5C1EA

Crystal structure of the pectin methylesterase from aspergillus niger in penultimately deglycosylated form (n-acetylglucosamine stub at asn84)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGNLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
total genus 112
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1eA00
3VMWA 2PYGA 1HG8A 1PE9A 2QX3A 1PLUA 2ODLA 4EW9A 1QJVA 2INVA 1QCXA 2IQ7A 4XLEA 2NT9A 3B4NA 1CZFA 1DBOA 5C1EA 1OGOX 2VBKA 2QXZA 1OFLA 4XR6A 1VBLA 3GQ8A 1XG2A 4PMHA 2O0VA 2VBEA 4XN3A 1AIRA 4XNFA 3UW0A 1NHCA 2NTBA 1O8FA 2NTQA 3FY3A 1JTAA 1KCCA 3JURA 3KRGA 4AVZA 5C1CA 1O8GA 1BHEA 1IDJA 2O04A 1O8JA 1GQ8A 4W8TA 1H80A 2PYHA 4I84A 4XMYA 1IB4A 3B90A 1X0CA 4YZQA 3GQ9A 2PECA 4MR0A 4XN0A 1IA5A 4U4BA 1O8KA 4OJ6A 5AMVA 4OJ5A 1DBGA 3B8YA 3VSUA 4OJOA 2NT6A 1KCDA 4OJLA 2Z8GA 1OFMA 4YZXA 4OZYA 4W8QA 3EQNA 1RMGA 1RU4A 4OJPA 1O8MA 4XLCA 2NTPA 2X6YA 4XKVA 1O8HA 4NK8A 4YZ0A 3ZSCA 1OGMX 4XLFA 4XOPA 2VBMA 4XQFA 1BN8A 3VSVA 2VJJA 4Z05A 4U49A 1PXZA 3EQOA 3ZPPA 4XORA 4Z03A 1IDKA 3GRHA 4OZZA 4YZAA 2X3HA 1EE6A 4XLAA 2O17A 1O8IA 1O8LA 2UVFA 3GQAA 1O88A 2BSPA 2NZMA 2QY1A 4XOTA 4W8SA 3SUCA 2O0WA 3GQ7A 4NK6A 4XKWA 2O1DA 4Z06A 4YELA 3LMWA 4XL9A 2VJIA 1WMRA 2NSPA 1K5CA 2X6XA 4XONA 3VMVA 3T9GA 4XLHA 4YEJA 4XM3A 1JRGA 2EWEA 2NSTA 1OOCA 4W8RA 1RWRA 2X6WA 3WWGA 2UVEA 2X85A 1KTWA 3VSTA 4URRA 1O8EA 4HWVA 4MXNA 1O8DA 4C2LA 2INUA
chains in the Genus database with same CATH superfamily
3VMWA 3NAWA 3PSZA 2PYGA 1HG8A 1PE9A 2V5IA 1QA2A 2BM5A 2QX3A 2F3LA 1PLUA 2ODLA 4EW9A 1QJVA 2VFQA 2INVA 1QCXA 2IQ7A 4XLEA 2O6WA 3NB2A 2NT9A 3B4NA 1CZFA 1DBOA 5C1EA 1OGOX 2VBKA 3BH6B 2QXZA 1OFLA 3N90A 4XR6A 1VBLA 3SYJA 3GQ8A 3LYCA 1XG2A 4YC5A 4PMHA 3N6ZA 4YCQA 1EZGA 2O0VA 2VBEA 4XN3A 1AIRA 1K8FA 4OPWA 4XNFA 4YDTA 3UW0A 1NHCA 3SQVA 2NTBA 1O8FA 2NTQA 5DNSA 5JMCB 3FY3A 1JTAA 1KCCA 3JURA 3KRGA 4AVZA 2XC1A 1O8GA 5C1CA 1L1IA 1K4ZA 1BHEA 2XTYA 1IDJA 2O04A 1TYVA 1O8JA 1GQ8A 1QRCA 4W8TA 3SZEA 1LLZA 2B0RA 1H80A 2PYHA 