5C1OA

Crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
297
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 88
structure length 297
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1oA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1oA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1oA01
4WBNF 3MWEA 2NU9B 5CA1F 5CAEB 4XYLB 4O7NA 2YZLA 2HGSA 3LWBA 1W96A 5JQWA 4EA8A 4O7VA 4MV6A 3DF7A 2PVPA 2R85A 2YZNA 2X0SA 3R5HA 4EABA 1CQJB 4ZOLF 3HO8A 2DIKA 1KUTA 4WD3A 1JDEA 2YRXA 2GPWA 3JZFA 2SCUB 1IOWA 4O86A 1GGOA 3UFXB 4C5CA 2YS7A 3ETHA 1CE8A 2ZDHA 2R87A 3KAKA 3KAJA 3TW6A 2GLTA 4MV7A 2ZDGA 3HB9A 3BFPA 2YL2A 4I55F 3V4ZA 2VHEA 4HR7A 1KJ9A 4O4HF 5KX5F 5JH7F 3WNZA 2WYOA 2FP4B 1EHIA 3K5IA 3GIDA 1GSAA 2W6MA 3HBLA 5BPHA 4MV1A 1KBLA 4HQ6A 1UC9A 4MV9A 3R5FA 4EGJA 2CNUA 1KEEA 2XD4A 3ETJA 4HNVA 4FU0A 4IWYA 5LA6F 5FNVF 3N8DA 4TV9F 5I47A 4MV8A 1DV1A 2P0AA 1M0WA 3E5NA 3KALA 4IWXA 4O7YA 3R9RA 4HNUA 3RFCA 4YAKB 3V4SA 5DMXA 1JDBB 2YZMA 1WR2A 1EZ1A 2ZDQA 4J6EA 1EUDB 3K5HA 1GLVA 4M99A 3OUZA 5JQGF 2W6QA 4O84A 4XZ3B 1B6RA 4O7RA 1DIKA 2W6OA 3U9TA 5IYZF 4TUYF 2VPQA 4FFRA 3JRXA 3BSWA 4M9UA 4NYEA 1KJJA 2DWCA 2I80A 2YRWA 3GLKA 4XX0B 2DZDA 3VPBA 2NUAB 4DIMA 3LP8A 5H80A 2NPOA 1PX2A 4C5BA 1Z2NX 2R84A 4DLKA 3VPCA 2HJWA 4M98A 2QK4A 3SE7A 1SCUB 2W6NA 4EGQA 1UC8A 4ZHQF 4O7WA 2R86A 2YYAA 4MA5A 2FPGB 3VOTA 4M9CA 4IZOA 4O2AF 4MA0A 4O81A 2DLNA 5CB4F 2V59A 1AUXA 3WO1A 4MAMA 3RV4A 3JRWA 1PK8A 4O4JF 3TQTA 1IOVA 3U54A 3NUAA 2I87A 4O7ZA 1DV2A 1OBGA 4MV3A 5LP6F 3VPDA 4YJ2F 3U9SA 5LXTF 5JVLA 4FFMA 2CNVA 2XCLA 2YZGA 4FFOA 1CQIB 5LOVF 1JKJB 1OBDA 2R7NA 3JZIA 2Z04A 2R7MA 4QSHA 4YBZB 5J2TF 5KKNB 2CQYA 2VR1A 3TINA 1E4EB 2R6FA 1VBGA 2YWVA 4RZQA 1BNCA 3AW8A 5CA0F 3WO0A 2PN1A 2QF7A 1A48A 1B6SA 5C1OA 1W93A 1KJIA 4O7SA 4O2BF 4I4TF 4O83A 5D8DA 3R5XA 1VBHA 1Z2OX 1C3OA 1ULZA 4HNTA 1E4EA 2V58A 2R7KA 4TV8F 5BMVF 2C00A 1EYZA 1I7LA 2PBZA 1VKZA 2W6PA 3Q1KA 3BSSA 1JLLB 5GONF 4FFLA 5K2MA 4O7LA 2CNQA 4C5AA 3KREA 2GQRA 1C30A 1T36A 3OUUA 5EZYF 4IIJF 4O4IF 4GGMX 5BPFA 1M6VA 4O4LF 3G8DA 4XYMB 2GPSA 1M0TA 1Z2PX 5J2UF 2W71A 3G8CA 2NU6B 1GSHA 4YB8B 2W6ZA 5C1PA 3MWDA 3Q2OA 4EA9A 1A9XA 5HV6A 5C8YF 1AUVA 2NU7B 1CS0A 4I50F 3BSYA 5LYJF 2FB9A 4O82A 2CZGA 3ORRA 4YJ3F 4MV4A 4EA7A 2IP4A 3RV3A 2FPPB 4YAJB 2GQSA 3TIGA 4FE2A 3MJFA 2V5AA 3I12A 4ZQIA 4O7TA 1KJ8A 1KC7A 2FPIB 1EUCB 3AX6A 4FFNA 3BG5A 4IHJF 4ME6A 4EAAA 4E4TA 3K3PA 4Y8VB 4FGRA 2YW2A 2OLSA 3RUPA 3N6RA 1I7NA 2Z02A 2J9GA 3R23A 5HBRB 2I8CA 1KJQA 1GSOA 3QFFA 2VQDA 2NU8B 3VMMA 2W70A 2R7LA 2R82A 4L1KA 3U55A 5JVDF 4FFPA 3VA7A 4EG0A 1BXRA 2YS6A 3ORQA 4ZI7F 3TIIA
chains in the Genus database with same CATH superfamily
