5C1OA

Crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
297
Chain Sequence
b'MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 88
structure length 297
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1oA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1oA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1oA01
4YBZB 1PK8A 4HNVA 3R9RA 3ETHA 1WR2A 4EA9A 3SE7A 4FE2A 4FFRA 3RV3A 4ME6A 4ZHQF 3JZFA 4MV1A 3RUPA 3G8CA 4HR7A 3HB9A 3TINA 2YZGA 2DWCA 1GSAA 2R6FA 3U54A 1E4EA 4FFLA 3RFCA 4GGMX 4MV7A 1KUTA 4YB8B 4WD3A 1JDEA 1W93A 2YZNA 1Z2NX 4O4HF 4MV6A 2YZLA 2ZDQA 4M9UA 3U9SA 2W6OA 1KJQA 2C00A 3OUUA 4MV9A 4EABA 3HO8A 2GLTA 2R86A 2VR1A 2SCUB 2VPQA 3HBLA 2NU8B 3U55A 2YS7A 4IZOA 2V59A 1AUXA 3KREA 4YAJB 1KJ8A 4DLKA 1JDBB 2NU7B 3LWBA 3R5HA 4EA8A 1GLVA 3BFPA 1SCUB 3BSYA 4IWXA 1UC8A 1OBGA 4EG0A 5D8DA 3BSSA 4XYMB 1PX2A 3DF7A 2GPSA 3JRWA 3R5FA 2X0SA 1BNCA 4O2BF 2HJWA 3K5IA 2CNUA 5CA0F 2WYOA 4DIMA 3UFXB 4J6EA 1KEEA 4EA7A 4M9CA 4ZI7F 1KJ9A 4O7TA 4MA0A 5LP6F 4O86A 4I50F 4I55F 4O4IF 2DLNA 4ZOLF 1EYZA 5GONF 2YYAA 1IOWA 5C1OA 5LYJF 3I12A 4NYEA 4WBNF 4HQ6A 1EZ1A 2W6QA 2CQYA 4C5BA 3VMMA 1UC9A 4O84A 3V4ZA 4FU0A 2R7LA 5BPFA 1M6VA 2GPWA 2YWVA 4O4LF 3WO1A 5JVDF 1B6SA 1AUVA 4EAAA 1C30A 2OLSA 4FFMA 2YRWA 4YJ2F 1I7NA 4O2AF 1DV2A 1GGOA 2ZDHA 4IIJF 4ZQIA 4I4TF 3AX6A 1CE8A 2Z02A 2FPGB 2FB9A 2I80A 1VBHA 4FFOA 3VOTA 2VHEA 1VKZA 2I8CA 2YZMA 5DMXA 3ORRA 1I7LA 4L1KA 1CQJB 3G8DA 3K5HA 5JQWA 4O81A 2W70A 2YL2A 3VPCA 4O83A 1GSOA 5LOVF 3VPBA 1BXRA 2R85A 2VQDA 2CZGA 5BMVF 5JQGF 4E4TA 2W6PA 1ULZA 4HNTA 2ZDGA 4YAKB 4FFNA 2FPPB 5KX5F 4TUYF 4EGQA 3KALA 1Z2PX 1GSHA 3ETJA 3U9TA 2R7KA 3WO0A 3V4SA 4HNUA 4M98A 5CAEB 3OUZA 4RZQA 4XX0B 1VBGA 2PBZA 3MWDA 1EUCB 2PVPA 3MWEA 3VA7A 3ORQA 4MV8A 4C5AA 5HV6A 1M0TA 1KC7A 5KKNB 2FPIB 3R23A 4C5CA 5H80A 3JZIA 3K3PA 5J2UF 5C1PA 3Q2OA 3TIIA 5I47A 2IP4A 4O7RA 1T36A 2R82A 5CA1F 4MA5A 4XZ3B 2W71A 3GLKA 3JRXA 2P0AA 2QF7A 1OBDA 3GIDA 3LP8A 5EZYF 3TQTA 2FP4B 1W96A 2CNVA 2YRXA 5JVLA 4MAMA 3BSWA 2CNQA 2DZDA 4YJ3F 1KJIA 4XYLB 1A48A 3R5XA 5LA6F 2NUAB 2R7NA 2GQRA 2W6NA 3TIGA 1B6RA 1DIKA 4IHJF 4MV4A 4O7NA 1E4EB 5FNVF 1EHIA 3WNZA 3E5NA 1JKJB 4FGRA 2NU6B 4O4JF 4FFPA 4TV9F 3Q1KA 2PN1A 2GQSA 4O7VA 4EGJA 1DV1A 2XCLA 5HBRB 3N6RA 2R84A 1IOVA 1CS0A 2QK4A 2V5AA 2YS6A 1KJJA 5C8YF 2HGSA 3VPDA 4Y8VB 5JH7F 2DIKA 4QSHA 2R7MA 5BPHA 4M99A 2J9GA 3NUAA 4TV8F 4O7WA 2I87A 1KBLA 2XD4A 5LXTF 1JLLB 5IYZF 2W6MA 3KAKA 3BG5A 3TW6A 1A9XA 2R87A 2W6ZA 1M0WA 4O7LA 4O7YA 3AW8A 4O7SA 3RV4A 1CQIB 5CB4F 5K2MA 3QFFA 4MV3A 2Z04A 1EUDB 5J2TF 4O82A 3N8DA 1Z2OX 3KAJA 2NU9B 2YW2A 4IWYA 4O7ZA 1C3OA 3MJFA 2V58A 2NPOA
chains in the Genus database with same CATH superfamily
1ZD3A 1KMHB 1XQWA 2D8AA 4A8TA 1B23P 3AZOA 4HS9A 3TQHA 5TQ2B 3B53X 4YIKA 4P34A 4EBEA 2RGWA 4BLUA 1W2GA 4ZAVA 4B1FA 3T54A 4FOSA 4HY3A 2XUAA 1N3IA 3CNEA 4CU5A 3JTEA 4CTNA 4ENPA 2O8CA 2HTFA 1ZH8A 5FA6A 1XFAA 1P3Y1 2WUDA 1V3QE 5IP9G 4I50A 4LXTA 3RS8A 3ICOA 2GUGA 2JLQA 1ZUD1 5KVVA 2ATCA 1V7PC 4XTRA 1WZNA 5D2CA 2J6TA 3ZC3A 4PNEA 2C84A 3VC3A 3ESRA 4ACBA 4UAJA 4X45A 4L5YA 3PR2B 2JGAA 2NZVG 1Y6GA 5ALTA 5AMXA 4LJ6A 4FPXA 5JO0A 3L04A 2WJHA 3I61A 2YH2A 3CSWA 3USES 5LQAA 2XMDA 4H1UA 2B0JA 1SVSA 3KXPA 4XVUA 4A3KG 3DOJA 5I7OA 2AZDA 5LYJF 1DI0A 3H7IA 3NIFB 3D8NA 3VSCA 3OTGA 1AT1A 3H5VA 3B1ZA 5F51A 3WQQA 3HU1A 4GM1A 1Q92A 2AN4A 2XQFA 1ZMRA 4G01B 4CUJA 2FDCA 3WBFA 4TWRA 5BN5A 2B8WA 5HKKD 5BWCA 4NNOA 3M9WA 4LZPA 1GAJA 1C8VB 2VHWA 1T4CA 3UOGA 1OROA 4MP6A 3QU4A 3G2JA 1YS1X 2BFFB 2XVAA 2A86A 2PZAA 4GYKA 1GRQA 1Z33A 1YRWA 3LUFA 4OU4A 2BW0A 2P6MA 3VR6D 3AERB 1E3QA 4CODB 5IEJA 5TPZA 1U1CA 1T5TA 4W63A 3K73O 1DTWA 1VRWA 3IAUA 2XGJA 3BILA 4RNMA 3GW8A 3O9ZA 4WASA 3IAAA 1CNEA 1WXIA 2VAPA 2CHGA 3ABSB 2OG2A 2XVXA 3ICCA 1JSXA 4G4IA 4MPRA 3FSEA 1JIHA 5DM0A 3QW2A 1SA0A 1N57A 1J22A 3DTYA 4JLSA 4BVJA 2I2AA 3AW9A 3PT5A 4PV7A 1AMUA 4N7JA 4Q4AB 4PCUA 1GDHA 2AFRA 1NOKA 4UVHA 5EZYF 4E03A 3LW7A 4GLWA 3O4FA 3Q9SA 4H0CA 3DOUA 3EDOA 3VSDA 1SC6A 1I9GA 4R5MA 2PQMA 1YRLA 2O4UX 1P8JA 1GQSA 4B09A 1Y1QA 4MUBA 5HX7A 4X3OA 5GM2A 3QLUC 3H5LA 3LRTA 1GG5A 3NFRA 4YCNA 4A73A 3FD8A 3CF6R 4ZI3A 4J0JA 1W85B 4WAUA 5FUWA 5MFPA 1A3CA 1SUCA 4MKIA 4NXMB 2FPPA 2E3JA 4AKIA 4QBTA 4B6GA 3K7EA 1K83A 4PIPA 2HN9A 4PS0A 3BICA 2RHOA 3CZ5A 4DV0H 2MT9A 1H2BA 1IBRA 4MGZR 3IA7A 3AR4A 4HDMB 3WLOA 4RHTA 4BO1A 3HJFA 2EYUA 3HFSA 2D3TA 4TV8F 3QKTA 1W6UA 1SQ5A 2WF9A 1CUCA 4JHXA 5B1DA 4OM8A 4LPKA 3ABQB 4CEJA 4F5WA 4FGSA 4GGOA 3F3KA 2IBTA 1ETHA 2JCSA 1CZRA 3TEFA 2GK4A 5DTJA 1GL6A 2JCXA 3H5NA 2J46A 1X7XB 4MP8A 2PUWA 3K4HA 3VI4B 2O8VA 5JEEA 4D57A 3L0CA 3ER9A 1OI7A 4EA9A 4FFRA 5CNKA 4OEHA 3V2GA 1YK1A 4BC1A 2XOKD 1Q95A 2FSVC 4JT8A 2HNAA 2EJ0A 1M1UA 4I5GA 2C2YA 4RPHA 1CB0A 2ZTVA 3AF4A 4G09A 4OKNA 1Z13A 2I7TA 2KS6A 1ZMBA 3PHGA 4G89A 3IEXA 1M2EA 1E18A 5LNK1 4WNCA 1C7ZA 3IDQA 3TRJA 3A1NA 1R3UA 5HF9A 2ID9A 2IOHA 1KK2A 4DAEA 4PYQA 4R9VA 4K9KA 1KJ8A 2WM2A 3RAPR 1L6RA 4P22A 1HE8B 5M2QA 2Y0SE 1YI1A 3FUXA 4K9SA 1KPGA 1V3TA 3L7OA 1I33A 2VOJA 2X8LA 3INTA 4HTFA 4FILA 2X0IA 4J6FA 3LRXA 