 5CEEA 4GTTA 1J2RA 4HGZA 5BOVA 4GI2A 3VPBA 1ZC3A 1DAMA 2BBTA 2OCPA 4FHZA 3PK0A 3VTFA 3FUHA 1ONOA 2FRDA 2BFPA 3OQIB 4MWBA 2XXAB 1R8XA 4NE7A 4DE5A 4NU8X 5BXUA 3ZY2A 2DBYA 5E9WA 4FT2A 4NRHB 4QHYA 1DOHA 1HLDA 1LBSA 4DBLE 1B93A 4D8VA 3U19A 3EPHA 5ILQA 3QYAA 1PFWA 5KVVA 2ZUEA 4L4RA 1Z33A 3FRJA 4DM3A 5L3VA 3RM3A 2XUGA 5ALWA 1DTSA 4FBMA 4B8WA 2HRBA 3AY3A 4IM7A 2JDID 4Z3KA 2AQKA 1UXGA 1DUIA 5FI0B 4DLXA 1WXWA 1FP7A 1I3LA 1YA4A 2YH2A 3EGVA 3HBMA 5LB4A 1A2KC 2W4MA 4A8PA 4B8YA 1GRCA 5FOSA 3FVTA 1L4NA 4H7JA 3HIZA 2WFZA 4NMHA 5CBKA 1VGRA 1YD7A 2J0UA 4U6SA 1KA9H 3CQCB 4I66A 1US8B 1CS0A 1BX0A 4KC0A 4JJ6A 3T1NA 4CLOB 3W5AA 5C18A 3IJPA 3RIBA 4N82A 5DHFA 1X1AA 1JI3A 2AG1A 4QQIA 3KQMA 2JLYA 1NRJB 1W7AA 4FLEA 4U2DA 1AKYA 1NNSA 2IFTA 1G3MA 2GA8A 3GMIA 4KFTA 5CCXA 1ESEA 4BPBA 4ZOEA 4DR1B 5JW6A 4FT4A 3KJNA 1V9LA 3ULKA 5ISMA 4ARUA 1B23P 1NJGA 3I4CA 1QRAA 1QLHA 2DBQA 3GH3A 4U2KA 4L22A 1E2UA 1K8ZB 3ZCVA 1IZZA 5AXAA 4FVTA 1SO8A 3KLPX 3TZEA 1T8RA 1YK1A 2F3QA 3EVDA 3LX8A 1E8OB 4H7PA 2BFWA 2GDJA 4HDSA 4NTZA 4C7BA 5LVAA 2WDPA 2ZLBA 5E2BA 1VIAA 4QGAA 3EC1A 2NYVA 3Q2KA 5HRYA 4YCBA 4WDQA 2G07A 4HB3A 5EWLA 4JASB 4B5LA 2Q2WA 4HI0E 4JOSA 4RDCA 1C30A 5JNVA 3PXAA 2PUVA 3WJ2A 1IY1A 2XWPA 1YYHA 1MXFA 4M88A 2I2WA 2BKXA 2VZ8A 4O4JF 5IW8A 4TWZA 1OLOA 2G9VA 4BTVA 5HKKD 5IUNC 1IBLB 4HNQA 1XDUA 2VPXA 3IBSA 3SX2A 1FMCA 1EFPA 3NP9A 4BWVA 4LSWA 4AQYB 1Z7YA 3JXJA 4KVGA 4R9UC 1ZFNA 1AXRA 4BZWA 4KO2S 2P2YA 3ND9A 3IOCA 1SCBA 3WG7E 1XMSA 2CXRA 2ODQA 3LBNA 5LDGA 5IFKA 1EIZA 1P0QA 1GZ6A 2QVBA 3IAFA 2DEUA 1NDHA 2GSWA 1QJCA 1S2IA 3PIDA 1RW2A 1H0RA 2G0NA 3WQRA 4I1RA 4BP3A 4XSGA 3L0IB 3WGZA 3WX0A 3BDVA 4P2BA 2OK8A 1AMOA 2I0FA 1U7XA 2H07A 4DRXB 4MUIA 3IH5A 4MPDA 2E89A 2IYSA 3S6JA 1VKHA 5ERXA 2QN1A 1GUZA 1T2FA 3REQB 3ZDRA 4EYQA 1T1SA 4ZQCB 2F62A 3DH0A 4ZI2A 3I64A 1NU6A 2R1VA 2ZRAA 3KUDA 5G05C 1TAHA 2NYAA 3ANSA 1SNYA 1NOJA 4G8CA 4U1RA 1NI1A 2XCLA 4J8EA 1YAJA 2ILTA 5E7JA 1SVSA 4N3CA 4FE3A 4OUKX 4GCNA 1BWPA 2Z6QA 2CG3A 3O0DA 3OPQA 1EDBA 2VF8A 1OFHA 4OO3A 1IEQA 3F3SA 2O4UX 1BWQA 1FY2A 3RU2A 2UXCB 1BDBA 1SJ9A 4OG2A 5F1KA 4PYKA 1H66A 3EQZA 3FBWA 4H1VA 1EXVA 1BD8A 5IMSA 4OB6A 