1ZH4A 1P81A 2JIQA 2WAAA 1UMKA 2WT8A 1U99A 5I5UA 5KT7A 1TFRA 1QF9A 2CEKA 3PUWA 4J0GA 4D8WA 4LTDA 1Y1SA 2FSIA 2C9CA 2H51A 1FW8A 2OP1A 4W9NC 1YJ5A 3GROA 5KNDH 1CQJB 2HSJA 2OG2A 3PDUA 1S0MA 3AEYA 5AKHA 2JIOA 3U19A 5KC8A 3MN1A 1WX1A 1GQQA 1WV0A 5BR1A 4BGDA 4JOSA 1YZUA 3U7JA 1Z29A 4AZSA 2OY0A 4QBKA 3DCIA 2RBGA 5A6SB 4H3SA 1PT7A 2IEDA 4X90A 2B5VA 1NBOA 1PTKA 2HA3A 1VLMA 2IX3A 4K88A 3FWPA 4GQIA 3K16A 4TN5A 4GMKA 3U3KA 4BV3A 3EGVA 3DM5A 3V8MA 2MCTA 2I4TA 3PD0A 4HSGA 2BGRA 1GTVA 3CT6A 5JH7A 3Q7IA 3WTBA 2HGZA 3D0QA 1ECFA 4ND8B 4EFBA 3JY6A 3ZY3A 2RAUA 4P33A 4RJKA 4CETA 2EXXA 2HQOA 3UWPA 1T24A 4S1OA 2JCGA 4L95C 1Z6YA 1RMTA 3X44A 4DAEA 1DTWA 4KR3A 1P0PA 2CKZB 2VS1A 2F90A 2DT5A 4L85A 5K8CA 1CW2B 2V74B 4BVHA 4WOJA 1AKYA 5HYVA 5JQGA 4L3OA 4Q4HB 1TW2A 3BMQB 1QVVA 2WJGA 3IV7A 4AQYB 4EY7A 5CFOA 3HTXA 3H9JA 1O9GA 1D2MA 1P73A 4ZHQF 2VKTA 1O95D 2IL1A 1K68A 4RF5A 2HIVA 5CVTA 5A05A 5KTMA 3R9WA 5D3MA 1V0JA 1Z47A 4DC9A 4JBIA 1LBHA 4QU0A 3A1CA 3CF4A 1SZJG 3RKUA 2O7RA 4R1QA 2PHZA 2QSJA 4YJ2F 5SY6A 5DGAA 1G6KA 4JT9A 4YP0A 4UM8B 1A7UA 1XHFA 1GAJA 4FZJA 2LKDA 4A3MG 2QRVA 1E3WA 1VLZA 1L5LA 1GYPA 4DCCA 4D0RA 4BGEA 5DZSA 3L7JA 5KTOA 4L7QA 1G5QA 2OWOA 1X7HA 4MRSA 1OWTA 2I3GA 4I4LA 1FKAH 4G65A 5F1YA 1ZZGA 3RF6A 3UQZA 1PRYA 1C8BA 3RYHA 2GS9A 3A3KA 3Q8WA 2TECE 1Y33E 3D81A 4Y9TA 4BE7B 1RQXA 5TQ2B 1YE3A 2YZ2A 4Q66C 5TV2A 1Q7RA 1CJKC 4FCCA 1IY8A 1QVAA 4DUZH 2ZJFA 2Y1OA 2H63A 1D6JA 4RZ3A 3WL7A 1FDVA 1O3YA 3ZTWA 5BPFA 2NTNA 2DT8A 5HGJA 4AKTA 4MICA 1K7YA 2IQ5A 1UEXC 1YMUA 3CVXA 2Q6OA 4KXWA 2LCIA 3I9JA 4I6GA 1QONA 3K9LA 3PXAA 1VMIA 1ZISA 4DL4A 1RIIA 3RD5A 4HDNA 4L8VA 4R2JA 3FMAA 2OR3A 3FSGD 4EYKA 2H5LA 1G19A 2EWVA 4O7TA 3MCVA 4Y7DA 3GRYA 4HWSA 1XCPA 4RORA 1UT5A 5D85A 2A0UA 4TS3A 3B1YA 4KXYA 5CLIA 5K0BA 2VYND 4MB6A 3LWNA 1LBTA 4B33A 4JXXA 5AJHA 2J45A 2AJTA 1BW9B 1BHQ1 1WB5A 3UT5B 3U55A 2Z56A 1IXRC 2A33A 1I14A 3W8EA 4JLOA 4MB2A 2FHSA 5TGZA 1X2BA 1OI2A 4ZYLA 3NDJA 1R8JA 3C5WP 2O05A 1U8CB 4JA0A 3TQRA 3AKCA 4R0VA 4YHBA 3L93A 4QXAA 3RANA 1HNWH 1QC5A 4US2R 1FUIA 3IKLA 2NV0A 4Q9LA 2QY9A 4XPIA 4AO6A 3W7AA 1OAOA 4OK5A 4HN2A 3FFXA 1M75A 3GUCA 1EWRA 1EXWA 2XCUA 4XYLA 5TC4A 4GSLA 1ZY2A 3PC7A 1YJCA 3KXPA 1LJLA 3PR2B 3FMFA 4DCGA 3VR3D 4MV7A 3U09A 5DN6A 4GC9A 1AF7A 3F7MA 1RC8A 1JU4A 4UTPA 4L08A 2BUCA 4B80A 2ORWA 4BB0A 2AR0A 1CFJA 2ZSEA 5DLYA 2AOXA 3HYTA 3JAWA 4DSOA 4R8VA 1UC9A 2RHWA 1KFBB 4EGJA 3LC0A 1HQDA 4ECVA 1G8AA 4H18A 1AGNA 4NYMQ 1NVFA 3QOWA 5JD6A 4ECYA 2F9MA 1Z82A 1KYTA 4W5OA 3CINA 1PR3A 2X1VA 3OIYA 3MAJA 2QP4A 3EVEA 3R9RA 4FS1A 4R1MA 5DMXA 4DL5A 2I6FA 4TQAA 3DBRB 3AF2A 3K0KA 1SOMA 4CE6A 3PEWA 3R20A 3PGA1 3GTOA 3AHHA 5KT4A 2FQ1A 2B36A 2EYUA 3KJXA 4M9QA 2NG1A 3B6EA 3GMDA 5EPUA 1T9GS 4TWBA 4C43A 1RZRA 3PKIA 3LO5A 4R2KA 2J4FA 1DT5A 4HPXB 1N5OX 3A7EA 3NHPA 1OIWA 1ZLYA 4EDFA 2ANCA 4IMPA 1HZZA 4IZOA 4JLUA 2P5TB 3K72B 5JBNA 3PD1A 2DM6A 1FCJA 3LBAA 1K7SN 3DZKA 4J4HA 3T1NA 