1YQGA 2AZ4A 3VC1A 3DS8A 3ROQA 3QKRB 4QLOA 3G6YA 2EKPA 4BV8A 2XZPA 3L4JA 4LGCA 3ENVA 5DBHX 1E1CB 1EU1A 4LF6H 1AA6A 5I8WA 4EARA 4HDCA 5FR9A 5IC4A 1SO8A 3FWZA 1A8SA 5E9WA 4M76B 5F76A 3NKFA 1P81A 3CURA 2DWPA 4XWAA 4DLAA 2QRJA 1O97C 3GT0A 1UP7A 4KR7A 4LGMA 4LHZA 3O0TA 4LRWA 3BD6A 4GOOD 2W42A 2PCLA 2C9MA 2XNDA 1NXXA 5JH7B 1CYDA 1QV9A 5JSQA 4G0QA 3O73A 2H3HA 1BH6A 4WCVA 2BGIA 3CINA 2ZBFA 2HXSA 1RLMA 4A91A 4GKBA 4ZFNA 2QW8A 5JZOA 3K96A 4FDTA 1Q17A 1OWTA 3R74A 3MERA 2RDIA 3RAQA 2JBAB 1G0OA 3GQCA 1VLJA 4IIEA 3LDHA 4B44A 4WFJA 1ZEJA 1QE0A 4JBGA 2QAGA 5EL0A 2QL5A 4ZYYA 2GK7A 3FRHA 2FX2A 1EDEA 1UAGA 2B82A 2DYKA 4N3CA 2QXUA 3FPAA 1B7GO 1HZZA 2Z0MA 2G7ZA 4LECA 2VDKB 3ANYB 1G7SA 1QG0A 2C3YA 2CYBA 4Z1MD 3EGCA 2R82A 3UEOA 4JI4B 3FOEC 4XLTA 2GHIA 2O50A 4MPTA 1G291 1D2AA 1DL5A 2FP4B 1FYXA 3G13A 4ZO9A 4QBIA 4UUAA 3BWYA 1L1QA 2HXGA 3DQPA 5LP6C 4NDNE 2R8RA 2DWOA 5MGBA 1E99A 4TSFA 1TA0A 2E4YA 3NGDA 2QRUA 5F5LA 5KTMA 4EJSB 4IVRA 3M4IA 2D59A 3ZQJA 1C8KA 1RTTA 2PNJA 3D7SA 1UDCA 2C94A 1U7OA 3I09A 4RHCA 4ZDKA 1UNNC 3DBHA 1NNLA 5CNMA 2QENA 3JPWA 2ZPUA 3ZCRA 2UUAH 1UDWA 2BFDA 2IDKA 5GQSA 3DEKA 4E09A 2IP1A 5BR8B 3ZCSA 4ZMRA 3ZHVA 2YV2A 4ENTA 4PC7A 3D3WA 4TL8A 4NBSA 4QQ8A 4PO1A 1F8FA 3PXCX 3EBLA 4BKOA 3IT2A 2OCPA 2DQYA 8GPBA 5FD6A 1ZG3A 4C0WA 3UHOA 3PICA 3WBKA 2I87A 2X19A 4XZ3A 4MI9A 3AKEA 3TY8A 3CRZA 1Y7IA 3KV3O 4EJFA 1GQYA 4Q9LA 1JR6A 1NZDA 1NOIA 2OD2A 4MUMA 2QLJA 3DL0A 1K7EB 2NVUA 2QN9A 2WQ6A 2JLYA 4D99A 1BD4A 4ER0A 3RCBA 4M55A 3ZVLA 3DW1X 4RENA 4R71A 2ORIA 1MORA 5J4VA 3T3DA 3CF4A 4EA6A 2XA1A 2JD1A 2GTIA 2OSVA 1H2RS 3U4AA 3QWBA 4U8HA 2QL7A 4PW0A 2BFOA 4O3SA 5IXJA 1O5TA 4AYXA 1M2VB 2VJLA 4UUNA 4ARAA 1PWYE 5K05A 3ZE9A 4LMPA 4XLLA 3NDJA 2ERXA 5E1BA 1E9SA 3GGJA 1N9KA 2Q28A 1X80B 3LT2A 3FPGA 3K6SB 1ESEA 1TCBA 4C4YA 4E5YA 3QUTA 2PV7A 1D8AA 3PD1A 5LMCA 1HE2A 1D4OA 2W2KB 3FYUA 1MEEA 2O0MA 4F45A 3PQ8A 2NXWA 2EC5A 1BXRB 3DDUA 4CR6A 1CY1A 4WTOA 3IVAA 1OH5A 3EVFA 2ZKLA 5EUMA 2EIXA 5JTTA 5KFLA 4IOLA 3C3XA 2JA6A 1ZAKA 1RE1A 3FI0A 3BACA 4DLVA 4IVNA 2IY8A 1KDPA 2C4NA 3RVRA 4MEAA 4HDSB 3F6PA 3GH3A 3WV5A 4CF3A 5BWUA 4HH1A 2Y9MB 3S7ZA 4IGAA 3ETGA 3I2JA 1B6GA 4TL7A 1H94A 3ADOA 2SKDA 5LLDA 2DECA 3UZOA 1FP4A 4MWTA 3GLIA 4ZP1A 5AIAA 3V3KA 1H1LB 2PT7A 1I7NA 2IZ1A 3D2CA 4UDXX 3S0JA 5F21A 3EMVA 3GZNB 4YCLA 1H2XA 4QL3A 1N0UA 4KLZA 2UXBB 2CUKA 1IRIA 2VPZA 2J32A 3TLMA 2MHCA 4B74A 1J6UA 1P72A 2E1RA 1LCIA 2IFTA 2Q0SA 4RO0A 2H5LA 5IYZB 1QPGA 1ZW1A 2HA5A 1EFCA 1Y1WA 3B52X 1Z3CA 1O94C 1ZR4A 2ZREA 4Q7QA 2R48A 2Z5LA 1QIJA 5KYNA 1H9CA 1P73A 1P1IA 2XODA 3VPHA 2OYCA 1WUHS 5EE0A 1N7HA 3BJIC 3U4HA 1AB5A 1T34A 1N6NA 3MAAC 3QUSA 4TTJA 4W5TA 1FFXA 1Q6ZA 3WE7A 1I1MA 1YNSA 5DGCA 3EVNA 2XB6A 5DTMA 4I7HA 4M8NE 1C81A 3KSBC 5CVDA 3T6KA 4A8JA 2A0XA 2PMEA 2H6EA 3OCYA 2R6CA 1G8SA 3CPJB 2REOA 1P0MA 4J91A 2GKSA 3NWJA 4ILKA 2H1LA 3GFRA 3KUCA 4M1WA 2PD4A 5ER6A 2COJA 3X2SA 3T4UA 1IQ0A 4QYXA 3RW9A 5HJ2A 5BP7A 1FFYA 1C3EA 1COWD 2GPYA 2NACA 1ACMA 3A28A 3X1WA 2Z5VA 1KPHA 4FMCF 3KWJA 3IHWA 4EB8A 5ARDA 4S1WA 1KH2A 2X5OA 4RETA 4UNRA 3Q41A 3ECSA 4D25A 1E3TA 5IVDA 3DBOB 3FB1A 1QK3A 1Y1LA 4G0PA 1UODA 4RANA 2I2XB 1QYDA 3K2BA 1HT0A 2O1SA 2XCLA 4ZVRA 2P9JA 3GZJA 5LZ2A 4M36A 4GYJA 4UEOA 3M6FA 2VYVA 3PUYA 3VU9B 3TQCA 2HMTA 2IQIA 3NWBA 4NZ9A 3OPQA 1H8ED 1GPKA 3UXEA 4BV3A 1Z0SA 3ZNNA 1IY1A 2QPAA 4LOIA 3RV4A 3T3HA 3R3ZA 2FMUA 1JU3A 2YJTD 4P80A 2V7WA 3NC1C 2JGFA 3L05A 1U0RA 4NEHB 4UHEA 2WWXA 3GNTA 1YS9A 4IXWA 1R50A 4PXSA 2QSJA 3N74A 2ZRFA 1ZGBA 2J5KA 4H4CA 3CLKA 3KHGA 4PYKA 2YR0A 4TL9A 2YJ4A 2B99A 3IUYA 5B12A 2GCGA 5LOVB 3RVPA 1JH9A 1M2KA 1CNMA 5IBRA 2Q2VA 1MIOA 1NVEA 5BOVA 5E4TA 5FOXA 1GN9A 1NPDA 3BB4A 5EJ5A 4D3DA 4IKPA 3CX6A 1N3YA 3VR4A 5D1PA 4WZ6A 3IXLA 1KK0A 1TNDA 2ZIAA 1M10A 1NBWB 4JASB 4OQYA 1G8YA 4IMIB 3LW8A 2HI0A 2PBRA 1W0KA 2XYHA 4BIMA 3CKYA 1UBHS 3IVXA 3W6PA 4R8LA 2YCLA 4H3KB 4C05A 1CJTC 1KJ9A 4MDEA 1E9VA 3L7CA 1YA6A 1OHHA 3MTIA 4DZZA 7AT1A 2D0OB 5F3DA 3CF0A 5BT9A 2Q1UA 1NLUA 3W4KA 3C3PA 3LTNC 4L6AA 1IQUA 3CV3A 1PTJA 2GH1A 4BXOB 2H85A 2Y1FA 3O1HB 1CZLA 3E9RA 1D04A 3EQ6A 5JYEA 4E5UA 2ZJOA 4PC1A 4DQNA 3IQXA 1QFZA 3P4UA 3T5HA 1AMOA 4RMJA 1VG9B 4KXYA 2WFMA 1ORDA 2J9RA 3V4VB 1SUPA 2H2WA 4OM7A 2IZOA 1WEKA 1DU4A 1J2YA 3W1VA 3FBGA 3BTVA 2P69A 1TJ3A 3FPJA 3ITNA 5CB4B 5DN6D 2QVZX 1ISFA 4MPDA 4R68A 1M5RA 2AMVA 4Q5IA 3BMQB 5ALRA 5NLLA 4EUSA 4IJWA 2V4MA 4FFNA 3KKMA 1WTAA 3FZNA 3PYXA 1Y48E 4BZPA 1GIAA 1VJ1A 3LT1A 1YK0A 4LF7H 5JSUA 4RF3A 1K6XA 2KM1A 3T3GA 4NJMB 4HNGA 4KBYA 4PZZA 3QVGB 3ILHA 4ZARA 1DJQA 3W9UA 4WSOA 3A1SA 2PXAA 1PR0A 5CD9A 5CT8A 3RROA 1QZXA 4MVJG 3NTXA 1V51A 3F7NA 3T5PA 4JYBA 4IDBA 3GJSA 2HK6A 4JLPA 3KKEA 1ZN2A 3PN1A 3H9BA 4X24A 5T8KC 4LHYA 2VF7A 3SR3A 1E2UA 3NUZA 4YHHB 3JALB 4RA6B 3R5XA 1EDDA 1Q7GA 4UZFA 1SFOA 2VJQA 1FYFA 1B6RA 3V8BA 5A9RA 4CUKA 4QPZA 3AJEA 4NYJR 4KE8A 5MHTA 4DA4A 4GPZA 3AOEA 3QELB 2Y0PA 3H1EA 4CE5A 4JP3A 4NCIA 5FTWA 4MGIR 1XU4A 4FOPA 3ANXA 1TO1E 2OCLA 5AIBA 3OQHA 1BWSA 1CF2O 4X64H 4F4YA 4OL9A 4O6VA 3U26A 5CVTA 1JECA 2H57A 4CIYA 4M9QA 3ZDYB 3SJBA 3PXXA 3PEYA 3JASB 5LBTA 