4I84A 4XMYA 2XTXA 2BX6A 1IB4A 3B90A 2VFNA 3AK5A 1X0CA 4YZQA 2IOUG 1LLWA 3GQ9A 2PECA 4MR0A 4XN0A 1IA5A 4U4BA 1O8KA 4OJ6A 4V02C 5AMVA 2J8IA 3PSSA 4OJ5A 1DBGA 2VFPA 3B8YA 4OJOA 2NT6A 3VSUA 1KCDA 1TSPA 4OJLA 1HF2A 1OFDA 2XTWA 2Z8GA 3DU1X 1OFMA 4YZXA 2QZAA 3LJYA 4OZYA 4W8QA 3EQNA 2YUHA 1RMGA 5JLVC 1RU4A 2VFOA 4OJPA 1O8MA 4XLCA 2NTPA 2X6YA 4XKVA 1O8HA 2W7ZA 4NK8A 4YZ0A 2J8KA 3ML3A 1CLWA 3ZSCA 1OGMX 4XLFA 4XOPA 2VBMA 1LM1A 2G0YA 4XQFA 1BN8A 3VSVA 2BM7A 3JX8A 1TYWA 2VJJA 1KQ5A 3P4GA 4Z05A 4U49A 1PXZA 3EQOA 3ZPPA 1WXRA 2VFMA 4XORA 4Z03A 1IDKA 3GRHA 4OZZA 4YZAA 2X3HA 1EE6A 3SY2A 4XLAA 2O17A 1O8IA 1O8LA 2UVFA 3PETA 3GQAA 2XT2A 4YFOA 4OM9A 1DABA 1TYXA 1O88A 2BSPA 1OFEA 2NZMA 2QY1A 4XOTA 4W8SA 3SUCA 2XT4A 3TH0A 2O0WA 3GQ7A 4NK6A 4XKWA 2O1DA 4Z06A 4YELA 3LMWA 3H09A 3RIQA 4XL9A 2QYUA 2VJIA 1WMRA 1EA0A 2NSPA 3BH7B 1QQ1A 4KH3A 2X6XA 4XONA 3VMVA 4YEIA 1K5CA 3T9GA 4XLHA 4YEJA 4XM3A 1JRGA 1TYUA 2EWEA 2NSTA 1OOCA 4W8RA 1RWRA 2X6WA 1QA1A 1QA3A 2BM6A 3WWGA 2UVEA 2BM4A 2X85A 1KTWA 3VSTA 1QRBA 4URRA 1O8EA 4HWVA 4JRAC 4MXNA 1O8DA 4C2LA 2INUA
chains in the Genus database with same CATH topology
3VMWA 2PYGA 1HG8A 1PE9A 2QX3A 1PLUA 2ODLA 4EW9A 1QJVA 2INVA 1QCXA 2IQ7A 4XLEA 2NT9A 3B4NA 1CZFA 1DBOA 5C1EA 1OGOX 2VBKA 2QXZA 1OFLA 4XR6A 1VBLA 3GQ8A 1XG2A 4PMHA 2O0VA 2VBEA 4XN3A 1AIRA 4XNFA 3UW0A 1NHCA 2NTBA 1O8FA 2NTQA 3FY3A 1JTAA 1KCCA 3JURA 3KRGA 4AVZA 5C1CA 1O8GA 1BHEA 1IDJA 2O04A 1O8JA 1GQ8A 4W8TA 1H80A 2PYHA 4I84A 4XMYA 1IB4A 3B90A 1X0CA 4YZQA 3GQ9A 2PECA 4MR0A 4XN0A 1IA5A 4U4BA 1O8KA 4OJ6A 5AMVA 4OJ5A 1DBGA 3B8YA 3VSUA 4OJOA 2NT6A 1KCDA 4OJLA 2Z8GA 1OFMA 4YZXA 4OZYA 4W8QA 3EQNA 1RMGA 1RU4A 4OJPA 1O8MA 4XLCA 2NTPA 2X6YA 4XKVA 1O8HA 4NK8A 4YZ0A 3ZSCA 1OGMX 4XLFA 4XOPA 2VBMA 4XQFA 1BN8A 3VSVA 2VJJA 4Z05A 4U49A 1PXZA 3EQOA 3ZPPA 4XORA 4Z03A 1IDKA 3GRHA 4OZZA 4YZAA 2X3HA 1EE6A 4XLAA 2O17A 1O8IA 1O8LA 2UVFA 3GQAA 1O88A 2BSPA 2NZMA 2QY1A 4XOTA 4W8SA 3SUCA 2O0WA 3GQ7A 4NK6A 4XKWA 2O1DA 4Z06A 4YELA 3LMWA 4XL9A 