5C1EA

Crystal structure of the pectin methylesterase from aspergillus niger in penultimately deglycosylated form (n-acetylglucosamine stub at asn84)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGNLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
molecule keywords Pectinesterase
total genus 112
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1eA00
3VSVA 4XOPA 4YZAA 1K5CA 2NTPA 3ZSCA 4XLCA 3B4NA 3GQ9A 3KRGA 1CZFA 1RMGA 4XN3A 4W8SA 2NT9A 2INUA 1VBLA 4MXNA 3VSTA 3JURA 4I84A 4OZYA 3GQAA 1O8DA 3SUCA 1DBOA 1O8JA 2NTQA 4Z03A 4XNFA 4W8QA 1RWRA 4MR0A 2O04A 4U4BA 2VJIA 1O8FA 4W8RA 3VMVA 1KCCA 4W8TA 4HWVA 4OJ6A 2X6WA 1PXZA 1O8LA 3UW0A 3VSUA 5AMVA 2PECA 1IB4A 1HG8A 1OFMA 2NSPA 2VBMA 4XLAA 1BHEA 1O8EA 1WMRA 4XN0A 1H80A 2VJJA 4U49A 1PLUA 3B90A 4XORA 2VBKA 4URRA 2NZMA 2X85A 2EWEA 4XLHA 1DBGA 1IDKA 4XLFA 2O0WA 1QJVA 2O17A 1JRGA 2X3HA 4OJPA 3LMWA 4AVZA 1QCXA 1OGMX 4XMYA 4NK6A 1OGOX 3GQ7A 4XL9A 4EW9A 3WWGA 4XQFA 1KTWA 3VMWA 1XG2A 2NT6A 2UVFA 1O8HA 1KCDA 3ZPPA 1RU4A 4XR6A 1O8MA 4OJOA 4OJ5A 3B8YA 1GQ8A 1O8IA 4C2LA 1OFLA 2Z8GA 1X0CA 2IQ7A 4XKVA 4XOTA 4XM3A 2PYHA 5C1CA 2NSTA 2NTBA 4OZZA 4XLEA 4YZQA 1JTAA 3T9GA 4YZ0A 3FY3A 3GQ8A 4OJLA 4YEJA 4XONA 2X6YA 4Z06A 2ODLA 5C1EA 1OOCA 2INVA 2O1DA 3EQNA 1IA5A 4PMHA 3EQOA 1EE6A 2UVEA 4YELA 2O0VA 2QX3A 2PYGA 1NHCA 1IDJA 1O8GA 2BSPA 2QXZA 3GRHA 1PE9A 4YZXA 2X6XA 1O88A 2QY1A 1O8KA 4NK8A 4XKWA 1BN8A 4Z05A 2VBEA 1AIRA
chains in the Genus database with same CATH superfamily
3SQVA 4XOPA 4YZAA 3SZEA 2NTPA 3VSVA 1K5CA 1QQ1A 3ZSCA 4XLCA 3B4NA 2J8IA 3GQ9A 1CZFA 3BH7B 1RMGA 1OFEA 3KRGA 1HF2A 4OPWA 4W8SA 4XN3A 2NT9A 2INUA 1VBLA 4MXNA 2XTXA 3VSTA 3JURA 4I84A 2QZAA 1L1IA 4YC5A 3AK5A 2BX6A 3GQAA 1O8DA 2BM5A 4OZYA 3SUCA 1DBOA 1O8JA 2NTQA 1KQ5A 3PSZA 4Z03A 2VFPA 4XNFA 4W8QA 1RWRA 4MR0A 3NAWA 1OFDA 2O04A 4U4BA 2VJIA 1O8FA 4W8RA 3VMVA 1KCCA 4W8TA 2BM4A 4HWVA 4OJ6A 2X6WA 4V02C 1PXZA 1O8LA 3UW0A 3VSUA 1EA0A 5AMVA 1TYWA 2PECA 1IB4A 1HG8A 1OFMA 3SYJA 1TYVA 2NSPA 1CLWA 