2OLJA 1ZB1A 1YCGA 3CCCA 4DK5A 1G64A 1T3ZA 1ILWA 1XMPA 3JAWA 3L7CA 1V3VA 4IS3A 2IPNA 4BXOB 4QXOA 2GOYA 4II3A 3PNLB 5FR1A 1LEHA 1EX1A 1EUYA 4G24A 3UATA 3H0EA 4CTJA 3ELUA 1IN6A 1HV8A 3T06B 3GEDA 3NWBA 3VO1A 4HWTA 1ZHHA 3EH2A 4YIKA 2RCNA 7ABPA 2KCKA 3CKMA 1SOMA 4XX0A 4INAA 4JQZA 3ESCA 1I9CA 1ACLA 1Q0TA 1N2ZA 4C6HA 3G79A 1IHYA 2V58A 1TOAA 5LD2B 1KRXA 1WS6A 2G83A 1JNZB 1FUUA 1SZJG 2ETVA 4S35A 5KVQA 2ZE8A 1VPWA 1ZITA 2BKEA 3D8BA 5ALTA 4R9NA 1SA0A 4NSNA 5DYYA 4GAAA 1Y7HA 3T8MA 3VR2A 1BXGA 1LLFA 1WX1A 1Z4JA 3KJZA 1YRYE 3N86A 5FLXA 1N8TA 4FNOA 3R9AB 3DUFB 5EHIA 3V4FA 2QMZA 4WJZA 2AQIA 1DKMA 4DX2A 3E4CA 1QP7A 5EN4A 1JG1A 2VP3A 3ELWA 1ONBA 1EQ2A 1A82A 1J5EB 1TN7A 4UCXA 4UM5A 2YW9A 5CNJA 4ENVA 2ZCJA 5ALPA 3CE9A 4KQ2A 4EHKA 4CIWA 3M70A 4Y9SA 3I53A 5AH0A 1K2VN 1II8B 5JAZA 2J49A 1QBKC 1YBAA 2BM0A 3PD7A 4QE3A 1VIMA 4CQLB 2C5EA 1N25A 2JHFA 3OQ1A 3WJ7A 3H1FA 2YRFA 4P22A 1JTFA 2XBUA 3I2JA 5I7FA 4J16C 2OLKA 2EBUA 4RORA 2YY5A 3CUYA 5FNVF 1BMFD 3IE0A 4LWPA 2AZDA 5LIRA 2BGJA 2PL1A 1QP4A 3V8QA 1NN1A 4WMLA 2G88A 2I7XA 3DGFC 1OU4A 3R20A 5AVVA 3EN0A 5AQ7A 2HIGA 3TW4A 4EY8A 1P4SA 3J7AC 2J3LA 5FQ8A 2QVXX 1VL6A 3EFHA 4TSFD 4CZ2D 3K0CA 1U2PA 4WKNA 2Z95A 5DLYA 5HTKA 4YT2A 1NXTA 5JPDA 4UU8A 1YJAA 2AE2A 3R5XA 4J03A 5FJJA 1JE1A 3V1KA 4U0UA 1Q91A 2ODTX 2WTEA 2PKWA 4L8VA 2Y4NA 3HI6A 4QBTA 1LD3A 3HZOA 4I2VA 2AMFA 4WOPA 3V2UA 4CV3A 4D3YA 4DWWA 4I81A 9LDBA 2IS6A 3PQ8A 5C5IA 2FU5C 1TCAA 4IG4A 4P86A 2FFAA 4OVKA 4NACA 3TXNA 1BH2A 1LC3A 4DSAA 5TEVA 5T8KA 4K1XA 3OE4A 1BDJA 3QWPA 1PWZA 4YO7A 5HE8A 1PTKA 1XMXA 3HRIA 2BPOA 4ZVRA 1FUEA 3LGXA 3HBAA 1H93A 2QVCA 1GW6A 4J6IA 2DCUA 1GLVA 3HS3A 1KYXA 2I9PA 3AL2A 5EPOA 5CDUA 4Z4QA 3DDZX 4KR9A 1SHJA 1A4IA 1MZCA 3MQ2A 4EBBA 2QD5A 1U3VA 4KEAA 2X8JB 4TZ0A 2IGBA 4JITA 5TVGA 1Q7RA 1E3WB 4A5SA 3I3SR 3OX4A 2YOFA 3V7UA 1JKMA 2XMZA 4J1QA 3P9KA 2PS1A 1YB1A 4QVGA 1VJRA 2IPAB 1DKRA 2E5WA 1BRMA 1FDWA 2C2YA 2I1QA 2ZEJA 2P2NA 1LDYA 2OHHA 3HCRA 3R0QA 1MOPA 4MYTA 1QAMA 4HLEA 4MW0A 3SHWA 5I51A 2I78A 2REXB 1OGYA 2HQSA 3EJWA 1SQ5A 1EVYA 2JB9A 2XUJA 3C8HA 1JHYA 3F9CA 3KJGA 4TMWA 4UNQA 5KBAA 4F53A 1WF6A 3K9QO 4L02A 1DTEA 3O8DA 