5C1EA

Crystal structure of the pectin methylesterase from aspergillus niger in penultimately deglycosylated form (n-acetylglucosamine stub at asn84)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
299
structure length
299
Chain Sequence
ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGNLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
molecule keywords Pectinesterase
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
molecule tags Hydrolase
total genus 112
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1eA00
3JURA 4XLEA 4XMYA 1EE6A 3B90A 3VSUA 2Z8GA 3ZSCA 3GRHA 1PLUA 4YZ0A 4W8TA 4MR0A 4OJ6A 2INVA 3GQ7A 4XKVA 2X6YA 1DBOA 2NT6A 2NT9A 2O04A 2QXZA 1X0CA 1AIRA 4U4BA 1KTWA 1QCXA 4XR6A 1K5CA 2UVEA 4W8RA 4C2LA 4XOPA 1OFMA 4YEJA 4NK6A 1O88A 3KRGA 3UW0A 4XL9A 3LMWA 1IDJA 3B8YA 4XLHA 4XKWA 1O8GA 4OZZA 4XORA 1IB4A 1OGMX 2NSTA 4XN0A 1O8IA 3B4NA 4YZXA 2QY1A 1KCDA 4NK8A 2X6XA 4Z03A 2NTPA 1XG2A 2O0VA 2ODLA 2VBMA 3EQOA 2UVFA 4OJ5A 4URRA 3VMWA 1JRGA 3GQ9A 2BSPA 1PE9A 2X85A 2IQ7A 4Z06A 1KCCA 1BHEA 3SUCA 5AMVA 4XN3A 1RWRA 4PMHA 1O8EA 3VSTA 2NSPA 4W8SA 4XLAA 1JTAA 1CZFA 1GQ8A 1WMRA 1IA5A 2NTQA 4MXNA 3VSVA 1HG8A 1O8DA 1DBGA 2INUA 4U49A 4OZYA 1PXZA 1RU4A 2PYGA 4XLCA 4W8QA 2O0WA 2NTBA 1O8KA 1VBLA 3FY3A 2VJIA 3EQNA 2QX3A 1O8FA 2X3HA 2PECA 4YZQA 4EW9A 2NZMA 4YELA 1OOCA 2VBKA 4OJOA 4XLFA 4XOTA 1IDKA 1RMGA 2VJJA 1BN8A 3WWGA 2O17A 1O8JA 2O1DA 3GQAA 4YZAA 1O8HA 3VMVA 2X6WA 1OGOX 1O8LA 4OJLA 2PYHA 4XQFA 3ZPPA 2EWEA 5C1CA 2VBEA 3T9GA 4AVZA 1OFLA 4HWVA 1O8MA 4XNFA 4XONA 1H80A 3GQ8A 1QJVA 4XM3A 1NHCA 5C1EA 4Z05A 4OJPA 4I84A
chains in the Genus database with same CATH superfamily
4I84A 2BM6A 3JURA 4XMYA 1EE6A 3B90A 4XLEA 2Z8GA 3VSUA 2VFMA 3GRHA 3ZSCA 1EZGA 1PLUA 5DNSA 4YZ0A 3SZEA 4W8TA 4MR0A 4OJ6A 3RIQA 1LLZA 2BM7A 2INVA 3GQ7A 2J8KA 3N6ZA 4XKVA 2X6YA 1DBOA 2NT6A 2NT9A 2O04A 2QXZA 4KH3A 2V5IA 1X0CA 1AIRA 4U4BA 1KTWA 1QCXA 4XR6A 1K5CA 2UVEA 1WXRA 3JX8A 2XT4A 1TYUA 2BX6A 3PSZA 1K4ZA 1K8FA 4W8RA 4C2LA 4XOPA 3ML3A 1OFMA 4YEJA 