2VBMA 4XLAA 4YCQA 1BHEA 3LJYA 1O8EA 1WMRA 1EZGA 4XN0A 1H80A 2VJJA 2J8KA 2V5IA 4U49A 1PLUA 3B90A 1QA1A 1WXRA 2O6WA 2XT2A 4XORA 2XTWA 2VBKA 3RIQA 4URRA 2NZMA 2X85A 2EWEA 3JX8A 1DBGA 1IDKA 4XLFA 1QRCA 2O0WA 4XLHA 1QJVA 3LYCA 2O17A 1JRGA 2X3HA 4OJPA 3LMWA 3N90A 4AVZA 2VFOA 1QCXA 1OGMX 2XC1A 2VFQA 4XMYA 4YDTA 1LLZA 1K4ZA 1OGOX 2QYUA 3DU1X 3GQ7A 4NK6A 4XL9A 3WWGA 4EW9A 1QRBA 4XQFA 1K8FA 1KTWA 3VMWA 3SY2A 1XG2A 2NT6A 2UVFA 1O8HA 5JMCB 1KCDA 3ZPPA 1RU4A 4XR6A 1O8MA 4OJOA 4OJ5A 3ML3A 3N6ZA 3B8YA 1GQ8A 1O8IA 1QA2A 4C2LA 1OFLA 2Z8GA 1X0CA 4YFOA 5JLVC 4YEIA 2IQ7A 4XKVA 4XOTA 4XM3A 5DNSA 2PYHA 5C1CA 2NSTA 4OM9A 2NTBA 4OZZA 4XLEA 4YZQA 2F3LA 1JTAA 2BM6A 3T9GA 4YZ0A 3FY3A 1LLWA 3BH6B 3GQ8A 2YUHA 4JRAC 4OJLA 4YEJA 4XONA 2X6YA 4Z06A 3H09A 1LM1A 1DABA 1TSPA 3P4GA 2ODLA 5C1EA 2G0YA 1OOCA 2INVA 2O1DA 2B0RA 2XT4A 3EQNA 1IA5A 4PMHA 3PSSA 3EQOA 1EE6A 2UVEA 4YELA 2W7ZA 2O0VA 2QX3A 2PYGA 1NHCA 1IDJA 2VFMA 2BM7A 3PETA 3TH0A 1O8GA 1QA3A 2VFNA 2BSPA 2QXZA 3GRHA 1PE9A 4YZXA 2IOUG 2X6XA 2XTYA 1TYXA 1O88A 2QY1A 1O8KA 4KH3A 4NK8A 4XKWA 1BN8A 1TYUA 3NB2A 4Z05A 2VBEA 1AIRA
chains in the Genus database with same CATH topology
3VSVA 4XOPA 4YZAA 1K5CA 2NTPA 3ZSCA 4XLCA 3B4NA 3GQ9A 3KRGA 1CZFA 1RMGA 4XN3A 4W8SA 2NT9A 2INUA 1VBLA 4MXNA 3VSTA 3JURA 4I84A 4OZYA 3GQAA 1O8DA 3SUCA 1DBOA 1O8JA 2NTQA 4Z03A 4XNFA 4W8QA 1RWRA 4MR0A 2O04A 4U4BA 2VJIA 1O8FA 4W8RA 3VMVA 1KCCA 4W8TA 4HWVA 4OJ6A 2X6WA 1PXZA 1O8LA 3UW0A 3VSUA 5AMVA 2PECA 1IB4A 1HG8A 1OFMA 2NSPA 2VBMA 4XLAA 1BHEA 1O8EA 1WMRA 4XN0A 1H80A 2VJJA 4U49A 1PLUA 3B90A 4XORA 2VBKA 4URRA 2NZMA 2X85A 2EWEA 4XLHA 1DBGA 1IDKA 4XLFA 2O0WA 1QJVA 2O17A 1JRGA 2X3HA 4OJPA 3LMWA 4AVZA 1QCXA 1OGMX 4XMYA 4NK6A 1OGOX 3GQ7A 4XL9A 4EW9A 3WWGA 4XQFA 1KTWA 3VMWA 1XG2A 2NT6A 2UVFA 1O8HA 1KCDA 3ZPPA 1RU4A 4XR6A 1O8MA 4OJOA 4OJ5A 3B8YA 1GQ8A 1O8IA 4C2LA 1OFLA 2Z8GA 1X0CA 2IQ7A 4XKVA 4XOTA 4XM3A 2PYHA 5C1CA 2NSTA 2NTBA 4OZZA 4XLEA 4YZQA 1JTAA 3T9GA 4YZ0A 3FY3A 3GQ8A 4OJLA 4YEJA 4XONA 2X6YA 