4IOKA 5FQOA 4Q9DA 3I30X 1J2TA 1PQWA 3W9BA 3VPAA 1KVSA 3GGSA 4X8HA 2LPMA 2XUIA 3DAAA 1QVZA 4MR7B 1CYEA 4IIEA 3G1TA 4AXBA 2IYEA 4F4XA 1OXXK 1L5RA 3N86A 4CEIA 4PRKA 4EG3A 4PEVA 4UFPA 3ZV7A 1OIXA 1A1SA 2NTEA 1CUYA 2H9YA 5SZJA 3LAWA 2FH5B 2YVLA 4G0MA 2WWYA 4G2NA 1BU8A 1CZNA 3FY4A 3B6JA 1NA5A 4D45A 3NGMA 4NZOA 3CEPB 1VPEA 2HYIC 1MUUA 3GJXC 2Q99A 3JQFA 1T36A 2J3DA 4CXMA 2PQMA 3OUUA 2I2AA 4DV1H 4EYQA 3VNAA 1HFKA 4PX5A 3BE5A 4YRFA 1NXVA 3L3BA 3B1WA 4HVCA 3VDRA 4ZKEA 2P9JA 3BQMB 5L8VA 1CY7A 3PC2A 3WLEA 3ORHA 2NZ2A 5E4JA 1NXXA 4MS4B 2GQSA 3WA6A 5I5YA 1P2VA 1I30A 4UEJA 1JR6A 4FYVA 3L8EA 2C8LA 4JUBA 5C9ZA 2I34A 5BR4A 1OAOC 3H13A 3K6SB 5I9NA 5HS6A 3UB3A 1J1UA 4UHFA 3R76A 3HDQA 1ZD4A 2BHNA 3KR2A 5FV7A 3L40A 3OX2A 4KPEC 3L0CA 2ATEA 2JHFA 3IJEB 1RI4A 4K1XA 1KI8A 4G0ZA 1XMIA 2QUAA 3DH0A 4TGLA 5BV7A 4IJVA 1DAMA 1XROA 1KDYA 1GAQA 4G1FA 4D42A 4Q3NA 1FRZA 4CC6A 1IPHA 1JT2A 4I8DA 2GTHA 4TXNA 2VHYA 1GKYA 5A9TA 4BNVA 3OZUA 3K9FC 4ZCIA 2EC5A 5IJWA 4F5ZA 3IVAA 4H6XA 4AQDA 2P9GA 1RAAA 1XZ8A 1CZRA 3IXQA 2C0QA 3C6YA 2OOKA 4PBRA 3UC5A 1E6WA 3FJOA 2PMCA 3DLHA 3BWEA 1GEGA 1X0VA 4HSEA 3EZLA 3MZ0A 4L4XA 1VLLA 1C9YA 2D2FA 7AT1A 3GRPA 3RF2A 4PGAA 1K6JA 3LUAA 2LDXA 2Q4RA 4L16A 4TV9B 1ZCJA 1KNQA 5KFCA 5F52A 1UODA 2NM0A 4XB2A 3WLJA 5JAQA 2WJYA 1FLNA 4ZANA 3IKJA 3K0BA 4II7A 5IWCA 1M0WA 1P1RA 4KWCA 4ALIA 3D6NB 4J0KA 1PS9A 2AFIB 4OGLA 1HZZC 4MITA 5KT3A 2B30A 1ECBA 5D51S 4D2IA 2G4VA 1M6WA 2IE8A 5L3SA 2E9SA 4RKQA 2HF2A 3FDIA 2QLFA 3BPSA 5AP9A 3VR4H 4Q3AA 1KYIA 4B6QA 4QHTA 1EDOA 5JALA 1RWOA 4NMLA 3DOOA 3F96A 4M88A 1RACA 2EF1A 4BO2A 3GX1A 1ECGA 1NYLA 3FUWA 3S40A 1EZ4A 2A1UA 3PVZA 1ZJ5A 2AOWA 3H16A 4DIMA 4MMYB 1RQ7A 4G0XA 4KYTA 1EXDA 4LCJA 4OB7A 4RETA 2Y99A 1G2PA 3A9CA 1X0XA 3TY5A 4QICA 1M6NA 4M76B 2JFXA 5CFNA 2Y05A 3N2IA 4KK3A 1E2JA 4DV5H 2QW1A 1W0KA 3AZPA 4EQ5A 3UXMA 4TZKA 2N75A 4LF8B 4D3YA 2VCHA 3EVGA 3DYVA 1TVKA 5DM4A 2QTGA 1VJ0A 1EKXA 3TSZA 3Q88A 3SYRA 3JQFC 5HRAA 1EP1B 1DC3A 2B1GA 4UMVA 3AF3A 4Q19A 1GZ6A 1T13A 5M04A 3BICA 3QE4A 2XB9A 4EJMA 3FSEA 1RI1A 4OJYA 3JQ9A 1UXOA 4EYIB 3SX4A 3BOSA 2FWRA 3GUYA 4X94A 5C1OA 4HQKA 4EVIA 1L4BA 4M7RA 4C1BA 1IVYA 3M33A 1LW6E 2WBLC 2CV0A 3KUKA 1AURA 1Z06A 2GF9A 4DV6B 4IP0A 1VKZA 2XNDD 1FDRA 5LLDA 3TY9A 1VLHA 3W5BA 1U0EA 2Z6AA 5HF5A 5JXGA 2QPTA 5AJYA 4ADSG 2NSDA 2GPSA 4PIVA 4WY2A 4MWTA 5DBGA 3I6QA 2WHYA 3E7FA 1XD8A 3D6HA 4C4RA 1O4VA 1P6QA 4IDPA 3HCPA 2QG6A 4JV5B 4JN6B 4O82A 4ZHQA 4BB9A 4M9SA 2FTKE 2GARA 3L7LA 3U6BA 4C30A 1HF3A 1S9FA 1N3YA 3OLZA 2FWMX 5C4IA 3EDCA 3A6FA 3D2CA 4JI1H 3QM1A 4W9RA 2IYFA 1F0KA 1ODKA 1VGQA 2NU6A 2C2EA 1YUNA 4PTZA 1RRKA 2R92A 2XYHA 5C51B 1J4AA 3P19A 1O58A 3R40A 1M2GA 3TEKA 1NMSA 3GJQA 3NONA 2CLCX 3S24A 1KJQA 4NOKA 2FMAA 4LVNA 3RWOA 4E33A 4BXOA 2VJMB 1H0SA 2ACKA 1E3IA 5H02A 5EQTA 1GNRA 4HVTA 