5C1OA

Crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
297
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 88
structure length 297
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1oA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1oA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1oA01
3U9TA 4J6EA 5C1PA 4MAMA 4O7WA 3SE7A 5D8DA 5J2TF 1I7LA 2DZDA 2PBZA 2R86A 5H80A 5LXTF 5CB4F 3ETJA 4EABA 4O82A 4O7NA 1B6RA 1PK8A 2FP4B 3Q2OA 5LOVF 2NPOA 4MA0A 1T36A 1KBLA 4TV9F 3K5HA 4O83A 1KEEA 1VKZA 2W6ZA 5EZYF 5JQWA 4EA8A 1EZ1A 3TINA 4FFNA 2NU8B 1JKJB 3G8CA 5HBRB 2W71A 4M99A 3VPCA 3E5NA 4NYEA 3U54A 4C5AA 3V4SA 1OBGA 2SCUB 2WYOA 2YZNA 3RUPA 2J9GA 1GSOA 4L1KA 5BPFA 2FPIB 2YS7A 3AX6A 3HBLA 4EA7A 3TIIA 2YL2A 4ZOLF 1W93A 4TUYF 1I7NA 2ZDHA 2GQRA 1OBDA 2YRWA 3Q1KA 2CNQA 3TW6A 2R7KA 3TIGA 2VHEA 2I87A 1UC8A 4XX0B 3RV3A 4M98A 5C8YF 2ZDGA 3VOTA 2CNUA 2V58A 4O2BF 4E4TA 3KREA 2PN1A 1CQIB 2X0SA 3R5HA 1CE8A 3OUUA 1IOVA 4HQ6A 1JLLB 4O86A 2XD4A 2V5AA 4YBZB 2R82A 2ZDQA 3KAJA 4FFOA 3HB9A 5BPHA 2W6OA 4MV8A 4WBNF 2HJWA 4EGJA 4IHJF 3QFFA 2YYAA 5JH7F 3BSYA 1JDBB 1KC7A 1M0TA 4DLKA 4O4JF 5J2UF 4MV1A 1W96A 1KJ9A 3R5XA 5JQGF 1B6SA 3I12A 4O7SA 2OLSA 4EAAA 1A9XA 3RFCA 4IWXA 1E4EA 4XYMB 3WNZA 2NU6B 2QF7A 2W70A 5CAEB 2W6QA 1E4EB 1SCUB 4YAJB 4YJ2F 4EGQA 1EHIA 4O4HF 5JVLA 2YZMA 4FFRA 3R23A 4IWYA 5JVDF 5DMXA 3JZFA 1UC9A 2W6MA 4O7TA 2YS6A 5LYJF 1BNCA 5IYZF 4TV8F 4YB8B 3KAKA 4M9CA 4O4LF 2DLNA 4O7ZA 4I4TF 4M9UA 4XYLB 1GSHA 2NU9B 4MA5A 4DIMA 5LA6F 2NUAB 3ORQA 1IOWA 3MWEA 4MV9A 2W6NA 3N8DA 2HGSA 2YWVA 3BFPA 3KALA 4O81A 5GONF 5FNVF 1WR2A 3HO8A 3K5IA 4FGRA 2Z04A 3VPBA 2R7MA 1ULZA 4EA9A 5CA0F 4YAKB 2GPWA 2YZLA 2QK4A 1BXRA 3OUZA 4C5CA 1GLVA 5KX5F 1GSAA 4WD3A 3RV4A 2Z02A 2GQSA 4FE2A 3K3PA 3BSSA 1C3OA 1M0WA 2R7NA 2FPGB 2YZGA 2VR1A 1KJQA 2YRXA 3ETHA 5KKNB 3BG5A 4ME6A 1EYZA 4ZI7F 2XCLA 3GIDA 3AW8A 3WO1A 4O7RA 4HNTA 1Z2PX 1Z2NX 2CNVA 3ORRA 5I47A 4IZOA 3R9RA 4MV7A 5C1OA 1DIKA 3G8DA 3WO0A 4XZ3B 4ZHQF 2W6PA 3JRWA 4RZQA 4I50F 2DIKA 5K2MA 3V4ZA 4HNUA 3BSWA 4FFLA 3U9SA 4GGMX 1GGOA 2DWCA 5BMVF 3MJFA 4QSHA 4HR7A 3GLKA 3LP8A 2P0AA 4O4IF 2GLTA 4MV3A 1KJIA 1PX2A 3NUAA 1VBGA 1CS0A 2VQDA 1VBHA 3JRXA 2I8CA 4O7VA 4HNVA 3VPDA 1EUCB 3VMMA 2C00A 2GPSA 2V59A 3UFXB 1AUXA 1EUDB 3LWBA 4O84A 1M6VA 4MV6A 4YJ3F 2R84A 4Y8VB 2I80A 3R5FA 4FU0A 4O7YA 4IIJF 1KJ8A 2R6FA 4I55F 4EG0A 1CQJB 1A48A 4MV4A 5CA1F 2R7LA 3TQTA 2NU7B 2FPPB 2IP4A 2R87A 2CQYA 2R85A 3U55A 1C30A 1AUVA 4ZQIA 3JZIA 4FFMA 3DF7A 2CZGA 2PVPA 5HV6A 3MWDA 4O7LA 4FFPA 1JDEA 2VPQA 1KJJA 4C5BA 2FB9A 2YW2A 5LP6F 3VA7A 1KUTA 1Z2OX 4O2AF 3N6RA 1DV1A 1DV2A
chains in the Genus database with same CATH superfamily
1PNVA 5E6RA 4BFXA 1D2NA 3EUEA 4DMRA 2D1RA 2EP5A 1NDHA 5AVJA 2GCPA 3WRVA 4O7WA 2Q0SA 3BH7A 5IN4A 1O9HA 1ZJZA 3KTOA 1Q7RA 1P17A 4O33A 3OAAA 4K9SA 5J4KA 4GSLA 2ZYIA 2BUAA 4LHYA 3F78A 2I6UA 2YICA 3H4DA 5B3KA 3QBVA 4OFBA 1Z08A 5F7XA 3H8JA 4BVJA 2R6ZA 1E2UA 3OE1A 4XR9A 2PS3A 1Z8HA 1CRZA 3ILVA 1NW8A 4LC0A 1CPYA 4U7GA 2BEKA 1X1SA 3IMEA 4I1SA 5C34B 3KUDA 1IY8A 3Q88A 2XT6A 1TVMA 4DR3H 4NXNH 5GV7A 4RF2A 2N1MA 1NOJA 4JB8A 2VKQA 3MD9A 1J49A 2XNSA 1W0CA 2V7EA 2RGBA 1AK2A 3AEYA 4AJNA 2EZ4A 1Q95A 1PR5A 2OAQ1 4DV6H 1VKZA 2B69A 1NBME 3C48A 4KYIB 2QQFA 4TS9A 1EESA 1NG1A 1VLJA 3PQCA 3WOHA 1WX1A 2XXJA 4MW7A 1N3LA 3ERCA 5LNK6 2C83A 4OOFA 4CTKA 1S8FA 3EEBA 3FVVA 4IS3A 4AJOA 4FYPA 4D0SA 4MB6A 1UM9A 3B89A 1V4VA 2D3TA 2PGIA 3GTKA 3G6WA 4KP7A 1A9TA 2J0UB 4RD6A 2O5EA 3LNCA 3DXFA 5BSTA 3GVIA 4DTIA 4HSEA 1DC8A 1M6WA 3W2FA 3B48A 1UH5A 2PQMA 3L46A 1II9A 2LVBA 3H5WA 3NONA 2V9WA 4PAMA 4W5RA 4ZTUB 1L5VA 4QRDA 1Q0QA 4ZCQA 1SKMA 2V6MA 4C9BA 3W4KA 4F9EA 4PX2A 1UOEA 4UE3S 4E1VA 1DKUA 4KYUA 4TOIA 1XTBA 1GSOA 5JBNA 1U9IC 3CISA 4EL5A 2LE0A 1TVKA 1YOVA 2FZEA 2Q5CA 3HEBA 4K2HA 1P8LA 1W0JA 3A06A 4BO3A 4X85A 2QN9A 5EOYA 1EKXA 2XOKA 4UJ5A 1ESNA 3VH4A 1ST3A 2XB8A 4N0EA 1LK0A 4FBLA 3V32A 3WGMA 2E2HA 1XTVA 1SQ0A 4Q19A 1FFYA 4Q15A 1MN6A 2ZW9A 3HOWG 2YY7A 1A2OA 4XR4A 3L07A 3FD8A 3QX3A 3P94A 2C7RA 4B1FA 4KGXA 3EWSA 2GQRA 1CJUC 3A4LA 1UPCA 2R8GA 1OKKA 1P4JA 1SBHA 1VE6A 4XIFA 3LZDA 2QRKA 4YJHB 2A0WA 4RAZA 1RQPA 3FA2A 2IF2A 1IMJA 2C7VA 3AHCA 2Q27A 4DYHA 4BNLA 5HIIA 4Y18A 4II7A 4O0MA 1QXSA 1L7EA 3DMGA 1TM7E 3H6GA 4ZQBA 3RGXA 5EY5B 5FBLB 4KXWA 4RKYA 3WHLA 1AF7A 4O0LA 3VOSA 2C4NA 4JI0H 4EB3A 5JS8A 3GA7A 1AJEA 2ZJ4A 1J0XO 5CM9C 5TNXA 3ICPA 3EVZA 3KREA 1VIYA 4EYGA 3E3AA 1IJFA 4MICA 2BCGY 3HOVG 5AKLA 4R8MA 1CRPA 4B3TB 1RKQA 2DQZA 3TE7A 2ZRGA 1KSJA 1SR8A 4HRXA 2HT1A 1KAHA 4GMHA 3OETA 4KLAA 4WLOA 2P3QA 5AJUA 3TBKA 4ZANA 5FBHA 3ZHTA 1FVIA 3INGA 4Z53A 5LKAA 1TGYA 4EG6A 3USCS 4FLMA 2V6GA 2BGUA 1H9CA 1XCOA 2B9VA 2CMFA 3MJSA 5ER9A 3WK6A 1AUQA 3OU2A 2E5LH 2ADFA 3VNNA 4PU0A 5E0OA 3KAJA 1U7ZA 3ZD9A 1VSTA 2XADA 1ZD8A 3O8BA 5C9ZA 2HUNA 1RWQA 3QKWA 1EQUA 1U7PA 2MSWA 3KL4A 5TT1A 3T9FA 2ZIXB 3D3JA 3ETEA 5P21A 5A5FA 4GM4A 5CMLA 5FADA 4OQQA 1MHPA 5CTAA 3RTBA 5I51A 3ODGA 1X1BA 3RJMA 3GGDA 5K0SA 1G1AA 3R3XA 1P39A 3P32A 2QT0A 4Q9NA 5DO9A 3PT9A 1K7FB 3EVBA 1JDBB 3UNXA 5I5YA 2WWTA 