5C1EA

Crystal structure of the pectin methylesterase from aspergillus niger in penultimately deglycosylated form (n-acetylglucosamine stub at asn84)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGNLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
total genus 112
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1eA00
1GQ8A 2NSTA 2INUA 4YZQA 1O8DA 2PYHA 4MR0A 3FY3A 2IQ7A 1IB4A 2NTQA 2NZMA 4XLAA 4XM3A 1O8KA 3VMWA 1EE6A 2PYGA 2NSPA 2O1DA 1O8HA 1QJVA 4YZXA 2VJJA 4Z05A 1DBOA 2INVA 4OJ5A 4XORA 1O8LA 2UVFA 3JURA 2QY1A 1AIRA 2BSPA 4XLFA 4XN3A 3VMVA 2VBEA 1DBGA 1JRGA 4XONA 3EQNA 4OJOA 1QCXA 2QX3A 2Z8GA 1OOCA 4Z06A 2NT9A 1IDJA 2UVEA 4MXNA 5C1CA 5AMVA 1PLUA 4XKVA 1K5CA 3B8YA 2NT6A 2ODLA 4OJLA 4XQFA 1BN8A 4XMYA 1H80A 2PECA 3GQ8A 4OJPA 1X0CA 3VSVA 4URRA 1HG8A 3GRHA 3VSUA 4YZAA 3KRGA 1OFMA 1O8GA 1XG2A 2VBMA 5C1EA 2NTBA 4OJ6A 4YELA 2O0VA 1BHEA 4NK8A 3EQOA 4U4BA 4OZZA 4W8SA 2X85A 1OGMX 1O88A 2O04A 2EWEA 3WWGA 3GQ9A 4OZYA 4EW9A 1OFLA 1O8EA 1RU4A 2X3HA 3B4NA 4XKWA 1WMRA 1O8JA 3GQAA 4XR6A 4U49A 4YZ0A 1VBLA 1KCCA 3LMWA 4XOTA 4W8TA 4XOPA 4Z03A 1O8MA 4W8QA 4XLHA 3VSTA 1NHCA 4YEJA 1KCDA 4HWVA 4XLEA 1KTWA 2VJIA 1OGOX 2NTPA 2QXZA 2X6YA 1JTAA 2O17A 4XLCA 4C2LA 3SUCA 1O8IA 2O0WA 1CZFA 1RMGA 3UW0A 4XL9A 2VBKA 1PE9A 4I84A 4XNFA 1PXZA 3B90A 3GQ7A 4NK6A 1IDKA 1O8FA 1RWRA 1IA5A 3ZPPA 4XN0A 4AVZA 2X6XA 2X6WA 4W8RA 3ZSCA 3T9GA 4PMHA
chains in the Genus database with same CATH superfamily
3DU1X 3ML3A 3PSSA 1GQ8A 1LM1A 2NSTA 2VFMA 2YUHA 2INUA 4YZQA 1O8DA 2PYHA 4JRAC 4MR0A 3FY3A 2BM6A 2IQ7A 1IB4A 2NTQA 1EA0A 2NZMA 4XLAA 4XM3A 1O8KA 3VMWA 1EE6A 2PYGA 1QA2A 2NSPA 2O1DA 1O8HA 1TYXA 1QJVA 3PETA 1OFEA 1LLWA 4YZXA 2VJJA 4Z05A 1DBOA 2INVA 3JX8A 4OJ5A 4V02C 3LJYA 4XORA 1O8LA 2UVFA 1TYUA 2QY1A 1AIRA 2BSPA 3JURA 4XLFA 4XN3A 2VBEA 1DBGA 1JRGA 2XTXA 4XONA 3EQNA 4YC5A 4OJOA 4YEIA 1EZGA 1QCXA 2QX3A 2Z8GA 1OOCA 4Z06A 1WXRA 1K4ZA 2NT9A 1L1IA 3SY2A 1IDJA 2XC1A 2UVEA 4MXNA 2VFOA 5AMVA 5C1CA 1PLUA 4XKVA 1K5CA 