3A1UA 3T5DA 3KTAA 1K3FA 3OBIA 2PL9A 4E21A 4GW3A 1YJAA 3DAGA 5DYIA 2JFPA 3I52A 5GP1A 2AF3C 1EFVA 4EY4A 5HDBB 4DE5A 5CVJA 1C3OA 5JPDA 4UPEA 2B35A 3LVQE 3QNMA 3AR2A 1KYIA 4L5BA 2XSZA 1AVTA 3ZD6A 3SIPA 2PQ2A 2BQUA 1AGXA 4KR0A 1ECGA 3MELA 3S3TA 3D0KA 4LDPA 1CJUC 1FLAA 1QHYA 5L3ZA 1N5RA 1ISGA 4KXVA 2J33A 2I2WA 2VAWA 2LCIA 2B4QA 5JC8A 4BQFA 4XGNA 4MYTA 4PC6A 4DG5A 4X7RA 1A9QA 1X0XA 1PJQA 2ZSJA 4GBMA 1ECJA 4KPUB 2JCBA 1XPUA 2CXPA 2ZLBA 5CA1B 3RYHB 1TVCA 3W5AA 1OREA 3A1FA 1EJ6A 2PANA 5KAMA 3DAYA 2CCGA 4D79A 1Z5GA 2WJWA 1C1YA 5C52B 1N6PA 1UPCA 2CNUA 2DFLA 3I9JA 1KMHA 3OUTA 2VTVA 5D5HA 5TQ2A 5BRAA 2BHLA 5A04A 2OAQ1 2E6UX 3C98A 2BELA 2WMNB 4MLZA 4QQKA 2CYCA 3TE6A 3AI1A 4M1KA 1YL5A 4JUCA 1PJAA 4QNNA 2P4UA 4FB4A 3BA1A 4RQAA 2BM9A 1YZLA 2JGNA 4PZPA 4RD6A 3MQFA 1U98A 2YC4C 3RB8A 5JZVA 3A4YA 3EDRA 2Z56A 1CHNA 2QRVB 4R84A 3GP8A 2Y1LA 1NVAA 5FADA 5IFLA 1N5DA 2QVYX 5HF6A 2FW0A 5LUBA 1S5PA 3GNQA 1A9SA 3ET5A 1OFHA 2WTUA 1EE1A 4EHIA 3KQUA 1JDTA 4CG1A 3HJRA 5GV8A 1FTYA 4A3IG 4DUZB 4HADA 2N3ZA 3CZQA 5GPBA 4N76A 5ITSA 3C3MA 1D2RA 2Z1NA 2D8MA 5FWDA 3CTPA 3PYLA 4I2NA 5K3BA 4ILEA 3E27A 5ADVA 4M98A 4Q3EA 4P86A 5DLDA 5ICFA 4N40A 1GZ6A 3RRFA 4DHEA 3WOHA 3TTYA 1IE3A 3KX2A 5LN1A 1OAOC 3A9CA 4G3XA 5H80A 5EG5A 3U3JA 2VIIA 5KFNA 2IP4A 1QYRA 2JH3A 4MI3A 4I2VA 4CKWB 1TYEB 3MOSA 3HDVA 3CUKA 2WJJA 1JYFA 1UKVY 4JGBA 3OKAA 5LB2A 1I4DD 1V71A 2BFFA 2NV2B 3LIPA 2QTMA 4GLBA 4Q1CA 2GO1A 3RRNA 1O75A 2HU7A 4WCDA 2IV7A 1K2WA 5CIYA 5H4HA 1TOAA 4EHBA 3AERA 4ZTUB 2AXEA 2G36A 1HDRA 1Q1NA 2H92A 2H11A 1PV2A 4KHPB 5CRIA 3H0GG 1Y3IA 4NI5A 1JBEA 3MJRA 3W5HA 2OCDA 4AJ9A 4D3XA 1AZTA 3MMSA 2BI4A 1U8XX 3HVIA 2CNLA 4D4JA 2OYRA 4I1RA 5FUBA 1RE0A 1HDCA 1TJ5A 3E9ZA 4D9JA 1N6OA 3VR4H 4YUXA 1V96A 4EY5A 1Y9EA 4BJ6A 1E4OA 3TMAA 1G5RA 2Q62A 4TLCA 5AI4A 4MGYR 4Q4AA 4KBGA 2PUJA 3UV6A 2CW7A 4ZJZA 4K0KH 1O57A 3HRIA 2YW2A 2EERA 2QE6A 3AI3A 2YHAA 4FLFA 2IYRA 1ZH2A 2GD1O 4HNVA 4JJEA 2O7SA 2JIRA 4OIMA 3R0VA 4ECUA 4B3RB 1HORA 4GI5A 3IAHA 3TINA 4UQOA 2JPDA 1P45A 1C3XA 2VCEA 4CR8A 3DE5X 1EJ0A 1FFAA 3VOAA 1FNSA 3INNA 1PQWA 4CIXA 1Q1QA 2BFEB 1FEZA 3PTZA 1W85A 3SZRA 4KQGA 3G3EA 1M6NA 1T5HX 2DOKA 1MW8X 3O4JA 3UMCA 4MYHA 3ZDZB 4QARA 2WSMA 4RK6A 3AKYA 2F2TA 4RE5A 3LG2A 3N3BC 4RVOA 1YR3A 2X5RA 1PJ8A 5C3EG 4HDMA 4Z8XA 3R75A 2XWBF 1GTVA 2ZSFA 8ABPA 2ZITA 3H4MA 3WB0A 4XXHA 4CFZA 1MB3A 2WJ3A 1DZIA 1PBNA 3K32A 2J5QA 4S2UA 2LP4Y 3OC6A 5EPUA 2BGKA 1X7XA 4L27A 3SJAA 4IQ4A 4N01A 1FSGA 2Z2ZA 2F3SA 1UANA 3G1UA 1VPDA 4BVFA 1VSTA 4JQSA 4E0BA 4MICA 5EA2A 4PM4A 3GT4A 1QRTA 3K8YA 4LQ4A 3WAGA 4MZXA 2VUIB 5JCZA 2NMVA 2OHFA 3DFUA 4C20A 2HLNA 4ZYZA 4OAQA 5HW0A 3Q8MA 3PQDA 5GGXA 4A10A 3ILVA 1JG3A 2Y93A 1QGZA 4P33A 1P80A 4PICA 1X1CA 2O9JA 1N3LA 2DHDA 4TMXA 4XFDA 4IIJF 4BDTA 4CCAA 4A6DA 1X74A 4C14A 2P9HA 2JIZD 3HI6A 1OXXK 4M21A 2ONJA 1R5BA 3FN4A 1EB9A 2EW1A 2N75A 5EJFA 3W05A 4RM3A 5IASA 3RB0A 2V3VA 5C32A 3E58A 5KFZA 1XPRA 1L4LA 4BFYA 1O08A 5FOUA 3QKRA 4QIWE 3NX4A 5EE3A 2VQFB 5LPNA 2WTXA 3N5CA 3BB3A 5KX5F 3LHFA 3JD1A 3RIXA 1UIMA 2W2LA 4N49A 4QUIA 1E1CA 2Q7XA 2VZEA 4QPCA 2AQKA 5IF3A 2HNBA 3ZOKA 2BE9A 5J59A 5A0FA 1K0FA 4ZODA 5BUQA 1XNRH 5HFJA 1S2NA 2BUBA 5GY7A 2E9SA 1SUFA 4WW0A 4AYBE 5FEMA 1H5UA 4AX4A 2GCNA 4Q4DA 1PNRA 3TLXA 4MDYA 1PG2A 2E82A 1OXKB 3BN3A 3BMOB 5JH7A 2FQWA 2JEOA 4ZYTA 3E5RA 1PRYA 3NO4A 4DEYA 1OH8A 4BEWA 3S70A 3AKZA 1U7DA 2BVNA 4LHVA 4CM3A 2C5SA 3G0BA 3NXKA 4KR3A 4PBSA 1M54A 4IUBS 1J42A 4INJA 5LQRA 1BW9B 3N8KA 4CQJA 4HFMA 2BRUC 2JBAA 4ZOAA 4JU9A 1I4EB 1KFCB 3RTXA 2WHQA 1M8JA 2D4AA 3EGOA 4LA4A 1GA6A 1V4NA 1HURA 4IGIA 5KC8A 2FPMA 4WVLA 3ABZA 2A58A 3A4MA 5ALDA 1Q12A 5AHKA 4ZTZB 4KSYA 1PS9A 4X95A 1P3DA 1OFIA 1FDIA 4DIKA 2CUZA 5ESXA 1LFAA 4UU8A 2VP5A 2BGRA 5AW1A 1TAEA 1OJ7A 2VHXA 4YAWA 4M1EA 4FWBA 3KQTA 2BMJA 2FP4A 5HJ7A 2DFPA 2FHPA 4ZCQA 2VEOA 3VR5D 1RQXA 1CUYA 3L8CA 3V33A 2CDCA 4HVTA 2QB5A 5JYBA 2EEPA 2X4DA 4MVCA 5TMDA 2N0SA 3RC2A 4EJSA 2FZEA 2BYTA 2IH4A 2ODEA 1T2AA 1BKYA 3CCFA 4ECZA 4YCJA 3R5TA 4UREA 2BTQB 4M9ZA 3DM9B 3BZUA 4UU0A 1SK8A 5L9XA 4C0QC 4AN0A 1T94A 4GMGA 4W4TA 2PTGA 1CRWG 2LKCA 2QRGA 1K92A 4JV5B 1RCTE 1U7ZA 4BEBA 3JQBA 3DVLA 1W5TA 5DO9A 5G0SA 3UWMA 2ADMA 2HLHA 3S40A 1DJLA 1F0PA 2G6BA 1E64A 3RFVA 5FP0A 4M8KA 5BSUA 4D9FA 1YQWA 5I7UA 7REQB 2C7RA 3BMCB 4UVIA 1NBEA 5D8DA 2W7OA 2IYAA 5EYPB 3FLEA 1LDYA 4FR2A 1KAHA 1L7AA 3ANNA 3B6EA 3IKLA 2JHFA 1HGXA 5BW8A 2ZIFA 5DTIA 2R65A 3VVLA 1YRBA 3ZNOA 4RD4A 3HL0A 2E0IA 3ADKA 3SQMA 1W47A 5IVPA 1EK2A 4MYCA 4OQZA 1WBJB 4QU9A 4QXAA 1U1GA 2JGLA 1CDOA 5DM1A 5B1YA 3KFXA 3HEBA 4MUXA 5FPPA 3ZK7A 3RYIB 4YQFA 3GILA 3FOAA 1E7MA 3O03A 4HNRA 1WQ1R 1L4FA 1NWHA 1M2VA 4FEGA 3NQ41 2WWHA 3UJ7A 4KXNA 2OL4A 5B6JA 1GJRA 2FMHA 4J9VA 4QG7A 4U9UA 5IJXA 1WUIS 4AS1A 4C21A 4I0WB 1X80A 3EX7C 2HVRA 1L7BA 1WHTB 3RBVA 3DZCA 3K6SA 2JFUA 1Y33E 6GPBA 5TJ9A 4YLYA 2JK0A 3NIGB 4DYHA 3GPCA 2X5JO 2W2KA 3L77A 1CXZA 1YB5A 3KPYA 3WG9A 1IUNA 1G5TA 1P5ZB 3K5HA 4I6EA 4YP5A 1AIPA 4MS3B 2JGJA 4DLBA 5CH5A 2QTNA 2QUJA 1BXRA 2OB2A 2HWYA 1NV9A 1U9JA 1U2GC 1X6VA 1WCYA 1X19A 4AYWA 1UF9A 3OSZA 4QXRA 3L46A 