4AO8A 1UZMA 5DISB 3OZXA 1X38A 3RUFA 4DYVA 3LPLA 3QMMA 2BEVA 1A69A 3L8HA 4PWYA 4Z9FA 2FRXA 2R96A 5ANRB 1ZAKA 3E35A 4WBXC 3ZI7A 2AFIA 4ZI3A 5LJIA 3GLIA 1RRPA 1SCJA 4O29A 1W4LA 4KHZA 2Z6VA 3ZW7A 1IOZA 1LQ2A 1XIVA 2O06A 4TYPA 5HTKA 1XPOA 4BS9A 1NBAA 2D7DA 3AR6A 1ODTC 1KEKA 2DHEA 2CVQA 4EKGA 1UFQA 2H65A 3LU1A 2PSHA 5C0OE 2V1UA 3E2MA 4ZKDA 2W6QA 1N92A 1NBEA 4C7JA 1QJCA 1QQAA 3ENZA 2HVSA 3BIJA 1UKZA 1PR4A 4EGQA 1MPXA 3FHLA 1U5CA 1X9HA 3UQYS 1PCXA 4MV5A 1Q2UA 1BO6A 2B35A 5K3EA 3K94A 1NG9A 5IAAA 4O4HF 4UATA 3SHQA 2RGYA 3Q9NA 2IDKA 1FDTA 3O73A 1SXQA 3RF6A 4U0KA 2ORVA 1V9CA 4BJ3A 3AETB 4IWYA 2JCBA 3EWAA 1E0KA 2VHJA 3F71A 4JITA 3GGGA 3UY4A 4IHAA 2OQVA 1J22A 1FJGB 3RUIA 2XCSB 4ETIA 2ONYA 5DULA 2WTUA 4H4CA 2C9CA 4LJSA 1GL3A 2LP4Y 3FNEA 4GRDA 3BQ1A 4JODA 5F76A 4D82A 4E46A 1EEHA 1Y6ZA 1YTLA 3C6MA 2ORYA 3DAGA 4ZARA 4G3XA 4DR7B 4GPIB 1Y5RA 4YIHA 3FUWA 3RVKA 3D6MA 2GN4A 3K71B 3CCCA 4O4IA 1GQYA 3NLLA 4RHXA 2OP1A 3HDJA 1CHDA 1EVZA 4ASUA 1TCCA 4A91A 4RD0A 3TIXB 5TVGA 3GJRA 3KAKA 4A23A 4NNJA 2DQKA 2XC9A 1U28A 1AF4A 3HKCB 1N3BA 4JB0A 3U6BA 4A6PA 3CF4A 1X77A 1NR7A 5TQ2A 3SR4A 4O7ZA 1VE9A 2EU8A 3MT8A 3O8LA 1X7YA 1VJCA 3T3MB 1IN1A 2EZTA 3RYCA 3ELUA 1Z88A 2WT9A 2YQ4A 3BAZA 4D92A 1YDHA 3I1IA 3NEAA 4M1SA 4CG0A 3WGVA 4JR2A 4HP8A 5H4GA 1O3YA 1PNQA 1Z29A 3EF0A 3WGNA 2Z2YA 4MTLA 2WK1A 1TPYA 1XYGA 4B6OA 3RRNA 4D3XA 2G7ZA 3VO2A 2JEJA 1A72A 2HGSA 2G1UA 2OECA 3ABZA 4WN9A 3ABRB 5BVHB 5CLJA 4I5GA 1ET0A 3TDNA 2FW1A 3ZHBA 2WG0A 2IMWP 1JQKA 4CU2A 1WR2A 1C1DA 2W98A 1EX1A 3PUKA 1UZAA 1YB4A 1M34A 2C99A 4MO2A 2R5WA 1W36B 1YTUA 1J0EA 1S4MA 1PV2A 3VTKA 4YP3A 1U2GC 1XG5A 4OHMA 2V5UA 4RB2C 1JG4A 3EISA 4NK4A 4RAQA 3LK7A 2R7MA 1G4UR 1VHWA 3G7NA 3W9YA 1XNQH 2ZUVA 5TMDA 3W6UA 5KTMA 1C7IA 1GGMA 1ZINA 3V2HA 2RGUA 1IWOA 5KNBH 1Z0FA 2ZUWA 1V39A 4R2IA 5EGNA 4JBHA 1XL1A 2QK4A 1N6OA 2CLSA 3L1HA 2G4CA 4MI1A 5JCOA 1VKOA 5JZOA 1LA2A 1TW3A 2G06A 1D07A 3O91A 3PJEA 5F9MA 1NM5C 4DWVA 5EHIA 4PBSA 1SHJA 3IJEB 2GQSA 1SNYA 1OBCA 2YUIA 2JA6G 2HJRA 3IUNA 4WERA 4JYZA 3CC8A 1J25A 4RD2A 4X6UA 1U2EA 4NOJA 3AU8A 4DRYA 2FUEA 4EYQA 3HM9A 4ZEXA 1NW4A 1QH1A 3WMRA 4ENSA 5DI3B 3WA6A 5F98A 4KQ6A 4J3NA 3IDOA 5DM70 5IMBA 1E4OA 2QD4A 3TPZA 4FBUA 3ST7A 3TNYA 5LXTA 3RAFC 4B87A 2WYUA 1QM5A 3GJ6A 3P52A 1K6EA 1XMVA 3IDZA 1C3EA 3A6GA 1ZH0A 4B44A 3BJYA 4BRZA 4AJHA 1P7VA 3BDAA 2IGTA 3PQEA 1IBKH 1UPTA 1VIDA 2AL7A 1ZU5A 1OWOA 2FEPA 4G89A 4MVCA 4Z0HO 4HUTA 2PV0A 5HBRA 1FS4A 5BSHA 1R64A 1P19A 2A86A 4Z1MA 3I2FA 1HE5A 3RFUA 4EB8A 3CVWA 2H4YA 2FAXA 3COJA 1EIWA 4LF8B 1FNSA 4GI5A 2FK8A 4KRXA 4Y2SA 3E22B 1HNXH 2IT1A 4GD3Q 3E23A 1WBJB 3Q85A 4EI8A 4EUSA 1E6EA 3CRQA 4WDRA 1OI3A 4N1AA 3RLIA 1NJGA 3KXKA 4R2MA 1WWKA 2YV2A 4HQKA 1HEIA 2CDRA 3WR5A 3BD8A 3NBYC 3ZBPA 2H08A 3A4TA 1YR8A 5K8JB 3B2EA 1FQKA 5EIEA 2FR8C 1W48A 1Y7IA 2Y1DA 4GPD1 4RZXA 1DGQA 5FHQA 3WO1A 1G59A 3REOA 5IJ0A 4E1AA 4CLDA 3OCYA 3UAYA 2FDCA 2H1HA 4UTZA 1T9AA 2H63A 1UXGA 5EOVA 3JVIA 5E2AA 3B3QA 4TYMA 3BJEA 1G9TA 4UDYX 4B7UA 3K15A 1EP2B 2H7CA 4PLTA 2BRUA 4ZVLA 2JI4A 5JISA 1YDWA 3QXHA 1A2QA 5AJHA 2VIIA 4DQDA 2OCPA 1YMUA 4KQEA 3TLKA 1BQ3A 1S97A 4P58A 2RHLA 2WJIA 5DOVA 3B6KA 1VSBA 2BFWA 4IEIA 3VHRA 4AG5A 4BE7B 5A7HA 1NA5A 1S02A 4ML3A 1FP7A 1EDOA 3FTQA 2JJMA 4R9NA 3E4DA 4BX3A 1ZESA 2XBLA 1M1YB 1F14A 4IRUB 2P2YA 3MFQA 4S1OA 5L3RA 1RQXA 1U1GA 4TV9A 1OLSA 2Q1XA 3RADC 3IAUA 3K35A 1ORIA 2ID8A 1O97C 4GOOD 2AXQA 1CVRA 4ZVNA 2X3FA 2O2DA 1TKRA 3GAAA 5FBRB 4Q1BA 2A0UA 1BAPA 2FE1A 2HFJA 4EFDA 3N1UA 1JLLA 1V5WA 3ESCA 1DIBA 1U7HA 2ZZKA 3N8HA 4YROA 3EA0A 3GA5A 2AOUB 2C54A 4FFLA 5DYTA 1MRSA 1OFUX 4J03A 2YCHA 1CZKA 3U9SA 1P72A 2O5RA 2Z4TA 4HAYA 2P27A 3TQRA 5HNKA 4CCWA 3P9YA 2XWJI 3CWQA 4FK8A 5H3LA 3GDGA 3RAXA 4ZAVA 1C9EA 3MLEA 3PF8A 4X20A 3TL2A 3VPSA 5I7AA 4AW9A 3C5VA 3U61B 3BIOA 1W5BA 3DPSA 4FYMA 1NJ2A 3A4NA 4TMFA 4MUIA 1NLFA 1RHJA 1EJBA 2BSXA 4BU0A 2NSJA 2KM1A 1VCOA 2O4UX 3MWMA 3Q6IA 3KLPX 3L6RA 3JALA 4PAQA 2GPNA 2SBTA 3FF4A 1Q0ZA 5BXQC 1XA0A 3HV0A 5ES4B 2QZJA 1Z4KA 3NAGA 3VJLA 3K9CA 3WV4A 4DA4A 1P5JA 4TXNA 5J4HA 3KETA 4FE4A 2G1PA 2O5CA 1O95A 3N74A 2WNHA 2XQGA 4PNZA 4TWJA 4Q7KA 1M1YE 1LTQA 5GINE 1G42A 2FK7A 1TJPB 4CMDA 1F8UA 2V7BA 2EIHA 1JR3D 3I4MG 1UXIA 4LHZA 4LJ8A 2QENA 2TECE 2ZJAA 4OP1A 5IH3A 3KJHA 2ZXEA 4KXQA 5TMBA 4K8OA 2YYZA 4UNNA 1MKYA 3NTQA 4TM5A 4Z9YA 2IXGA 3ELYA 3CF0A 1IDN1 2B3DA 2DKFA 4N5LA 3WFZA 3F47A 5ALYA 5M29A 1AKYA 1R66A 1H1LB 2YJNA 1LY1A 1Z17A 3BWCA 1MRNA 1Z2EA 5MGBA 3BREA 1DIOB 4RTSA 2GZSA 3EF3A 1Y3CE 2P9CA 3DKKA 3IESA 5DISC 4JC0A 5EIOA 4G2TA 5EIBD 3ZCUA 1CY1A 2O8NA 3IJRA 4BTLA 2XCIA 1XXLA 1WV0A 3H5AA 2GWHA 2H0QA 3CSWA 4DA6A 1DJMA 4PZ6A 4DSTA 1DWUA 3HXLA 1E6UA 2HH9A 1B2LA 3C6XA 1K5GA 2BMAA 2FPLA 1Z39A 4K87A 3TFOA 3M34A 5CA1F 3EN0A 1RZRA 4DRZA 4KQ1A 2OBFA 4O2AB 4Q1AA 3VR1A 1KO7A 2Q8PA 3LLSA 5BP7A 3V8BA 5CFRA 4NI5A 1UWCA 5FB3A 5J9FA 4AURA 4HQNA 4ZXPA 1P1IA 1P74A 2JJQA 1A7UA 4Q1FA 3W06A 3IB6A 1EQAA 2WUDA 2X2FA 1A8HA 3F6BX 3H2YA 4BKOA 3W5BA 1W2HA 4ZV9A 5DH9A 4NZ9A 1D2RA 4Y1RB 3T41A 2RH5A 1QIEA 4R6XA 1SU6A 5F1KA 3T5MA 1T4DA 1MRZA 4U5XA 4UUPA 