4NLLA 4Z2AA 2EWWA 3UAOA 3KVYA 2W0MA 3GPCA 4Y2VA 5CEAA 1MIHA 4LSMA 1KEUA 1O8CA 3OC6A 4HN9A 2PMFA 4ZYUA 2GPWA 4FDUA 1M67A 4D82A 5EJMA 1LI4A 3R3SA 1ODJA 3QFSA 1CDDA 4YJ3F 1PFYA 3PLRA 2R8OA 4B46A 3DYIA 1V16B 2YQ5A 5H9WA 4YJDA 3ZHYA 3TW6A 1PG2A 5DMXA 1Q22A 3FYHA 2ZUFA 4RETA 1H9CA 3KTDA 1Z73A 3FPHA 3UUFA 2ZRBA 3RFUA 3G5TA 3GVIA 5ITSA 4K3VA 1M10A 4KIWA 5B58C 5C8ZA 1T8PA 3ZQ4A 1OY3D 3F2VA 3U7QA 1J99A 5AI0A 4BGUA 5HZMA 1Y1SA 3RVLA 3AU9A 1WW3A 2CHFA 4W7IA 3PNTB 1JUDA 4H18A 5HJ7A 4IOKA 1T6BY 1RPAA 1JHVA 2Q4RA 2XCIA 4LX0A 3VNAA 4KYIB 4EB6A 3EIFA 3KEQA 4Q00A 4YDQA 2C7QA 1G7CA 3K8QA 3ZTWA 1E7WA 2ZIGA 3NVAA 3DZDA 5AVWA 1SU4A 5DRYA 4UKDA 5C1OA 5C35A 1T0IA 4FM9A 2OSBA 1UBTS 2OO5A 2V4UA 3D6NB 3L79A 1AMNA 1UUFA 5LMNB 3CBQA 3AY7A 3K1TA 3KJHA 3N6RA 4YRNA 4IXWA 3N0VA 3CR7A 2VHXA 3DBHB 1RWBA 4CVNA 3K0BA 4QYTA 4F3RA 4G1FA 4Q48A 4DM4A 3WWPA 1CK4A 3NJ8A 3UV6A 2PMDA 3ZS9A 5HRAA 1OZAA 4YV1A 1ZOPA 2A4MA 3ZHEA 3VH2A 4NBRA 5LOZA 2ZQYA 4IUYA 1UMCA 3F4KA 5AT1A 4TXMA 2WPDD 4ZMBA 5LOVA 3Q3EA 4YAWA 2DMRA 4W5TA 3RAJA 2JI7A 5H02A 1LSJA 1Q2XA 5J63A 4A8JB 5HKAA 2FLWA 5ITZB 3IAHA 3H7AA 1CVLA 3K53A 4TKZA 1L1FA 3WGJA 4BVEA 3ETNA 2BGUA 2X9LA 4GTMA 1I0IA 3K05A 2W6OA 3FVRA 3O4GA 5LR6A 4XVUA 4TMKA 4X24A 4WWPA 4NYMQ 3BT3A 4N0PA 3HB0A 3UB4A 3UK2A 4MDEA 4QX6A 3DDOA 1RZVA 1EZ4A 3OZFA 2BGNA 4MYUA 4NZZA 4RNDB 1BOFA 3CNHA 3BERA 4K0KB 1PQYA 2GO1A 3TLEA 4IO0A 5G3YA 3L04A 2FW1A 2PTGA 1C1HA 3TOXA 2J5XA 1P0PA 3EDQA 3DEKA 3H9UA 2C3UA 4HLLA 1E6UA 1C3OA 3RS2A 2WPNA 1YFZA 3U4GA 3M3HA 2LZ0A 3TTVA 5B6IA 2QG6A 3IA2A 3PHBE 3IDQA 4HZUA 4Q47A 3WWEA 4U2EA 3UH1A 4AX8A 3U4QA 3GT7A 1Q1BA 1ZM7A 3FOBA 4X6LA 2NADA 4RV5A 1M7GA 4WZAB 2X6TA 1RJDA 1ZR4A 4U63A 1E8WA 1LJ8A 2QTLA 4EAAA 3Q8MA 5INTA 1EZZA 1CUXA 3WLOA 1IPHA 5BSKA 1SB9A 2HRQA 3R3WA 4DQUA 3PUXA 5EE5B 3MZ0A 4D0NA 3VU3A 1DXQA 1GGEA 4RULA 3FU3A 1ISJA 1HFKA 2X9GA 3NWOA 4BP8A 1GPDG 4P5PA 2OZVA 3AGQA 3LH5A 1ORIA 3Q15C 2GBPA 1A0OA 2WTBA 1I5OA 4CIAA 2CN1A 1B8NA 4BU1A 2J08A 1J00A 4D3DA 2W2QA 1NVUQ 3TW0A 4F46A 5E3JA 4WNAA 3QWIA 3HB4X 4JJGA 3D6FA 2OAP1 4X94A 1NVVQ 3MBIA 4H7IA 1F6WA 4L8LA 3LJNA 4PYOA 4URWR 3GLSA 5AJUA 4BMNA 4U5XA 1KEVA 