4HEJA 3EPHA 4K9KA 3OHBA 1RWPA 4DY6A 4Q34A 3HYCA 1VQ1A 3WGMA 4NR0A 1ONPA 2VRCD 4OHFA 2IK8A 3CSUA 3Q8XB 1BX3A 5FX2A 2JA1A 2HSWA 3H2YA 1TVMA 5FBLB 4I5GA 3COSA 2Q3MA 3G5MA 5F2NA 4GDFA 2IELA 1Q6ZA 1B00A 1HH4A 4REOA 5A3VA 5ALQA 2AR7A 1WWKA 3C3BA 4PYKA 2CXSA 1T3ZA 4ZEOA 4L4YA 2PWYA 1IEXA 1JQBA 4E5SA 5T4EA 1QR2A 4TYNA 3DC2A 3NIDB 1KFCB 1Q0HA 3KYBA 2VC2B 2WWIA 2P41A 4JLMA 3IDFA 1E32A 1AE1A 1XSEA 2VF2A 2EJ0A 1UH5A 4DQXA 1BO6A 1VKHA 2A1TR 3HKCA 5TEVA 1QHSA 4J9LA 3UK1A 3ILVA 3C87A 2VTDA 2WAXA 3VBEA 3F6EX 5ALLA 3A3YA 3B3FA 3JYPA 1JUDA 4JUFA 4DL3A 4R9UC 4F7DA 2J9FB 1R6BX 5LU9A 3ETJA 4XUDA 1PT5A 3ANYB 3TE7A 1P3Y1 3TBFA 5FNVF 4CIVA 4PYLA 5FD8A 4AUKA 4BBSG 1TYZA 2WNIA 5K7SA 2H57A 1B33N 3BUSA 3B7GA 3MR3A 3TYXA 5E6UB 2AKAB 4ARIA 2XWBF 2JLBA 3KXLA 1WD7A 5DNYB 5TJHA 4S1PA 1TFUA 2PUJA 4YCSA 5JJLA 4NESA 2IS2A 4KXFB 4JBGA 2UU9H 4QPCA 4BUZA 2IQIA 3HMQA 1GNLA 1VE3A 3C3WA 1B0PA 2Z1NA 2EG9A 9ATCA 3GEMA 1QRDA 1HE2A 5IF9A 4TM7A 2LRHA 3GCXA 3WNQA 3OD1A 3E7WA 5K0TA 4XX0B 4WI1A 3JQ9C 1XMJA 3N05A 2VQFH 1Z2NX 4JGGA 4BLTA 5FTKA 4BNFA 4DV2H 3PX7A 4LGVA 4JT4A 3IPCA 1V47A 4M0UA 3CEBA 1L1FA 2GAFA 2JVJA 5JNVA 2BFCA 1QU2A 4QODA 3U54A 2DULA 4Y6LA 3R6DA 2FMUA 1ZUWA 3KT6A 3P9ZA 4BNWA 3ETGA 3DD1A 1GZDA 5EGNA 1C3VA 3Q9LA 4LYJA 3RVOA 1CR1A 2CHUA 5FBHA 3F5DA 1B8NA 4QJ3A 1NP6A 3DOHA 4AO7A 1YS4A 3TL6A 1LBSA 4Y1EA 2V6GA 2WJHA 5F77A 5K0SA 4DR5H 1GG8A 2ASJA 5BNFA 1MB2A 2FQYA 1LV8A 3ZZMA 2OOSA 3I2JA 2DQYA 1KS9A 2XUPA 1V4VA 1QIHA 2SHKA 1OV4A 1QUEA 3G2LA 1FQJA 3JYLA 4G37A 4D8YA 1LTQA 2Z3WA 3MWLA 4CIXA 3HCRA 3KM0A 1Q7BA 2EBHX 1MA0A 4QGHA 5ELXA 3ZNQA 4OP1A 3GOQA 4EEZA 3ZY5A 3VHLB 1JBQA 3JPYA 5K8IA 3F5FA 1Z22A 2WJIA 2OZPA 2ASEA 3GG2A 4IJKA 3WK8A 2NZJA 3LUBA 4A27A 2HLHA 1KAMA 1OPRA 2BSQA 5F1PA 5K20A 5B7QA 1I1OA 4BO3A 1LF0A 2BDUA 4GPEA 5EHGA 3WICA 1JEYB 2IV7A 4YJHA 3CZPA 1M7JA 5AVTA 2HPZA 4B48A 4GL4A 3ETDA 3LCUA 1COWA 2IP1A 5KOHA 3IT0A 1KA9H 3NGXA 1AN0A 6LDHA 4E5PA 4E3ZA 1TJYA 1ZVMA 4NY1A 1EUCB 3BG5A 5EE3A 3T3DA 4PZ8A 3CCCA 1E20A 1J33A 4WXMA 1LX7A 1AXRA 3IS3A 3HGTA 1VMAA 2MMCA 2M6KA 2EARA 3ZQKA 3WWJA 3DXYA 1A1VA 1H2FA 2NSHA 3K71B 4ED6A 5IP9G 4HB4A 3N59A 2UVVA 5H16A 4RACA 2W0SA 4MXDA 2FPOA 521PA 4RFVA 4LGCA 2BE9A 5C5EA 4WGGA 1HDGO 3BMNA 4CMDA 1J99A 4BMOB 3AI1A 5EN4A 3IB6A 2H5EA 1WBJB 3C8UA 3WGHA 3C3AA 1LKZA 4LK3A 4LNUA 2DUJA 4LOHA 3ENKA 3SU8A 3DTVD 1BQ4A 2VP2A 5CD9A 2X5RA 1EVYA 2FPUA 1A9ZA 3BQNB 2Y1XA 3MTGA 4ZGGA 3GR6A 2C1ZA 1UWLA 3OI7A 2CLSA 4XWOA 2AUNA 1P7ZA 2TS1A 1CCWA 5L40A 1QO7A 1JFFB 2A67A 4N48A 4MUFA 6REQB 2CLFB 4ROSA 5DCLA 2QRJA 3LQFA 2WOOA 3FPJA 2FRVA 1ZH2A 2AJCA 3DXFA 3K0FA 4XWYA 2P67A 2WKWA 3BQ2A 3HCCA 2P75A 4J3JA 2OXTA 1YL5A 2CNUA 3IRUA 2VUTA 5AM1A 1IZYA 4DR6H 4N8DA 4HWKA 4B5LA 2GDZA 3ZXYA 2R8RA 5EUQB 3PNMA 1U9ZA 1L1EA 1MQSA 4O7YA 1PGOA 1BQEA 3NWBA 5KINB 