1QA3A 1OFEA 4NK6A 1KQ5A 1O88A 3KRGA 3UW0A 4YDTA 4XL9A 3LMWA 4YCQA 1TSPA 3TH0A 1IDJA 3BH6B 3B8YA 4XLHA 4XKWA 1O8GA 4OZZA 4XORA 1IB4A 1OGMX 2VFOA 2NSTA 2G0YA 4XN0A 1O8IA 3B4NA 4YZXA 2QY1A 1KCDA 4NK8A 4OPWA 2X6XA 3PETA 4Z03A 2NTPA 1XG2A 2O0VA 2ODLA 2VBMA 3EQOA 2UVFA 4OJ5A 4URRA 3VMWA 1JRGA 2XC1A 2VFQA 3GQ9A 2J8IA 3NAWA 3LJYA 2BSPA 1PE9A 1L1IA 2X85A 2IQ7A 4Z06A 1KCCA 1BHEA 2BM4A 1LM1A 3SUCA 5AMVA 2XTWA 4XQFA 4XN3A 1QRCA 4YEIA 2XTYA 1RWRA 4PMHA 1O8EA 3VSTA 3N90A 3NB2A 2NSPA 4W8SA 4XLAA 1JTAA 1TYXA 1CZFA 5JMCB 2YUHA 1GQ8A 1WMRA 1IA5A 2NTQA 3LYCA 4MXNA 3VSVA 1CLWA 1HG8A 2W7ZA 1O8DA 1DBGA 3DU1X 2INUA 4U49A 1QQ1A 1LLWA 4OZYA 1PXZA 1RU4A 2PYGA 4XLCA 4W8QA 1QA1A 2XTXA 5JLVC 2O0WA 4YC5A 2NTBA 4JRAC 1O8KA 2VFPA 1HF2A 1VBLA 3FY3A 1TYVA 2VJIA 3EQNA 3H09A 4OM9A 2QX3A 1O8FA 2X3HA 1DABA 2PECA 4YZQA 4EW9A 3P4GA 1QRBA 2F3LA 2NZMA 4V02C 3SYJA 4YELA 1OOCA 2VBKA 4OJOA 4XLFA 4XOTA 1IDKA 1RMGA 2VJJA 1BN8A 3SY2A 2XT2A 3WWGA 2O17A 3AK5A 1O8JA 2O1DA 3GQAA 4YZAA 1QA2A 3SQVA 1O8HA 2BM5A 3VMVA 2X6WA 1OGOX 1O8LA 2IOUG 2PYHA 2VFNA 4OJLA 2EWEA 3ZPPA 3PSSA 4YFOA 2VBEA 3T9GA 5C1CA 4AVZA 1EA0A 1OFLA 2B0RA 1O8MA 2O6WA 3BH7B 4HWVA 4XNFA 4XONA 1H80A 3GQ8A 1QJVA 4XM3A 1NHCA 2QZAA 5C1EA 2QYUA 4Z05A 1OFDA 4OJPA 1TYWA
chains in the Genus database with same CATH topology
3JURA 4XLEA 4XMYA 1EE6A 3B90A 3VSUA 2Z8GA 3ZSCA 3GRHA 1PLUA 4YZ0A 4W8TA 4MR0A 4OJ6A 2INVA 3GQ7A 4XKVA 2X6YA 1DBOA 2NT6A 2NT9A 2O04A 2QXZA 1X0CA 1AIRA 4U4BA 1KTWA 1QCXA 4XR6A 1K5CA 2UVEA 4W8RA 4C2LA 4XOPA 1OFMA 4YEJA 4NK6A 1O88A 3KRGA 3UW0A 4XL9A 3LMWA 1IDJA 3B8YA 4XLHA 4XKWA 1O8GA 4OZZA 4XORA 1IB4A 1OGMX 2NSTA 4XN0A 1O8IA 3B4NA 4YZXA 2QY1A 1KCDA 4NK8A 2X6XA 4Z03A 2NTPA 1XG2A 2O0VA 2ODLA 2VBMA 3EQOA 2UVFA 4OJ5A 4URRA 3VMWA 1JRGA 3GQ9A 2BSPA 1PE9A 2X85A 2IQ7A 4Z06A 1KCCA 1BHEA 3SUCA 5AMVA 4XN3A 1RWRA 4PMHA 1O8EA 3VSTA 2NSPA 4W8SA 4XLAA 1JTAA 1CZFA 1GQ8A 1WMRA 1IA5A 2NTQA 4MXNA 3VSVA 1HG8A 1O8DA 1DBGA 2INUA 4U49A 4OZYA 1PXZA 1RU4A 2PYGA 4XLCA 4W8QA 2O0WA 2NTBA 1O8KA 1VBLA 3FY3A 2VJIA 3EQNA 