4OA5A 1MLDA 3FTNA 4HDSA 3QM1A 5IYBG 3KYCB 2X9QA 5KJFA 2IZ6A 1GYFA 3W5JA 2GAOA 2BBTA 3BXXA 3D8HA 3JYPA 1A8UA 5I47A 1B76A 1XI2A 2QDKA 3WNDA 1H1LA 1UBLS 4WZBE 5H16A 3OZXA 4XVRA 4DJFC 1YI8A 2OCKA 2J0SA 3GZNA 2M1XA 3LWNA 1Z26A 4MLCA 5KOHB 1CJSA 1P0IA 2AW5A 4B47A 1GR1A 5IYZA 4Z9YA 1ZN8A 2PUBA 2NVYA 2HQRA 3MWJA 4K2HA 1AGPA 2GHRA 1JFRA 4ZT2A 4D0NA 3Q0EA 2Q6IA 4HH4A 1XK5A 2VKTA 3WBJA 4J9MA 1KQNA 2AOWA 1LX7A 4WL0A 4M9RA 1P5RA 1UT6A 4HWTA 3DMDA 5TQJA 1KJJA 3OTOB 5EGSA 4L4ZA 4NBNA 4Z54A 3SLKA 5CJJA 2OBYA 3PS9A 3TLCA 5BSHA 4ZJYA 5I5UA 4Q93A 5I7HA 3IHTA 1XPJA 2WSSD 3PFHA 1BSVA 1GGHA 3ROTA 2CFIA 1A96A 3OQPA 1ONPA 3ZEAA 4AUNA 3DKIA 3AW8A 3H3JA 4A03A 4XE5A 4KZKA 3MJFA 4Q18A 3ZQ4A 4R2LA 2WU0A 1G8HA 3K0SA 5ITVA 5TEWA 5FNVB 4YRCA 3RAFC 4C2TA 2NNWB 1Z4QA 5ALUA 1NJ1A 1NULA 4EPTA 3PE6A 2QBYB 4C1NA 4UAUA 2OWOA 1MB9A 1E2LA 1NBIA 2VXBA 5LWHA 5KFOA 4A6PA 4LTDA 1LV7A 3HV2A 1P7YA 3VU9A 4LZJA 3VDXA 3SP1A 3RC7A 4U7TB 4DLKA 4ZT6A 1FCJA 1Q15A 3T5BA 3DLCA 2VQ3A 3L8GA 5J1TB 3U31A 2R3SA 4XYMB 3T5KA 4DXDA 1NXSA 5AVSA 4Q47A 4M88A 4IHQA 1MOPA 4NDAA 2OMEA 2C2KA 4BBJA 4Q16A 4QWDA 4CKYA 1SVMA 3TTTA 3UC5A 2AFHE 4K6NA 2PZEA 5BO5A 4HDKB 4O86A 3UO8B 4AMBA 5EMNA 3GLGE 2YYAA 4AJJA 1QFSA 4JEUA 5LOVA 4QJFA 1UBEA 1LWNA 1KZ7B 2VXOA 3LX8A 4L95C 2Z4TA 4H1TA 3EFEA 2OK7A 5ISMA 3O75A 3KZVA 2QM8A 2V9CA 2SKEA 1KY3A 4Z4CA 2AKEA 4QQFA 2ZBQA 3R7WB 4QOHA 2WE7A 1Q83A 1JALA 1K6IA 3T5LA 3Q72A 3L79A 4KRFA 5EE1A 3AFOA 4FMPA 1NE7A 1S2LA 4D4HA 1XUOA 3LYUA 4R1TA 2M05A 1ZA1A 1LGYA 2PJZA 4L2IB 3AVXA 1HT1E 5CEEA 3RVQA 4YXWA 1Z82A 5TRTA 1R3DA 5CB0A 4QUAA 2QR2A 1R1DA 3DV2A 5FOTA 1YC2A 4G1CA 3UAOA 2X41A 4BVLA 2ACWA 3V55A 4F06A 1D2CA 4BWFB 1FYEA 1KI4A 4OB6A 1OI4A 5DWQA 1U2PA 3J7AK 4EBBA 1CKEA 2GS9A 3QX7A 5HUJA 1YBVA 3R8FA 4BCDA 2EARA 4TMYA 4NP6A 5EN4A 3FNBA 1PJRA 2HRCA 4RWZA 1K1QA 4BXOA 3ZXIA 4W9NA 2ZJ2A 8MHTA 4DIBA 3ZQKA 3Q10A 5KFJA 1CZNA 4BV2A 3SM3A 3SOZA 3HSYA 4HAUA 2VF4X 3CLVA 3DFIA 4JHLA 4Q24A 4JI4H 1IZZA 5FBHA 5BR1A 3HG7A 4CCWA 1AH2A 3QKUA 4PCVA 4KAAA 3L6OO 1U2RA 1A1SA 2WQZA 3ASZA 4P83A 1STOA 2W6NA 1JILA 1KDZA 3X1DA 3IE0A 2FR8C 2J67A 5CB4A 4MV4A 2TS1A 3WFJA 3ZW8A 4EEYA 2I03A 3EF0A 4YP1A 1LV8A 1PWEA 1XRMA 3BMQA 1ZK4A 3O82A 2R66A 3KD2A 5HE8A 5JO9A 2O07A 1RQGA 4W1QA 1VLVA 4EGJA 2PY6A 4MYUA 2G09A 1Y3FE 1NZFA 5G0VA 2WAOA 5BR8H 3OJLA 3MA0A 3CO5A 4NJMA 5KVSA 3QVGA 1OBOA 1U7PA 4B3DA 2X86A 2P3QA 4UVDA 1V37A 4GP7A 3W06A 2AC7A 3IALA 3LS2A 1ZVJA 2CL0X 1JLLB 1RIFA 4BJ5A 3L6EA 3DDNA 4DEVA 1GR0A 4Y3UA 4M8LA 2F59A 4GOND 4FGJA 1XXLA 1M1YB 5LWQA 1UFQA 5EMMA 2I9PA 3DGFC 4D96A 3JALA 4RA6A 4LMRA 2B7CA 5ABPA 3CLRD 4Q34A 1ST2A 4Q82A 2GN2A 4YV2A 4WFIA 4URVR 5F64A 1SHLA 1JQLB 2EL7A 5L6MB 3P94A 5B5SA 1HNNA 3QELA 3SJ7A 1EGMB 2C9DA 2XNKA 3MUFA 3QU7A 2L69A 1X86B 1SY7A 2OXEA 4B3TB 3DAAA 1NQTA 4ND5A 1KEKA 3BC1A 1DKLA 1R6TA 5EKTA 4ZCRA 4IJKA 1C30B 4A0RA 5EDWA 2D13A 1BAPA 4LBWA 4WOCA 2EFEB 4RACA 1D8TA 1YR9A 2ZM6B 1EDBA 4IDPA 4CYMA 3NKLA 3RB3A 3JASA 4UM8B 4AT1A 1NXTA 2QE7A 4ZT4A 4PF1A 2RGRA 3IHKA 3WXMA 3MWMA 2C03A 3CMMA 4DL9A 3BXPA 1TO2E 2BY4A 1XV5A 4G97A 4OJQA 2NPFA 1N25A 1VGRA 4WK4B 2QD3A 2V7PA 2VRWA 2BR0A 1P39A 3PC6A 4Q37A 4GMKA 2GGSA 4F4FA 1GL7A 1R8SA 4J7XA 4J4BA 2FQQA 1HT2E 4EJ6A 1BE8A 3GRAA 2AFVA 3EXEB 2BE7A 4RMIA 5BV1A 4KP7A 4XYEA 3QPUA 2PKYX 1TUIA 2F8MA 2OLJA 2RBGA 3TQFA 4NH0A 3ZDAA 3ZS8A 4KWIA 3T3OA 4RKQA 1G21B 3LLVA 4O2LA 2FQ1A 3KPUA 1QIKA 5BNZA 4IDHA 1SHZA 2DVMA 3PENA 5EJIA 2SNIE 3ER8A 3L2OB 5IDYA 2J6CA 1YQXA 3W5CA 2EQBA 3FTFA 3ONDA 3I01M 3G8BA 4FYYA 1JSCA 4F93B 5AUPB 3TF5A 1JUDA 4XA8A 4KPUA 3IODA 3RSFA 1YZHA 1IG3A 3UK7A 1RCFA 2UXBH 4B32A 5CA1A 3RYHA 2FZCA 4NE7A 2XCTB 4K03A 3OJWA 4IIXA 1Q74A 2HSGA 4M87A 4BVAA 2WV7A 3HWX1 4FD2A 5DULA 2Q2NA 3F8WA 4O4IB 1NVBA 3OVMA 5EINA 1KEUA 1NLZA 2O4CA 2XCRB 4IRMA 3Q4GA 1L4GA 2H1HA 1J2EA 5LYYA 1R9MA 4MWBA 2C57A 4D9MA 4TVOA 3GTGA 3N0RA 4V1CI 2PS9A 3ES9A 4DAAA 5LD2B 2ZTMA 4C5CA 5LZ9A 1FRVA 1HSZA 3MJVA 4K8OA 2QRVA 5KQRA 3MT8A 2MCTA 1FX1A 4ECEA 2XMSA 2WHPB 4X6UA 5GM1A 3P2KA 3PNMA 2CNKA 1PYDA 3F8SA 5CFQA 5D5QA 2BQ3A 3BSWA 3FWYA 2SECE 1KMNA 3E0XA 1T1EA 2C2WA 3T9DA 3HEAA 5CXXA 2BFNA 4EECA 1ZK2A 4FBMA 3VSBA 3DE0X 5TT1A 2IPMA 3TIGA 1HI9A 1L5HB 4G84A 3EZNA 3QFSA 2GO7A 3MUEA 3A25A 3M3PA 4HLUA 3N8NA 1WG8A 4MIEA 3WKDA 4CIWA 4FFSA 3IIEA 2VYND 2ZI9A 1LRJA 5TVKA 4HXFB 3TW8B 2Q5OA 2YYYA 3UH1A 3ETEA 3SS9X 3KBOA 1ZCAA 1EX6A 2NVBA 1WVMA 2PV0A 3WRXC 5B6PA 1TTTA 2H5JA 4WY2A 3GLVA 1JIUA 1K7FB 3WSTA 3WYBA 1QDUA 4DDHA 3EASA 2OWDA 1WXQA 1NSFA 4CKWA 5KFYA 3KXIA 4DLNA 2F9LA 4IUCS 5J2TF 5GOTA 4BRUA 3AHGA 3E8SA 1LNQA 3OTQA 2B9VA 4ZRMA 2FEXA 3KEFA 3TGLA 3DE2X 4RPLA 3TQRA 1UOQA 3GEGA 4ZAWA 1FUEA 4F96A 2XC9A 1OYVA 2CFRA 4OHXA 3CX8A 3MR5A 4Q19A 4GGPA 1K66A 4W99A 4B3FX 3AWIA 2NQ2C 3WMWA 2R93G 1G4HA 3AFHA 3LSYA 2J3EA 4DM7A 5JIBA 5KU1A 3KZMA 1EFLA 3G89A 2DKNA 3FETA 1YRYE 1XVUA 1Q77A 2J59A 2HWXA 5KPJA 3D0OA 1JHYA 5AM1A 2JK1A 2FAXA 4A3LG 4LY9A 4BU1A 1RWMA 2DFTA 1XEWY 1J33A 1GPYA 1MAAA 2VWGA 4G0OA 2QP4A 1WPQA 2VXYA 4PLZA 4B84A 5K51A 1UZLA 3B9BA 3P26A 4BY9E 4DQVA 3G2KA 1EVKA 3S1LA 3C41J 5JSYA 