1DBIA 3BM5A 1TEZA 3MMPA 1FFEA 2WMYA 3DV0B 3IPLA 2KC7A 3UM1A 1W3BA 3QVJA 4WZZA 5JVDB 2EFDB 2OGZA 4ACBA 2HDNB 5FHRA 2BM1A 2L18A 3M1YA 2IA5A 1P5FA 3ZI7A 4PO3X 1N1GA 2FCAA 2A9QA 3VU8A 4PGFA 1KGSA 1OVGA 3RO3A 1OC2A 2IXDA 3GD7A 4PSCA 4YDOA 4EHMA 1D5WA 1A17A 2CF6A 1UKYA 1WCYA 1YONA 3K35A 3R7QA 2CLKB 2QFCA 4GZ5A 3V2XA 2VJNA 3WHIA 3AOGA 3H9JA 1BGXT 5AVTA 4DFDA 4YXWA 3SQVA 2IXFA 2XDYA 1ZL2A 2ZSAA 2D0OB 2FDCA 3ASGA 2XB6A 2PS3A 3P0IA 4LPSA 4UNIA 4E2YA 2ZJ1A 1UZMA 3DAOA 2RGYA 5B1IA 4FR5A 5KB3A 1ZMRA 1I3OA 3ZHRA 3FTZA 5EE9A 4DYDA 1KO7A 2I2AA 1L8OA 3O2QB 1RYHA 2Y9MB 3SJUA 2VTVA 4NQRA 4C01A 1B1AA 1ECJA 3W79A 4AN1A 5C32A 1CEEA 5JS1A 4WNFA 4ZQGA 3F71A 3K9GA 5AHRA 2GPTA 1AQUA 1RXUA 5AHWA 4B7ZA 4TPKA 2J59A 2NZWA 2YC2C 4TQUS 4MKRA 1YNOA 3NKFA 3VTKA 3UO8B 5E6SB 5HX7A 2V3CC 3NYIA 4KIJA 4OUDB 3V9AA 1K7FB 1ZH0A 2YXLA 2A1TS 3NIBA 2QT1A 2C9ZA 2IZ7A 2PXXA 3JVUA 4OOFA 4BRWA 5ICCA 2CLCX 5LZ9A 2JBHA 3OAAD 4YDHB 5GIPE 4FFNA 3RVSA 2YR0A 2YWJA 3EWNA 5NLLA 5DNYB 1CUJA 1VRVA 1STOA 4UEJA 1QYIA 2JNWA 3S4YA 4UWFA 2QNRA 1QBGA 3TLKA 1E4OA 5HUHA 2ZRKA 3EXFB 3PYXA 1CSEE 4Q9LA 3TCXB 5ITZF 5KTYA 3MKQB 3FZYA 2CD7A 2GBCA 3PGLA 4IYRA 2WM9B 1B1CA 3EYAA 2A88A 1L4YA 2QE7D 1JG3A 3SX0A 4GX5A 4HDSB 4KWTA 3ZR4B 2F9MA 2UUPA 3C1OA 4WK4B 3QPCA 2EJUA 2POCA 3ABIA 2XVAA 3RU7A 4QFVA 3OXLA 3V8RA 4CKWA 4XM0A 3KOWA 5B7GA 5F77A 2G63A 2FI1A 4ZAFA 1NY6A 5JRDS 1ZNWA 1AZTA 3RVDA 1IY9A 2IZZA 1GZ5A 2Q8NA 4LFCB 5FBRB 2GVNA 2OAQ1 3EIQA 2VWHA 4RZ2A 3STHA 3U9WA 4EZJA 3GMDA 1BEUB 2AX3A 5EXXA 2IOQA 5JQWA 1GUYA 3G0HA 1NKVA 2Q45A 1MB0A 2CLEB 3I8OA 1RWWA 4H7HA 4IIJF 4WGGA 4PPQA 4L50A 1RDFA 4ON9A 4ARZB 3GT0A 5EXTA 2FEPA 3GNQA 1XL0A 3GJTA 3EWAA 3SAJA 3F97A 4DBZA 5HZGA 3LYLA 2PSEA 4WBXC 5FO1A 5ENOD 2KI5A 2OCBA 1SW6A 3ZZMA 4G8KA 4EPTA 2UUAB 3ETCA 1CYDA 4R3NA 2QL5A 1P45A 4RWEA 2AN4A 4GG1A 5EP2A 3JQFC 4MVYA 3WFJA 2ZGGA 3TRHA 4ZCRA 5K99A 3EF3A 4DJFC 2PEYA 2KWIA 2HJVA 3F6EX 1EDEA 4FYYA 3VR3D 4XLZA 4Y6PA 2A5GA 2GAJA 3EE6A 3IVCA 3HXQA 3EJNA 4P4UA 4PLGA 4OJYA 1ODKA 1DAFA 3ZV6A 4PVDA 5CDFE 1LXCA 1E2KA 2G5CA 2NXJA 3DKKA 2PGAA 2CK3A 2GSDA 3MT9A 4X45A 3A31A 2PLRA 5CAEB 4AOFA 3G0OA 4EARA 2QY7A 2XI4A 