4Z06A 2ODLA 5C1EA 1OOCA 2INVA 2O1DA 3EQNA 1IA5A 4PMHA 3EQOA 1EE6A 2UVEA 4YELA 2O0VA 2QX3A 2PYGA 1NHCA 1IDJA 1O8GA 2BSPA 2QXZA 3GRHA 1PE9A 4YZXA 2X6XA 1O88A 2QY1A 1O8KA 4NK8A 4XKWA 1BN8A 4Z05A 2VBEA 1AIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSV A;  4XOP A;  4YZA A;  1K5C A;  2NTP A;  3ZSC A;  4XLC A;  3B4N A;  3GQ9 A;  3KRG A;  1CZF A;  1RMG A;  4XN3 A;  4W8S A;  2NT9 A;  2INU A;  1VBL A;  4MXN A;  3VST A;  3JUR A;  4I84 A;  4OZY A;  3GQA A;  1O8D A;  3SUC A;  1DBO A;  1O8J A;  2NTQ A;  4Z03 A;  4XNF A;  4W8Q A;  1RWR A;  4MR0 A;  2O04 A;  4U4B A;  2VJI A;  1O8F A;  4W8R A;  3VMV A;  1KCC A;  4W8T A;  4HWV A;  4OJ6 A;  2X6W A;  1PXZ A;  1O8L A;  3UW0 A;  3VSU A;  5AMV A;  2PEC A;  1IB4 A;  1HG8 A;  1OFM A;  2NSP A;  2VBM A;  4XLA A;  1BHE A;  1O8E A;  1WMR A;  4XN0 A;  1H80 A;  2VJJ A;  4U49 A;  1PLU A;  3B90 A;  4XOR A;  2VBK A;  4URR A;  2NZM A;  2X85 A;  2EWE A;  4XLH A;  1DBG A;  1IDK A;  4XLF A;  2O0W A;  1QJV A;  2O17 A;  1JRG A;  2X3H A;  4OJP A;  3LMW A;  4AVZ A;  1QCX A;  1OGM X;  4XMY A;  4NK6 A;  1OGO X;  3GQ7 A;  4XL9 A;  4EW9 A;  3WWG A;  4XQF A;  1KTW A;  3VMW A;  1XG2 A;  2NT6 A;  2UVF A;  1O8H A;  1KCD A;  3ZPP A;  1RU4 A;  4XR6 A;  1O8M A;  4OJO A;  4OJ5 A;  3B8Y A;  1GQ8 A;  1O8I A;  4C2L A;  1OFL A;  2Z8G A;  1X0C A;  2IQ7 A;  4XKV A;  4XOT A;  4XM3 A;  2PYH A;  5C1C A;  2NST A;  2NTB A;  4OZZ A;  4XLE A;  4YZQ A;  1JTA A;  3T9G A;  4YZ0 A;  3FY3 A;  3GQ8 A;  4OJL A;  4YEJ A;  4XON A;  2X6Y A;  4Z06 A;  2ODL A;  5C1E A;  1OOC A;  2INV A;  2O1D A;  3EQN A;  1IA5 A;  4PMH A;  3EQO A;  1EE6 A;  2UVE A;  4YEL A;  2O0V A;  2QX3 A;  2PYG A;  1NHC A;  1IDJ A;  1O8G A;  2BSP A;  2QXZ A;  3GRH A;  1PE9 A;  4YZX A;  2X6X A;  1O88 A;  2QY1 A;  1O8K A;  4NK8 A;  4XKW A;  1BN8 A;  4Z05 A;  2VBE A;  1AIR A; 
#chains in the Genus database with same CATH topology