2PHZA 2ZT7A 2X9NA 2WMDA 2PSJA 3OZRA 3E4DA 3IQEA 4KVZA 4RQUA 3QA9A 3AR9A 1U3DA 4X61A 2BFEA 1E1MA 3D3EA 1E9EA 4KMSA 5JT1A 3TX2A 4TS1A 4E4RA 1ILEA 1KVTA 1CVRA 2X0KA 1PVVA 2FX3A 5E4YA 2FGJA 1CBUA 1MQ9A 2HIVA 2Z02A 2VUMG 1EQ2A 1XZMA 2YJ6A 1M9NA 4JJ7A 3NHSA 1PT7A 1AKYA 4J0QA 4MVJE 4NG5A 2MYUA 3L9XA 2YL2A 5HCIA 2QM0A 3I4LA 3TSZA 2P1DA 3AB7A 4DQKA 2GN8A 5JQGF 2HD4A 3AUSA 4N0EA 4Z2AA 2GI4A 4IOJA 4NYMQ 1K9SA 4D1YA 1VZ2A 4QYIB 5FQOA 4IRUB 1YCGA 4UM9D 3PXDA 4DSUA 3EIXA 4N3AA 1M6WA 1A9OA 1FMFA 4E30A 3GV0A 1DQSA 3M9MB 1M1NB 4QDUA 5FLEX 2EP8A 4XIGS 1GAQA 3LRPA 2ASJA 2FWPA 4AG3A 4BZZA 1JFTA 1NW4A 3TDKA 2IXGA 4HEA1 4YK7A 2QGFA 1ARZA 3Q0TA 3UMVA 5ECWA 2YMQA 4EY8A 3LWZA 2LTAA 3VYRB 5COAA 1CY4A 1L7OA 3K9LA 3G0GA 1J8DA 1GNSA 1YAHA 4YJDA 1PFQA 5JV5A 4CWAA 3I5UA 3RVDA 4FBGA 3I9FA 4MQ6A 3ND7A 4UBNA 1SU4A 4YHHH 1MPTA 3ESBA 1R27A 3VJRA 1ZC3A 4DCPA 5M3BA 1TQDA 3H04A 5I7WA 2VPWA 1L5LA 3DT8A 3M5DA 1ZITA 2HK9A 4U7JA 1ZD9A 1O0CA 2X22A 4Q3LA 3DO5A 2RDMA 4AWAA 1DKNA 1KJZA 4L51A 2QX6A 1VYUA 2VP4A 1I5EA 3L01A 3W8DA 4LMAA 1V43A 3F1LA 5BWLA 1TZJA 3A32A 3VR1A 2Z1MA 3AP3A 1O5IA 3G8YA 3BFJA 4EGFA 4WOKA 3S5JA 3UANA 3Q3HA 2H1FA 1B8OA 1WY7A 1N5IA 1V5FA 4ALKA 4TQSA 2X7JA 4CF4A 2FUNB 4Q3DA 2AZXA 1MAUA 3NT2A 5DIZA 1P19A 5EXXA 3E81A 4I9FA 3QITA 2Q5EA 1Y1TA 2WUWE 3RV3A 4ZHQF 1SNYA 3RD5A 2CXSA 4BQNA 1CF4A 5IP5A 5GINE 1Y1RA 1W4ZA 2HWWA 3E6AA 1ULBA 1BW9A 2P11A 4TQ9A 3OFJA 1XD2B 1Z2NX 2YOHA 5B4TA 2X3FA 3IE1A 1CYEA 3RF6A 3Q11A 2A4MA 3BA9A 4QU8A 2NU8B 2COGA 1X3LA 2OVBA 3QOFA 4S1VA 3CONA 3GTQA 4L4XA 4J0CA 1I36A 1C0IA 1WCXA 1JT9A 2HLDA 3VO8A 4AIIA 3M4YA 3ZX4A 4FMBB 2VP6A 2FUKA 4MHSA 4G5HA 3A2KA 3HGTA 2VUSA 2WT4A 2OXCA 2BFBB 2HCFA 3WOVA 4EX6A 3AKDA 3WKCA 3CVJA 4KN5A 3EXG1 1HX7A 2XQVA 4LE2A 3VBCA 4EHDA 1SZCA 3KHLA 1QYVA 5FI3A 1E8DA 1VCMA 5F1OA 2WUVA 3TOCA 2FE3A 2ZS8A 2BTQA 4LQDA 1BC5A 4LJKA 1F48A 3CPSA 2VAMA 3V4ZA 2REBA 4CW7A 2O2IA 4I6JA 4M4SA 4LVUA 3W2FA 3JQ6A 1ZQ9A 1JDZA 1VIVA 1F8UA 4FW9A 2FMFA 1EBFA 1QNLA 2IY7A 4KO8A 2ZRQA 2HPHA 3ANTA 4E5MA 1S1CA 3EPPA 2BKLA 1ZD5A 5LFAA 3HBNA 3C6BA 4LOAA 1KIAA 1V9SA 5U9CA 4EGCB 7REQA 1RZ3A 3BMCA 1P2DA 1L5RA 2OWEA 4FI3C 1TGVA 1L5QA 1NW6A 2I3AA 5EYPA 4D7AA 2XZTA 2DTEA 3FKSA 2J4FA 2X7XA 3KLBA 4YJKA 3CZAA 2WF8A 2BJVA 2G25A 2ZWMA 4DUZH 5BNIA 1RWBA 2PZ8A 3M1AA 5ECDA 2XB9A 4NNJA 3KXDA 4ZKEA 1BQEA 3IAM6 2VYCA 2B6HA 4GT1A 1RJEA 1SAYA 1Z2DA 3FH0A 4P3PA 1A27A 3WKAA 3DDSA 3FCOA 3IBFA 4JUDX 2AMLA 1LK5A 4AAYA 1TVKB 2IDMA 3RYIA 1O87A 1S0OA 2H65A 2Z6QA 4MTLA 4EB3A 4ED6A 1W5AA 4NR0A 2DB3A 3ZI4A 2YWDA 1R9NA 5AXBA 5HKBA 2XBLA 3KE9A 4DIDA 4MWSA 5KSPA 1T1SA 2FWRA 4NCHA 1WHTA 2PZKA 3TBFA 4J3JA 3PRYA 3N42B 3T52A 3A3OA 3SFZA 2JATA 2GCEA 1Z2AA 4W7SA 1BYUA 4TRNA 1U3WA 3AQ4A 4C0XA 1PR5A 3L92A 2W8KA 1U7TA 2D7DA 5B64A 5KNDD 2Q1XA 4MS3A 4GIBA 3WL7A 4N0DA 3COJA 4BCCA 1XO1A 3RNLA 2QTFA 4RYLA 2FWBA 3V00A 1VL2A 1EFHA 4KHPH 3SYMA 3ZYCA 3QBDA 2C2GA 1ISMA 5JUMA 2V6JA 3E7PA 5HFAA 3ZY2A 5DLGA 3KYCA 1TMOA 4YCSA 1NUQA 4RFLA 4YVFA 4JP2A 1OWNA 1CZHA 1NW7A 3H9UA 1MJGA 2A35A 3V8RA 1ND5A 2IYZA 4YRGA 2DJIA 4DL4A 4BJ1A 3ROPA 1FDOA 3BXHA 3QWAA 1XOIA 1B8VA 4OOEA 4Y6RA 2CK3D 2VUHB 4YPOA 4BMOB 3HNRA 3H2IA 1FP6A 3OPNA 3R6TA 2B7LA 3ZHTA 1ZUNB 2NO4A 2Q0QA 5HKOA 5K3FB 2HDHA 3V6HA 3KJFA 4QELA 3EVBA 1JIJA 5KOHA 4F86A 4B9AA 1LKZA 2R8GA 3RK4A 5ALGA 2F43B 2FZWA 5DNVA 2X6RA 1LTQA 2R6FA 4B3RH 4MW1A 3IAFA 3ASUA 1TT7A 4W8OA 2CJYA 3P2IA 3IMFA 3N70A 3LLSA 3W8EA 3EBPA 4EQ5A 3C5HA 3U6KA 3X1ZA 2V7QA 3GLHE 4P36A 1PT6A 1C7JA 1K4KA 1ODTC 3SQLA 4Y2UA 3A6HA 1QUFA 4R3WA 3IEPA 3S7TA 3HXPA 3DV0B 3B3AA 1CU1A 221PA 1QO0D 4KXMA 3BFPA 2YC2C 1Q2XA 4UD6A 4ZVQA 3OHBA 3IOMA 3IP8A 4N8EA 1XROA 2GAJA 3BJYA 1N2JA 2FK7A 1KXJA 4ZYLA 4TLEA 4HQNA 3ONVA 1JEAA 3N2YA 2RHDA 4GR4A 3OLWA 2XCAA 1C1DB 4IYRA 5FNVA 1TECE 2H2DA 1PGOA 2HSDA 2DJ5A 2OKCA 2VDVE 2VYQA 2N9UA 3DUFB 1AQJA 1HKHA 3EIQA 2QBYA 3I62A 1IB0A 4HUJA 3TO5A 1YT5A 4WKBA 5G1NA 4NOMA 4U63A 2XZDA 3BWDD 5BPFA 1PFVA 3A1WA 2GJAA 1KRHA 4F5DA 1IBSA 1OZGA 5KDOA 4ID9A 4TYWA 4MSUA 1B00A 3USZA 4BNXA 3IJ5A 1ICEA 1DOAA 1VP9A 2NP6A 1A97A 3Q87B 3TSCA 5EPEA 1LF0A 3O90A 3PEVA 2QUKA 4HSGA 1EEHA 4FHEA 4DLZA 4WVFA 3RTEA 5FUQA 3NP9A 4P53A 3QKIA 4HGYA 4XYMA 1G8KA 5ESRA 2GNPA 4S35A 2O2GA 4L0CA 4YQZA 3RKRA 5CURA 1RQ2A 1KBOA 3BZBA 4RU1A 1JLRA 1CY8A 4ZEXA 1G20E 1XEAA 5JCJD 4CIDA 1TIKA 5H70A 5FOWA 4ZANA 3D7KA 4M86A 3KALA 4HDKA 2VQFH 5DQGA 2YHSA 2J3QA 4A2QA 5L7TA 3EDQA 3MC1A 4ZVMA 2X5NA 1K89A 2G9UA 4HX5A 4PRYA 1VKRA 3G02A 2YZ7A 1YVDA 1U2DA 4MRAA 1PDWA 4A8HA 1WVGA 3FSGD 1I30A 2DHQA 3TJZA 1K68A 2PR7A 4U2FA 3ESZA 4G1VA 4LSXA 2IYOA 2PMZE 5LKRA 5EMKA 2CYAA 4B2YA 4P6VF 3NBQA 3GIDA 5AFSA 5ENZA 1GRVA 4RK0A 4RX1A 2YY7A 3R7WA 4LZLA 4DCMA 4L50A 1LX6A 4YJGB 4V0QA 1XXHB 5G1OA 2XLBA 3C6KA 4L2IA 4BB0A 1EX9A 1MO6A 1T2DA 4O7NA 1CP2A 3WGLA 2PK3A 1PL8A 1BEEA 4G26A 1JAIA 2VRCD 1RLJA 1QWOA 1PBTA 1PNVA 2BGUA 3PZPA 2WWWA 1JU4A 3UMGA 4U00A 1MA3A 2GOYA 1ZMXA 1P91A 5FJIA 3DPUA 3NORA 4LYHA 2F1IA 2GTPA 2QVLA 3WLFA 3HDGA 4RTSA 2ZZNA 2H1SA 4OHMA 4ZVLA 3JZAA 4NV3A 5FWXB 1M2NA 1X70A 4EAQA 1ORHA 4YTEA 1KMCA 1BU8A 2C2DA 