5C1EA

Crystal structure of the pectin methylesterase from aspergillus niger in penultimately deglycosylated form (n-acetylglucosamine stub at asn84)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
299
structure length
299
Chain Sequence
b'ESRTSAPSGCLTVGSDGTYSTIGDALDALGSSTSSACIYVASGTYEEQLTIDYAGNLTLYGETTDTSTYKDNVVTITHTISSPDAGSLDKSATVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYSNCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVSLTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDREYETSISAAVDKTTVLGETWGDWIDRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase
molecule tags Hydrolase
source organism Aspergillus niger (strain atcc 1015 / cbs 113.46 / fgsc a1144 / lshb ac4 / nctc
publication title Structure and Properties of a Non-processive, Salt-requiring, and Acidophilic Pectin Methylesterase from Aspergillus niger Provide Insights into the Key Determinants of Processivity Control.
pubmed doi rcsb
total genus 112
structure length 299
sequence length 299
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2015-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 5c1eA00
4YELA 4XONA 2O04A 3KRGA 4XKWA 3VSTA 2NSPA 2VBMA 1O8KA 5C1CA 3JURA 4XLFA 4XQFA 3FY3A 4OJLA 1O8DA 4XKVA 4XLCA 1QJVA 2NT9A 2O17A 2PYHA 3ZSCA 3GQ9A 3EQNA 4OZZA 1QCXA 2PYGA 2VBKA 3VSUA 4YZQA 1CZFA 1BN8A 2O0WA 4W8TA 4XLEA 1IA5A 1O8EA 4HWVA 1EE6A 2INVA 4XL9A 4XLHA 4XR6A 4YEJA 4Z03A 1KCDA 1WMRA 4XORA 3ZPPA 1RWRA 4W8QA 4YZXA 1O8GA 4MXNA 3VMWA 1IDKA 4YZAA 3T9GA 2NZMA 1DBGA 2VJJA 4Z06A 4NK6A 4URRA 2BSPA 3VSVA 1XG2A 3UW0A 1X0CA 3SUCA 2O1DA 3B90A 2NSTA 4W8SA 4OJ5A 4W8RA 4AVZA 2X85A 4C2LA 2NT6A 4EW9A 1JRGA 4I84A 1DBOA 5C1EA 3GQ7A 2EWEA 4OJPA 2VJIA 1O8JA 1OGMX 4XNFA 1KCCA 1IB4A 1K5CA 4Z05A 1H80A 2PECA 1PXZA 1BHEA 5AMVA 1OOCA 1OGOX 1VBLA 2ODLA 2X6WA 2QXZA 1O8MA 2O0VA 3GQ8A 4PMHA 2NTBA 2NTQA 1O8IA 3GRHA 1KTWA 4MR0A 2Z8GA 4XN0A 1JTAA 4XMYA 2VBEA 2QX3A 3B8YA 1AIRA 1RMGA 3EQOA 4XN3A 4NK8A 1O8HA 2X6XA 1GQ8A 2INUA 1O88A 4OZYA 1O8FA 1RU4A 3B4NA 4OJOA 2UVEA 3WWGA 1O8LA 1OFLA 3GQAA 3LMWA 2IQ7A 1PE9A 2X3HA 4XLAA 1NHCA 2UVFA 4U4BA 1OFMA 4XOPA 4YZ0A 4XM3A 1IDJA 2X6YA 4XOTA 4OJ6A 3VMVA 4U49A 1PLUA 2QY1A 1HG8A 2NTPA