4XYBA 3TRDA 1TUIA 3WOVA 4CIVA 1C9DB 2JDIA 5L7TA 2PKCA 2MMCA 2RIPA 1FX1A 2MTBA 3DUFB 3K9BA 3L82B 4JY7A 3LPAA 4IS2A 4U6NA 4UOZA 5IXJA 5HCIA 1FSPA 3CBQA 1B0UA 1SKBA 1FFAA 2OHXA 3WLQA 5B4VA 1UT6A 3GG2A 1LDYA 1YRQA 3N0XA 4MS4B 4WXMA 5AW8A 4MRNA 3KEFA 3ISTA 3L0DA 5AK0A 1Z5WA 3K4PA 4KN9S 5DBFA 3KYIB 5C7LO 5HZKA 2XRZA 2F64A 3K9NA 3TRIA 1BCRB 1XEWY 2VA8A 4BAUA 3GPDG 1SVOA 9GPBA 3CY6A 3K8OE 5IWAH 5L1IA 2F3TA 1M1NB 3EJWA 4JBIA 1WVMA 2DECA 1ZI6A 5LP6F 4RHCA 1QNLA 1P4SA 3E81A 1GQQA 3PSHA 4IXMA 2AZMA 2NADA 3PUZA 1VJ1A 5AW0A 1DV1A 1LI7A 4Q05A 4R83A 4ZAWA 4BC0A 4YAUA 4CMEC 3LCCA 3KWMA 3J81k 3R0QA 5A0TA 3SE7A 1CQXA 1CZUA 5IAOA 3AM3A 1I7LA 4B17A 3NZEA 1GPDG 1JZSA 1PT9A 5HUQA 3UANA 4EHHA 2YINC 5WRFA 1AGNA 4FHZA 2LD4A 4QUDA 3RHTA 5SZHB 3RQIA 3SYRA 2UZ1A 1W4CA 4R69A 4WOJA 3W79A 1NASA 1GPMA 5JVDA 1V37A 3JAMA 3IE0A 1VE3A 1VYVA 4B33A 3PE3A 1AA9A 3PUVA 1ZHQA 1C9MA 3E18A 2P4HX 3QHQA 4FTWA 4MYRA 1IYDA 2ORIA 3HMKA 4G4SP 1DKQA 4GI3A 1Y1PA 4G1CA 3GIJA 4KACA 2G3YA 2BELA 2WDZA 1XJWA 4RNOA 1MX1A 3HADA 3S7ZA 3QM1A 4TZ0A 1N2OA 1N36H 4K9PA 5D84A 4LSGA 2JFBA 3U3MA 1V16A 5ILGA 3PXCX 2WTNA 4H1WA 1FA9A 2ZI5A 5LWHA 2VBFA 4O83A 2GCEA 2A67A 3B1ZA 2CLLB 3NNNA 4ENWA 1U0JA 3GLGB 1DJNA 2Q1YA 4TLCA 1JKJB 1J20A 3PQ8A 1S8AA 4P4NA 5EKSA 3MTIA 2AJCA 4W4TA 1ZK0A 2QXUA 3PXDA 4M99A 2QMYA 5KVAA 4ABTA 2JLZA 2R8KA 3RBDA 4BNJA 3RKUA 2JL1A 3BTOA 4KAJA 1AXGA 2QWXA 2OCIA 1G17A 1M6NA 4KK4A 4KVAA 5FTNA 4BNWA 1DLIA 3ICVA 5KFCA 2VZ8A 2W2LD 1WU7A 3F46A 3L7OA 1ZMBA 2BFEB 2PL5A 4G01B 1E6KA 2HTFA 4O1HA 5E0KB 5JDCC 4D0RA 1DC7A 1ZJ6A 2OQ2A 3Q40A 5T14A 4L1KA 2RDJA 1ZRHA 4NYMR 4OBWA 1GNLA 3HBLA 3MMXA 4F4FA 3NV9A 4Z4QA 5COQA 2XTAA 1HF3A 1KFBB 2W83A 5I5XA 1Y9ZA 4TKUB 4R1PA 1XC7A 4RPCA 3JWHA 1NF2A 3G2KA 2VUTA 4WBNA 3O83A 4MRAA 1CUGA 2BHTA 1ORDA 2VQFH 3GILA 1WZIA 2A94A 2PGXA 1NN3A 2Z1NA 4G1BA 3G2PA 2BGJA 4ZEWA 4DCMA 4ENQA 2VJLA 2Q3CA 4WTOA 1CP2A 1YU9A 2RHJA 5CUQA 3Q3GE 1UBEA 1A8SA 3K70C 1YQ9A 4AS1A 3EGVA 4WN9B 2BT4A 3TLXA 4HZIA 1SKUA 3SY8A 4QW8A 2Q1UA 3EIXA 2AOTB 4KFCA 2YY6A 1OV6A 2OAGA 3LWDA 4YY3H 2W8BB 1B73A 1QRRA 1V9SA 2WJ3A 2YTZA 1RQRA 1FVXA 2B5VA 4AS2A 1KOLA 1UOOA 2O0KA 5E9WA 3QEAZ 4KXXA 1Z22A 1ZIOA 3DL7A 4WZBA 3RHFA 5UKDA 2R6JA 3DOFA 2AD5A 2FR0A 4FFSA 5AKKA 2OA0A 3EFOB 3PT5A 2YMQA 3TCNA 2CKZB 3LDGA 3M6WA 1O5OA 4PTLA 2H7VA 5JD6A 1GQSA 5L7YA 1SMKA 1BN6A 2QJTA 2DP4E 3KELA 4HLUC 1G0NA 2G9QA 2WZQA 3LCJA 5FTMA 4NENB 1QQBA 1WPQA 2VLBA 4BX9A 1Y6GA 1JTEA 3FXAA 1A88A 1G20E 3T3NA 2G82A 2O0HA 2QRPA 3Q0TA 1S9HA 1Y1QA 2R1VB 3KOZA 3IKMB 2RG7A 3FTCA 4U3JB 2I34A 3HL4A 5G1NA 1X0VA 2JIOA 1UBCA 2AWNA 4MIEA 3RIXA 5EIAA 5BVHA 3HB9A 2J9FB 2J9ZB 2R6CA 4NEGA 2HLPA 1G6OA 3ENVA 1Z6XA 2H07A 5FOVA 4EZEA 2EZ8A 1AO0A 4CIBA 4AY6A 1EM8A 1UDWA 3VRHA 3ZQJA 1WXWA 5DI3A 5DBHX 2B8JA 4ODIA 3LZCA 1M33A 2VWQA 2Y4OA 4UAVA 4BZXA 1QGYA 4X90A 4B75A 5KNDA 1JA0A 3JQPA 3SDSA 3PFHA 5JH7F 4YI3A 4PONA 3SXJA 2D62A 2R4TA 4F04A 4L9AA 2FUNB 3N2IA 4MV1A 5I7FA 1TCBA 4OJKA 4RGVA 2II6A 2Z8XA 4JXKA 4LOHA 5D00A 1IULA 1JEEA 2ZRPA 2B6HA 2ERYA 3RFCA 5FP0A 2VKTA 3T95A 1MO6A 1BMDA 1V8BA 2ZS8A 4PZ0A 4Q48A 4WZZA 2BTOA 2W70A 1XT6A 1M34E 3E22A 4PYNA 1L4YA 1YFZA 3GEIA 3VR4H 2ODPA 3BCSA 4DXHA 1E4EB 3DE1X 4IJUA 1MMFB 4BFYA 1QVVA 1WBBA 2IS2A 4Q00A 2FDXA 4OVKA 2I8LA 3MPUA 1IEXA 2VYNA 1HYGA 2X8AA 3MRVA 1T10A 2IH4A 3HA3A 3WWJA 4LJAA 1T4CB 4H3SA 4QHTA 1Y8QA 3EOAI 4JCCA 4BVKA 2AC2A 1AZTA 5HDBB 2ZVQX 4DMGA 3LQ2A 1KOJA 4GE0A 1MG5A 4Q1VA 1R0LA 4J1QA 2VNKA 3FRIA 1BX1A 5DW0A 4UM7A 1I0IA 5IN5A 2XITA 5FX2A 4ZMBA 4PF1A 5DMXA 1D9ZA 2FH5B 4QFMA 1PKXA 2XOXA 4J0HA 4REQB 2V7TA 1N0VC 2R3SA 2DUWA 1EVIA 4ZO4A 2PZGA 4ARCA 2QI9C 3K53A 2CNWD 1EFRD 2R1UA 1UBGA 3OM0A 1NXSA 2CMHA 2HW8A 3OEEA 5FF9A 4TRRA 3VU0A 3FR7A 2FV8A 2HHCA 2WHQA 1N78A 4FXOA 2WAXA 2W93A 1DBPA 4GKAA 5IYZA 2BMJA 1ILEA 1HL3A 1MAUA 3UMJA 1G5IA 1PDWA 3GEGA 2QZSA 3RGGA 3L3BA 1SUCA 2C61A 1AGRA 1HNZH 2FPSA 3RJ9A 4TYQA 1G8KA 5HA5A 5IC5A 4F5EA 4BZPA 4R1LA 3K9GA 4J8PA 4LMRA 2HKIA 5FA8A 4NCAA 1GGEA 4RJLA 1ORRA 2OQRA 2XMZA 4BNXA 3E3NA 1W88B 3ADKA 4BNYA 4ARZA 2AQHA 2PX0A 2BCJQ 4H18A 2GDZA 1U9CA 3D2BA 1ID8A 3NYIA 4MA5A 2PS0A 1ZW6A 2JI9A 3ZS9A 2FEWB 4IGKA 1NC1A 1VRCA 1PDOA 3HR4A 1RM3A 3R1IA 3R77A 1D1SA 4BO0A 1BH2A 3KTMA 1O87A 2CDBA 1SZCA 1HA3A 4HGPA 1X2BA 4S12A 2A30A 1P81A 4CLEA 3ZE8A 4W7HA 5JNSA 5KWJA 3VKGA 4MSUA 2OFWA 5FNVF 4MTEA 4NPCA 3PJFA 4QATA 1K06A 3I83A 1XI2A 2BBWA 2GZMA 4MKHA 1CRWG 4XUGB 5CH3A 2XYPA 3EYYA 4E03A 5EJIA 3W4IA 4LGCA 3A58B 2OOSA 1KE1A 1KYVA 3BWMA 2LRHA 3W5DA 4UBOA 1ECPA 3B3JA 5DCLA 2B83A 3KSUA 3S1AA 2J0QA 4H7JA 4DDTA 3OKAA 2QOEA 1N75A 4YUWA 1XZKA 5I5VA 2Y1EA 3PGA1 1KZ7B 3ZK7A 1T4GA 1XR3A 1OFTA 5EN4A 1B00A 4BLRA 4Z3OA 2HHHH 3PQ5A 3V7UA 2VAMA 5EUMA 2ILTA 3GY0A 1DCFA 1WS6A 3M9XA 4LOLA 3EWNA 3SDBA 1US8A 2IPOA 5ADHA 4LFAB 4GL4A 1JPVA 1XA4A 3ZHOA 2QY9A 2WAAA 4TZ6A 1I94H 1GUFA 2Y93A 3LA6A 3FNIA 4HQOA 3F98A 1USKA 1UKYA 3WLKX 3KTFA 3INYA 1NBHA 5DG9A 3A9TA 4BWSC 2G08A 2JZOA 3WLEA 1ONBA 3W3AA 4PX5A 4RHFA 1KTIA 3JALB 3HB0A 5KFSA 3QEOA 3H5IA 3NC1C 4DABA 3ZJYA 3KSZO 1TB4A 1AKUA 2J9XB 2F62A 4BEBA 2N46A 