1Q1GA 3JQPA 2V4RA 4GO1A 1QVAA 1RPZA 5JLJA 2DM6A 1K06A 2QN1A 2SKCA 3V32A 4M0FA 3PPXA 1EUDB 2HHFB 3U3DA 3SNKA 1LSJA 5L9AA 4I4TB 3G2NA 1MC4A 4ED2A 1GLNA 1IVSA 5BR7A 5DTEA 1S97A 1XJWA 1UXKA 1WMSA 3ELWA 4X3CA 1BQ3A 4FHDA 4S0XA 5HG0A 1FDSA 3OEWA 1IBMB 4X60A 3AP2A 1DWPA 4RK5A 3KKPA 3JVVA 1LB1B 3OU7A 1ZJWA 1QS0B 1RI3A 3IBGA 3CLTC 1CUEA 2G7MC 2HEGA 1SXJD 4M0LA 2R8OA 2JIDA 1P75A 3QBVA 3F9CA 1BGWA 4JV5H 3KEGA 5IHXA 1UJ2A 1D5WA 1AN0A 2BJWA 1UT8A 4EUEA 2FJ0A 3IBCA 1HUQA 5E0OA 1ZGZA 4E3ZA 1JLLA 4OHWA 1RWKA 1K6JA 2E49A 5DLEA 4KAJA 4IKOA 5BSRA 5FYQA 1VMEA 1M1YA 1R8JA 3MJEA 4HGRA 4AJIA 2Q46A 2X0SA 4KQ1A 4N7MA 5CDFE 5AM4A 3FNQA 3I05A 1C7IA 3EOZA 4X8OA 5IUNC 3UFXB 3R20A 4AQYB 3DB2A 4LSMA 1RRKA 3RM3A 5EQTA 5LA6B 1LNSA 4MQ5A 4RKEA 1U3CA 2OUKA 5HR5A 1WXDA 1U9IC 4KN9S 4UHCA 5CGZA 1CW2B 1B2LA 1YDWA 4WOBA 3N07A 2P4QA 4NH4A 2FN8A 2GRUA 2QS9A 2EAUA 1JDJA 3TQIA 2ODTX 1A5BB 3WTCA 2GF0A 4XJXA 3VAAA 2J5XA 4CI0B 3HLKA 1C30A 2HF8A 4DV1B 3RU9A 2WUEA 4FQ8A 2P1RA 3D6FA 1QFJA 1J2JA 4UQPA 2R8IA 2FG7C 4R51A 2EJ2A 1ABBA 1ZK3A 5EWFA 2XD9A 3G5LA 3HCNA 2OP0A 4RK7A 1KJWA 5ED0A 1E5QA 4GI2A 4JXUA 2W2QA 1QQAA 3TNDA 1NRIA 1W76A 2O48X 4HNTA 3OOHA 1TUGA 3WWHA 4MIKA 3EXEA 1X1RA 3F98A 3JQCA 3H4BA 1L5ZA 5DYWA 4MVXA 2BDEA 2UVRA 6ABPA 2XV1A 1CP3A 4KWEA 4JR0A 4UQLA 3GZ4A 1IY2A 1G21A 2HIXA 5FJJA 1CHDA 2P9YA 5DISC 1S3IA 3Q2OA 4OLAA 4L73A 4C6SA 2XKKA 4P4NA 4NAHA 3ORFA 3QZ8A 3O3OB 3ENQA 4AB1A 3LP8A 2QRNA 3GG2A 4TYYA 1C4KA 2ZJAA 4MXDA 1RWPA 4WERA 4LZZA 1BMDA 1MHPA 1L9KA 4G0XA 3SGIA 4JN6B 4TM7A 2GD2A 4FXOA 1YE5A 1WKCA 2ZUTA 4EEQA 2FNAA 4LHWA 1TCUA 5EZ5A 3DR3A 5DGDA 2X9GA 1IEXA 3GH1A 1R6UA 5BYKA 1I2MA 1F1BA 1Y4UA 1BOOA 3L84A 3AF2A 4DLSA 3GLQA 1U2SA 3R7AA 2XGSA 4O4IA 2RIPA 4UOEA 1A5SB 2ZBRA 4GC5A 5EZSA 2YNMC 1SBZA 5H59A 4F3NA 3KJIA 2AXQA 4CQLB 1SXIA 2FSGA 3EZYA 2YS6A 1EVEA 3ANMA 1L9XA 4XSHA 2M6SA 2H2AA 3SJZA 1IM5A 3UAWA 1WMAA 3OTOH 3ILYA 3IO5A 1J90A 3WYNA 3BTOA 4YRMA 4BMPB 1VG0B 2A2ZA 3K1JA 3PZBA 2XMPA 4BMZA 3NBKA 3REFA 5K8JB 2WHPA 1P8AA 3ZVRA 3D8BA 4JOQA 3WFIA 2V58A 4W5WA 4JSYA 1ODKA 1Q0QA 1SOAA 1QIHA 4P08A 3MCAA 1KYTA 5AUOB 3BFKA 3EPLA 1EDZA 1L5HA 4PCLA 2WSLA 3ET4A 2W6ID 4QYWA 2DWCA 3GGOA 5K0BA 1ZHOA 3E0QA 3FRJA 4C6RA 2IS4A 2OQ2A 2ZI6A 1XRJA 4AN1A 3KKOA 1WZCA 4QOIA 4UE2A 4XEHA 2HUPA 1CERA 3VOBA 1MNAA 3MIIA 2F90A 2ONCA 2FSUA 1UOPA 2FRDA 1JX4A 3TW8A 4K6HA 4K05A 4EYKA 2J3KA 5EE5B 1E6CA 2IQ5A 721PA 3COSA 4YAJB 5CCXA 3IEUA 2OZVA 3CX4A 3ELUA 2GJ9A 4U7DA 3I4FA 5I4CA 1SCUB 5IFKA 4Y1GA 3RJZA 4RPGA 3RF2A 3OFNA 4D5EA 1KFKB 1TYAE 3GPDG 2ASVA 5BWBA 3H5RA 1SC3A 3IOBA 5KBYA 4D98A 4O7TA 5AUNB 3H8JA 3N86A 1Z8DA 2NSLA 1VRVA 3M9OB 4UM5A 1ZRHA 4BFCA 1M7BA 2FFRA 1OTYA 2JI7A 4UNQA 3VV3A 3ZHZA 4E22A 4FMDF 3QKSB 4TTPA 5IM5A 4HB3A 2PGXA 4CN8A 1ZRNA 4DJDC 2DPLA 3LX4A 1XJQA 4UTVA 1N8SA 3LX5A 4PZLA 3CUTA 1N7IA 4HRXA 2GB4A 2IHJA 4FE3A 4QO8A 1I3NA 2ZTUA 3SBXA 4B4WA 1J8QA 4DEXA 1HEUA 3LC0A 1YKSA 4P1ZA 4TQUS 2C31A 2PUAA 1RD4A 1ZRSA 2JA7G 3IR5A 4BTLA 2OHVA 2C7VA 2Q5QA 4HAVA 3SCZA 4Y0AA 3KJZA 4AKGA 1AZSC 1KAGA 5BQOA 4NXMH 5DYTA 5LP6B 2XITA 1UM8A 2C2OA 3U6BA 1SD1A 1SVLA 5ESDA 2DY1A 3E7WA 3ZDBA 3M82A 3JATB 1NBHA 1SIOA 5CAEB 2AHRA 2PJDA 3FKIA 4MVJP 5AJVB 1TZMA 3TQSA 2G76A 2PYDA 1RAGA 1YFLA 5FLYA 2AJCA 2XB2A 1G3MA 4U5XA 1NYQA 2CLEB 3PLRA 1L5OA 3Q3EA 2ZEJA 4MI6A 1JX6A 3Q7RA 1L7NA 1P7PA 5KNBA 3SVTA 1EPUA 1LBEA 2H5EA 3MWGA 1DGSA 1EXWA 5PNTA 1QIGA 3OF2A 4JJ8A 4ZOEA 4MHOA 1H1TA 5HA5A 1CY7A 1CUSA 4QNMA 4RVUA 3DE1X 2BFWA 1LBHA 4JI1B 1IONA 4R2KA 1VYVA 5L1KA 3VQTA 4R7RA 1OW3B 1GDDA 1T5SA 1RJPA 3O83A 5KFCA 1TM1E 3NNNA 5HRAA 5L3RA 4MS1B 4URHA 5JZBA 2KX7A 1JYEA 4QYIA 3QTBA 4D9EA 5AKZA 3KD3A 5C9ZA 4K7JA 2A5LA 4JXKA 4KUEA 2Q8QA 1S2OA 3L43A 1LW7A 4MWOA 1M1NA 3H1GA 1WPXA 4XB1A 5TQ0B 2DIKA 4AJHA 4M99A 2JZCA 2EBHX 1V6AA 1H8HA 3UK6A 1A8PA 2A8YA 1J2UA 3JAMW 2ZJZA 1KR2A 1CY6A 4OK6A 3DPSA 4K9LA 5GZ6A 3NG1A 3FVTA 2CB0A 4TN1A 1XA0A 4IG9A 4XAQA 1C1HA 2H8GA 4GR9A 3MRXA 2CJPA 2A0WA 4Y1EA 3W5IA 3EFOB 1L4EA 3R3UA 4OJMX 1XLTA 1WR2A 1QIIA 1TRKA 3DNPA 3U7GA 4H2DA 2Y0DA 4N5LA 2C0QA 2YCHA 1X9GA 1ECBA 3L41A 3FMGA 3HABA 3R0QA 3AHEA 2CVQA 3SYNA 3T1OA 3T5CA 3OETA 1R4AA 1L3CA 1VJDA 1ZNYA 4F92B 1Y7TA 2PO7A 4IINA 2I4IA 2W6JD 2YWGA 3EMBA 5H9WA 4B3TH 4LJRA 4RD0A 1XTZA 4Q9AA 2CXXA 1B0AA 2V6FA 2Y8EA 3KHUA 3B70A 4DDUA 2FZKA 3KYDB 2G06A 3OZVA 2ZM6H 2B36A 2AV6A 2QP3A 1C7RA 4WLFA 2NTVA 2R8JA 5J2UB 3QXSA 4RGVA 4WA8A 1Y4SA 3V97A 1X2BA 2WPDA 4QXOA 4MW6A 3T94A 4B8WA 3DEIA 2FCRA 1ZRMA 4JXXA 2P8SA 2PTHA 1NJ5A 3JQAD 1BNCA 2HJWA 4RK1A 1XHEA 3OCCA 4JUFA 4LV5B 1EWTA 4GM0A 1CUUA 1C2YA 3KP1A 5LQUA 3L5OA 4UCWA 2RC5A 1ZAUA 1CUVA 1KE2A 3RPEA 2AC4A 4UCOA 4F9GA 2BCGY 3W3AD 1LDGA 1VPLA 3A6ZA 2UZAA 4EBFA 3I8OA 2G9RA 5FX2A 1YAJA 1XD2A 4O8ZA 5I9SA 3A9RA 2PSHA 4DV4B 3TZCA 4UBJA 1YJ5A 4QUGA 4JJIA 5KVCA 3NTOA 4P92A 4V0KA 1XAJA 1UMDB 4UE6A 2NU8A 1J06A 4IR9A 5L4SA 3KR2A 2F67A 4RXMA 4HNSA 1P1KA 1XYGA 1E0KA 3WGUA 1Z38A 1JDSA 3IV9A 5UKDA 1VHLA 5TMEA 2C97A 3OOEA 2FKLA 2XWJI 2VG8A 5JFGA 4A15A 1TZKA 2GXQA 1DHRA 1P6XA 1V4BA 3PA6A 4YT5A 1TQ2A 2VT6A 3TB6A 1KEWA 4HYKA 4RELA 