chains in the Genus database with same CATH superfamily
4YELA 2V5IA 4XONA 2O04A 1TYXA 3KRGA 4XKWA 4YDTA 2XTWA 3VSTA 1HF2A 2NSPA 2QYUA 2VBMA 4JRAC 1O8KA 5C1CA 3JURA 2VFOA 4XLFA 2BM4A 4XQFA 3FY3A 3JX8A 4OJLA 1O8DA 2BM7A 3BH7B 4XKVA 4XLCA 1QJVA 2NT9A 2O17A 2PYHA 1K8FA 3ZSCA 3GQ9A 3EQNA 3LJYA 4OZZA 1QCXA 2PYGA 2VBKA 3VSUA 4YZQA 1CZFA 1BN8A 2O0WA 4W8TA 2IOUG 4XLEA 1IA5A 4YC5A 1O8EA 4HWVA 1EE6A 3LYCA 2INVA 4XL9A 4XLHA 1TYVA 4XR6A 2BM6A 3NB2A 4YEJA 4Z03A 1KCDA 1WMRA 4XORA 3ZPPA 1RWRA 4W8QA 4YZXA 4YEIA 1O8GA 1L1IA 4MXNA 3VMWA 1IDKA 4YZAA 3T9GA 2NZMA 2G0YA 3BH6B 4V02C 2XC1A 1DBGA 2VJJA 4Z06A 4NK6A 4URRA 2BSPA 3VSVA 1XG2A 3UW0A 1QRBA 1LM1A 1X0CA 2BM5A 3SUCA 2O1DA 1LLZA 3B90A 1QQ1A 1DABA 2NSTA 3P4GA 2J8KA 4W8SA 1WXRA 4OJ5A 4W8RA 2XTXA 1EA0A 4AVZA 2X85A 1LLWA 2VFNA 4C2LA 4OM9A 2NT6A 4EW9A 1JRGA 4I84A 2XTYA 3RIQA 1QA3A 1DBOA 3PSSA 5C1EA 3GQ7A 2EWEA 4OJPA 2F3LA 2VJIA 3SZEA 1O8JA 1OGMX 4XNFA 1KCCA 3N6ZA 3ML3A 1IB4A 1K5CA 4Z05A 1QA1A 1H80A 2PECA 1PXZA 1TYWA 3NAWA 2XT4A 5DNSA 1BHEA 5AMVA 3TH0A 3SYJA 3AK5A 1OOCA 1TSPA 1QA2A 5JLVC 3H09A 1OGOX 1VBLA 2ODLA 2X6WA 1OFEA 2QXZA 1O8MA 2O0VA 3GQ8A 4PMHA 2NTBA 2NTQA 2VFMA 4YFOA 4OPWA 1O8IA 1TYUA 1KTWA 3GRHA 4MR0A 2Z8GA 4XN0A 1JTAA 4YCQA 4XMYA 2YUHA 3SQVA 2VBEA 2XT2A 2J8IA 2QX3A 3B8YA 1AIRA 1RMGA 3EQOA 1QRCA 4XN3A 4NK8A 1O8HA 1K4ZA 2QZAA 2X6XA 1EZGA 1GQ8A 1KQ5A 2INUA 1O88A 5JMCB 4OZYA 1O8FA 1RU4A 3B4NA 4OJOA 2UVEA 3WWGA 1O8LA 1OFLA 3GQAA 3LMWA 2IQ7A 1PE9A 2X3HA 3PETA 4XLAA 1NHCA 2VFPA 2UVFA 1OFDA 4U4BA 1OFMA 4XOPA 4YZ0A 4XM3A 2VFQA 3PSZA 1IDJA 2X6YA 4KH3A 4XOTA 2B0RA 2BX6A 4OJ6A 3VMVA 3DU1X 4U49A 1CLWA 1PLUA 2O6WA 3N90A 3SY2A 2QY1A 1HG8A 2NTPA 2W7ZA
chains in the Genus database with same CATH topology
4YELA 4XONA 2O04A 3KRGA 4XKWA 3VSTA 2NSPA 2VBMA 1O8KA 5C1CA 3JURA 4XLFA 4XQFA 3FY3A 4OJLA 1O8DA 4XKVA 4XLCA 1QJVA 2NT9A 2O17A 2PYHA 3ZSCA 3GQ9A 3EQNA 4OZZA 1QCXA 2PYGA 2VBKA 3VSUA 4YZQA 1CZFA 1BN8A 2O0WA 4W8TA 4XLEA 1IA5A 1O8EA 4HWVA 1EE6A 2INVA 4XL9A 4XLHA 4XR6A 4YEJA 4Z03A 1KCDA 1WMRA 4XORA 3ZPPA 1RWRA 4W8QA 4YZXA 1O8GA 4MXNA 3VMWA 1IDKA 4YZAA 3T9GA 