3B8YA 2NT6A 2ODLA 4OJLA 4XQFA 4YFOA 1BN8A 2BM4A 2XT4A 4XMYA 1H80A 4KH3A 2PECA 2QYUA 3GQ8A 4OJPA 3PSZA 1X0CA 3P4GA 3VSVA 4URRA 1HG8A 2BM5A 3GRHA 3SYJA 1QRBA 4YZAA 2J8IA 3VSUA 3VMVA 3KRGA 1OFMA 1O8GA 1XG2A 2B0RA 2O6WA 2VBMA 1TSPA 5JMCB 5C1EA 2NTBA 4OJ6A 2XTYA 4YELA 2O0VA 1BHEA 4NK8A 3EQOA 4YDTA 4U4BA 3TH0A 1QRCA 4OZZA 4W8SA 2QZAA 2VFPA 2X85A 3NB2A 1OGMX 1O88A 2O04A 2EWEA 3SQVA 1KQ5A 1K8FA 3GQ9A 4OZYA 3WWGA 4EW9A 1OFLA 1QA1A 3H09A 1O8EA 1RU4A 2IOUG 2X3HA 2G0YA 3B4NA 4XKWA 1WMRA 1O8JA 3BH6B 3GQAA 3LYCA 4U49A 4XR6A 4YCQA 5DNSA 2XTWA 4YZ0A 1VBLA 1KCCA 3LMWA 4XOTA 4W8TA 4XOPA 4Z03A 1O8MA 4W8QA 1QA3A 4XLHA 2V5IA 3VSTA 1NHCA 4YEJA 1KCDA 4HWVA 2VFNA 4XLEA 5JLVC 3N6ZA 2J8KA 2BM7A 1KTWA 3BH7B 1CLWA 4OPWA 2F3LA 3NAWA 2VJIA 1OGOX 2NTPA 2QXZA 2X6YA 1JTAA 2O17A 4XLCA 3SZEA 4C2LA 2W7ZA 2BX6A 3SUCA 2XT2A 1O8IA 1DABA 2O0WA 1OFDA 3RIQA 1TYWA 1LLZA 1CZFA 1RMGA 3UW0A 4XL9A 2VBKA 1TYVA 1PE9A 4I84A 4XNFA 1PXZA 3B90A 3GQ7A 4NK6A 4OM9A 1IDKA 1O8FA 1HF2A 2VFQA 1RWRA 1IA5A 3ZPPA 4XN0A 1QQ1A 4AVZA 2X6XA 2X6WA 4W8RA 3ZSCA 3AK5A 3T9GA 3N90A 4PMHA
chains in the Genus database with same CATH topology
1GQ8A 2NSTA 2INUA 4YZQA 1O8DA 2PYHA 4MR0A 3FY3A 2IQ7A 1IB4A 2NTQA 2NZMA 4XLAA 4XM3A 1O8KA 3VMWA 1EE6A 2PYGA 2NSPA 2O1DA 1O8HA 1QJVA 4YZXA 2VJJA 4Z05A 1DBOA 2INVA 4OJ5A 4XORA 1O8LA 2UVFA 3JURA 2QY1A 1AIRA 2BSPA 4XLFA 4XN3A 3VMVA 2VBEA 1DBGA 1JRGA 4XONA 3EQNA 4OJOA 1QCXA 2QX3A 2Z8GA 1OOCA 4Z06A 2NT9A 1IDJA 2UVEA 4MXNA 5C1CA 5AMVA 1PLUA 4XKVA 1K5CA 3B8YA 2NT6A 2ODLA 4OJLA 4XQFA 1BN8A 4XMYA 1H80A 2PECA 3GQ8A 4OJPA 1X0CA 3VSVA 4URRA 1HG8A 3GRHA 3VSUA 4YZAA 3KRGA 1OFMA 1O8GA 1XG2A 2VBMA 5C1EA 2NTBA 4OJ6A 4YELA 2O0VA 1BHEA 4NK8A 3EQOA 4U4BA 4OZZA 4W8SA 2X85A 1OGMX 1O88A 2O04A 2EWEA 3WWGA 3GQ9A 4OZYA 4EW9A 1OFLA 1O8EA 1RU4A 2X3HA 3B4NA 4XKWA 1WMRA 1O8JA 3GQAA 4XR6A 4U49A 4YZ0A 1VBLA 1KCCA 3LMWA 4XOTA 4W8TA 4XOPA 4Z03A 1O8MA 4W8QA 4XLHA 3VSTA 1NHCA 4YEJA 1KCDA 4HWVA 4XLEA 1KTWA 2VJIA 1OGOX 2NTPA 2QXZA 2X6YA 1JTAA 2O17A 