4ABYA 5LVAA 3LY7A 2BBOA 4H6XA 4GNRA 3GRVA 4A93G 3M5CA 2C07A 3RTGA 2DFKB 2BFBA 3VR0A 1T8PA 3NTRA 5IJAA 1P62B 2HYDA 2JHAA 3CH7A 1U7XA 1LLUA 4A8PA 4B6SA 5CM2Z 1KMMA 5IT5A 5TARA 1XDSA 2Q3DA 5CIQA 2NAPA 3W8RA 4U7CA 3V4SA 5HWSA 4Q03A 2EJUA 4PGHA 4YRSA 2NZJA 1HDOA 3QQMA 4WGFA 5FPRA 2YMLA 1GTJ1 5F2EA 2BF4A 3IB3A 3PHJA 5B37A 4R83A 2RHTA 1I6LA 2P9FA 2DTDA 5GV7A 1NMEA 4OKSA 5AP9A 1QE5A 3ZWDA 3B6JA 3HYLA 4HZGA 2EKBA 4NG4A 5KFQA 1PKEA 2ZXFA 3I1YA 3GLFE 1T3TA 3NGXA 3TZQA 1XQXA 4Q43A 3GRCA 4HDOB 1LK7A 2O0LA 4GXQA 2AJTA 4J7CA 3DV9A 3T1YB 5K6TA 4G5QA 2KWIA 2Q7DA 2BM1A 1L4NA 4Z86A 4HQLA 4YFYA 3SR4A 3SZGA 3SXUB 1H6DA 1DTEA 3ETCA 4N0PA 2I34A 2PX2A 5HZMA 3RJTA 1UPAA 1AUPA 5KPDA 2W11A 3PXEA 3DHWC 4JSRA 1H66A 1XVVA 1YULA 4RQBA 3PWZA 4TMTA 3AR8A 3OMLA 2BZ0A 1AGNA 4PFQA 4HAYA 4DIFA 4N6GA 3BWXA 4P3XA 1TVKA 5C8YF 4A2PA 4YR2A 2GDJA 3HKEB 5A3RA 4KZPA 1HDZA 2BEUB 2CNWD 4UCTA 2O2HA 3ZJTA 4O7WA 1QVRA 2C83A 1U99A 1XDUA 2MYTA 2CNNA 4E6PA 3OCXA 1PEDA 1TK3A 1EXDA 5E7QA 4I36A 5I7SA 1C1XB 1XP5A 3A9WA 3MNFA 3GLTA 1J07A 1SYXB 3Q5EA 4B81A 2DAAA 3COWA 1JE1A 3GRZA 2ZRLA 3GRKA 1Y14B 2HDOA 3A8TA 4M0JA 4JT9A 5KJEA 4DV7B 3D3QA 4TZTA 1FLDA 5B58C 2LWIA 4F4ZA 1NMYA 3TL2A 3RUPA 2VT2A 2ZAMA 4G81A 4PG6A 4EM6A 5IAOA 4OYHA 1DDGA 1HK7A 1Q21A 5JAZA 2GBCA 4WKGA 1OTXA 2Z3VA 1YB2A 3ZDRA 4HH3C 1RM5A 4PZ9A 2HQSA 2LZ0A 3L40A 2YYZA 2R62A 4JLVA 5KFEA 1SN7A 2ISCA 4DCUA 3T7RA 4L76A 3M1IA 4EYIB 3LBAA 4CQMB 1W73A 2ZWAA 4PZ6A 2CXUA 1XDNA 3VV2A 4C7OB 3OQJA 1FW6A 3KTMA 4UUBA 2RAPA 3PRKE 4KTTE 5DT9A 1VL5A 3PC7A 1U0NA 4TYNA 2D2FA 1M72A 2DQZA 2BT4A 3ZZ1A 1IZ9A 3H2GA 4DCTA 2PLWA 3ADCA 4J94A 3H0CA 2F1KA 1TIPA 1YE8A 1XEWX 1ZUNA 2E4UA 1O8BA 2JFZA 2VZLA 2ZVPX 5K3FA 1SBIA 4NFYA 3RBDA 4OP1A 1OA1A 3Q6MA 4A2CA 1EG2A 3HWWA 3O5AA 3UAGA 3T7JA 5IK2D 5DX8A 2QL9A 4OMCA 4PAMA 3HP7A 1NRWA 3EC7A 1EWQA 2F43A 5E7IA 2Y9PB 1Q91A 3AV3A 2PRYA 3I4MG 1T9GS 3K0HA 4IXMA 1K7YA 4B3IA 4Z9FA 4RV4A 4OJNA 1USGA 1XCPA 1PL0A 4OMUA 3GPBA 1WD7A 2FDRA 3EXG2 3V6LA 5CCDA 4U6SA 3M1YA 3FMIA 1QHNA 2G9VA 2Y0BA 1IDN1 1OVGA 4O2AF 4L9AA 1WEHA 2PH5A 4BLQA 4GSLA 1NX6A 1USIA 3DV0A 5E6RB 4D4GA 3DE4X 2I6UA 1P7ZA 5KNBH 3GTMA 1UFVA 1WUTA 1Z4OA 3RUCA 3UH0A 2CXHA 3DVAB 2FW8A 4JC8A 4X71A 4J0DA 3ROEA 5AESA 3VBEA 1C1DA 1AGRA 1KDTA 3URMA 3H83A 4DCOA 4KYIB 1HL7A 4QGHA 4TUYF 2IYPA 2R7AA 3D7NA 1E1LA 2HJVA 4RVNA 1O96B 3UJ8A 3DUFA 5CM9C 4EFMA 4FNGA 2DMRA 2D2EA 4MCIA 2P90A 3WADA 2XMBA 4DCNA 1SXGA 3A6GA 4MMXB 5IABA 821PA 1DAIA 1O95C 3BBPA 2Z6UA 2VJYA 4RABA 1ML3A 3COPA 3L4EA 5KTRA 5LMZA 2HPZA 3HN7A 3L1JA 3BBLA 2X42A 3SX4A 5JR3A 2R6AA 3MCWA 3EPRA 1BDIA 4FSHA 2ZT8A 3EQ7A 3M2TA 2DH6A 1SQGA 1X39A 3SK0A 3F6RA 5LIPA 3NDPA 2OV6A 2CXQA 5AOCA 2PL3A 1N8KA 5JXWA 1ILWA 5JS2A 3AQIA 2NU6B 4UTOA 1O77A 3EEFA 4H1WA 1XFDA 1YZFA 1UK7A 1FVHA 4F3KA 1X9HA 3QSGA 1RYEA 3J81W 3G5UA 2UVVA 3AIOA 4FHFA 3KV1A 4TTSA 3QIAA 3S27A 3MHPA 3SNOA 5LLTA 4RNNA 3SHFA 3DWIA 4LNHA 3WLKX 1RXVA 1ORTA 3MCZA 4J0GA 5IKPA 1KO7A 5JBNA 2CXNA 4EO4A 2QRKA 2W00A 5LJIA 1DXOA 3BULA 5CEFA 1IN5A 1BRMA 2I2CA 4A0HA 3EA5A 2DFNA 4LVOA 1G8FA 2XMRA 3R3SA 2C04A 3O7MA 3UOWA 5BWOA 2R8ZA 1AKWA 1RLOA 4YJGA 4MRVA 1XXHA 2FOXA 3EIFA 3DLHA 2CCKA 4EG4A 4C22A 3DONA 4DJJA 5C4XG 2AE2A 3WGIA 1LI7A 2YHIB 1NKSA 1DAFA 1EVJA 2EKQA 2WG0A 2XXBA 3UMRA 4XFJA 4FCTA 4QBFA 2ZUUA 2KE5A 2ZRBA 2DHCA 3HFRA 3TRHA 3S2EA 3FYTA 1SIUA 4KQEA 2QLBA 3IP3A 3IXMA 4UTRA 2VR1A 5IYDG 2QAIA 5DW3A 3CU5A 3HZOA 1TYCA 2JS7A 5H3CA 4LWQA 4UPVA 5FWXA 3WLTA 4MV0A 3FNGA 4WMLA 2XW6A 4TVIA 1US8B 3FIUA 1RM4A 1IBCA 2VDPB 3GNSA 1JI0A 2OT3B 1RAIA 3PQCA 5B4UA 1EUDA 2HHFA 3T9FA 4PC2A 1CJBA 1LUAA 3A26A 3AESB 2Y0SA 2FX5A 4WEOA 2XVYA 4QUKA 2GYUA 4I4TA 3UUEA 1QMPA 2FYTA 2Q9UA 5I3CA 3K09C 1RYHA 3I23A 4HPJB 3JVUA 5NULA 3PGMA 4E31A 1QQ7A 1P5HA 2AD1A 4IEIA 3R2JA 2UAGA 1E6MA 4DDTA 1OZAA 2QTZA 1QS0A 3H2KA 2XCUA 2IYSA 4NJEB 2GPWA 1OV6A 1E1RD 2BMAA 2VLBA 3EQ8A 4Y2QA 2XUPA 1HQKA 5A3SA 3PX2A 1NVTA 5IAAA 4L0DA 5FPYA 2QM3A 3SSAA 2GJSA 5DHUA 3P9NA 2H4JA 5EERA 3T35A 2LIVA 1GAXA 3CEHA 3FY4A 3GL9A 5HSGA 3VAYA 5DHFA 3DZGA 4DL5A 1OXMA 4ZKDA 3ZWBA 4A3GG 2Q3MA 1PFUA 3AK4A 1RZRD 2PX6A 3MXOA 3HDYA 4YAFA 3MYYA 4DWVA 1RQPA 3G5AA 1ULZA 1X7ZB 3UFXA 2MSEB 3GB9A 5BORA 1VI6A 4DABA 5CFMA 5LA6A 4UTNA 4LFAB 1R66A 2B63A 2IKQA 3EA4A 5FL3A 1ELOA 1TU0A 4EFEA 4Q0YA 4MR9B 4TGLA 3K71B 2BDTA 1HE4A 1YI0A 2G83A 5A2QW 3NYIA 3WHPA 2XLCA 2JI4A 3KSUA 2Z58A 5K8LA 1S0MA 2X1HA 1J25A 2AJ8A 2MDTA 4ECSA 1H65A 1ENOA 1X1SA 3BMOA 3GVPA 3I04M 3OCVA 1WUYA 3SS8A 4G5OA 1C41A 2CT8A 2I2FA 2E21A 2V7VA 1TKAA 1OOEA 4MGKR 1IXKA 1DARA 4WY8A 3H9EO 3PC3A 1KWKA 4MKZA 1MD9A 2JFOA 3Q40A 4B4VA 5CHYA 3PIDA 3Q9NA 2Z2XA 4IHJF 1TTHA 5THKA 1E4EB 3DHVA 4CT0A 3VNSA 3LPNA 1O0BA 4RKFA 3OCZA 3OU2A 5GGYA 5ADUS 3VAZA 1KTVA 1TADA 1Z83A 4J1SA 1SCDA 1RRVA 1IVNA 1J00A 5KT2A 1O6CA 2A3NA 4GX1A 4E7OA 1JXAA 2EXXA 2Y71A 5HBRB 3UIEA 3QLUA 4I08A 1WMDA 4AJLA 3P0EA 3FB4A 3PYMA 2DULA 1ZCBA 3N6XA 4UC0A 4RTOA 5HZKA 2A1TR 2Q3LA 3CKMA 4TQRA 4QUEA 1QFYA 1XVIA 4EFDA 1BE0A 4HATA 2E2HA 4OLFA 2QORA 5DASA 3FOWA 2AGVA 4PFJA 1AKNA 3GP3A 1LDEA 3TRIA 3C14C 3TTWA 3TDNA 