2QX3A 1O8FA 2X3HA 2PECA 4YZQA 4EW9A 2NZMA 4YELA 1OOCA 2VBKA 4OJOA 4XLFA 4XOTA 1IDKA 1RMGA 2VJJA 1BN8A 3WWGA 2O17A 1O8JA 2O1DA 3GQAA 4YZAA 1O8HA 3VMVA 2X6WA 1OGOX 1O8LA 4OJLA 2PYHA 4XQFA 3ZPPA 2EWEA 5C1CA 2VBEA 3T9GA 4AVZA 1OFLA 4HWVA 1O8MA 4XNFA 4XONA 1H80A 3GQ8A 1QJVA 4XM3A 1NHCA 5C1EA 4Z05A 4OJPA 4I84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUR A;  4XLE A;  4XMY A;  1EE6 A;  3B90 A;  3VSU A;  2Z8G A;  3ZSC A;  3GRH A;  1PLU A;  4YZ0 A;  4W8T A;  4MR0 A;  4OJ6 A;  2INV A;  3GQ7 A;  4XKV A;  2X6Y A;  1DBO A;  2NT6 A;  2NT9 A;  2O04 A;  2QXZ A;  1X0C A;  1AIR A;  4U4B A;  1KTW A;  1QCX A;  4XR6 A;  1K5C A;  2UVE A;  4W8R A;  4C2L A;  4XOP A;  1OFM A;  4YEJ A;  4NK6 A;  1O88 A;  3KRG A;  3UW0 A;  4XL9 A;  3LMW A;  1IDJ A;  3B8Y A;  4XLH A;  4XKW A;  1O8G A;  4OZZ A;  4XOR A;  1IB4 A;  1OGM X;  2NST A;  4XN0 A;  1O8I A;  3B4N A;  4YZX A;  2QY1 A;  1KCD A;  4NK8 A;  2X6X A;  4Z03 A;  2NTP A;  1XG2 A;  2O0V A;  2ODL A;  2VBM A;  3EQO A;  2UVF A;  4OJ5 A;  4URR A;  3VMW A;  1JRG A;  3GQ9 A;  2BSP A;  1PE9 A;  2X85 A;  2IQ7 A;  4Z06 A;  1KCC A;  1BHE A;  3SUC A;  5AMV A;  4XN3 A;  1RWR A;  4PMH A;  1O8E A;  3VST A;  2NSP A;  4W8S A;  4XLA A;  1JTA A;  1CZF A;  1GQ8 A;  1WMR A;  1IA5 A;  2NTQ A;  4MXN A;  3VSV A;  1HG8 A;  1O8D A;  1DBG A;  2INU A;  4U49 A;  4OZY A;  1PXZ A;  1RU4 A;  2PYG A;  4XLC A;  4W8Q A;  2O0W A;  2NTB A;  1O8K A;  1VBL A;  3FY3 A;  2VJI A;  3EQN A;  2QX3 A;  1O8F A;  2X3H A;  2PEC A;  4YZQ A;  4EW9 A;  2NZM A;  4YEL A;  1OOC A;  2VBK A;  4OJO A;  4XLF A;  4XOT A;  1IDK A;  1RMG A;  2VJJ A;  1BN8 A;  3WWG A;  2O17 A;  1O8J A;  2O1D A;  3GQA A;  4YZA A;  1O8H A;  3VMV A;  2X6W A;  1OGO X;  1O8L A;  4OJL A;  2PYH A;  4XQF A;  3ZPP A;  2EWE A;  5C1C A;  2VBE A;  3T9G A;  4AVZ A;  1OFL A;  4HWV A;  1O8M A;  4XNF A;  4XON A;  1H80 A;  3GQ8 A;  1QJV A;  4XM3 A;  1NHC A;  5C1E A;  4Z05 A;  4OJP A;  4I84 A; 
#chains in the Genus database with same CATH topology