4U2BA 4YGXB 3VNBA 3W5JA 3WJ2A 4N7JA 2DWUA 5K5EA 3W2IA 2UU9H 4DR1H 4G4GA 4EATA 3DTVD 3DZFA 4NCIA 3IQGX 4CC5A 1GSIA 1T8TA 2QN7A 3DWEX 4LRTB 1XXHB 3BEOA 1N48A 4XDHA 4F3CA 3IILA 1W0KA 1WKCA 2IL1A 1I7QB 1O57A 5BVGA 4UXHA 3RS4A 3PYXA 3DPIA 2Q5OA 1LSOA 2J0UA 3MELA 2ZJ3A 3OP1A 4GIBA 4QU5A 2AHOA 3PR4A 4XUCA 5DT9A 5L4LA 1P7WA 4B4OA 2CD9A 2FA9A 4Y3UA 1K66A 1L5FA 4EUKA 3OF2A 1ZSNA 2CDAA 3DEKA 1M1XB 2VUMG 1PSDA 3KYCA 4JSYA 1WB9A 1RIIA 3OZVA 2BTQA 4NH4A 2CL7X 2IXEA 3QSGA 2ZWPA 1E1RD 3STHA 4YMWA 4NFYA 4A26A 4ECQA 3MR2A 1IPEA 4DQNA 5FT9A 3OT1A 4O7RA 1SAYA 5DWDA 4I7HA 4Y98A 1YHZA 1Q2XA 2PT5A 3BA8A 3CINA 4R1QA 4TM8A 1GAQA 3IPRA 4Q3KA 4BIIA 1QO9A 2P9FA 1AQ6A 2HMVA 4A8HA 1GZ4A 2NVOA 5AI0A 5ER6A 2PYDA 4ND8A 1MLDA 2MYTA 1CU1A 1MEOA 3L4SO 1Z33A 2IYWA 4I6JA 2PZMA 2X77A 3GVCA 3HA5A 3T0FA 3L6UA 5C1OA 2HYDA 3K0FA 3LDUA 4LY6A 1Z0SA 4ZV7A 5BWNA 5C51B 5KTPA 4E6PA 4CMJA 2Q4TA 2Z4SA 5B2FA 1NUHA 3AFOA 2VPIA 1GN9A 3QVWA 2QVYX 1SOAA 2WILA 5C4GB 5T64A 3QEJA 2E87A 2HHJA 1SBNE 3VM6A 1BGXT 4C05A 1FB5A 1QF9A 3UGKA 4I1OA 2FF7A 4HDKB 3RSOA 2PWYA 5CXUA 4ZHQF 2N9UA 2EFYA 3AMVA 3WDLA 4V3CA 1E7RA 1JHQA 3ESDA 5GOTA 2BLNA 2JGFA 2PBLA 1BXGB 4ZU6X 2GJ4A 2CCJA 1P8AA 2Z6AA 2QV0A 2H2DA 3I01A 4MQBA 5EKTA 1UT5A 3EZ6A 3LPNA 3FOZA 5LUAA 2DTEA 3TM5A 5KYNA 3K70D 3R24A 1N7GA 1Z4JA 2YWJA 4IILA 1SO8A 4GOXA 2QL5A 3HCNA 4I8IA 1QB8A 1TLTA 5F2EA 2GN8A 2ZUFA 1H0SA 1W5SA 2DUJA 1SWVA 1C14A 2UYOA 3C1UA 3HCAA 3O4VA 3T3GA 4X94A 2FXIA 2RHMA 3RNOA 2FLLA 1AVTA 2G1AA 5TXGA 5HJ2A 2BF7A 5G53C 3LXRA 5H68A 1QRTA 4I9GA 5A7GA 1K0FA 3FUVA 3GV5B 1EK1A 3DJYA 3LBAA 2QGFA 1MJ5A 2O3UA 3HM2A 1VE5A 4RFLA 3TBFA 2P35A 3MMZA 4EPXA 2QYHA 2UUBB 1QU3A 1B26A 5JECA 1VPEA 3NXSA 5H8WA 1ODLA 1R9NA 1SFRA 2ID7A 4EQZA 1YB7A 4UAGA 1JE0A 2OXEA 2XJ9A 3H5LA 1LFAA 2HK9A 3CTMA 2XD9A 1PR9A 1VBNA 4ER5A 4J9LA 1D6NA 3WP0A 1E1RA 1Y1VG 1F60A 2AFIB 2AX3A 3GLIB 2F1IA 2WHPB 3STVA 4S2UA 3W1GA 3NPMA 2XIJA 4P31A 2V59A 1U6IA 3HCRA 3OZSA 4KQJA 3ANNA 4RF3A 3HRIA 3CNNA 4QODA 3UUEA 5J1SB 2G04A 3LYAA 1ZGCA 1P7ZA 2ZRBA 2IBMA 3BQ2A 3FI0A 5LOVB 3GFGA 3R9WA 2ZI7A 4TSFA 1EFTA 4FNGA 3Q8WA 3S55A 5JSQA 3WDSA 2O57A 2IXBA 2HRQA 4TVSA 5DGHA 4FZRA 2CVPA 4R05A 3K72B 4EPYA 2A4MA 2CE2X 2XT0A 1OFVA 5B12A 3IOMA 221PA 4ZODA 4F6LA 2P5YA 3O8RA 1KQOA 1XRMA 3N0VA 5JBIA 5KFDA 4EFMA 4S05A 3CO0S 3CS3A 5IARA 4YJGA 5J1TB 2BWJA 2P65A 2XPCA 1A48A 1M8JA 5H3CA 1D4ZA 3H2KA 1TO2E 1G8FA 1XNRB 4UHCA 1KYQA 1ST2A 2RDIA 4HX2A 1SKAA 3RB8A 5DGDA 3UMBA 1WY5A 2I33A 3VPGA 3OX4A 2BFDB 5FBQB 3TQTA 5FFMA 2UXCH 2HHAA 5BSUA 4WGFA 1FFHA 2C2KA 5B1DA 3T7AA 1UPBA 2QRLA 4ETMA 1SKQA 2AXNA 1Z73A 2VPZA 1P0CA 2WF8A 3G5AA 4B6QA 5JJCA 3OEWA 4IFIA 4YCBA 3GUYA 3QOFA 4CMBA 2C8VA 4ZWNA 1IEQA 2X2EA 4YR3A 4TTQA 5T6BA 1FTGA 4AYXA 3TMYA 1G8SA 3M6UA 3PC8A 3HCWA 3LFTA 3GDHA 2B63A 4TMVA 3TQQA 5CITA 2VATA 2J46A 4KCGA 1SD5A 2GHQA 5J59A 1GRCA 4NULA 1PDVA 3SF8B 4FFWA 1KI1A 2C5LA 1ODKA 4ZFNA 4DIUA 5C7OO 5CG2A 2PUDA 5DBOA 3NVAA 1N7JA 2O2CA 1P16A 1RAFA 4EPRA 1BQ4A 4IIJA 3DQZA 4LX0A 5ENVA 2C28A 1CUCA 1KJJA 1DUSA 1ONSA 3MTBA 3OTWA 3OUTA 1OXXK 2QD3A 3I39X 5LCXA 1RM0A 3WKDA 2BRUC 2G67A 5IZCA 2N1BA 1YT5A 2HCJB 1DZIA 3NETA 2AOTA 1OLUB 1YS2X 4XX1A 5BV1A 3WJ1A 1Z2OX 3U1BA 2PRKA 2WF9A 2XQVA 2VHCA 4F4ZA 4PX3A 5CTJA 1QIHA 3M49A 3LG2A 1F9EA 2H9AA 1JLKA 1X1CA 4CLOA 4RMGA 3PNBA 1AXEA 1NGSA 2EBHX 2FX5A 1QOPB 1J33A 1K7XB 4FSHA 4G5FA 4TL9A 5A0FA 1E3WB 3G3EA 4IDEA 5AQ1A 1KPHA 1YUNA 4HVLA 4G56A 1YZYA 5ALTA 4B80A 4TMYA 3S1LA 3NJ8A 2VEOA 2QVCA 3DYBA 1UQUA 3QWFA 4P4GA 4YCCA 4YHHH 3IIMA 1KMCA 5JJLA 1VRWA 4EABA 1NJ5A 5MFZA 1YR3A 4PPQA 3HUFA 3FGPA 1PQYA 4HN9A 4ZO8A 5EWMB 4BFLA 1YQTA 2RE8A 3I92A 1M2OA 2B30A 5A4JA 4EZBA 3RUAA 3ZNNA 2VO1A 3HFRA 2I6GA 2OMEA 3NEJA 1CIJA 1WSBA 3OTQA 4DSUA 2CUZA 5IZCC 1TUBB 3G9XA 4MWGA 4XQEA 2CB0A 3VR3A 1DC5A 5C81A 3ZE0B 5LP6B 1SD1A 5A04A 1OH8A 1UXOA 1TRKA 3FSJX 2CNWA 3LVFO 1ZHOA 2M6KA 5KWIA 2DKNA 2VK1A 1M8KA 2R7ZG 2VAWA 4UULA 2NTEA 2OYRA 4DLPA 1V2HE 1TZMA 10MHA 1QE3A 3PNVA 3PQ4A 3EVCA 2PTHA 4XB2A 4EKNB 4CKCB 5LIRA 3TBHA 2EWWA 1SEVA 1D8AA 2ECPA 3CLSD 4D3FA 4GGOA 1LKZA 2W71A 2WUWE 1PEAA 5DKFA 1CQJA 3VPCA 2X14A 1O96A 5BW8A 4D25A 2Q2WA 5JQGA 5JSHA 3X1JA 4RTNA 3FFWA 1JA1A 2EFGA 1U3UA 4B6RA 1EWQA 3H4TA 3OI7A 3K5PA 4MW4A 1EVQA 4I81A 4KUGA 5ALMA 1K3FA 1PEYA 2QLNA 4PO8A 3L8ZA 4HZUA 3R0ZA 3KD2A 4PLGA 5DN9A 5AFSA 4QXQA 3TSYA 2IDZA 4CR7A 1JHXA 1CKNB 5KFAA 1LDEA 2J5KA 2Q5IA 2V4UA 3BBLA 4GW3A 4BXOA 2Z9CA 2F8TA 4BO1A 5JNWA 4N5IX 5DHAA 2NPFA 3PC6A 3T1HH 2C5BA 1TZ2A 3MEQA 5SZJA 4UCSA 4DCPA 1M1UA 2AHRA 4JJ6A 3RS0A 4JI0B 4EBEA 1AV6A 5EC8A 3ONDA 4MAAA 4IDQA 3DC2A 1KEUA 3Q11A 3STTA 1C4KA 1MP0A 3PQ3A 3RRZA 3DCJA 5JXGA 3Q3CA 1KH2A 1W4BA 3SP1A 1UFOA 4V1CB 3OAAD 3LY8A 2DJIA 5AVVA 4Z2AA 2GZAA 2FHSA 2QSZA 3EBOA 5PNTA 4UNSA 4CT0A 1N5IA 5E8JA 5D3QA 1JYFA 1O7JA 5KTNA 1RE0A 4XX0B 2ODNA 1FVHA 3NORA 5CX4A 2ZBVA 1GCAA 5HFJA 2OCBA 3K09C 3ZKAA 4FC7A 3UMCA 5AOBA 4D4HA 3UAZA 4MR9A 1BYIA 4DWJA 3CIFA 2GJSA 5DXAA 3NATA 4OHXA 4B9AA 2QLTA 2GVZC 5EKDA 1DS6A 2P9EA 2QR2A 4F1WA 4HFRA 3NNDA 2DQ4A 4DMFA 1S68A 4YAWA 4BRUA 3B6EA 2C22A 3GARA 