1Z5ZA 3DOJA 5T57A 3EC2A 3D2BA 1KQNA 5CM2Z 4ZREA 5D86A 4G4SO 4LHYA 6YASA 2Q1XA 4XVHA 4ZDJA 4QXRA 3FSRA 1GTL1 2JAXA 1K92A 4B9AA 2JATA 3NTXA 1P80A 3G5UA 4N1AA 3EDQA 4I9HA 1KDPA 2O8FB 1LA2A 2L19A 3JQGA 4KQGA 3WQRA 2CFTA 3FTDA 4X6XA 1Y5IA 4KQJA 5BURA 2QP3A 2IYQA 3NTOA 4JI8H 5FTMA 1FPMA 4HAIA 3R09A 1GCOA 3H9BA 1I1LA 1FX1A 2FEMA 1Z15A 3PGLA 1L7QA 4DMRA 2Q0QA 3FNIA 1OLXB 4IX9A 2ZI3A 1R0LA 2BHTA 1S6YA 4B47A 3FZQA 2BISA 1CUHA 3I4FA 2PG3A 3MUEA 1DMSA 4QX6A 1PCXA 1KMQA 4P31A 3GJ6A 2GYWA 1YRWA 1J8QA 1XQ6A 5IKMA 3LUKA 1MX1A 4IX1A 2XWJI 3FM9A 5TT1A 2H8GA 1TA8A 1K66A 4HAYA 4GPIB 1DKOA 2ROQA 4B3TB 1WU7A 5MFZA 2JRCA 1X1AA 2FN7A 4MUHA 2ORVA 2W4IA 2ZK7A 4WMLA 2FU5C 3U61B 1CD5A 4ISCA 3A1DA 1W36B 1ADGA 1NI3A 1U2SA 1RCUA 1LWOA 3GP5A 5K0NA 4H7EA 3GXBA 5FEUA 2W8KA 1WW2A 2LNDA 3HKDA 2YMMA 5CG2A 2NO7A 4R1PA 3PLNA 2QN3A 1JIUA 3GV7B 4U0JA 3LBNA 3SSMA 1V8DA 4O4LF 4FWTA 1UT8A 1KXJA 2D0OB 1GSHA 3VKGA 2QTBA 1A9SA 4DCNA 5C8YF 4UUGA 1QP7A 5JRZA 3MT8A 1QZUA 5LQMA 2FXVA 5U4QA 4Q8FA 3ASYA 2R4UA 4KXNA 1NWCA 4KN5A 2ZXFA 1W85A 4A8JA 2GPBA 1NF9A 4JQCA 1WLSA 3ZWDA 3Q0TA 1PUXA 4JVLA 2R7ZG 2BUBA 1P9LA 4A6PA 4S35A 1ST2A 2RGDA 5CPFA 3EUEA 5A5GA 4CLEA 4KN8A 2R8KA 2ES4A 3QNUA 3TXYA 4R1TA 1DT3A 1E66A 1SC4A 1CNEA 1P1IA 3EX7C 3OWXA 2F59A 1K98A 3QV1A 1G2IA 1YNSA 4HAWA 4AJOA 2GEBA 3B5JA 4U2CA 4LYEA 1IQPA 1HR0H 5T64A 3UMRA 4IIYA 3L1JA 2RF4A 2AG5A 2CF5A 1CIJA 4K9MA 1MVLA 5DT9A 3RB0A 3OG9A 5KHOC 3QMPA 3MCUA 2NAFA 5BQ3A 3KHTA 4D96A 5LWHA 2XMGA 3EYWA 5A04A 4BFCA 1UKBA 1NM5A 5GPBA 4NBSA 3W04A 4TMZA 3CO0S 2O8EB 4TTRA 1NU6A 1ZSVA 1SQ5A 3SBEA 1SBTA 1O57A 4WKBA 3UAZA 2ECFA 1QV9A 4PZYA 3SF8B 2ZPAA 3EUWA 3ND9A 2X8JA 1EKPA 4TYMA 4YPVA 2JGLA 3S1AA 3CIFA 1IMOA 4D41A 3KJEA 3IIEA 3STYA 4XYGA 1U1FA 1AZWA 4NU6A 2MWMA 4X66B 3K70D 1C3XA 1O54A 1R8XA 5HBRA 4OSPA 1JIVA 1VSBA 2VDWA 2CY0A 3SC2A 1NXQA 2FK8A 2JJ2A 1OYVA 1P1FA 2XHZA 5H4GA 2G5CA 4ZT3A 3BSWA 4G2TA 2WWHA 4QRDA 4XCXA 1GYRA 4EEQA 2O0HA 2PQ0A 5JSKA 4EMBA 5IC6A 1JDNA 5EEHA 2FFQA 4TUYA 1LVHA 1CJUC 5LQRA 1F20A 2CWDA 5BW8A 3JYQA 4DEXA 1R0RE 4POOA 5K05A 3D02A 3O84A 4BNIA 4HGYA 4LRSB 4D6PA 4YI3A 4FJ2A 3FG9A 4BNTA 3NBKA 4CMEA 1TM4E 1TLFA 3NV9A 4DR7H 5HXAA 3OPYA 2RH5A 3I6MA 1E4GT 2XGMA 1VDZA 1XG5A 1XDUA 2HJHA 1K08A 5FUXA 1Q3TA 4G1UC 1XRNA 3NTLA 3W77A 1HE5A 4QYWA 3G9ZA 5FNVA 2DU8A 3W5HA 4PHHA 5CCEA 3UAOA 5TE9A 1A7AA 3BXOA 4K26A 5KFBA 1LLQA 1M34B 5ALMA 2GK6A 2PZGA 1AQIA 1GIAA 1L8LA 4ZQHA 2DMRA 1N3BA 2JFOA 2D5LA 1Z2OX 2W48A 2H1HA 3I3OA 4RKEA 1FJ2A 3ZYZA 2JW5A 4ESVA 4BWFB 2JFPA 3GLVA 4A8JC 5KTPA 1V6CA 2XCPA 1B43A 3HUTA 4ZCSA 3M1LA 3ZXSA 3OTWA 2DB3A 1YVPA 4PBSA 2FK1A 1T8RA 2VHXA 1AH2A 5YASA 3DL2A 2JBWA 2P5UA 4PC2A 1GSIA 4W8HA 4W6ZA 2W2OA 3KSMA 1SBQA 2ENWA 4CCYA 4I50F 1J2YA 3NKVA 3T9DA 1N8KA 4Q7EA 4ZHSA 2ZT5A 5TDHA 3DDUA 4XOUA 3A05A 2WE8A 