 3SQV A;  4XOP A;  4YZA A;  3SZE A;  2NTP A;  3VSV A;  1K5C A;  1QQ1 A;  3ZSC A;  4XLC A;  3B4N A;  2J8I A;  3GQ9 A;  1CZF A;  3BH7 B;  1RMG A;  1OFE A;  3KRG A;  1HF2 A;  4OPW A;  4W8S A;  4XN3 A;  2NT9 A;  2INU A;  1VBL A;  4MXN A;  2XTX A;  3VST A;  3JUR A;  4I84 A;  2QZA A;  1L1I A;  4YC5 A;  3AK5 A;  2BX6 A;  3GQA A;  1O8D A;  2BM5 A;  4OZY A;  3SUC A;  1DBO A;  1O8J A;  2NTQ A;  1KQ5 A;  3PSZ A;  4Z03 A;  2VFP A;  4XNF A;  4W8Q A;  1RWR A;  4MR0 A;  3NAW A;  1OFD A;  2O04 A;  4U4B A;  2VJI A;  1O8F A;  4W8R A;  3VMV A;  1KCC A;  4W8T A;  2BM4 A;  4HWV A;  4OJ6 A;  2X6W A;  4V02 C;  1PXZ A;  1O8L A;  3UW0 A;  3VSU A;  1EA0 A;  5AMV A;  1TYW A;  2PEC A;  1IB4 A;  1HG8 A;  1OFM A;  3SYJ A;  1TYV A;  2NSP A;  1CLW A;  2VBM A;  4XLA A;  4YCQ A;  1BHE A;  3LJY A;  1O8E A;  1WMR A;  1EZG A;  4XN0 A;  1H80 A;  2VJJ A;  2J8K A;  2V5I A;  4U49 A;  1PLU A;  3B90 A;  1QA1 A;  1WXR A;  2O6W A;  2XT2 A;  4XOR A;  2XTW A;  2VBK A;  3RIQ A;  4URR A;  2NZM A;  2X85 A;  2EWE A;  3JX8 A;  1DBG A;  1IDK A;  4XLF A;  1QRC A;  2O0W A;  4XLH A;  1QJV A;  3LYC A;  2O17 A;  1JRG A;  2X3H A;  4OJP A;  3LMW A;  3N90 A;  4AVZ A;  2VFO A;  1QCX A;  1OGM X;  2XC1 A;  2VFQ A;  4XMY A;  4YDT A;  1LLZ A;  1K4Z A;  1OGO X;  2QYU A;  3DU1 X;  3GQ7 A;  4NK6 A;  4XL9 A;  3WWG A;  4EW9 A;  1QRB A;  4XQF A;  1K8F A;  1KTW A;  3VMW A;  3SY2 A;  1XG2 A;  2NT6 A;  2UVF A;  1O8H A;  5JMC B;  1KCD A;  3ZPP A;  1RU4 A;  4XR6 A;  1O8M A;  4OJO A;  4OJ5 A;  3ML3 A;  3N6Z A;  3B8Y A;  1GQ8 A;  1O8I A;  1QA2 A;  4C2L A;  1OFL A;  2Z8G A;  1X0C A;  4YFO A;  5JLV C;  4YEI A;  2IQ7 A;  4XKV A;  4XOT A;  4XM3 A;  5DNS A;  2PYH A;  5C1C A;  2NST A;  4OM9 A;  2NTB A;  4OZZ A;  4XLE A;  4YZQ A;  2F3L A;  1JTA A;  2BM6 A;  3T9G A;  4YZ0 A;  3FY3 A;  1LLW A;  3BH6 B;  3GQ8 A;  2YUH A;  4JRA C;  4OJL A;  4YEJ A;  4XON A;  2X6Y A;  4Z06 A;  3H09 A;  1LM1 A;  1DAB A;  1TSP A;  3P4G A;  2ODL A;  5C1E A;  2G0Y A;  1OOC A;  2INV A;  2O1D A;  2B0R A;  2XT4 A;  3EQN A;  1IA5 A;  4PMH A;  3PSS A;  3EQO A;  1EE6 A;  2UVE A;  4YEL A;  2W7Z