3AMVA 2X5JO 1JWAB 3HRKA 3NU1A 2QTFA 2EIME 1G42A 4PLFA 3UC9A 1ADJA 2Z2IA 1N95A 2ZYUX 3DFFA 2XZOA 1DSSG 4AO7A 4BBAA 4O3FA 2YHSA 4NCJA 3TD9A 3CRZA 4NZPA 3P9QA 1R7RA 1K86A 4I4TF 4KPUA 3CLUC 1CY2A 2FYTA 5B4TA 5BVGA 1BQEA 4ZVUA 2PUEA 1GAWA 3K9NA 1B26A 1VFPA 2JAXA 2QTVA 3ZNGA 3PE3A 4GP7A 1PDWA 1F12A 3EWSA 3L0DA 2WXHA 2PUAA 2QZZA 5JZBA 3ZBQA 3ZIMA 1G3QA 4X1YB 3DT9A 5CXQA 4IGFA 1E3MA 2HPVA 2V59A 3C3JA 3KQWA 5H81A 4ZQHA 5K3CA 4EB0A 1UJCA 4LN1A 3RVKA 1KPHA 3FDJA 4MH0R 4A23A 3J80A 5C52B 2CKMA 2PX2A 3H1PA 2FPOA 1A9PA 1YA8A 3M6XA 4KVAA 4LJ8A 1TQ2A 4XM1A 1XOIA 1BHJA 1RAFA 3Q3GE 4FQ5A 1Y9EA 2DFNA 3O8OB 4NABA 4G5FA 3SKVA 1SCAA 5CR9A 4R7GA 4F7AA 4AJHA 1GU0A 3DEHA 1XCPA 2GYWA 2ACEA 1ZVJA 3IBFA 4NCHA 1ZSYA 3ABLE 1B00A 2KE5A 3OTNA 4AJIA 4TLDA 1XZIA 3ZU4A 3LHKA 4A8JC 1M0SA 3R3UA 3S81A 3AJ8A 4DQVA 1QMGA 3FYTA 3AHGA 4L9RA 5U9CA 3IKMB 2YHIB 3LLMA 4E2WA 5DN6A 2R8ZA 1N2CA 5KOYA 4YI3A 1R6AA 4FHKA 3L84A 4G4JA 1MENA 5FUMA 3Q49B 2WF6A 1S2DA 4NEHB 2H2DA 1PFKA 2VRCD 3Q85A 2HYIC 2Y67A 3E23A 4XVHA 1H2RS 1EP1B 1RWVA 2O23A 1NUAA 3Q8KA 1DC4A 2CBGA 3HSYA 4YT4A 2OAGA 1TYBE 1ADFA 2Z3WA 4MP3A 2R7AA 1E1NA 1CEYA 3C5EA 4O2AA 1S64A 4HK4A 1QC5A 3RW9A 1DARA 1PLJA 2D3WA 5F9HA 1G98A 1KH3A 2UZAA 3JR3A 4HDKA 4NH4A 2O0LA 3WK6A 4CKYA 1G4UR 2GN8A 1RXIA 1KQOA 4BE9A 4LF7B 4BT8A 4DSZA 2ZK7A 5G0SA 1KVUA 3UY4A 3ZHZA 5LMZA 3KEAA 3O73A 3K70C 3AEUB 1VPTA 5B7NA 3D3JA 1DEHA 1X1CA 2I6QA 3IRUA 4N5DA 5LQMA 5AARA 1M34E 1Y4UA 4Q5IA 1AV7A 1I6WA 1BGVA 5AWFC 3O8QA 3I12A 4KREA 1P33A 1Z18A 1AB5A 3BE6A 3LYUA 2I4RA 5FFFA 5IN5A 4D9JA 5CB6A 3U39A 2VJYA 3I1JA 1VZ3A 1WCWA 4WRRA 3I9OA 1MA3A 4WLVA 1PQUA 1KXZA 2BFNA 2XKJE 5J9FA 3LSYA 1U8FO 1PT8A 1C1DA 3K0EA 1M6VB 2Q99A 3VNSA 1AUXA 3ZZTA 4GM4A 1XTZA 4X93A 4V0KA 4EOGA 4F4FA 2V6FA 3O8LA 4MWDA 4K6HA 2LAIA 1MEOA 1F6BA 4U8VD 1MPTA 2WTXA 2B2NA 2Z98A 4ZYVA 5LQJA 5CRUA 4JYBA 2O8FB 4B8CB 3KEFA 4RVCA 2H5EA 1JG6A 4QECA 1ML4A 2BOVA 3H3FA 4J6EA 4CM4A 4ZOQI 1KR5A 1YJXA 1Z8HA 4KVFA 3L0CA 3UNXA 2IP2A 3NBXX 4N8DA 4AK9A 3BE8A 1T1JA 2H3EA 2HFJA 2Z58A 3C8ZA 1MO6A 3QC1A 1UMCB 3GH1A 1C0PA 3QOFA 3D1JA 1Q7TA 5KJLA 2P3SA 3OEEA 4GLOA 4NFLA 4QEKA 5EXSA 5BW5A 3VC2A 