2VJIA 1WMRA 2NSPA 1K5CA 2X6XA 4XONA 3VMVA 3T9GA 4XLHA 4YEJA 4XM3A 1JRGA 2EWEA 2NSTA 1OOCA 4W8RA 1RWRA 2X6WA 3WWGA 2UVEA 2X85A 1KTWA 3VSTA 4URRA 1O8EA 4HWVA 4MXNA 1O8DA 4C2LA 2INUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMW A;  2PYG A;  1HG8 A;  1PE9 A;  2QX3 A;  1PLU A;  2ODL A;  4EW9 A;  1QJV A;  2INV A;  1QCX A;  2IQ7 A;  4XLE A;  2NT9 A;  3B4N A;  1CZF A;  1DBO A;  5C1E A;  1OGO X;  2VBK A;  2QXZ A;  1OFL A;  4XR6 A;  1VBL A;  3GQ8 A;  1XG2 A;  4PMH A;  2O0V A;  2VBE A;  4XN3 A;  1AIR A;  4XNF A;  3UW0 A;  1NHC A;  2NTB A;  1O8F A;  2NTQ A;  3FY3 A;  1JTA A;  1KCC A;  3JUR A;  3KRG A;  4AVZ A;  5C1C A;  1O8G A;  1BHE A;  1IDJ A;  2O04 A;  1O8J A;  1GQ8 A;  4W8T A;  1H80 A;  2PYH A;  4I84 A;  4XMY A;  1IB4 A;  3B90 A;  1X0C A;  4YZQ A;  3GQ9 A;  2PEC A;  4MR0 A;  4XN0 A;  1IA5 A;  4U4B A;  1O8K A;  4OJ6 A;  5AMV A;  4OJ5 A;  1DBG A;  3B8Y A;  3VSU A;  4OJO A;  2NT6 A;  1KCD A;  4OJL A;  2Z8G A;  1OFM A;  4YZX A;  4OZY A;  4W8Q A;  3EQN A;  1RMG A;  1RU4 A;  4OJP A;  1O8M A;  4XLC A;  2NTP A;  2X6Y A;  4XKV A;  1O8H A;  4NK8 A;  4YZ0 A;  3ZSC A;  1OGM X;  4XLF A;  4XOP A;  2VBM A;  4XQF A;  1BN8 A;  3VSV A;  2VJJ A;  4Z05 A;  4U49 A;  1PXZ A;  3EQO A;  3ZPP A;  4XOR A;  4Z03 A;  1IDK A;  3GRH A;  4OZZ A;  4YZA A;  2X3H A;  1EE6 A;  4XLA A;  2O17 A;  1O8I A;  1O8L A;  2UVF A;  3GQA A;  1O88 A;  2BSP A;  2NZM A;  2QY1 A;  4XOT A;  4W8S A;  3SUC A;  2O0W A;  3GQ7 A;  4NK6 A;  4XKW A;  2O1D A;  4Z06 A;  4YEL A;  3LMW A;  4XL9 A;  2VJI A;  1WMR A;  2NSP A;  1K5C A;  2X6X A;  4XON A;  3VMV A;  3T9G A;  4XLH A;  4YEJ A;  4XM3 A;  1JRG A;  2EWE A;  2NST A;  1OOC A;  4W8R A;  1RWR A;  2X6W A;  3WWG A;  2UVE A;  2X85 A;  1KTW A;  3VST A;  4URR A;  1O8E A;  4HWV A;  4MXN A;  1O8D A;  4C2L A;  2INU A; 
#chains in the Genus database with same CATH topology