2BSXA 2H4WA 4GUDA 2D5AA 1ZOSA 2ZTUA 1PR4A 3T3GA 4QWAA 3ZJVA 1RYZA 3L43A 4YQEA 1QE0A 4PCUA 5DTEA 1VXRA 3HYSA 2JKVA 3DT6A 4Z86A 2NPFA 3ZHQA 2XDAA 3S68A 3WLAA 1SRQA 2EBFX 1DARA 2OGZA 1F17A 4DCTA 3L7KA 5G3YA 4B35A 2JEFA 2WM8A 5AFSA 3DLBA 3RAFC 1IZZA 1SC6A 3H3FA 4E11A 4RMNA 3TM4A 3ORQA 3QELB 4EQ6B 1D8TA 3DZIA 2WPDD 4UBNA 3HO1A 2QL7A 2ONCA 4OJKA 2HBQA 1XVUA 2R2GA 4KDEA 4YASA 4HEA6 1NE7A 3IT2A 3HOVG 3UJAA 3KJZA 4MV6A 1FNDA 2OLEA 1A8SA 4E7PA 4EI9A 3RVKA 3K8OE 3SHFA 3PS9A 1A50B 1IHXA 1K6XA 4W1PA 5E4TA 4F3KA 1NBAA 4WADA 4GLWA 4MI6A 3UMJA 5DH9A 3KHHA 1ADJA 4IFTA 3FPBA 1F7VA 3I72A 3V7WA 4CKBA 2FQQA 1PG2A 4CG0A 3PU6A 2RHHA 3CM0A 4UM9B 4FYPA 2AFHA 3CH6A 3MTEA 4I3FA 1F60A 2X42A 3L41A 2PUCA 3I5AA 2O2HA 1JDTA 2VJPA 4N7RA 1KQFA 4I9GA 4A36A 2DTEA 3RJ0A 2UYCA 4GBMA 4KB5A 1S2LA 3LUFA 4RTKA 3KKKA 5HR5A 2DF8A 1ZJZA 3D9QX 4G23A 4DSNA 1H8EA 2EJCA 1X7YA 2DQZA 4RNCA 1M1YB 2C03A 2QM7A 3H1AA 3OJEA 4MTDA 4WLOA 1U0LA 2V98A 1PZGA 1KMHA 3C14C 3IUSA 3NVKI 1SUAA 4WZ6A 2JFFA 1ZOLA 4LOLA 2J3KA 3SM3A 1JSXA 1JT9A 2OWDA 3ANXA 3AV0B 2YTZA 4A3SA 2QVZX 2ECKA 3A28A 4CMEC 4XZ3B 4JXUA 4OHPA 4KVAA 4LF4H 1CUDA 1FP4A 3FYDA 3A2KA 1I6UA 3LZDA 4EHKA 3CQZA 3HWSA 1SXIA 4MWGA 3TFOA 2GZRA 1W9MA 4ZU6X 2POQX 3CEJA 3TB4A 4N0DA 2D3TA 2XUQA 1U3GA 4ZALA 1Y1LA 3UHJA 4FUQA 3VR1A 1NMQA 3QOXA 5E1OA 4B71A 4MWOA 4ZDIA 1W2WB 1ZC4A 2QTTA 4WFJA 4O4JF 4V0NA 1L5WA 3EGIA 5TPZD 1FY2A 3P9QA 2BI7A 1X1EA 4CTKA 1LK7A 2YZGA 1CQIB 1PJLA 1O5TA 2FP3A 1P2UA 2ZRGA 2G08A 3CPEA 4MI1A 2LV8A 3PEUA 2BEUB 3D8SA 4Z9AA 4Q3KA 2M2IA 3U44A 1XNJA 2VZEA 1H3NA 1QIMA 1DL5A 1R6TA 2D1SA 1RCFA 2P4SA 3RKSA 3CLKA 3EXG2 1O6ZA 4B3MB 3I2IA 4DXDA 4XM1A 1Y3DE 3K2IA 4NNJA 5KFNA 1UJ2A 3PP8A 4ATNA 5A9SB 1K2WA 2UZ1A 2ZUBA 2I6XA 5SYAA 4BEJA 3AV3A 3Q85A 1EM8A 3R3XA 1RHJA 4ECSA 1PQUA 2B8JA 5ILOA 1KVUA 2VSXA 2ZT8A 2C2DA 4I1OA 3M81A 4EY6A 2GJ8A 2G40A 5LD2B 4JBLA 3WLSA 4KR0A 3CNNA 4FJ1A 3IA7A 1XDWA 2XZPA 2A59A 2EDCA 4RSGA 1USGA 1IN4A 2BF7A 4RQUA 4QGAA 1VSQA 3NB0A 3VR6H 3TKLA 1XMXA 1RJWA 4RAZA 2CZGA 5FYDA 2CLDX 4U63A 4EBEA 2XC9A 4ESEA 2I22A 1P1CA 4DDHA 4NL4H 3CCBA 4P86A 3V7UA 4G84A 1AGRA 2I2CA 1BHO1 4FGRA 4K0RA 5JBIA 4UNIA 2NO1A 2E4YA 2KMLA 1UBKS 1V9LA 3PE4A 1ENZA 2NNLD 2JAWA 3KZMA 3VH4A 2HDWA 4URUR 3BQ1A 4L5IA 1YO6A 1QAOA 1G21A 1VJCA 5BWVA 3Q3IA 4NLLA 3WKDA 1Z0DA 2IT1A 2OL4A 2O2ZA 1FFHA 4E4RA 4ESOA 3JZMA 5FWYA 1J20A 3T1QA 3DW1X 4EGCB 1DJMA 2VOEA 4ES6A 4NECA 4EUNA 1VZ3A 4H1UA 4YDHB 3JAMA 3IALA 3LWZA 3ESQA 4MCAA 4F46A 2H11A 4FINA 1QIKA 3TAUA 1AMUA 5GZ1A 3DHWC 5FKJA 5HJEA 1K89A 3R3UA 4I55B 4CT4B 4EG4A 2VBIA 1I9CA 1VL1A 3CBGA 3HVRA 3QOYA 2O6HA 2EX1A 1HTBA 4DT1A 3AIIA 4GF5A 4QUHA 1IUOA 5C8YA 3K5IA 5J5CA 2GLUA 4EVRA 1SWVA 4CEJA 3M9NB 4LF5H 1EE2A 5DCWA 5E7IA 1PJQA 3KPYA 2VHUA 3NWPA 2QVBA 1KPIA 4OI4A 5DYYA 3CX7A 2FDCA 1ECJA 2TMKA 