2NZMA 1DBGA 2VJJA 4Z06A 4NK6A 4URRA 2BSPA 3VSVA 1XG2A 3UW0A 1X0CA 3SUCA 2O1DA 3B90A 2NSTA 4W8SA 4OJ5A 4W8RA 4AVZA 2X85A 4C2LA 2NT6A 4EW9A 1JRGA 4I84A 1DBOA 5C1EA 3GQ7A 2EWEA 4OJPA 2VJIA 1O8JA 1OGMX 4XNFA 1KCCA 1IB4A 1K5CA 4Z05A 1H80A 2PECA 1PXZA 1BHEA 5AMVA 1OOCA 1OGOX 1VBLA 2ODLA 2X6WA 2QXZA 1O8MA 2O0VA 3GQ8A 4PMHA 2NTBA 2NTQA 1O8IA 3GRHA 1KTWA 4MR0A 2Z8GA 4XN0A 1JTAA 4XMYA 2VBEA 2QX3A 3B8YA 1AIRA 1RMGA 3EQOA 4XN3A 4NK8A 1O8HA 2X6XA 1GQ8A 2INUA 1O88A 4OZYA 1O8FA 1RU4A 3B4NA 4OJOA 2UVEA 3WWGA 1O8LA 1OFLA 3GQAA 3LMWA 2IQ7A 1PE9A 2X3HA 4XLAA 1NHCA 2UVFA 4U4BA 1OFMA 4XOPA 4YZ0A 4XM3A 1IDJA 2X6YA 4XOTA 4OJ6A 3VMVA 4U49A 1PLUA 2QY1A 1HG8A 2NTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEL A;  4XON A;  2O04 A;  3KRG A;  4XKW A;  3VST A;  2NSP A;  2VBM A;  1O8K A;  5C1C A;  3JUR A;  4XLF A;  4XQF A;  3FY3 A;  4OJL A;  1O8D A;  4XKV A;  4XLC A;  1QJV A;  2NT9 A;  2O17 A;  2PYH A;  3ZSC A;  3GQ9 A;  3EQN A;  4OZZ A;  1QCX A;  2PYG A;  2VBK A;  3VSU A;  4YZQ A;  1CZF A;  1BN8 A;  2O0W A;  4W8T A;  4XLE A;  1IA5 A;  1O8E A;  4HWV A;  1EE6 A;  2INV A;  4XL9 A;  4XLH A;  4XR6 A;  4YEJ A;  4Z03 A;  1KCD A;  1WMR A;  4XOR A;  3ZPP A;  1RWR A;  4W8Q A;  4YZX A;  1O8G A;  4MXN A;  3VMW A;  1IDK A;  4YZA A;  3T9G A;  2NZM A;  1DBG A;  2VJJ A;  4Z06 A;  4NK6 A;  4URR A;  2BSP A;  3VSV A;  1XG2 A;  3UW0 A;  1X0C A;  3SUC A;  2O1D A;  3B90 A;  2NST A;  4W8S A;  4OJ5 A;  4W8R A;  4AVZ A;  2X85 A;  4C2L A;  2NT6 A;  4EW9 A;  1JRG A;  4I84 A;  1DBO A;  5C1E A;  3GQ7 A;  2EWE A;  4OJP A;  2VJI A;  1O8J A;  1OGM X;  4XNF A;  1KCC A;  1IB4 A;  1K5C A;  4Z05 A;  1H80 A;  2PEC A;  1PXZ A;  1BHE A;  5AMV A;  1OOC A;  1OGO X;  1VBL A;  2ODL A;  2X6W A;  2QXZ A;  1O8M A;  2O0V A;  3GQ8 A;  4PMH A;  2NTB A;  2NTQ A;  1O8I A;  3GRH A;  1KTW A;  4MR0 A;  2Z8G A;  4XN0 A;  1JTA A;  4XMY A;  2VBE A;  2QX3 A;  3B8Y A;  1AIR A;  1RMG A;  3EQO A;  4XN3 A;  4NK8 A;  1O8H A;  2X6X A;  1GQ8 A;  2INU A;  1O88 A;  4OZY A;  1O8F A;  1RU4 A;  3B4N A;  4OJO A;  2UVE A;  3WWG A;  1O8L A;  1OFL A;  3GQA A;  3LMW A;  2IQ7 A;  1PE9 A;  2X3H A;  4XLA A;  1NHC A;  2UVF A;  4U4B A;  1OFM A;  4XOP A;  4YZ0 A;  4XM3 A;  1IDJ A;  2X6Y A;  4XOT A;  4OJ6 A;  3VMV A;  4U49 A;  1PLU A;  2QY1 A;  1HG8 A;  2NTP A; 