1P5ZB 4C1NA 4N5HX 4TUYA 2EWMA 2C9YA 2VL7A 4RTNA 2KCLA 2GYUA 3K6KA 4AXHA 1E89A 4UJ3A 4L2LA 1E4YA 1E60A 4FMDB 1E2FA 1MW9X 4NBSA 3QSYA 4NAUA 3CKYA 3LVFO 4MLDA 4ENQA 3GUHA 2FW9A 1EFHA 3MJHA 1NIPA 1N6RA 1T0PA 4JLPA 2RH4A 3V46A 1NXVA 1Y1LA 1C7IA 3RR2A 3DEYX 4BE7B 1E79A 3QARA 2J45A 2X5NA 5A9TA 2IHKA 1JWFA 3D0RA 2JLXA 3VR3A 1OMOA 3FDHA 4O60A 1Y6JA 3KLOA 1ZAYA 5A71A 2FR8C 1YB5A 1CETA 3UJ7A 3W9GA 3IGFA 5LQDA 5CB0A 2XB9A 1KEEB 4BT9A 3FUNA 2K4NA 3FWYA 1Z45A 3AL0C 1UKZA 1S70B 1WSBA 1MU0A 1GGJA 3QJYA 4JVSA 4Y9TA 2VSOE 1E6MA 1Q7BA 2Y1CA 2IS4A 3E18A 1J5PA 4MWTA 4CYMD 2YHAA 5SY4A 2IUYA 1U7UA 2V0PA 4X7PA 4BNIA 3LLVA 1FDVA 5FL3A 3QEMB 2PO5A 3AM5A 3QENA 3DZGA 1O1TA 2G71A 2PIAA 5CM9C 1WW8A 2Q9UA 1E2IA 5ILOA 1L4EA 4GO1A 1JIQA 4MR7B 1ZK1A 4RF4A 3ORHA 3WYFA 3AG5A 3UK0A 5JMWA 2IUSA 3JWEA 5TGZA 3UJ8A 4Y2RA 3OZVA 3V48A 5EMJA 4DLSA 5AJYA 5BWMA 3ORYA 2IIBA 2ZJ5A 3DSRA 1B6SA 1C3XA 2FZGA 3HQ4O 1RBMA 1Y3CE 1GYQA 1QVAA 5E4YA 4DNFA 3I61A 2O6HA 4LDJA 3HHPA 4FXPA 5HGJA 3TR5A 4FYKA 3EIJA 2FF5A 3HPRA 3OIWA 3D9PA 4PICA 5ALRA 5E6SA 4RY8A 3UMCA 4RDIA 721PA 3U3WA 3ENZA 3LQ1A 4GXQA 5K4HA 2FMKA 1JQBA 3SF4A 2QUHA 3IV0A 1RHMA 2KM1A 4XGRA 1F2TA 5T67A 2HMAA 4HQLA 2ZZNA 1H8HA 3VV3A 3L01A 1RWKA 4PZZA 3PS6A 4G85A 3IUMA 4DNPA 4BQOA 3I28A 3L6UA 4PLVA 3OIUA 4WADA 3ASYA 4ICIA 4M1QA 5E8RA 5TVKA 2EP7A 2VNSA 1P1IA 4MOWA 4FSHA 4WECA 1JQAA 2XBLA 3E2IA 2EKLA 5G4LA 1A7UA 1SQSA 4KQMA 4OGWA 1FX0A 3W6NA 2DSTA 3PC3A 1DG1G 3VTYA 1SOVA 1FRQA 1Z08A 2NTVA 3L7AA 5GQSA 4Q94A 1BHQ1 4IF4A 2OVBA 1KY5A 1L7AA 4NZYA 1VHWA 3VI3B 1T5HX 3GMTA 5AW8A 4MYSA 3CRVA 4LF9B 1N52A 3PGJA 1TEHA 3ZOKA 3URKA 3BSFA 5A6SB 2DGDA 3W8NA 3IP9A 8ATCA 3QELA 5HS4A 3A9RA 2CY0A 3KXIA 2J0VA 2J3JA 2EIJE 3PD1A 2OBFA 4IQ4A 2VJDA 3SC3A 2PJDA 4NCXA 2ZRPA 4X00A 3CJQA 1MC1A 4RK5A 5FJYA 3EUWA 1U2ZA 1BSVA 1JQJC 1S4QA 1U6KA 2C3OA 3MBKA 4EQ6B 3VJLA 5IKPA 1RKXA 4RMNA 2F00A 3H11A 3JSAA 2EFYA 2D1QA 3CLVA 3GA5A 3J7TA 5F3DA 5FWDA 5DNEA 1QRTA 4YVQC 2H4WA 3CVWA 2ZPUA 4NYIR 1ORTA 1914A 3LT1A 4RCZA 5EIWA 4O63O 4W1SA 4D3XA 5JEEA 3W77A 5H0IA 4CMAA 5CYGA 4Y2XA 5KQRA 5D2MC 4FS8A 4E2XA 2Y0BA 5F73A 5IYZF 2BGKA 5DTRA 3H4TA 4IRUA 