2O0LA 3ICVA 1RJDA 3S5UA 1MOZA 2IYPA 4XFJA 3PUJA 3GLGB 3A27A 5JZSA 2JJ1D 3FGPA 4BKMA 3SJZA 1KJWA 3QQMA 3LX8A 3OJWA 4AW9A 1W44A 3H0GG 3VH3A 2PX8A 4F6LA 2AOTB 2GXUA 1Y8QA 2EX0A 2P78A 4UEQA 2OBYA 2HSEA 1O0SA 1T9KA 3KWFA 1FSGA 5U9CA 3KQUA 4MUMA 2G1JA 4ARAA 1UOOA 1E6CA 4IV8A 2Y0EA 4NE7A 1WZIA 3R7WB 4S3MA 2ZXUA 2C1XA 2X58A 2VQEB 1M0SA 4ND6A 1LSJA 1N2IA 4G25A 1JYFA 1W1IA 2YRFA 4QQKA 3PEFA 2J5RA 3CPSA 3N8IA 2Q6IA 2Q2QA 2NVXA 1TF2A 3TMAA 2D1QA 3KDSE 1KEKA 3UMVA 2W7PA 1WABA 2AW5A 2V9WA 3QK7A 1ZL0A 4NEGA 4GP6A 4IRUB 4YBZB 1QG2A 4KIWA 1M5RA 3CX3A 4JQSA 2HNKA 4XIJA 4YQFA 1Z68A 5LMNH 1XTBA 5E7MA 3KU1A 4EB8A 4BNZA 3IP8A 1CR0A 2G17A 1XFDA 3GO4A 3K9WA 1H2EA 1GWNA 3GJTA 3DWIA 2FE1A 2PX4A 2QF7A 3O47A 1SURA 3OTIA 3LK6A 5E6RB 1POWA 1ZZEA 1NMEA 1WCWA 3N2EA 3THWA 2H65A 2FR8A 3LOPA 4QBGB 3PJEA 3JSNA 4LDNA 4KI0A 3M49A 2QR2A 2B78A 2PX2A 1Q0QA 3B6ZA 3U49A 1CQPA 4AZVA 3WLFA 1ZL2A 1H4VB 3C1UA 3DMYA 2E4AA 2XMBA 3Q6MA 1TQHA 1U4NA 4URFA 1X42A 4M6WA 4G07A 4QOFA 2GKSA 4IH1A 2LE0A 1Y6GA 5DYTA 1NG1A 4AF6A 3WLRA 2HDKA 2WHRA 3M89A 4K6FA 2ZYAA 1BDIA 1PR2A 1QHEA 3C3KA 4GR5A 4HTAA 5E2AA 4UUNA 3MERA 4MKZA 5EJAA 2G5GX 1ZGBA 1SCNE 3K0EA 2O3JA 5L9AA 1AZTA 2UVRA 1KK1A 2ZWVA 1C5KA 1JB9A 2COEA 3BZUA 4I7HA 4B7CA 2V0GA 4HLDA 5DM60 2X15A 1D7AA 2ZIWB 3FYCA 3HSKA 2ZS7A 3W6ZA 2PSJA 3ZY4A 4A2AA 2FY8A 1SCBA 1T2DA 4R3NA 1ZVQA 4OFBA 4D9NA 3W2IA 3RPEA 5JDIC 1T5OA 5IAEA 2G28A 4RHEA 5CITA 5KKAA 1NN5A 4PN3A 4EELA 4BS9A 4HXFB 4YMTA 3OQPA 4CQLB 4TMXA 2EV9A 4R41A 3SR3A 2R8IA 4CPDA 2NGRA 1MDFA 4YT8A 4MQ6A 2ZVQX 5AVKA 3V7NA 3OE1A 3RFVA 3WQBA 5C8DA 3V4PB 1S03G 1W96A 3ZLBA 1WZCA 1ZMRA 3QY0A 5DNEA 4RVOA 4E22A 3WL4A 1G9XA 5HQ3A 1CY8A 4RMJA 3SJCA 4OQLA 4EHBA 3AVTA 1RXEA 5AVVA 3CPJB 3V3TA 3WDLA 5KUTA 1Y5MA 4CM5A 3TN7A 4AX8A 4X85A 2PKQP 2IHYA 5F64A 1J7JA 2BI4A 1YAHA 3SY8A 4QNNA 1I5RA 2YL2A 2JCBA 2FUEA 2MYUA 2UZ3A 3DZ8A 5A0FA 1II0A 3VR5H 5AVQA 2BMAA 1G5FA 2WF6A 3KELA 3LH5A 3QEAZ 3Q8SB 4Q82A 3T5KA 2QQGA 5IBQA 3WVNA 4FXPA 5B1IA 2HCRA 4YMSA 4DR4B 1DDIA 3FYUC 4K86A 2TMDA 1PKXA 1J70A 3P9YA 4GE3A 3FR7A 4ENVA 2PVSA 4IOMA 4F4YA 1Y6ZA 2PMWB 4ARZA 4BKOA 5KFIA 4LQDA 3G3EA 1EE1A 4RB2C 1M6VB 5FWXA 2AK3A 3O8LA 3DAYA 4QVKA 1EA5A 1ZI9A 3U0VA 4G97A 1RZVA 4JB2A 2K6GA 1XN1A 4OEHA 5DNWA 4UMFA 1VP3A 4P34A 1A4XA 3K53A 5AUPB 4E7OA 3F9RA 1PNVA 1JBKA 4DL7A 2ZWAA 2ODBA 1J2JA 5DI3A 1P0IA 3O9ZA 3RJMA 4FYYA 2BH9A 4QJ4A 4ZEVA 4GX0A 2MSNA 3IAS1 3MQ4A 4TMVA 4LDAA 2FR8C 2R6ZA 3H6KA 1XUOA 2PGDA 4K9NA 4MYSA 1XZMA 2GDJA 5PNTA 2C0PA 3MAGA 4M46A 1OF1A 2IGBA 5KQGA 1HT3A 4LRWA 4Q24A 4UC0A 1HG0A 5FBWB 5JAZA 2HL6A 1E4EB 3QU2A 3R3ZA 2QXTA 4HDSB 1TQ2A 1Y8RA 4ZVVA 5K3CA 4S0ZA 2RI0A 1OZAA 2OD9A 1JEQA 2FRDA 4YR2A 1WKCA 1KL7A 1TMYA 4NICA 4L0CA 3V1YA 2C83A 4TLBA 2B0CA 1QH8B 5EZQA 2XMDA 1WZUA 1JRLA 3I6IA 2JLCA 2E85A 4TLDA 2W6PA 