1Q50A 4S12A 2YWRA 4IR7A 4CF7A 5JADA 3IDFA 4YBZB 3AONB 1Q6YA 4LF8B 2QIOA 1SEPA 4D3YA 1V7QA 3RUEA 1QB8A 3O1LA 4BO5A 4XVQA 4UPDA 2I66A 2OK8A 4JBXA 4DQLA 2ES4A 3MMXA 2G63A 1POXA 4EVRA 4FSXA 2OA0A 2O7QA 3LL7A 3V4RA 1ZMTA 2UZIR 4NHOA 5H5JA 4P7FA 1SPXA 3OY2A 2FSVA 2ZR7A 4XUGB 2BD0A 1MO5A 4HXGA 3ZV3A 1C5KA 2J0UB 3RRMA 2FH5B 1PKXA 1JMYA 3LH5A 3NJRA 2Q8NA 4ZVUA 4D6YA 2JAPA 3HA7A 4FKBA 3M7IA 5CVVA 2FW6A 1AUQA 3IIIA 3PHIA 1WKBA 4OI0A 1R0LA 3PW4A 2H06A 5H3HA 4AD8A 3BQMB 4BP8A 2ZP1A 1B0PA 4S1NA 3LUJA 5H1YA 4LRTB 5KJ1A 4J9LA 1FPMA 3WWYA 3ZY5A 5DNCA 2O7VA 3LFTA 1QO7A 4KWHA 2IYNA 3ED5A 1YRHA 4HGZA 1INLA 3L06A 2HSZA 3VR2D 4JYZA 2NUPB 3DEAA 4A92A 2QSYA 4RTNA 2IPAB 3HKZE 1AD2A 4DV5B 2WKWA 1QIMA 3WLJA 2XGGA 3QMMA 5DNUA 4LXYA 2QX4A 4A3DG 2P9QA 2H52A 2EF0A 1Z45A 1UT5A 1BCSB 2H1VA 2NT3A 2RB4A 3C5WP 4CRWB 3PC8C 3DKVA 3KT3A 1USWA 4YAJA 4U3JB 1FTGA 3VNQA 1QTIA 4H0FA 3KT6A 3MPUA 4F1WA 1TYDE 4BO8A 5DP2A 2XTZA 3CEPB 4WZBB 1SCUA 5FFNA 1A8HA 5DG8A 2K87A 4YV1A 3UYLA 1WULS 5DH9A 4O02B 2BKEA 4RTKA 4RAZA 3L7JA 4KMRA 3LHKA 2JA5G 3BMNB 3I53A 4JLJA 4TL6A 1GRRA 3IB6A 3N8HA 4R8RA 1VKHA 4BATA 1XLWA 4K87A 5AVXA 2PCJA 1GGKA 5F9FA 1XVAA 2MINB 1QQTA 3TKAA 4EATA 2HBYA 1HPLA 1YZKA 2A4KA 1R64A 5JW6A 2JZOA 1JA0A 1SCIA 3P32A 4TMKA 2VUGA 3A0UA 3SFVA 2FPKA 4OYYA 2FMIA 1EP3B 4WE3A 3U7HB 3PFKA 3QKSA 4WK2B 5KT7A 3ADBA 3CUUA 5E1MA 4QUJA 3TEMA 2Q4TA 1BEUB 3SHOA 2JGDB 1NQVA 4GE0A 4IQGA 3PIRA 3G2PA 4KO2S 1RW4A 4GZ3A 2QUBA 4W8HA 3NBXX 1KOGA 3Q7EA 4GI3A 4PGGA 2CMDA 5C53B 5CIWA 3SQNA 2I6XA 2YKGA 3UB3A 3IFSA 4D5GA 4HGQA 5G41A 3UKDA 1Q20A 1GGNA 2HGZA 2XYGA 1TAQA 2PGIA 1DQRA 2E4WA 2C88A 3GA5A 2ZSAA 3V48A 1QGYA 3WIEA 2YZ2A 3G2HA 4OX9Y 1Z4KA 5K03A 5LP6A 4IEEA 3WXBA 4BNMA 1MENA 3KQQA 4AS3A 5EHNA 2OEPA 3JATA 1FRQA 1N8TA 3EGWA 5CAEA 5LMNB 4I46A 3FA2A 4B80A 4GPEA 3E2PA 2DPIA 3M6IA 4DNXA 4M7EA 2ZGIA 4FWIB 3IP6A 3CUWA 1OU0A 2G9ZA 3IQFA 5F9LA 4BKRA 3PF9A 4RZ2A 3NVMB 1YU9A 3D43A 4OQNA 2GASA 2VJCA 2Y0CA 5IKXA 3DKRA 3KAKA 2G80A 1KVQA 3UPUA 1GTG1 1N5LA 1Q0TA 1A88A 4LNAA 3WL3A 1A9TA 4MW9A 2VS1A 5KG3A 2ZSEA 3M6WA 2WA2A 4NIMA 3VNUA 3K0FB 4NTZA 1NBOA 2RGEA 2WI8A 2Q4RA 1G8GA 1VKJA 2HCJB 3FFWA 4J9NA 1IOLA 3OG9A 5CVCA 3NBFA 4MS1A 1MO4A 4C0JA 3V8PA 2XEDA 3GLGB 1IBMH 2QYOA 2QD5A 4UCFA 2WJYA 1KI9A 3UGKA 1NF9A 2KSQA 3TSWA 2HG8A 3W2GA 2ATXA 1W1UA 3WQHA 1Y82A 1PAUA 3B1YA 1XDBA 2RKWA 3JPYA 2JDIA 4DW8A 4DUYB 1RJFA 1L0BA 1P7VA 1YA4A 5BT8A 1Z0AA 2V03A 4O3MA 3BWEA 1E66A 5DBIA 4UCVA 4R8MA 3GT7A 1TW3A 3IV6A 3DWFA 2NVOA 2YHUA 1Z6XA 3JQEA 5K0LA 2V97A 5HCUA 1LD3A 1QZZA 1T8TA 3EFOA 2PMKA 3IKJA 4WNYA 4FONA 3EEIA 3GELA 4KTVE 4TYMA 4C2AA 4I55F 2GPTA 2XUDA 4AQYH 1GZHB 2OY0A 3GXOA 1F1JA 1GYQA 5B7PA 4TLDA 3QEBZ 3HRKA 4I66A 4FOLA 4HQ6A 2JVKA 3JR7A 2WP0A 5KYGA 4K3VA 3RS4A 1PCXA 2GLUA 5SZHB 3MLAA 2UVQA 3ISVA 1CQZA 4PX2A 1ADJA 1M8KA 2PZJA 4DKJA 4R2JA 3KUKA 1I2AA 2G1PA 4URFA 4FINA 1VS0A 3FYCA 2VRBA 1Y6JA 2X7HA 1T9ZA 3ZJ4A 5J5CA 4C2UA 4DV1H 5SICE 3KYDA 3GX1A 5DWDA 3UGJA 1Z7GA 3AM3A 4LWOA 5J2UA 2JJ2D 4P4UA 3WSVA 1PTKA 2ZSDA 2ATLA 1YNOA 5C51B 4O81A 5T4HA 1X94A 3QLEA 5ILOA 2WHRA 2QTLA 2XF8A 5IUKC 1FSFA 1RJDA 3JWEA 1JNXX 3DEYX 1PO7A 4DLUA 4DAOA 3AVPA 2C99A 2FOIA 1T6NA 3P9XA 4FYKA 3TXYA 4DLPA 3BXGA 3QX3A 5SYNA 3JWHA 1DGQA 3R4CA 1O94A 4B6PA 5HK9A 5D84A 1PT8A 3OAAA 3VZDA 2VNIA 3KWLA 1KZ9A 4HT3B 3UKJA 3BAZA 3LQYA 4CM4B 5AM2A 4RJJA 3QF4B 3RU2A 1C50A 2P75A 5M04A 1M7GA 4ZN6A 4Q1AA 1QOPB 1UMDA 1SWVA 1KSFX 4DIEA 3V4LA 5G4LA 2X5KO 1J0BA 3OE4A 1GWNA 1KYZA 2NO0A 4ZYXA 2K2WA 3O3CA 1NJ6A 4MITA 1NBME 4J75A 1BE1A 1GPNA 2N47A 4MQLA 2P3OA 4PPNA 2O8DB 4G1UC 5COQA 1OY1A 3TTUA 5FTNA 1K5DA 3RS9A 3MFHA 1JPUA 4ZU3A 4Q05A 2WD9A 2WM3A 4BKMA 2G8LA 2Z2IA 4XW2A 2YVKA 5KWJA 2P5YA 4HQRA 4CLHA 3GJQA 1ZINA 4LXQA 4PZCA 2PR2A 3QHPA 3NHJA 5JJ5A 4BEVA 2YJ3A 1JNYA 2I6FA 4C29A 3DBRB 4NJOA 1Y3CE 3EGEA 4NESA 1Z88A 4LW8A 4UHJA 5GVRA 2A0FA 4YRFA 2JKVA 2Q1YA 3ID6C 2YDYA 3A4IA 3M4ZA 2I3ZA 2NU9B 1ZW6A 2H1CA 3SAJA 4B6RA 1MB4A 3L4KA 2NIPA 5TGDA 3CUYA 5BYBA 2MYNA 1HYGA 1YZ3A 2IUFA 3G6KA 1IN4A 5CXQA 4F9EA 1C4WA 2JNWA 1PDOA 3SXUA 1XMSA 3OEED 4BNWA 3MG9A 2H0RA 4S24A 4EG7A 2RKOA 1G3UA 3KVOA 1W49A 5DXAA 1Z3IX 2APJA 1ONNA 1JJAA 1UKZA 2WYIA 2YZLA 1HLDA 3U9SA 3WMEA 4G4SO 4EY7A 4DMKA 1HYEA 3IC5A 4GG1A 4F4IA 1MX1A 4F6CA 3G6VA 1YJXA 1XAGA 3HKEA 3OJ0A 4M1QA 3TY9A 5K3WA 2PH3A 3S24A 5EJ8A 2BEUA 4EQZA 3DLTA 1THMA 1YUMA 2OD9A 3Q7QA 3MQ2A 3VC7A 2E2IA 1V8DA 5BUCA 1C1XA 3DFZA 5AD1A 1C9NA 5I9IA 4FE4A 1I2ZA 4IPTA 3FHJA 8ADHA 3URKA 5T6BA 2RARA 1NX9A 1QH8B 1VM6A 3K5IA 4FCVA 2R8XA 4XR9A 3NDBB 5TX7A 1PR1A 4YBRA 4LRSB 3WRWA 1W4AA 3UBTA 4GQIA 13PKA 3ORHA 4C01A 4WZAE 2XE6A 3S1SA 2WIAA 1RACA 4R1NA 1XRPA 5JRDS 2HVQA 3I2KA 4ZTBA 1V8FA 5FOVA 5I48A 1XZIA 4B5KA 3UGTA 2RGGA 4QA9A 3ZWOA 4CGYA 3FHTA 1LJ8A 3ZWAA 5GJCA 5ALNA 5EHIA 4G0VA 1CD5A 4TQGA 2HRZA 4PQEA 1XTIA 1ADBA 1JIIA 4CQMA 4PWZA 2IPLA 4AKSA 4C7OA 1S2GA 1ATIA 4IZ6A 2ASEA 1E1DA 4CLEA 1E9RA 4EPYA 3DLIA 3ZKAA 1RAAA 2J3HA 4Z2YA 1ZHQA 2I7XA 4AQDA 1ZBQA 4GBGA 3A6EA 3HCRA 1MU0A 1JA9A 1S4QA 3HVJA 1YVRA 5H81A 2DH5A 4GUAA 1T3ZA 2EKZA 2XHZA 2Y99A