1SRQA 2IGTA 3ZTTA 3LY7A 3DSSA 4PHGA 5JBNA 4MKFA 5EI5A 3MSXA 3TB6A 2GPJA 3AR5A 1NBOA 4X66B 1ZM2A 1RJFA 3KHSA 3DHYA 2NNWB 4BC1A 2HJWA 3FMIA 2F8XK 4KKXB 4HOSA 1KSFX 2QTCA 3N07A 4ZO6A 1ZK4A 4YJGA 3FTQA 1YRWA 1TFUA 4EUSA 1P4RA 3C43A 4W5QA 2R2AA 4J0CA 5CT8A 4E4RA 5IKOA 3GX1A 1WSAA 1O95A 4GVPA 2HBYA 4BO7A 1BJRE 2MR6A 1G63A 1E9AA 4RMHA 3EEIA 2G9ZA 4HQ6A 1IWBB 2GXUA 1F9EA 5KNCD 1V5FA 1IMJA 2FN4A 2QPOA 4EF4A 1FXWA 2Y1FA 3M2PA 3A7DA 1TM5E 4R1UA 1FOEB 3O38A 2P9FA 4WVLA 4UREA 1U7IA 5HF8A 5AENA 3G7NA 1LLQA 3D5QA 5HFAA 2X8AA 1XZAA 4E1AA 3S7ZA 2CFUA 1EUZA 4OLFA 4BQPA 4JD2G 3KV1A 3GFTA 2QW1A 4CKCB 1P62B 3W7AA 2ZJAA 1XZHA 3TWRA 4TWJA 3ICCA 621PA 4MHSA 2HRZA 2GXSA 3OJWA 1HFEL 2DWOA 2ZB4A 2P9EA 1N2CE 3AQ4A 4HN2A 4K5CA 1ELKA 1U8CB 2RBEA 5BQ3A 2XUZA 4XGKA 3BVPA 4HB5A 3U66A 2NXCA 3BAFA 5K3BA 4QATA 2CCJA 1LNZA 2VBIA 4ENWA 3AG2E 1G1AA 3TJZA 2A35A 1UMKA 3MRVA 3ZVKA 1UBJS 3SSOA 4JSRA 3TSOA 1IY8A 1HLPA 1ECGA 1EF1C 1CZHA 2J1LA 4RCVA 4OYYA 2XUIA 3PNPA 4HEHA 2O0JA 5EJ2A 4ZT4A 2W2MA 3ZEIA 3GGCA 1PCXA 2AWNA 3U4IA 2I8LA 2WA1A 5CK5A 4B74A 3IVMA 3IV6A 1BX1A 3REOA 4CYMA 2BEVA 5K8CA 4FCWA 2QRJA 4JYPA 3DOCA 4E88A 4G1UC 4IDEA 2OD9A 2JAHA 2IYNA 4IX9A 1TDJA 4OHKA 2O2YA 4RKYA 4UOZA 2JCVA 1NNEA 3ZWMA 4DTIA 4RELA 1W5SA 3EFOA 5CRVA 3O7MA 4GTSA 5EN5D 1O94D 2QYHA 3OG9A 3G2IA 4JH0A 4KCGA 4MRRA 4OHOA 3B1ZA 1VE1A 4QTXA 3DP9A 1S7CA 1LA2A 1NPDA 3DEJA 3HYTA 4OXRA 4E4YA 4F2PA 5L3SB 2G7MC 4XEIG 4ZVTA 3O7WA 1WCIB 3EXEB 4Q24A 2EYQA 2UYQA 4TVSA 4XWKA 4CV0A 3MTAA 3L9TA 1DKLA 2WWFA 1NUTA 2ONCA 4LSZA 2A6PA 5IF9A 5IZCC 2I66A 5T4HA 4B0ZA 3RSGA 3GYGA 2WHXA 4V24A 4OJMX 3ASOE 3I0NA 1H8HD 1SK9A 3A6DA 1SKMA 4MR8A 4HSGA 5ALGA 4AWAA 5M34A 5ICSA 3V7FA 4J7WA 3EIUA 4I4NA 1XTRA 2VEOA 4MV1A 2OO3A 1U1EA 3BRSA 2WAAA 3W8RA 1W88B 4DDUA 7REQB 2QQGA 2B8WA 3H86A 4H3HB 3FR7A 3MCVA 3R8CA 4BLPA 2H54A 3U48A 3GJSA 2VR1A 3TG4A 2UVPB 3JATA 3VSCA 3REGA 1XJQA 4CTMA 1V96A 4DARA 1YZFA 3OQHA 3ESAA 2R44A 2QD3A 3HYRA 4XB6B 5BUQA 1QH9A 2XNJA 5A03A 2B36A 4CM7A 2XPZA 1Z5UA 5HJ2A 3IOBA 4CLDA 3ADOA 3RIXA 2AHRA 4FCCA 2BF7A 5EIAA 1FTGA 1EJ0A 5T3UA 1PZHA 1Q1EA 4BLOA 4E6PA 2OCDA 2TMGA 3G9TA 3HB9A 3ZHUA 4EG5A 