4H3HB 1PFQA 4TROA 3MWDB 3QPBA 4JFAA 4GPBA 2OSBA 2IV2X 2VSOA 4RKWA 1WDWB 1U1EA 4GLOA 4BNHA 621PA 1UIMA 5IT5A 3ZLJA 3A6JA 3B1XA 5AXDA 5IYBG 4R41A 2D2FA 4MUGA 3UJ6A 3ZLTA 4YJKA 1NHWA 4Q4JB 4UCTA 5K6AC 3E3MA 3KEMA 4QVIA 2XMPA 2QRNA 4TLMB 2QT9A 5B3JA 1W2WB 4DV4H 1WDKA 2BBTA 2D1FA 1FYFA 3BE6A 4GKBA 4UNPA 1QHHA 4YBZA 4IHJF 5LZ2A 2HYIC 3RLFA 3ICWA 1GYRA 4TTSA 3DEHA 4UVGA 4WACA 3SC6A 4HEA6 4MWDA 4X54A 4YCAA 4YV2A 3EW9A 1ZPDA 1GPAA 2B4AA 5J2UF 2IOFK 3IUYA 5DF1A 2P68A 1CZLA 1H8EA 2O7RA 1OXMA 1NMYA 1U90A 2DFPA 5HM6A 4X61A 4D45A 3P19A 4JUIA 3GJQA 1IQRA 1IPHA 3IEXA 4RS3A 4JLVA 5F9HA 3F7NA 4HGRA 2RBGA 1MW9X 3KUUA 2HDWA 5EMHA 5A5EA 1FK8A 1WOMA 4C06A 2IOFA 2ABJA 1RBQA 2Z2KA 4WFIA 3T5PA 1KO4A 4ZREA 2Z58A 2N3ZA 5IP5A 2JGEA 4LF6B 4QDUA 4PIVA 3TD9A 2Z57A 1VJ5A 3B2QA 1SCUB 3JQEA 4LJLA 3X3HA 3X43A 2ABWA 1XPUA 4FQ8A 4I1UA 5JY1A 1NW9B 4N9QA 3HJAA 1FUKA 1GT91 2R8HA 1WMSA 2W2OA 3OA0A 1N2CE 1HDXA 4N18A 1JFRA 1X7XA 4ZI5A 5B30A 4E5UA 4UCQA 5TSDA 3LP5A 4Z99A 2JFUA 4DHEA 4ZN6A 4QYWA 1H2ZA 3L8FA 5J47A 3PHBE 1ETHA 1KO5A 5DNCA 2R7AA 4FFRA 4HQFA 5BR7A 3Q8LA 1BHQ1 2BISA 1G5FA 5K0LA 1MH1A 4MX8A 4DR5B 2XUZA 3SJZA 4MR8A 3FDFA 2RHCA 1XO1A 3PUXA 4YPFA 5IASA 4XA8A 1PJSA 4NQZA 2J3DA 4PFKA 4PC3A 4DLBA 1JKXA 1E7MA 3TX6A 3QBJA 3TRKA 5HE9A 4YJFA 2WB2A 1QE5A 3MOIA 4YJHA 2GNOA 1Z4IA 3BL5A 2BGMA 1R10A 4I1IA 3GWGA 4ITVA 5KU1A 3R8FA 1QLJA 1Z7WA 2RBKA 1L4LA 4RY9A 3TY8A 4B32A 4B48A 4DMCA 1HG1A 4RANA 1ZIDA 1BSVA 4DL4A 3C3MA 1IUNA 4UREA 4IUBS 4RIIA 1T2UA 2HC9A 3CEAA 1R2QA 2FEXA 1Q21A 1K2WA 3NVMB 4ECAA 3JQ7B 2VRWA 4ISCA 4M2LA 4DR4B 3WYNA 3CA8A 1OT3A 3EW7A 4QEZA 4YQYA 4JI4H 1OX4A 4G0NA 1FS5A 3EDMA 1E4GT 4YRKA 1Y4ZA 4HEJA 3KUXA 5EQJB 1JB1A 4WLFA 1BVYF 3H11B 3K6SB 1GTG1 5GV8A 2B8WA 3MJVA 4FR0A 4MR7A 1O6GA 5FWNA 1W36C 3UZOA 3IQXA 3BGIA 2RARA 1KL7A 3GOQA 1OC2A 5E4JA 4A3JG 2BI7A 3GJZA 1M75A 3QIAA 4G8DA 5GONF 2FNAA 3EUAA 3DO8A 1Z0KA 3V4LA 4CL0A 3SM3A 4HADA 2VZLA 1WUTA 4B2PA 3W7AA 4R40A 5F12A 2JLQA 2HRZA 2IUFA 3G7UA 3AV0B 2P2DA 1ZN9A 2WMOB 5SY9A 5KSZA 3UPTA 421PA 3TQOA 4L78A 3Q2KA 1UJCA 3DFMA 3GEBA 3CUSA 4JZKA 3HYSA 3RS5A 3G0IA 1XHFA 4CF3A 3I04A 4NBWA 1TA9A 3IQWA 3QPCA 5KJ6A 5CA0F 1HNNA 5KPJA 5LD2B 5CDUA 5I5GA 3MCWA 1U8ZA 3V6LA 2CWDA 2BN4A 4UHDA 3RWMB 5DOZA 2UXCB 2R00A 3DOIA 3QWHA 2B8EA 3LF2A 5KX5F 3WKBA 3LBIA 4DEXA 5J4YA 4U7DA 2NGRA 2IZOA 4I3FA 3GRVA 4DSZA 2WKRA 1K2VN 2MINA 2F1OA 3DOJA 2OO5A 3P7MA 4QTTB 4EX6A 2WWXA 1Q3KA 5HCNA 4ZTZB 3Q7SA 2XF2A 2NO6A 1TJ4A 2DGDA 2WHXA 5T4EA 4EGFA 5EJ6A 1GTSA 2QYTA 2P8SA 2P9BA 1FIUA 3T15A 5CB4A 2QLBA 5BQPA 2QTZA 5FNVA 1M0WA 2CLFB 3AF5A 1LPSA 1ZCBA 3AHEA 3QW2A 3U4HA 2FMHA 2CNBA 4BRSA 2D0IA 1N9ZA 3B3AA 3PP8A 1NJSA 2A4KA 3KX2A 4L3VA 2GPYA 3VYWA 2GCNA 2FUG6 1M2GA 3AV3A 4CLRA 1KJQA 3TOXA 1R9TA 1IATA 3L4BC 1PU2A 4IRKA 2CNDA 3JYHA 4ITRC 4XYGA 4BHTA 1KGSA 2EJ3A 5C5IA 1CR4A 1LDNA 3DKRA 3DEYX 2R8BA 4K81B 4DN6A 3K9HA 3V8VA 3WFJA 3BCHA 1TC2A 2Y1OA 2O1XA 1E98A 1LLCA 1R9MA 2BZ1A 4H60A 3OY2A 4J49A 4XVHA 1MIOA 2YXLA 2V5VA 1LH0A 4IZHA 1S1CA 4RA9B 4MQEB 5E1DA 2EKLA 1UEIA 2BTEA 2DUMA 4W63A 2GRAA 1H2WA 3QPAA 4ZCPA 5TQ2B 4NU0A 5BYKA 1Q7TA 2JZCA 1OUMA 4ZZ1A 3KE9A 4KLNA 1UQRA 2AG5A 2O52A 5DGBA 5BV7A 1RBMA 2IPNA 2LGJA 3OCCA 3FWNA 4JI1H 2PUGA 1N8KA 1SHTX 3LKVA 2ZQYA 4YUVA 3TGLA 1HETA 4J9RA 4Q39A 3IEVA 1QYXA 1ZN8A 1V43A 1V48A 1YWGO 2YIVX 2X0DA 2GM9A 1T0IA 2Q3EA 3EUFA 3ZGYA 1C41A 3E9QA 3AOEA 3H2JA 4CLHA 1AHPA 3RAQA 3BMOA 5KG2A 2HXGA 2GESA 1M2FA 4OB6A 3G7SA 4LYDA 1GZDA 1VCHA 1XTJA 2ZVDA 2XMQA 1QMPA 3OPYI 4F4DA 4KR7A 1O5IA 3PO2G 4G5GA 4GT1A 4LNUA 1XDDA 2WVJA 3MCAA 3SC3A 3FMPB 3VPFA 2LV8A 3ZCVA 4MP6A 4XZ3B 1S7CA 2J6TA 4PG4A 1HG0A 5EWFA 1DAIA 3NTLA 3CW8X 2YWFA 3RVSA 4RZQA 1HURA 4NAVA 4TQ9A 4DC1A 2QRVB 4JI6H 3PWSA 4J2OA 5EWJA 4TXHA 2NX2A 1QQ5A 4D4JA 4AXBA 3DFKA 1OOEA 3NTVA 3BSWA 3E9ZA 1XKXA 2QTCA 4RWEA 3W04A 1WXEA 2D2VA 3PXAA 5JNRA 5ELXA 4HDRB 1FUUA 1GNQA 1ZA2A 3G6YA 4LHVA 3SHOA 4BN4A 1IEVA 1T9ZA 4A6XA 3AFNA 2JAOA 2PVCA 3DBRB 2XB2A 2EKQA 3EPKA 1DJOA 4EGAA 1ZVKA 2JJ2A 3RIEA 4HRYA 4H27A 5BWUA 2P2LA 3GRKA 1M7HA 4QSMA 4PPYA 4YACA 2B94A 1AG9A 3T1QA 1YZ3A 1Z3CA 1MB9A 2CCGA 1QH1B 3IO5A 3TL3A 3WQHA 3HTXA 4JYAB 1IPFA 2EOAA 1VA5A 2ZSUA 1ISIA 2XVXA 3JPYA 4BE4A 3UZBA 2FOXA 5H59A 3NWBA 1KORA 4ZQFA 4DMMA 4ZU1X 3ZG6A 3MAJA 4BU1A 5IDXA 4FZJA 4CV2A 5JJ5A 4ZICA 2ZIVB 3HWX1 1LI4A 4DXAA 3DUWA 1R4NB 2XE6A 4P4LA 4PV7A 3SCZA 1A9OA 3HN7A 3AGQA 1E9RA 4ZT5A 2P8JA 3S28A 2NZWA 2O7VA 1AUPA 4HNVA 1QDUA 1JPNA 2WHEA 3FPJA 4JBWA 4NP6A 1T3GA 2GAIA 3DMTA 3HJUA 3H3FA 4O1IA 5SYMA 1SHKA 3VU8A 3WGZA 3WK4A 4ECZA 4ZVMA 5T4HA 4B7XA 2RK3A 3RREA 2JIBA 1D1PA 4E5MA 1GFWA 4KXFB 4R84A 1XJQA 4R8KA 2VH5R 3AR5A 4P81A 5KX5A 1XPRA 1O0CA 4CKXA 4M7EA 3BXPA 4TVBA 3A0RB 4R68A 3FJOA 5F35A 5LMCA 1F0YA 3P9PA 2HBQA 1SCQA 1P0FA 1WCMG 1Q1EA 1N2BA 2ZYTX 3KOXA 1DAFA 2R84A 1CUFA 1P61B 3QJYA 1OAKA 2GA8A 4G9GA 1N34H 3G17A 3URKA 1BD3A 1KWGA 3HR8A 4NKRA 4Y6LA 5DFAA 1F4VA 1TJYA 5HIMA 1M6VB 1C0IA 1WG8A 1AZSC 3R7AA 2ZAIA 2HQOA 4CMFA 4MH0R 3ORFA 5AI4A 4A82A 2JA2A 5I4CA 1UAAA 4IR1A 2C96A 2NAPA 2Y0BA 5HIKA 2I2AA 2QQGA 2WYVA 3D7LA 