4XLCA 4C2LA 3SUCA 1O8IA 2O0WA 1CZFA 1RMGA 3UW0A 4XL9A 2VBKA 1PE9A 4I84A 4XNFA 1PXZA 3B90A 3GQ7A 4NK6A 1IDKA 1O8FA 1RWRA 1IA5A 3ZPPA 4XN0A 4AVZA 2X6XA 2X6WA 4W8RA 3ZSCA 3T9GA 4PMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQ8 A;  2NST A;  2INU A;  4YZQ A;  1O8D A;  2PYH A;  4MR0 A;  3FY3 A;  2IQ7 A;  1IB4 A;  2NTQ A;  2NZM A;  4XLA A;  4XM3 A;  1O8K A;  3VMW A;  1EE6 A;  2PYG A;  2NSP A;  2O1D A;  1O8H A;  1QJV A;  4YZX A;  2VJJ A;  4Z05 A;  1DBO A;  2INV A;  4OJ5 A;  4XOR A;  1O8L A;  2UVF A;  3JUR A;  2QY1 A;  1AIR A;  2BSP A;  4XLF A;  4XN3 A;  3VMV A;  2VBE A;  1DBG A;  1JRG A;  4XON A;  3EQN A;  4OJO A;  1QCX A;  2QX3 A;  2Z8G A;  1OOC A;  4Z06 A;  2NT9 A;  1IDJ A;  2UVE A;  4MXN A;  5C1C A;  5AMV A;  1PLU A;  4XKV A;  1K5C A;  3B8Y A;  2NT6 A;  2ODL A;  4OJL A;  4XQF A;  1BN8 A;  4XMY A;  1H80 A;  2PEC A;  3GQ8 A;  4OJP A;  1X0C A;  3VSV A;  4URR A;  1HG8 A;  3GRH A;  3VSU A;  4YZA A;  3KRG A;  1OFM A;  1O8G A;  1XG2 A;  2VBM A;  5C1E A;  2NTB A;  4OJ6 A;  4YEL A;  2O0V A;  1BHE A;  4NK8 A;  3EQO A;  4U4B A;  4OZZ A;  4W8S A;  2X85 A;  1OGM X;  1O88 A;  2O04 A;  2EWE A;  3WWG A;  3GQ9 A;  4OZY A;  4EW9 A;  1OFL A;  1O8E A;  1RU4 A;  2X3H A;  3B4N A;  4XKW A;  1WMR A;  1O8J A;  3GQA A;  4XR6 A;  4U49 A;  4YZ0 A;  1VBL A;  1KCC A;  3LMW A;  4XOT A;  4W8T A;  4XOP A;  4Z03 A;  1O8M A;  4W8Q A;  4XLH A;  3VST A;  1NHC A;  4YEJ A;  1KCD A;  4HWV A;  4XLE A;  1KTW A;  2VJI A;  1OGO X;  2NTP A;  2QXZ A;  2X6Y A;  1JTA A;  2O17 A;  4XLC A;  4C2L A;  3SUC A;  1O8I A;  2O0W A;  1CZF A;  1RMG A;  3UW0 A;  4XL9 A;  2VBK A;  1PE9 A;  4I84 A;  4XNF A;  1PXZ A;  3B90 A;  3GQ7 A;  4NK6 A;  1IDK A;  1O8F A;  1RWR A;  1IA5 A;  3ZPP A;  4XN0 A;  4AVZ A;  2X6X A;  2X6W A;  4W8R A;  3ZSC A;  3T9G A;  4PMH A; 
#chains in the Genus database with same CATH topology