 4I84 A;  2BM6 A;  3JUR A;  4XMY A;  1EE6 A;  3B90 A;  4XLE A;  2Z8G A;  3VSU A;  2VFM A;  3GRH A;  3ZSC A;  1EZG A;  1PLU A;  5DNS A;  4YZ0 A;  3SZE A;  4W8T A;  4MR0 A;  4OJ6 A;  3RIQ A;  1LLZ A;  2BM7 A;  2INV A;  3GQ7 A;  2J8K A;  3N6Z A;  4XKV A;  2X6Y A;  1DBO A;  2NT6 A;  2NT9 A;  2O04 A;  2QXZ A;  4KH3 A;  2V5I A;  1X0C A;  1AIR A;  4U4B A;  1KTW A;  1QCX A;  4XR6 A;  1K5C A;  2UVE A;  1WXR A;  3JX8 A;  2XT4 A;  1TYU A;  2BX6 A;  3PSZ A;  1K4Z A;  1K8F A;  4W8R A;  4C2L A;  4XOP A;  3ML3 A;  1OFM A;  4YEJ A;  1QA3 A;  1OFE A;  4NK6 A;  1KQ5 A;  1O88 A;  3KRG A;  3UW0 A;  4YDT A;  4XL9 A;  3LMW A;  4YCQ A;  1TSP A;  3TH0 A;  1IDJ A;  3BH6 B;  3B8Y A;  4XLH A;  4XKW A;  1O8G A;  4OZZ A;  4XOR A;  1IB4 A;  1OGM X;  2VFO A;  2NST A;  2G0Y A;  4XN0 A;  1O8I A;  3B4N A;  4YZX A;  2QY1 A;  1KCD A;  4NK8 A;  4OPW A;  2X6X A;  3PET A;  4Z03 A;  2NTP A;  1XG2 A;  2O0V A;  2ODL A;  2VBM A;  3EQO A;  2UVF A;  4OJ5 A;  4URR A;  3VMW A;  1JRG A;  2XC1 A;  2VFQ A;  3GQ9 A;  2J8I A;  3NAW A;  3LJY A;  2BSP A;  1PE9 A;  1L1I A;  2X85 A;  2IQ7 A;  4Z06 A;  1KCC A;  1BHE A;  2BM4 A;  1LM1 A;  3SUC A;  5AMV A;  2XTW A;  4XQF A;  4XN3 A;  1QRC A;  4YEI A;  2XTY A;  1RWR A;  4PMH A;  1O8E A;  3VST A;  3N90 A;  3NB2 A;  2NSP A;  4W8S A;  4XLA A;  1JTA A;  1TYX A;  1CZF A;  5JMC B;  2YUH A;  1GQ8 A;  1WMR A;  1IA5 A;  2NTQ A;  3LYC A;  4MXN A;  3VSV A;  1CLW A;  1HG8 A;  2W7Z A;  1O8D A;  1DBG A;  3DU1 X;  2INU A;  4U49 A;  1QQ1 A;  1LLW A;  4OZY A;  1PXZ A;  1RU4 A;  2PYG A;  4XLC A;  4W8Q A;  1QA1 A;  2XTX A;  5JLV C;  2O0W A;  4YC5 A;  2NTB A;  4JRA C;  1O8K A;  2VFP A;  1HF2 A;  1VBL A;  3FY3 A;  1TYV A;  2VJI A;  3EQN A;  3H09 A;  4OM9 A;  2QX3 A;  1O8F A;  2X3H A;  1DAB A;  2PEC A;  4YZQ A;  4EW9 A;  3P4G A;  1QRB A;  2F3L A;  2NZM A;  4V02 C;  3SYJ A;  4YEL A;  1OOC A;  2VBK A;  4OJO A;  4XLF A;  4XOT A;  1IDK A;  1RMG A;  2VJJ A;  1BN8 A;  3SY2 A;  2XT2 A;  3WWG A;  2O17 A;  3AK5 A;  1O8J A;  2O1D A;  3GQA A;  4YZA A;  1QA2 A;  3SQV A;  1O8H A;  2BM5 