#chains in the Genus database with same CATH topology
 4YEL A;  2V5I A;  4XON A;  2O04 A;  1TYX A;  3KRG A;  4XKW A;  4YDT A;  2XTW A;  3VST A;  1HF2 A;  2NSP A;  2QYU A;  2VBM A;  4JRA C;  1O8K A;  5C1C A;  3JUR A;  2VFO A;  4XLF A;  2BM4 A;  4XQF A;  3FY3 A;  3JX8 A;  4OJL A;  1O8D A;  2BM7 A;  3BH7 B;  4XKV A;  4XLC A;  1QJV A;  2NT9 A;  2O17 A;  2PYH A;  1K8F A;  3ZSC A;  3GQ9 A;  3EQN A;  3LJY A;  4OZZ A;  1QCX A;  2PYG A;  2VBK A;  3VSU A;  4YZQ A;  1CZF A;  1BN8 A;  2O0W A;  4W8T A;  2IOU G;  4XLE A;  1IA5 A;  4YC5 A;  1O8E A;  4HWV A;  1EE6 A;  3LYC A;  2INV A;  4XL9 A;  4XLH A;  1TYV A;  4XR6 A;  2BM6 A;  3NB2 A;  4YEJ A;  4Z03 A;  1KCD A;  1WMR A;  4XOR A;  3ZPP A;  1RWR A;  4W8Q A;  4YZX A;  4YEI A;  1O8G A;  1L1I A;  4MXN A;  3VMW A;  1IDK A;  4YZA A;  3T9G A;  2NZM A;  2G0Y A;  3BH6 B;  4V02 C;  2XC1 A;  1DBG A;  2VJJ A;  4Z06 A;  4NK6 A;  4URR A;  2BSP A;  3VSV A;  1XG2 A;  3UW0 A;  1QRB A;  1LM1 A;  1X0C A;  2BM5 A;  3SUC A;  2O1D A;  1LLZ A;  3B90 A;  1QQ1 A;  1DAB A;  2NST A;  3P4G A;  2J8K A;  4W8S A;  1WXR A;  4OJ5 A;  4W8R A;  2XTX A;  1EA0 A;  4AVZ A;  2X85 A;  1LLW A;  2VFN A;  4C2L A;  4OM9 A;  2NT6 A;  4EW9 A;  1JRG A;  4I84 A;  2XTY A;  3RIQ A;  1QA3 A;  1DBO A;  3PSS A;  5C1E A;  3GQ7 A;  2EWE A;  4OJP A;  2F3L A;  2VJI A;  3SZE A;  1O8J A;  1OGM X;  4XNF A;  1KCC A;  3N6Z A;  3ML3 A;  1IB4 A;  1K5C A;  4Z05 A;  1QA1 A;  1H80 A;  2PEC A;  1PXZ A;  1TYW A;  3NAW A;  2XT4 A;  5DNS A;  1BHE A;  5AMV A;  3TH0 A;  3SYJ A;  3AK5 A;  1OOC A;  1TSP A;  1QA2 A;  5JLV C;  3H09 A;  1OGO X;  1VBL A;  2ODL A;  2X6W A;  1OFE A;  2QXZ A;  1O8M A;  2O0V A;  3GQ8 A;  4PMH A;  2NTB A;  2NTQ A;  2VFM A;  4YFO A;  4OPW A;  1O8I A;  1TYU A;  1KTW A;  3GRH A;  4MR0 A;  2Z8G A;  4XN0 A;  1JTA A;  4YCQ A;  4XMY A;  2YUH A;  3SQV A;  2VBE A;  2XT2 A;  2J8I A;  2QX3 A;  3B8Y A;  1AIR A;  1RMG A;  3EQO A;  1QRC A;  4XN3 A;  4NK8 A;  1O8H A;  1K4Z A;  2QZA A;  2X6X A;  1EZG A;  1GQ8 A;  