2EEZA 5TT0A 5HR5A 4RVUA 3NUGA 3N76A 3THOA 3UJCA 5L6LB 2Z83A 1NVWQ 5M29A 2JFGA 2Z3VA 2IF0A 2OB1A 1TYQG 1NU8A 3H0CA 3E05A 4W7HA 2PH7A 2X42A 4UBKA 2ZIWB 1QQ6A 1XNRB 1VP9A 1OXBB 2Q5CA 4TMYA 1UJMA 3WL4A 1SMKA 2JKVA 2RD0A 5AM0A 4CT4A 3VKVA 3BCUA 2BFFB 3HXDA 3JYNA 5CIQA 4KZ0A 2QSUA 4J0DA 4O4IB 4KOEC 1M2OB 4K5BA 3HDGA 4QOSA 5BSWA 2BUAA 2AW3A 1VDZA 5BN5A 3D1VA 5EQFA 1JE0A 2P2DA 3C3MA 1DHRA 1TA4A 4TL9A 1IH8A 1X19A 1CUSA 3EXG1 4NDZA 1CZKA 4NYJR 4P0QB 3EA4A 1EWKA 5TQ0A 3MJ4A 4YROA 1Z62A 2WMOA 4PX2A 5C2YA 4MR9B 1ENYA 1A8SA 1YBFA 2FAXA 2GM5A 3CUUA 3E70C 3FNHA 3OURA 4ID3A 3RTGA 1Y6GA 5KPDA 4NU0A 1WIWA 3IX7A 2IQCA 5KTRA 3QKWA 1IXSB 1L5JA 1NA5A 2Z43A 1T9ZA 3GGJA 3FGOA 3M6AA 4HDRB 2OD2A 3STXA 3OTGA 2QRVA 2BGTA 3UOAB 3WRYA 1WHSB 4PAGA 3ZD7A 1JSCA 1EFUA 3WKAA 1MQ8B 4FHEA 4K46A 3NB0A 5AKJA 4HDAA 2GPAA 5FUBA 1E6LA 5GZ6A 5JDIC 3HYMB 3RADC 4OU5A 5FTLA 1RI3A 3G9XA 3QPAA 4U07A 2V54A 3Q72A 1UDCA 3PV0A 3RYIA 2II6A 4BO0A 1Z25A 1GGMA 3SYNA 1E2GA 4EZIA 4G8LA 1PW5A 1RAHA 2FN8A 3H17A 1X3SA 3OTHA 5HA5A 1LKZA 4IJWA 5EHGA 5FPKA 4MICA 4YONB 5KYTA 4RZ3A 5LBTA 5REQB 3T3MB 1L5MA 1DBWA 1CKEA 2O2JA 1GSAA 1AKWA 1YDFA 4R1TA 4RGQA 4UBOA 4WACA 5H5JA 3WGYA 3ZVMA 2PD6A 5A9RA 1SD2A 3ZUVB 4FKZA 4MUBA 1QE5A 4FFMA 4PZUA 3ZY6A 4Q7MB 2HMWA 4NYJQ 2F8LA 5KX5B 3CIOA 2LCFA 4NMMA 5IANA 4TV9F 3Q4GA 1GQFA 1Q1GA 4K7JA 4BZXA 4ER0A 2HQRA 5E4FA 1YFJA 5JCOC 5HIMA 5I3CA 1C1XA 3EHDA 3M49A 4K05A 2OFXA 2RHBA 1RWPA 3C85A 3EEFA 2A0XA 3UAXA 2GJSA 2FDXA 4IHJB 1O0SA 4AP2A 5H70A 2IXAA 3SHQA 2D3TA 2QN3A 3MWEB 4BPRA 1RYNA 2C8JA 1IOLA 2AFIA 2IITA 3O74A 3PFCA 4WOKA 3TCNA 2BMFA 3V4RA 3T12A 4ARCA 3CLTD 1RYDA 4KR2A 1I2BA 3A1EA 4J4BA 1JEAA 2CFCA 1NPTO 4PSDA 5F1PA 3PXGA 4YMHA 5JNTA 3AY6A 3DFKA 3OECA 4HV4A 2WJ3A 1PL6A 5H7XA 3TWVA 5AJXA 4W5RA 3EU5A 1NATA 2WR8A 4BMYA 2ALJA 2ODPA 3PGMA 3PGVA 4UU7A 1GG5A 3Q12A 2Y0PA 3ND8A 1I7SB 5HWSA 5KYNA 4CEHB 2B34A 4PZYA 3CS3A 3L8YA 5A4JA 3OOYA 5KDDA 3M89A 1W8IA 4LJKA 4XVRA 1SBTA 1JU9A 5KJ6A 3DTTA 1KVSA 1LK5A 2N46A 3WIDA 1CJKC 4QM6A 3NKVA 4R1OA 4ATZD 1DPGA 1VA5A 2PR2A 4N5QA 1Y8MA 4CMJA 1Y5MA 3I04M 2CCKA 3HJFA 4AJKA 1I80A 5EINA 3EH1A 4IXTA 4P4NA 1IKND 4O4HF