A;  3VMV A;  2X6W A;  1OGO X;  1O8L A;  2IOU G;  2PYH A;  2VFN A;  4OJL A;  2EWE A;  3ZPP A;  3PSS A;  4YFO A;  2VBE A;  3T9G A;  5C1C A;  4AVZ A;  1EA0 A;  1OFL A;  2B0R A;  1O8M A;  2O6W A;  3BH7 B;  4HWV A;  4XNF A;  4XON A;  1H80 A;  3GQ8 A;  1QJV A;  4XM3 A;  1NHC A;  2QZA A;  5C1E A;  2QYU A;  4Z05 A;  1OFD A;  4OJP A;  1TYW A; 
#chains in the Genus database with same CATH homology
 3JUR A;  4XLE A;  4XMY A;  1EE6 A;  3B90 A;  3VSU A;  2Z8G A;  3ZSC A;  3GRH A;  1PLU A;  4YZ0 A;  4W8T A;  4MR0 A;  4OJ6 A;  2INV A;  3GQ7 A;  4XKV A;  2X6Y A;  1DBO A;  2NT6 A;  2NT9 A;  2O04 A;  2QXZ A;  1X0C A;  1AIR A;  4U4B A;  1KTW A;  1QCX A;  4XR6 A;  1K5C A;  2UVE A;  4W8R A;  4C2L A;  4XOP A;  1OFM A;  4YEJ A;  4NK6 A;  1O88 A;  3KRG A;  3UW0 A;  4XL9 A;  3LMW A;  1IDJ A;  3B8Y A;  4XLH A;  4XKW A;  1O8G A;  4OZZ A;  4XOR A;  1IB4 A;  1OGM X;  2NST A;  4XN0 A;  1O8I A;  3B4N A;  4YZX A;  2QY1 A;  1KCD A;  4NK8 A;  2X6X A;  4Z03 A;  2NTP A;  1XG2 A;  2O0V A;  2ODL A;  2VBM A;  3EQO A;  2UVF A;  4OJ5 A;  4URR A;  3VMW A;  1JRG A;  3GQ9 A;  2BSP A;  1PE9 A;  2X85 A;  2IQ7 A;  4Z06 A;  1KCC A;  1BHE A;  3SUC A;  5AMV A;  4XN3 A;  1RWR A;  4PMH A;  1O8E A;  3VST A;  2NSP A;  4W8S A;  4XLA A;  1JTA A;  1CZF A;  1GQ8 A;  1WMR A;  1IA5 A;  2NTQ A;  4MXN A;  3VSV A;  1HG8 A;  1O8D A;  1DBG A;  2INU A;  4U49 A;  4OZY A;  1PXZ A;  1RU4 A;  2PYG A;  4XLC A;  4W8Q A;  2O0W A;  2NTB A;  1O8K A;  1VBL A;  3FY3 A;  2VJI A;  3EQN A;  2QX3 A;  1O8F A;  2X3H A;  2PEC A;  4YZQ A;  4EW9 A;  2NZM A;  4YEL A;  1OOC A;  2VBK A;  4OJO A;  4XLF A;  4XOT A;  1IDK A;  1RMG A;  2VJJ A;  1BN8 A;  3WWG A;  2O17 A;  1O8J A;  2O1D A;  3GQA A;  4YZA A;  1O8H A;  3VMV A;  2X6W A;  1OGO X;  1O8L A;  4OJL A;  2PYH A;  4XQF A;  3ZPP A;  2EWE A;  5C1C A;  2VBE A;  3T9G A;  4AVZ A;  1OFL A;  4HWV A;  1O8M A;  4XNF A;  4XON A;  1H80 A;  3GQ8 A;  1QJV A;  4XM3 A;  1NHC A;  5C1E A;  4Z05 A;  4OJP A;  4I84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...