 3DU1 X;  3ML3 A;  3PSS A;  1GQ8 A;  1LM1 A;  2NST A;  2VFM A;  2YUH A;  2INU A;  4YZQ A;  1O8D A;  2PYH A;  4JRA C;  4MR0 A;  3FY3 A;  2BM6 A;  2IQ7 A;  1IB4 A;  2NTQ A;  1EA0 A;  2NZM A;  4XLA A;  4XM3 A;  1O8K A;  3VMW A;  1EE6 A;  2PYG A;  1QA2 A;  2NSP A;  2O1D A;  1O8H A;  1TYX A;  1QJV A;  3PET A;  1OFE A;  1LLW A;  4YZX A;  2VJJ A;  4Z05 A;  1DBO A;  2INV A;  3JX8 A;  4OJ5 A;  4V02 C;  3LJY A;  4XOR A;  1O8L A;  2UVF A;  1TYU A;  2QY1 A;  1AIR A;  2BSP A;  3JUR A;  4XLF A;  4XN3 A;  2VBE A;  1DBG A;  1JRG A;  2XTX A;  4XON A;  3EQN A;  4YC5 A;  4OJO A;  4YEI A;  1EZG A;  1QCX A;  2QX3 A;  2Z8G A;  1OOC A;  4Z06 A;  1WXR A;  1K4Z A;  2NT9 A;  1L1I A;  3SY2 A;  1IDJ A;  2XC1 A;  2UVE A;  4MXN A;  2VFO A;  5AMV A;  5C1C A;  1PLU A;  4XKV A;  1K5C A;  3B8Y A;  2NT6 A;  2ODL A;  4OJL A;  4XQF A;  4YFO A;  1BN8 A;  2BM4 A;  2XT4 A;  4XMY A;  1H80 A;  4KH3 A;  2PEC A;  2QYU A;  3GQ8 A;  4OJP A;  3PSZ A;  1X0C A;  3P4G A;  3VSV A;  4URR A;  1HG8 A;  2BM5 A;  3GRH A;  3SYJ A;  1QRB A;  4YZA A;  2J8I A;  3VSU A;  3VMV A;  3KRG A;  1OFM A;  1O8G A;  1XG2 A;  2B0R A;  2O6W A;  2VBM A;  1TSP A;  5JMC B;  5C1E A;  2NTB A;  4OJ6 A;  2XTY A;  4YEL A;  2O0V A;  1BHE A;  4NK8 A;  3EQO A;  4YDT A;  4U4B A;  3TH0 A;  1QRC A;  4OZZ A;  4W8S A;  2QZA A;  2VFP A;  2X85 A;  3NB2 A;  1OGM X;  1O88 A;  2O04 A;  2EWE A;  3SQV A;  1KQ5 A;  1K8F A;  3GQ9 A;  4OZY A;  3WWG A;  4EW9 A;  1OFL A;  1QA1 A;  3H09 A;  1O8E A;  1RU4 A;  2IOU G;  2X3H A;  2G0Y A;  3B4N A;  4XKW A;  1WMR A;  1O8J A;  3BH6 B;  3GQA A;  3LYC A;  4U49 A;  4XR6 A;  4YCQ A;  5DNS A;  2XTW A;  4YZ0 A;  1VBL A;  1KCC A;  3LMW A;  4XOT A;  4W8T A;  4XOP A;  4Z03 A;  1O8M A;  4W8Q A;  1QA3 A;  4XLH A;  2V5I A;  3VST A;  1NHC A;  4YEJ A;  1KCD A;  4HWV A;  2VFN A;  4XLE A;  5JLV C;  3N6Z A;  2J8K A;  2BM7 A;  1KTW A;  3BH7 B;  1CLW A;  4OPW A;  2F3L A;  3NAW A;  2VJI A;  1OGO X;  2NTP A;  2QXZ A;  2X6Y A;  1JTA A;  2O17 A;  4XLC A;  3SZE A;  4C2L A;  2W7Z A;  2BX6 A;  3SUC A;  2XT2 A;  1O8I A;  1DAB A;  2O0W A;  1OFD A;  3RIQ A;  1TYW A;  