 3VMW A;  3NAW A;  3PSZ A;  2PYG A;  1HG8 A;  1PE9 A;  2V5I A;  1QA2 A;  2BM5 A;  2QX3 A;  2F3L A;  1PLU A;  2ODL A;  4EW9 A;  1QJV A;  2VFQ A;  2INV A;  1QCX A;  2IQ7 A;  4XLE A;  2O6W A;  3NB2 A;  2NT9 A;  3B4N A;  1CZF A;  1DBO A;  5C1E A;  1OGO X;  2VBK A;  3BH6 B;  2QXZ A;  1OFL A;  3N90 A;  4XR6 A;  1VBL A;  3SYJ A;  3GQ8 A;  3LYC A;  1XG2 A;  4YC5 A;  4PMH A;  3N6Z A;  4YCQ A;  1EZG A;  2O0V A;  2VBE A;  4XN3 A;  1AIR A;  1K8F A;  4OPW A;  4XNF A;  4YDT A;  3UW0 A;  1NHC A;  3SQV A;  2NTB A;  1O8F A;  2NTQ A;  5DNS A;  5JMC B;  3FY3 A;  1JTA A;  1KCC A;  3JUR A;  3KRG A;  4AVZ A;  2XC1 A;  1O8G A;  5C1C A;  1L1I A;  1K4Z A;  1BHE A;  2XTY A;  1IDJ A;  2O04 A;  1TYV A;  1O8J A;  1GQ8 A;  1QRC A;  4W8T A;  3SZE A;  1LLZ A;  2B0R A;  1H80 A;  2PYH A;  4I84 A;  4XMY A;  2XTX A;  2BX6 A;  1IB4 A;  3B90 A;  2VFN A;  3AK5 A;  1X0C A;  4YZQ A;  2IOU G;  1LLW A;  3GQ9 A;  2PEC A;  4MR0 A;  4XN0 A;  1IA5 A;  4U4B A;  1O8K A;  4OJ6 A;  4V02 C;  5AMV A;  2J8I A;  3PSS A;  4OJ5 A;  1DBG A;  2VFP A;  3B8Y A;  4OJO A;  2NT6 A;  3VSU A;  1KCD A;  1TSP A;  4OJL A;  1HF2 A;  1OFD A;  2XTW A;  2Z8G A;  3DU1 X;  1OFM A;  4YZX A;  2QZA A;  3LJY A;  4OZY A;  4W8Q A;  3EQN A;  2YUH A;  1RMG A;  5JLV C;  1RU4 A;  2VFO A;  4OJP A;  1O8M A;  4XLC A;  2NTP A;  2X6Y A;  4XKV A;  1O8H A;  2W7Z A;  4NK8 A;  4YZ0 A;  2J8K A;  3ML3 A;  1CLW A;  3ZSC A;  1OGM X;  4XLF A;  4XOP A;  2VBM A;  1LM1 A;  2G0Y A;  4XQF A;  1BN8 A;  3VSV A;  2BM7 A;  3JX8 A;  1TYW A;  2VJJ A;  1KQ5 A;  3P4G A;  4Z05 A;  4U49 A;  1PXZ A;  3EQO A;  3ZPP A;  1WXR A;  2VFM A;  4XOR A;  4Z03 A;  1IDK A;  3GRH A;  4OZZ A;  4YZA A;  2X3H A;  1EE6 A;  3SY2 A;  4XLA A;  2O17 A;  1O8I A;  1O8L A;  2UVF A;  3PET A;  3GQA A;  2XT2 A;  4YFO A;  4OM9 A;  1DAB A;  1TYX A;  1O88 A;  2BSP A;  1OFE A;  2NZM A;  2QY1 A;  4XOT A;  4W8S A;  3SUC A;  2XT4 A;  3TH0 A;  2O0W A;  3GQ7 A;  4NK6 A;  4XKW A;  2O1D A;  4Z06 A;  4YEL A;  3LMW A;  3H09 A;  3RIQ A;  4XL9 A;  2QYU A;  2VJI A;  1WMR A;  1EA0 A;  2NSP A;  3BH7 B;  1QQ1 A;  4KH3 A;  2X6X A;  4XON A;  