A;  2O0V A;  2QX3 A;  2PYG A;  1NHC A;  1IDJ A;  2VFM A;  2BM7 A;  3PET A;  3TH0 A;  1O8G A;  1QA3 A;  2VFN A;  2BSP A;  2QXZ A;  3GRH A;  1PE9 A;  4YZX A;  2IOU G;  2X6X A;  2XTY A;  1TYX A;  1O88 A;  2QY1 A;  1O8K A;  4KH3 A;  4NK8 A;  4XKW A;  1BN8 A;  1TYU A;  3NB2 A;  4Z05 A;  2VBE A;  1AIR A; 
#chains in the Genus database with same CATH homology
 3VSV A;  4XOP A;  4YZA A;  1K5C A;  2NTP A;  3ZSC A;  4XLC A;  3B4N A;  3GQ9 A;  3KRG A;  1CZF A;  1RMG A;  4XN3 A;  4W8S A;  2NT9 A;  2INU A;  1VBL A;  4MXN A;  3VST A;  3JUR A;  4I84 A;  4OZY A;  3GQA A;  1O8D A;  3SUC A;  1DBO A;  1O8J A;  2NTQ A;  4Z03 A;  4XNF A;  4W8Q A;  1RWR A;  4MR0 A;  2O04 A;  4U4B A;  2VJI A;  1O8F A;  4W8R A;  3VMV A;  1KCC A;  4W8T A;  4HWV A;  4OJ6 A;  2X6W A;  1PXZ A;  1O8L A;  3UW0 A;  3VSU A;  5AMV A;  2PEC A;  1IB4 A;  1HG8 A;  1OFM A;  2NSP A;  2VBM A;  4XLA A;  1BHE A;  1O8E A;  1WMR A;  4XN0 A;  1H80 A;  2VJJ A;  4U49 A;  1PLU A;  3B90 A;  4XOR A;  2VBK A;  4URR A;  2NZM A;  2X85 A;  2EWE A;  4XLH A;  1DBG A;  1IDK A;  4XLF A;  2O0W A;  1QJV A;  2O17 A;  1JRG A;  2X3H A;  4OJP A;  3LMW A;  4AVZ A;  1QCX A;  1OGM X;  4XMY A;  4NK6 A;  1OGO X;  3GQ7 A;  4XL9 A;  4EW9 A;  3WWG A;  4XQF A;  1KTW A;  3VMW A;  1XG2 A;  2NT6 A;  2UVF A;  1O8H A;  1KCD A;  3ZPP A;  1RU4 A;  4XR6 A;  1O8M A;  4OJO A;  4OJ5 A;  3B8Y A;  1GQ8 A;  1O8I A;  4C2L A;  1OFL A;  2Z8G A;  1X0C A;  2IQ7 A;  4XKV A;  4XOT A;  4XM3 A;  2PYH A;  5C1C A;  2NST A;  2NTB A;  4OZZ A;  4XLE A;  4YZQ A;  1JTA A;  3T9G A;  4YZ0 A;  3FY3 A;  3GQ8 A;  4OJL A;  4YEJ A;  4XON A;  2X6Y A;  4Z06 A;  2ODL A;  5C1E A;  1OOC A;  2INV A;  2O1D A;  3EQN A;  1IA5 A;  4PMH A;  3EQO A;  1EE6 A;  2UVE A;  4YEL A;  2O0V A;  2QX3 A;  2PYG A;  1NHC A;  1IDJ A;  1O8G A;  2BSP A;  2QXZ A;  3GRH A;  1PE9 A;  4YZX A;  2X6X A;  1O88 A;  2QY1 A;  1O8K A;  4NK8 A;  4XKW A;  1BN8 A;  4Z05 A;  2VBE A;  1AIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...