1CQJB 4ZOAA 2CJXA 4V1CA 1QDEA 3FG9A 5EZYA 4XFDA 2E37A 4LYAA 4MIYA 5KNCH 2PH5A 4GOND 1RWWA 4E6EA 3AI1A 3QUTA 5CFPA 5IVIA 5I5UA 2IQ5A 5FPQA 2I3GA 1THTA 1H2HA 3GT7A 2C20A 2GPJA 2FMAA 1FBTA 3BM5A 2ZE6A 3L01A 4E7PA 1RMTA 3L6CA 3I8OA 3OICA 2Q6VA 3PQ7A 2Q6IA 1XZAA 5DRTA 1EX7A 4QJIA 1FVOA 5G3YA 2LCFA 1A7AA 1PN3A 4Q1CA 2SECE 1RJ9B 4JVOA 3ZIAD 4BMYA 1WDLA 4L27A 4GLWA 4JV1A 4X1IA 1E0JA 3TKYA 1R9JA 1N2IA 2Z3ZA 4IO0A 3V6MA 4KGDA 2DSTA 5AVOA 3THWA 4P35A 1RADA 3AVPA 4ZO7A 4FZ3A 3LO5A 4ARZB 5BYBA 1A8UA 1O4WA 4RMJA 4B6FA 5AM2A 2YN2A 1F06A 3JQCA 4GFDA 3VNAA 3BA6A 2W00A 1CEYA 3RT9A 2CXXA 4M0PA 1WPRA 1XMSA 3IVMA 1NAIA 3N7TA 4NL4H 4C5BA 2YU9A 3NASA 2OHIA 1L5KA 3NDJA 4J1SA 2ZPUA 1T9GR 3I9JA 4RW0A 4C0KA 4RUKA 2YWXA 4N6OA 2R44A 4ZVVA 3I2JA 4DLVA 1T6NA 1H23A 3BXXA 4N5MA 2WFZA 2WWWA 1KZ4A 3HWSA 4GVLA 4OP2A 4NWIA 3KOMA 3O82A 5AUPB 4AIRA 5L4SA 3HP4A 1NY5A 1L7XA 4ZVPA 2P0EA 2V4RA 3H8SA 3PU6A 5FLXA 4RTOA 2WINI 1YASA 1KMHA 2YWCA 4RM3A 2FMTA 2IYSA 4AD8A 4D99A 4MYHA 5DGXA 3ZU3A 4IG4A 3F4LA 3OJOA 3PD0A 2H4ZA 2OAEA 4O3SA 4YO8A 3O4HA 4GLJA 2BPOA 5H70A 4NECA 3DXXA 1JIUA 4WVFA 4B3MH 2O1WA 3L0OA 3LGXA 4OHUA 1ZAYA 2ZGIA 4QX6A 3K6JA 4Z4FA 1EFHA 3FSGD 3HGQA 4P5PA 1MENA 1KI2A 5A03A 3IKTA 2VHXA 1XNHA 4K9RA 1I7DA 1LU9A 1KBOA 4WIAA 4IZ6A 1KETA 3HDQA 5EP3A 2DFTA 3DW1X 4YEDA 3FYUC 4V0QA 4PZPA 5DBEX 1O1YA 1X80B 2ASJA 1SCNE 3DBOB 3H1FA 3LYLA 2CXNA 4N8DA 3U49A 2I66A 5KYTA 4Z9BA 1T5HX 4OEHA 3ZW8A 1O5TA 4J3JA 5ADVA 1KBLA 2AGOA 1D8TA 1UODA 1JHPA 2IHZA 4KSYA 4EJSC 4F06A 1M5TA 2TSYB 3E9CA 3KC2A 5EZYF 3FKIA 4FHEA 2UUCH 2D1YA 2YHUA 2XDQB 2Z9BA 3K92A 1MEJA 5MF6A 3FYUB 2QIOA 1VMEA 1Z6TA 3AKYA 3IO3A 5BV8A 1VLVA 4WQMA 1MV8A 4HWPA 1U7XA 5KFPA 1GTVA 3UQ8A 1OBHA 2VJQA 1T5DX 2YW9A 1K8RA 3AERA 3A7DA 1YZQA 4I9HA 4YJFB 3ZGOA 2WC1A 4XWAA 2PRJA 5J40A 3D7NA 5CBPA 3AL0C 1V3UA 3C87A 2G40A 4Y6PA 4BNTA 4UU1A 1V1JA 4IAOA 1L4BA 2H31A 2WYOA 2SHKA 4GI7A 5FPYA 4EEKA 1G21A 4B4WA 4UU0A 2X76A 3GMDA 4A15A 5MHTA 5I9MA 3DV0A 4HXYA 2P78A 4CL3A 3EF1A 1M2WA 3GUVA 4Q7EA 3U4QB 6LDHA 3M8KA 1ECLA 1KC1A 2Q3MA 3JQ7A 1SVKA 2PGAA 2FEOA 2OZEA 5FEMA 3R7WA 4MWZA 1NI3A 1EVKA 2EHDA 3PE6A 5SY4A 4B8WA 2GFQA 2IXFA 4L9SA 3F1LA 2MR5A 1YA8A 4LZJA 4Y2TA 4D9JA 3UUGA 2NO1A 4TUYA 2QRZA 5JNTA 5KNLA 2R8OA 4UW9A 1ZIXA 1FTNA 1ZXXA 2E4YA 3RRMA 4B3GA 4R2JA 2A9FA 4LYGA 5CVDA 2PZFA 1RTKA 1YI8A 1VBFA 3IBFA 4YA6A 5D1HA 5HFNA 1VJDA 4ND8B 3U60B 2X0NA 3HN2A 3NWEA 2XIGA 2V7QD 4MLZA 1Y1RA 5DASA 4CHTA 4F9GA 3H4BA 2AN9A 4GX2A 4APMA 4DUPA 2DR2A 1UBTS 3FAZA 2H2WA 5AI6A 4EJSA 4M7WA 1PQWA 1UT8A 4JLOA 3QVOA 2GD2A 3GL9A 4L9RA 4YXFA 3SZOA 1MG0A 1YOBA 3QF4A 3TW8A 1JBKA 4RNDB 2CNUA 5HKLA 4DA0A 1HMYA 1DAMA 4JC4A 4FX2A 2VYFA 2QVZX 3J7TA 4U9IS 2H4JA 4MLDA 5KCZA 1OB2A 3WL5A 1YJ8A 2DR3A 2RAPA 3T3EA 5L3QB 1GGFA 3HRKA 2AKEA 4CDNA 5C18A 2W2PA 3TZLA 5CB4B 1YIOA 1MO3A 2PQ6A 3DONA 3QVMA 5BN5A 2REBA 4LSAA 2X58A 1I2AA 3AI7A 5EPUA 5BUQA 5M3BA 4BFCA 1XRPA 4LK3A 4L9WA 5CDFE 1G291 3OQHA 5DLFA 1IN8A 3IULA 3EEFA 5AI9A 4BE9A 4GSKA 4D81A 5KKCA 2W8KA 3J80W 2HMTA 4NBVA 2JEIA 1I2ZA 3N05A 1QS0B 5K6RA 4UASA 4GM1A 4QD3A 4EUNA 2F48A 2BP7B 4WHXA 3LQQA 2UVRA 2NVBA 2AF3C 5FUQA 4GKJB 4TLAA 2G5PA 4RBNA 3IJPA 2YYAA 3KT8A 2VTBA 1DRVA 4X8OA 1U81A 2Y1LA 3B7WA 3BSYA 5EUBA 4MQFB 4DAEA 2W6JD 5HQTA 3X1YA 2QD1A 1IQ0A 3VC2A 4MXDA 1FFCA 2R4UA 2OFOA 4LXGA 4QWAA 2ESRA 4X7RA 1ND6A 3FN4A 2Q4BA 3EPPA 3OZ7A 5CJPA 5EYPB 1VI5A 5DNVA 1A9XA 2GSDA 1V7CA 4DAOA 1SH7A 2G07A 3EQ6A 1M8GA 1GO3E 2XUOA 2ODTX 4FILA 4NMWA 4PPFA 3T7TA 3VSCA 3TRJA 4EB0A 1I32A 3QA3E 4MVJP 2P6RA 1DDGA 1P44A 2J07A 3A0UA 4K9KA 4WOKA 3W8DA 3ZV6A 3EQ7A 3OCZA 2RGCA 1N4DA 4M9ZA 5KNCD 1BWSA 3GEHA 4YJ2F 3QKIA 3FDSA 4ENVA 5G0VA 1ZD1A 2JCSA 4J0FA 4ZT4A 2DH5A 5C44G 1EEXB 4ND5A 4YDRA 3Q3IA 1P9OA 2C95A 4Y2VA 5JD3A 4D8XA 1BWPA 4URFA 4OUKX 5FWXB 4ISBA 1E1KA 4NBNA 3ROZA 3UT6A 2Y71A 4JFRA 5K05A 3OJEA 3QUSA 3ZY5A 2ZYSA 4LC9A 3R23A 3EOBI 4GAEA 2EKBA 3IBCA 5CA0B 4AJEA 4MUYA 4EGSA 3ACDA 4RVSA 1KO8A 3TZBA 4G8CA 1I3QA 1V35A 4WEQA 4EQ5A 1RKVA 3LUJA 3OE5A 1MU0A 1R88A 1QG0A 4YRMA 4BECA 3ZWXA 2HU8A 2IZ1A 1L7DA 3CXRA 1GILA 3FUXA 1PQPA 2B61A 1A2KC 2XTZA 3HCOA 4QM6A 4KIGA 3BQNB 2NTVA 4JI3B 5AVYA 3CPHA 5I3ZA 1Q7GA 4FS2A 4ARIA 1ML3A 1Q6ZA 3UK2A 4R9UC 2DY0A 3PDCA 1DAPA 3N40P 1E3IA 3G8AA 3R6TA 4EUFA 1PGJA 3ZK9A 4BUJA 2IYZA 3AM1A 1RRVA 4CG3A 4M1EA 3F49S 4LE0A 3SK0A 5IBCA 1JEQB 1A9QA 5AT1A 4DMLA 3GLTA 1K7SN 3VAAA 4N48A 3RIYA 2XE8A 2E55A 1TECE 1L5MA 4Q21A 3N2YA 1KEZA 3EGWA 4IF6A 4RCNA 2D54A 2ZU6A 4OP3A 3MWEA 4MV9A 1JMYA 3TZCA 1RQLA 2XVMA 3B2NA 1EH5A 2F8SA 1TRHA 3C45A 3JVUA 4C22A 3MUEA 4XTRA 3D6TB 1ZX1A 3CNEA 4G07A 3E9DA 4GRAA 3WAKA 3G6XA 3ZV3A 4OX9B 2F3UA 3T61A 3JQBC 4Q6WA 2Z8YM 3ISVA 1L7BA 3DYVA 5JMWA 3PV0A 4DC0A 2I9KA 1GKIA 1VG8A 4LF9H 1IBCA 1RWBA 2PAFA 3M2PA 2QYOA 3BA1A 1NXPA 4MB0A 4BL5A 3PTLA 4BLOA 5ELMA 3V4RA 1VBKA 4XZ3A 1G7SA 2QR3A 2NVYA 2E7ZA 2O2GA 3V2GA 1Z5ZA 3ZV4A 4BVLA 4FHGA 5EVCA 4QVGA 5THKA 4DREA 3QMWA 5EFZA 1R4NA 4IH4A 3L7YA 1LLUA 1UFKA 3T12A 4ETNA 2HVRA 2PH3A 4I50A 3W78A 4ECEA 1YR1A 2PRZA 3DZBA 1DQZA 3VPAA 2JVJA 4H7IA 3P71T 3PDWA 