3VMV A;  4YEI A;  1K5C A;  3T9G A;  4XLH A;  4YEJ A;  4XM3 A;  1JRG A;  1TYU A;  2EWE A;  2NST A;  1OOC A;  4W8R A;  1RWR A;  2X6W A;  1QA1 A;  1QA3 A;  2BM6 A;  3WWG A;  2UVE A;  2BM4 A;  2X85 A;  1KTW A;  3VST A;  1QRB A;  4URR A;  1O8E A;  4HWV A;  4JRA C;  4MXN A;  1O8D A;  4C2L A;  2INU A; 
#chains in the Genus database with same CATH homology
 3VMW A;  2PYG A;  1HG8 A;  1PE9 A;  2QX3 A;  1PLU A;  2ODL A;  4EW9 A;  1QJV A;  2INV A;  1QCX A;  2IQ7 A;  4XLE A;  2NT9 A;  3B4N A;  1CZF A;  1DBO A;  5C1E A;  1OGO X;  2VBK A;  2QXZ A;  1OFL A;  4XR6 A;  1VBL A;  3GQ8 A;  1XG2 A;  4PMH A;  2O0V A;  2VBE A;  4XN3 A;  1AIR A;  4XNF A;  3UW0 A;  1NHC A;  2NTB A;  1O8F A;  2NTQ A;  3FY3 A;  1JTA A;  1KCC A;  3JUR A;  3KRG A;  4AVZ A;  5C1C A;  1O8G A;  1BHE A;  1IDJ A;  2O04 A;  1O8J A;  1GQ8 A;  4W8T A;  1H80 A;  2PYH A;  4I84 A;  4XMY A;  1IB4 A;  3B90 A;  1X0C A;  4YZQ A;  3GQ9 A;  2PEC A;  4MR0 A;  4XN0 A;  1IA5 A;  4U4B A;  1O8K A;  4OJ6 A;  5AMV A;  4OJ5 A;  1DBG A;  3B8Y A;  3VSU A;  4OJO A;  2NT6 A;  1KCD A;  4OJL A;  2Z8G A;  1OFM A;  4YZX A;  4OZY A;  4W8Q A;  3EQN A;  1RMG A;  1RU4 A;  4OJP A;  1O8M A;  4XLC A;  2NTP A;  2X6Y A;  4XKV A;  1O8H A;  4NK8 A;  4YZ0 A;  3ZSC A;  1OGM X;  4XLF A;  4XOP A;  2VBM A;  4XQF A;  1BN8 A;  3VSV A;  2VJJ A;  4Z05 A;  4U49 A;  1PXZ A;  3EQO A;  3ZPP A;  4XOR A;  4Z03 A;  1IDK A;  3GRH A;  4OZZ A;  4YZA A;  2X3H A;  1EE6 A;  4XLA A;  2O17 A;  1O8I A;  1O8L A;  2UVF A;  3GQA A;  1O88 A;  2BSP A;  2NZM A;  2QY1 A;  4XOT A;  4W8S A;  3SUC A;  2O0W A;  3GQ7 A;  4NK6 A;  4XKW A;  2O1D A;  4Z06 A;  4YEL A;  3LMW A;  4XL9 A;  2VJI A;  1WMR A;  2NSP A;  1K5C A;  2X6X A;  4XON A;  3VMV A;  3T9G A;  4XLH A;  4YEJ A;  4XM3 A;  1JRG A;  2EWE A;  2NST A;  1OOC A;  4W8R A;  1RWR A;  2X6W A;  3WWG A;  2UVE A;  2X85 A;  1KTW A;  3VST A;  4URR A;  1O8E A;  4HWV A;  4MXN A;  1O8D A;  4C2L A;  2INU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...