1LLZ A;  1CZF A;  1RMG A;  3UW0 A;  4XL9 A;  2VBK A;  1TYV A;  1PE9 A;  4I84 A;  4XNF A;  1PXZ A;  3B90 A;  3GQ7 A;  4NK6 A;  4OM9 A;  1IDK A;  1O8F A;  1HF2 A;  2VFQ A;  1RWR A;  1IA5 A;  3ZPP A;  4XN0 A;  1QQ1 A;  4AVZ A;  2X6X A;  2X6W A;  4W8R A;  3ZSC A;  3AK5 A;  3T9G A;  3N90 A;  4PMH A; 
#chains in the Genus database with same CATH homology
 1GQ8 A;  2NST A;  2INU A;  4YZQ A;  1O8D A;  2PYH A;  4MR0 A;  3FY3 A;  2IQ7 A;  1IB4 A;  2NTQ A;  2NZM A;  4XLA A;  4XM3 A;  1O8K A;  3VMW A;  1EE6 A;  2PYG A;  2NSP A;  2O1D A;  1O8H A;  1QJV A;  4YZX A;  2VJJ A;  4Z05 A;  1DBO A;  2INV A;  4OJ5 A;  4XOR A;  1O8L A;  2UVF A;  3JUR A;  2QY1 A;  1AIR A;  2BSP A;  4XLF A;  4XN3 A;  3VMV A;  2VBE A;  1DBG A;  1JRG A;  4XON A;  3EQN A;  4OJO A;  1QCX A;  2QX3 A;  2Z8G A;  1OOC A;  4Z06 A;  2NT9 A;  1IDJ A;  2UVE A;  4MXN A;  5C1C A;  5AMV A;  1PLU A;  4XKV A;  1K5C A;  3B8Y A;  2NT6 A;  2ODL A;  4OJL A;  4XQF A;  1BN8 A;  4XMY A;  1H80 A;  2PEC A;  3GQ8 A;  4OJP A;  1X0C A;  3VSV A;  4URR A;  1HG8 A;  3GRH A;  3VSU A;  4YZA A;  3KRG A;  1OFM A;  1O8G A;  1XG2 A;  2VBM A;  5C1E A;  2NTB A;  4OJ6 A;  4YEL A;  2O0V A;  1BHE A;  4NK8 A;  3EQO A;  4U4B A;  4OZZ A;  4W8S A;  2X85 A;  1OGM X;  1O88 A;  2O04 A;  2EWE A;  3WWG A;  3GQ9 A;  4OZY A;  4EW9 A;  1OFL A;  1O8E A;  1RU4 A;  2X3H A;  3B4N A;  4XKW A;  1WMR A;  1O8J A;  3GQA A;  4XR6 A;  4U49 A;  4YZ0 A;  1VBL A;  1KCC A;  3LMW A;  4XOT A;  4W8T A;  4XOP A;  4Z03 A;  1O8M A;  4W8Q A;  4XLH A;  3VST A;  1NHC A;  4YEJ A;  1KCD A;  4HWV A;  4XLE A;  1KTW A;  2VJI A;  1OGO X;  2NTP A;  2QXZ A;  2X6Y A;  1JTA A;  2O17 A;  4XLC A;  4C2L A;  3SUC A;  1O8I A;  2O0W A;  1CZF A;  1RMG A;  3UW0 A;  4XL9 A;  2VBK A;  1PE9 A;  4I84 A;  4XNF A;  1PXZ A;  3B90 A;  3GQ7 A;  4NK6 A;  1IDK A;  1O8F A;  1RWR A;  1IA5 A;  3ZPP A;  4XN0 A;  4AVZ A;  2X6X A;  2X6W A;  4W8R A;  3ZSC A;  3T9G A;  4PMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...