5JD4A 3DG9A 4GBGA 4P4SB 5E3JA 4UUOA 3KXIA 5KS8A 4B2YA 5AUOB 1IVYA 4MMZB 4DOMA 2ZXUA 3RV4A 4XVCA 3UKOA 3UICA 4LQLA 2Q2QA 1AS3A 2ZRJA 4N5DA 3VPXA 1A4UA 3BJRA 4WASA 3C8MA 3H5NA 5DNEA 4D0LB 1Y5MA 3I01M 3PE4A 1EFDN 3D5EA 2VP5A 4F6RB 3H2SA 4PR3A 1Q83A 1VJTA 3FCSB 1PJTA 3PR2B 5D6OA 3ZIAA 4HNAB 1E2LA 4TVOA 4GSYA 3KM0A 4CCAA 1JU3A 2BUCA 3MBKA 3AQ4A 3RBVA 3UT5A 5DM60 1PJLA 2VPWA 1CFZA 1P5FA 5MGNA 1AC5A 3MVEA 4EY4A 3C16C 4IKPA 1TZJA 3T5CA 4IXDA 3HJFA 3K31A 1N6NA 3IGFA 1W4RA 3EPJA 4REQA 4CKCA 1CUAA 3Q3JB 1K8QA 5B36A 1VMKA 1P91A 4MW5A 2HXSA 3IPAA 3K8QA 5H16A 3UQZA 2OV8A 5I9SA 1F5SA 5EL0A 2WTFA 2RK6A 2R62A 5A4AA 4IUYA 1FNCA 1E7YA 1JIHA 2GR9A 5AK5A 3KKZA 4GPZA 3NBZB 5DIZA 5F7ZA 1ORWA 1E9AA 3A14A 5IYZB 1F9AA 3CH7A 3S2UA 2CWWA 5F4ZA 3G13A 1C7QA 3G1UA 2IZZA 2J1LA 2AN5A 3HRHA 4M1KA 3TCXB 1P4RA 3V7NA 1FX0B 5LMNB 1Q0PA 2WUGA 5KTSA 3BE5A 5I3CA 2O8DA 2XR1A 4RZIA 1DEHA 4FFBB 3P26A 1PLJA 1XQWA 2JEGA 3ZDCA 3GP3A 3H05A 4PAWA 3EXIB 1JEYA 2RGDA 1PIWA 2Z2ZA 2D8MA 1E5VA 5EUQB 5T8KA 5IC6A 2NP7A 2ES4A 4BATA 4XFJA 2Y9MB 3AG6A 2EFCB 2Q5FA 1LRKA 1T1JA 5L40A 4JT4A 5D2CA 1SXJD 2ID4A 3RIHA 3WWEA 1IXRC 4F2DA 5KWVA 4GQAA 4D3SA 3ZDBA 4JI4B 1W52X 2EQ5A 1QUFA 3LUFA 1TYZA 4QREA 2JARA 2AH5A 1AX9A 3AYXB 1B74A 3AVYA 3I73A 2QMQA 3SMVA 1VHDA 1ZM4A 1L1EA 2ZUBA 2FJPA 3R5SA 2ZR7A 4XCVA 3QELB 2A92A 4IIHA 2IS1A 4DPLA 2GEDA 3HJGA 1HFKA 2M05A 2OD9A 1KDVA 4K8RB 3R7BA 2FLWA 4F8EA 3JRWA 3ADCA 2H1RA 4P3NA 5DCYA 5T6MA 2WP0A 4Q24A 5CDHA 2IH5A 2I9PA 2D59A 2IYTA 4HNUA 2HPVA 3R20A 4EIWA 1LF5A 3DBHA 4HS9A 2B21A 5JZ9A 1NYTA 1YB2A 1FNNA 3I2IA 2GVNA 4L4RA 3WLJA 4M86A 2EIYA 2UUOA 5E1MA 1O6CA 1TYEB 4JYMA 4ZGWA 4FGSA 4ZRMA 3WIEA 1RRCA 1C9KA 5ALOA 1A97A 3DS8A 3ONVA 4J4TA 1APBA 1GR0A 4H31A 3SS9X 5DHQA 1YRBA 4B3HA 5DN6A 5KNCA 1Z35A 1ZOIA 3NHYA 3RVJA 1CF2O 4P1ZA 3CLHA 3WA7A 4NG4A 4JB2A 5K3WA 3WGYA 5CRIA 2B99A 2KBEA 3SXUB 5KYKA 2VWGA 1TMYA 2DFVA 1PWHA 3DMHA 2PNJA 3TTSA 4NHOA 1VLHA 2RGWA 2I4OA 1EWTA 3SJUA 4Z7OB 3GLHB 4C7OA 3Q8QB 1Z62A 4X3PA 1TYAE 4NJEB 4ZI7B 2XTNA 1GGHA 3K4QA 4B3IA 4CC6A 1VXRA 4G0MA 1QP0A 1NQVA 4X1OA 4WZAE 3EXFA 3WB0A 1QX4A 4EUEA 1KTVA 2P9JA 1SCIA 3C6BA 3GEDA 3G2QA 3KJFA 3W9SA 5B58C 4O2LA 3SOZA 3T5KA 3QKTA 4BCBA 1UMDB 4LXQA 4O7VA 2WD7B 3H2GA 3PQ2A 2VTDA 5HRAA 2OZLB 3NUQA 3TJZA 1DBSA 2A14A 1I9GA 2UDPA 4YUZA 2G25A 4YRSA 2VL7A 4JBXA 3K9FC 2CXSA 1VMIA 3CB2A 2YWDA 3TMKA 5J5AA 1F8FA 2PZJA 1R74A 2WIBA 1ZFNA 3ENKA 4W9NC 3LCMA 1NZFA 4IQGA 5FFNA 3AKZA 1RI5A 3Q41A 1NRIA 4FDMA 3LWBA 3W34A 1URPA 1FW8A 4JT2A 3YASA 3NP9A 4K0RA 2FPUA 4PG6A 3V3TA 1AMOA 1HFEL 1Y4AE 3RAJA 1YF3A 2MR6A 3JS5A 4MTDA 1O95C 1TKAA 2FFQA 5IJ0B 3RSCA 4U9HS 1EUDA 4FR5A 4WLUA 4AWXA 1OH7A 1VL8A 5DNWA 1QVZA 2H1CA 2J7PA 4TUYB 3H87A 1BU5A 3FUCA 1R9GA 4W7IA 1DWPA 3DV2A 3QENA 3U0BA 4ZV4A 4JI7H 3OHBA 3UJAA 4U7FA 3S8EA 4ED9A 4DPKA 1N6PA 3NOXA 1CYEA 2JGKA 4PQYA 2I2WA 1VS0A 3T1VA 3K2IA 2R8YA 4WE3A 2NU7B 1V8FA 3BHIA 2NNWB 3DLPX 4TMKA 1C0EA 4QAQA 4QVKA 3RC9A 1CUYA 1M1YA 4FB4A 1VXOA 5HK9A 3DEIA 4BUCA 1C30A 1CW2B 1AUVA 1HO3A 1N5DA 2J3HA 1PZXA 3HCFA 2COKA 4O2AA 4P7KA 4QO8A 3DJFA 1IQPA 1Q0UA 2ZR9A 3DTVA 3PGKA 3JZIA 1QHYA 1KI7A 4KXYA 4IVQA 4TRNA 1GCOA 4RNNA 4FVTA 1LV8A 2HV9A 4CYMA 4EYEA 3RVDA 2QBYB 3DT8A 3M7IA 1ZM7A 2P7IA 3ISJA 1A0IA 2G76A 5L3QA 2XKBA 4DV1H 1I33A 2IEGA 1BEEA 5CFMA 4K6HA 3IAXA 3OMLA 1YR7A 3CH4B 3IQZA 2D13A 3TR5A 4DG9A 3K0HA 3ILYA 3IP6A 3O8DA 4I36A 1XHEA 3GJYA 5KTOA 1DJPA 3VZRA 2GEFA 3CHYA 3CZMA 3J7AC 1L9KA 2O0LA 1JDEA 3HOYG 1ZK1A 2PD4A 2WYIA 4R54A 2R97A 4UEWA 1A96A 3K2QA 5FV7A 1RDFA 2PO7A 5FHRA 3HFSA 1Q84A 3IOCA 4JS0A 4JSTA 4UDNA 1TWHA 2F2TA 2JA6A 1QF7A 4UUQA 3K4HA 3WYGA 2GPTA 2HSZA 2XZPA 1Y63A 4RMIA 4EVQA 1E9CA 1RWNA 3AUYA 4LISA 5BOSB 1E2HA 3AF0A 2GX6A 2PZLA 4GXRA 5T8KC 3I5XA 4FDVA 4MJLA 3TLAA 2VCYA 1JG1A 4W5HA 1HMPA 3D8RA 4Y7CA 1RQGA 3AHGA 3WIBA 4JBGA 1WP4A 4FMBB 5FI0B 1DRUA 1KJWA 4RPIA 5TJHA 1ZZEA 4D8VA 2HF8A 3EEOA 1T43A 2XNDA 1XD9A 3NHFA 3DLTA 3WWYA 3FMOB 4KR9A 3DMYA 3V7WA 3QBTA 2C97A 4BEVA 4EK9A 2NVWA 4BASA 2Z6UA 5CVUA 3F6YA 1L4KA 3DM9B 1GZHB 1OA1A 1WCIA 2O50A 4XJVA 1B14A 4HD8A 4AX4A 3TRHA 4ES6A 3WL7A 2X41A 1KZ9A 3OZDA 4EQ6A 3T5AA 4MPTA 1FSGA 4O2BB 2P91A 2O8FA 3E6AA 4G8BA 4JHXA 2GASA 1YZTA 2XCOA 4CUJA 5KAPA 4NBSA 4CMGA 3MTJA 3QEBZ 5FWXA 3QE2A 1KYZA 4YAKA 4TS3A 4DLYA 1EUZA 2BR3A 3EZ2A 4TYWA 1HY3A 1QP8A 4CKBA 3NHPA 3BHMA 3BQMB 4ONEA 1S6YA 4QNMA 5EZSA 4YWHA 1KJNA 3SXPA 3LUDA 5C7YA 1V16B 1Y4DE 4FFNA 2NU8B 1V2GA 2WTEA 3AVQA 4O8CA 3TLMA 1CS0B 3QPVA 3JW8A 3C5HA 4H0CA 4F3KA 4QWCA 3PHJA 1G8AA 3E5NA 4JJ7A 3EODA 3PBKA 2FWRA 3HU3A 4FMCF 3ABQB 2AMFA 4M1ZA 4ZCSA 3WNDA 5DQGA 3D6UA 3JVDA 3V4SA 4XH9B 5AM4A 4L4ZA 1L7PA 1W46A 2BEUA 2X5OA 4P3XA 4DR4H 1G6KA 2OCXA 1P29A 2GHTA 3NJ4A 1DO8A 3PDJA 3QWAA 5JEDA 3T7KA 4O4IB 5AVWA 2PJRA 5DWVA 1QDLB 2CLEB 3NXKA 3RJ0A 3S40A 1G19A 1E59A 3JASA 2J8ZA 4D80A 1ULSA 2CFMA 1TIKA 4KFUA 1XAIA 3U4CA 3HB5X 3RE1A 3PZPA 3AX6A 1JHUA 4PS0A 4F2PA 4IW3B 3RJ5A 2BR5A 3SVLA 2G9UA 1H85A 4N47A 2P9YA 4QIWA 3NH9A 3R41A 3NW9A 4JGBA 2FFJA 4PRYA 4WKBA 1DTWA 1AOXA 2ADMA 1A5TA 4MVJM 4O25A 5ALSA 3OEYA 4MRPA 