1KQ5 A;  2INU A;  1O88 A;  5JMC B;  4OZY A;  1O8F A;  1RU4 A;  3B4N A;  4OJO A;  2UVE A;  3WWG A;  1O8L A;  1OFL A;  3GQA A;  3LMW A;  2IQ7 A;  1PE9 A;  2X3H A;  3PET A;  4XLA A;  1NHC A;  2VFP A;  2UVF A;  1OFD A;  4U4B A;  1OFM A;  4XOP A;  4YZ0 A;  4XM3 A;  2VFQ A;  3PSZ A;  1IDJ A;  2X6Y A;  4KH3 A;  4XOT A;  2B0R A;  2BX6 A;  4OJ6 A;  3VMV A;  3DU1 X;  4U49 A;  1CLW A;  1PLU A;  2O6W A;  3N90 A;  3SY2 A;  2QY1 A;  1HG8 A;  2NTP A;  2W7Z A; 
#chains in the Genus database with same CATH homology
 4YEL A;  4XON A;  2O04 A;  3KRG A;  4XKW A;  3VST A;  2NSP A;  2VBM A;  1O8K A;  5C1C A;  3JUR A;  4XLF A;  4XQF A;  3FY3 A;  4OJL A;  1O8D A;  4XKV A;  4XLC A;  1QJV A;  2NT9 A;  2O17 A;  2PYH A;  3ZSC A;  3GQ9 A;  3EQN A;  4OZZ A;  1QCX A;  2PYG A;  2VBK A;  3VSU A;  4YZQ A;  1CZF A;  1BN8 A;  2O0W A;  4W8T A;  4XLE A;  1IA5 A;  1O8E A;  4HWV A;  1EE6 A;  2INV A;  4XL9 A;  4XLH A;  4XR6 A;  4YEJ A;  4Z03 A;  1KCD A;  1WMR A;  4XOR A;  3ZPP A;  1RWR A;  4W8Q A;  4YZX A;  1O8G A;  4MXN A;  3VMW A;  1IDK A;  4YZA A;  3T9G A;  2NZM A;  1DBG A;  2VJJ A;  4Z06 A;  4NK6 A;  4URR A;  2BSP A;  3VSV A;  1XG2 A;  3UW0 A;  1X0C A;  3SUC A;  2O1D A;  3B90 A;  2NST A;  4W8S A;  4OJ5 A;  4W8R A;  4AVZ A;  2X85 A;  4C2L A;  2NT6 A;  4EW9 A;  1JRG A;  4I84 A;  1DBO A;  5C1E A;  3GQ7 A;  2EWE A;  4OJP A;  2VJI A;  1O8J A;  1OGM X;  4XNF A;  1KCC A;  1IB4 A;  1K5C A;  4Z05 A;  1H80 A;  2PEC A;  1PXZ A;  1BHE A;  5AMV A;  1OOC A;  1OGO X;  1VBL A;  2ODL A;  2X6W A;  2QXZ A;  1O8M A;  2O0V A;  3GQ8 A;  4PMH A;  2NTB A;  2NTQ A;  1O8I A;  3GRH A;  1KTW A;  4MR0 A;  2Z8G A;  4XN0 A;  1JTA A;  4XMY A;  2VBE A;  2QX3 A;  3B8Y A;  1AIR A;  1RMG A;  3EQO A;  4XN3 A;  4NK8 A;  1O8H A;  2X6X A;  1GQ8 A;  2INU A;  1O88 A;  4OZY A;  1O8F A;  1RU4 A;  3B4N A;  4OJO A;  2UVE A;  3WWG A;  1O8L A;  1OFL A;  3GQA A;  3LMW A;  2IQ7 A;  1PE9 A;  2X3H A;  4XLA A;  1NHC A;  2UVF A;  4U4B A;  1OFM A;  4XOP A;  4YZ0 A;  4XM3 A;  1IDJ A;  2X6Y A;  4XOT A;  4OJ6 A;  3VMV A;  4U49 A;  1PLU A;  2QY1 A;  1HG8 A;  2NTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...