3T34A 3TZEA 3AP2A 3UCEA 2BKVA 4AF6A 4D4MA 4UBMA 3Q98A 2M2IA 4QTXA 4DWOA 4HRAA 4KAXA 4X65B 4WEOA 2AG6A 5H9WA 3LD9A 4EO9A 1UJMA 3PXUA 2GAFA 3TW6A 4DA7A 3O90A 1SXJE 2QNIA 1KEPA 3PEWA 2I3ZA 4PO9A 1IIBA 2BMVA 1HH4A 2ONZA 4N40A 5GZ3A 4OI2A 1E4FT 1E61A 2IPMA 2Q6KA 3E5HA 4RAYA 1J6UA 1QAMA 3D8HA 5IYDG 4FBGA 5C8YF 5A71A 1T0PA 3TLJA 2WSBA 4PYIA 2RKOA 2PFGA 4NDZA 3TB6A 3B9QA 3GJXC 3ER6A 3TSCA 1U3WA 1H8HD 3QUCA 3KR1A 2ECKA 3VZCA 4BWFB 3F97A 4RGQA 2JA5A 2B82A 3TSWA 2FDRA 4UVDA 2VPXA 4PG5A 1OU4A 2I78A 4QBHA 4BMOB 3ZWNA 1N32B 1REQA 2B4YA 3GBVA 4E2ZA 1U3FA 4BGDA 2QRVA 3B13B 3V8NA 3WL8A 4W5OA 1DKRA 1ESDA 1SUSA 1T1RA 5ETJA 4COOA 1E2FA 3OFKA 1G7TA 2KSWA 5B37A 1D0VA 3AWDA 3ZBTA 2WYHA 4ZOLB 3S2IA 4UOEA 1YUMA 5ECYA 4CCYA 1LXCA 2PLFA 1CDOA 5JW6A 1AT1A 2R1VA 5JJIA 3L40A 3IAS6 4XTCS 2CW7A 2Q45A 3PC2A 3RJTA 5A4MS 3HJRA 4V03A 5AJXA 2QE7A 5H1YA 4BKUA 5I9NA 2ZSEA 2OTCA 2YC2C 3JX9A 2B3TA 2CDCA 4HBGA 5EHQA 2OH2A 4B6PA 4DV7H 3AT1A 3BICA 3E2IA 1RLTA 1SEPA 3P9ZA 5F78A 2P6OA 4AFNA 3M5PA 2WLTA 2XXBA 3GX1A 4G9BA 3GLRA 1KP3A 3MWYW 4MWSA 3OOYA 2PWBA 3E70C 3T7IA 4PEVA 4D56A 2DWPA 3ZUGA 1EXNA 3GMTA 1MDBA 1XZCA 3ZVLA 4F0JA 2V7UA 3FNQA 4MUEA 4IR9A 1UM8A 1DCKA 2QF7A 1F7VA 3KVNA 3IUMA 1XKTA 1HOTA 3ZWAA 1RR6A 2XMSA 5FKJA 3INRA 3D0KA 4ZPXA 1BW9A 4D8WA 4ZOCA 5CEFA 1K0UA 4LJ5A 1YVUA 4Q4HA 1JMKC 2P6PA 3CRVA 3B85A 1XJ0A 2F9LA 4MWTA 3U31A 4BDTA 3N28A 4R8LA 5LMUH 2C4VA 2PJDA 3D7RA 3HHPA 1K3UB 1ORVA 1D6SA 4D9IA 2JHGA 3NTRA 3QI2A 1U0OC 1CUUA 4MUKA 4YV1A 1Q6YA 4GPAA 3UHFA 1NMSA 2K2WA 1CY2A 2NT3A 1P5HA 3OWOA 2ZIEA 4G1UC 1Y34E 4HWGA 4JLNA 4KMMA 1KFJB 4JIMA 3SR0A 2O1EA 4BFTA 1SHLA 2DSNA 2IKQA 3HJHA 4MRMA 3GIMA 2W9XA 3ZCRA 3L0YA 5HUJA 1UC9A 1FDOA 3ZX5A 1U8XX 3UYYA 1V5GA 5FAXA 2UVPB 5K2OA 6YASA 1MOZA 4NAHA 2BW0A 1SXJA 4Z0NA 3SN6A 2D5IA 3UHOA 2G0TA 3CCBA 2YS6A 4IDNA 2PLNA 3EXHC 4LMBA 4IDFA 1QTIA 2RHRA 1RWPA 2ST1A 3MYRA 4M21A 2D8AA 2PU7A 4KIWA 4WZBB 3HDVA 2WE7A 2JI7A 3O3OB 4O4LF 3A27A 3TNFA 1O95D 1UOQA 1P1KA 3EGXB 3SICE 3EVAA 1RI1A 1L6RA 1ZM9A 3WYDA 3LQSA 3CG0A 3L4BA 4ZT6A 4DUGA 4WOPA 4AN1A 3NHMA 1DRWA 1UJ4A 1U7DA 3ZK8A 4XYLB 1OFUA 4CMKA 4UCVA 2B4KA 3H2IA 3PJGA 5FFFA 3WLTA 1OFGA 4K86A 4HGYA 4ANFA 3S68A 3UTCA 4RYLA 2XB9A 1HT0A 4CNBA 2BC9A 1W88A 3SFTA 1XP8A 1J56A 1H2XA 4ZHQA 2QHXA 2YN4A 1PZGA 3FWHA 3LYHA 4X20B 2ZBPA 1EU1A 2Y67A 5JUMA 4D96A 1IONA 1UJ6A 2G70A 3FM9A 5F1OA 1QZ3A 1W35A 4ETWA 4D9NA 4HFNA 5DYWA 2OO5C 5D1OB 2VQ6A 5EP1A 2ZRKA 1F4PA 4FGRA 1DBRA 1RM4A 4EF5A 2W11A 2PMKA 721PA 5E6UA 1OZFA 1PJZA 3CONA 1KJZA 3T8YA 4YQWA 1XEWX 3VVBA 1ZIYA 1ZN7A 1SEIA 4BO6A 3PR5B 4IIGA 5CW2A 4A3KG 1CEEA 3EZ9A 1ULZA 1QIJA 1U0SY 2HD4A 2VSXA 3BGOS 3BWXA 1ILWA 4KWEA 4TKZA 5AH0A 4DDVA 5JC8A 3KT6A 1G60A 3D3NA 2GYWA 3L6DA 3CUWA 4FKZA 1MAWA 2YMPA 3DGEC 5JDCA 3M9NB 1UBRS 3LQ1A 1GU1A 3GMSA 2AYYA 4MPPA 4UQPA 5EJ4A 2XUIA 2G5CA 4YRZA 1LB1B 1R6UA 3PO3G 1XQXA 1WXQA 2OFPA 1CHNA 3F9CA 3TEJA 5MDHA 4DV2B 2W6IA 2C59A 9ABPA 4D5EA 4HSGA 2I4IA 1TADA 3RD5A 2JRCA 2XMDA 1BN7A 4DJJA 2CJYA 2XGSA 4MKIA 1U4NA 4OA5A 1T4CA 3E8SA 4FEGA 3X2FA 3O2QB 3ZWDA 2W8ZA 3GLHA 3E48A 3ILSA 2AR0A 1TQ2A 3EDYA 1H2YA 3VSBA 2GZDA 3HXQA 4OAPA 4ZT3A 5ALFA 2CFIA 3KJNA 1BD4A 2VR1A 1HBJA 3L6OO 3DZDA 1YKGA 2J7KA 3O2NA 3QK7A 4MS3B 3D6HA 5F52A 4C87A 3I4NG 4Q44A 2EGUA 4CI9A 1IN5A 2AGVA 1PI3A 2GD0A 3FPAA 1JG7A 2OSVA 3B5JA 3LT4A 1A5AB 1E0DA 4K05A 1HR0B 2JAPA 1HR0H 2VA2A 1IG3A 1R0WA 1VPTA 2ZTVA 4D44A 5LMZA 2F4NA 3RR2A 3EGEA 3M4NA 2F3SA 1HDOA 2F8LA 4LX8A 3R75A 4D5GA 4I0WB 3KKQA 4OHOA 2J6IA 1OVMA 2CK3A 4H2DA 3S5UA 1PO7A 3EC7A 4EARA 4UTXA 2IEBA 5BW5A 3L6EA 1ZISA 3SI8A 2H9YA 2OCGA 4X0EA 3DTVB 4YFYA 3ZQ6A 5EJAA 1ZOOA 2XF8A 1X39A 4GKVA 1JH8A 2GRJA 2P77A 2PR2A 1EG7A 3UWMA 3FMIA 4QUAA 3RC3A 2ZANA 5B58T 4ZEVA 4CMEA 2Q2OA 1W1WA 3QEMA 5JXWA 5KOJA 3KUKA 5KFVA 1D7OA 2HMUA 1XDSA 2ZXFA 3ORRA 1B76A 2GN1A 4NZYA 1QYDA 4NPHA 4XWTA 4L5BA 4K5QA 4E33A 5AKGA 2Z4RA 5LN1A 3B78A 3RSFA 3K1AB 3EPRA 1QFJA 3U3RA 1X0XA 2FUKA 4M46A 1F8XA 2PH7A 1CUJA 1YR2A 3BDIA 3ZY2A 2F9FA 4KQGA 4J9QA 1DIKA 2OBBA 3FCAA 3IP9A 4P82A 5B1EA 3ZHXA 2BKUA 1XNJA 5LU9A 4AKHA 1T2AA 2BBSA 1ARZA 4BCDA 4DIEA 2J6UA 1MO4A 3GLQA 3KFLA 1S3IA 5B2ZA 3IA2A 1TNDA 1XAGA 2EFHB 1U9ZA 3KZNA 5HS6A 1G8JA 1C4OA 3C3BA 1L5HB 1POWA 2AK3A 3HO6A 4I50F 4BWYA 2DIKA 1OCEA 1WHSB 2QNBA 2Y2UA 3HG7A 4Y0NA 4E5YA 3Q7EA 5EKXA 2XMCA 2XUAA 2AU0A 2AG1A 3I9V1 4OI4A 4B46A 4C0QC 3IN5A 1TXGA 5K3OA 5J2TA 2JGRA 2QLFA 1OXTA 2NXWA 5TIIA 3F8TA 4MVWA 1XEXA 3DOOA 3MTDA 1A9SA 1Y7PA 2A9OA 3CGGA 4KXVA 1YS4A 4BLTA 3COWA 2IE8A 4KO2S 1XNQB 1R27A 3C8ZA 5BQ5A 5B3JC 1H4TA 1BVHA 2ZSKA 1H6CA 3AZOA 3L7IA 4N0QA 4WESB 2NZUG 2NW6A 5EKUA 2FSIA 2OCYC 3GFFA 2C4WA 2Q4OA 1YE8A 2BJWA 1EGVB 4XD7A 4Y67A 1DOHA 3D02A 4KLZA 4X8LA 2R5FA 5I7HA 2AN1A 5U4QA 4W9RA 4DR6B 2I8AA 1XZGA 2BE9A 4HLQB 3EPHA 3DMFA 2FP3A 3C98A 2DPXA 2HQSA 2NQ2C 4OV6B 1R4MB 1CR1A 1U1DA 3FW1A 4EW1A 1BVUA 4LCBA 1V5FA 4CQNA 3BF8A 3DDOA 3HYNA 1YVPA 1SXGA 3MUNA 4KTTE 2EARA 1NI4A 1RW4A 3THXB 4OX9Y 2IA5A 3KVVA 3DVSX 3GGOA 1LPNA 2C00A 2CN1A 5K3SA 1C4WA 2G88A 4G3IA 1GNRA 3A05A 2V9CA 3DO5A 3G5TA 4FHCA 2AJ8A