3LC7O 3ZS9A 3CRRA 4DLYA 2IUUA 2VAMA 3SKVA 2NYVA 1R8SA 4ZP1A 2XTZA 3WA7A 3QPVA 5T6MA 1EK6A 4BLRA 2R96A 4M22A 3GZTB 3H4MA 2BR3A 4I6EA 3Q5DA 3IDOA 5HRUA 5CJJA 1WSCA 3ORRA 2IEBA 3QTTA 2WTFA 2Y9MB 1BXZA 2YOHA 3AGPA 3DEZA 3RU9A 4URXR 4G63A 4PANA 1TWAA 2UV8A 1HI9A 2WIDA 1XEXB 3TVDA 3STUA 1TEHA 2L18A 4LECA 4DG5A 2PMZE 1DXOA 2D8AA 1K0UA 1XEWY 1TTHA 2XAUA 4RM2A 3VDNB 2QL9A 1NVDA 3KB6A 1TWHA 4JENA 5F4ZA 1UK9A 3C6XA 2V3WA 2CDCA 3SOZA 4YPOA 4Z7NB 2OQRA 1K3UB 4PZ7A 3VU9A 4F04A 4UQLA 1ICIA 4R8RA 5JCJA 3MOIA 4UMDA 3S6JA 1T3GA 2WYIA 3NJRA 4R0MA 1CSEE 3FNHA 2KPOA 4ZT5A 1DEHA 2KLBA 4R9NA 1AHNA 4HQRA 5KSPA 1K1SA 3GLFE 3JTEA 1JR3E 3WWZA 3MGCA 4LXHA 3VSBA 1J07A 3OUTA 3RJZA 4BWYA 1F2TA 1M8GA 1YKGA 5JH7B 4TMTA 1E9BA 3EG5A 4J9RA 5EXPA 2Q3EA 5I60A 3CIOA 4PAGA 2V7TA 4F6RA 2IYSA 1R12A 1O97C 5HFAA 5JHGB 4D92A 1BJKA 4OF4A 4YJGA 3E7PA 4MV9A 2W7TA 5F9MA 1V51A 2I2DA 2L82A 2C5HA 3V8EA 4PYJA 5JECA 5AI5A 3GQBA 3WX0A 4OU5A 4U3JA 3N28A 4JXKA 1OXUA 2LUOA 5KDOA 3OLWA 5B3JA 4C4YA 2GEUA 4WZBE 2R93A 1QCCA 3OH8A 1DFIA 3HKZE 5K0LA 4Z9YA 1C7EA 1U31A 1J24A 5JQGB 3GRKA 4DBVO 4XRRA 2KBEA 3U31A 1ZW1A 2WG1A 1KY4A 1C3LA 4W63A 3BQ0A 3GJ7A 4WJLA 3EARA 3D6MA 3L6BA 3IJRA 3OFSA 4E3WA 1TPZA 1P17A 1YKSA 4CNBA 1JVSA 1Z45A 3QUCA 3CWQA 4E5DA 2PCJA 4Q0MA 2FOIA 5D3MB 1FXWF 3H1FA 3EULA 3GLRA 4BVEA 1U8TA 4IKPA 1R0BA 4IHKA 3ABQB 4AJ2A 4PYMA 1T34A 1QOZA 3ZKWA 1R9JA 4MP6A 2B35A 3N2GA 5KNCD 2FRDC 2QRVB 5KZMB 1E3WB 1HMYA 2Q4TA 3AHCA 3EOZA 3MHTA 3D0KA 2ZRNA 3D4NA 5KWSA 3TOZA 1K5DA 4NMXB 2ASVA 5ECGC 4QDJA 2DH6A 2NXJA 5LOVB 1CZHA 2IHJA 1ZOPA 2RAVA 2V7EA 3VKWA 4ZOBA 4UHBA 1YJBA 1SCAA 4MUGA 3M82A 3GGJA 2RAPA 1WF3A 3A1EA 5DNAA 3BKWA 2FFJA 5CE8A 1ECCA 1B8OA 3PYLA 4XW2A 3P71T 4YJ2A 4KLCA 4HDMA 2WUWE 3OQHA 2WWXA 1UKVY 3K94A 2IUEA 1HURA 4CU2A 3WAJA 1TNDA 4RZQA 2FZWA 721PA 1M76A 1E2LA 1DJPA 5BWMA 1OXKB 3EH2A 4IR1A 4IRKA 3HJNA 2I6UA 4UJ5A 1PJAA 5L4SA 4XUEA 3DLPX 2GD0A 2PM8A 2YFKA 2JEYA 2JK0A 5FPTA 2NAPA 3O4FA 4MIOA 4GBGA 1Y1VG 1A9RA 5KKCA 1XNQH 1UOPA 4KWEA 3PT9A 4A93G 4HDNB 4ILKA 3DYBA 2G8NA 3PF8A 3RVLA 1S3SA 4ZV7A 2NVWA 3KKEA 2H52A 3GJXB 1KVTA 1AQYA 1DX6A 1GDDA 4KQCA 2COIA 2G36A 3J7AK 3GU3A 4CTJA 4ARCA 3L0IB 2FPXA 1MX3A 5FNZA 4IBOA 1X1TA 2CW5A 2PU7A 1SBHA 2XXBA 1R8QA 4LYGA 1N4AA 1BVUA 1VL5A 4U6PA 4PRLA 1D0SA 4B3SH 3L0ZA 1QC5B 5HOEA 2XGJA 5KTKA 1L7PA 4BY7G 2VCEA 3IOEA 2BMDA 2DFKB 2HV9A 1GL3A 2F4NA 4TN1A 4ND3A 4LDQA 2H17A 3HLKA 3QEKA 3DZCA 4XIGS 1GTG1 3OEED 4XYLB 1BRTA 3A6LA 1B1CA 3Q15C 1E1KA 4PZLA 1GZ3A 1X9GA 1IDOA 4NEQA 4YUXA 2P1DA 5IH3A 3FN4A 2G76A 3QUTA 3U7RA 1U0RA 3D3EA 2Y4RA 1KYYA 1V43A 5ADUS 5B3JC 1GPKA 1KO4A 1X92A 3S2YA 1NJGA 4U00A 1UK8A 4UBLA 2EX4A 3JAWB 2ZI7A 5IJAA 4DIEA 3RKRA 5L4NA 4PZEA 3FROA 1H9AA 5EP2A 2GVZC 3W5OA 2GR9A 5DXFA 2EL9A 3O8CA 3ND6A 1KI4A 1DAOA 2BTQA 2C4VA 3LKBA 3NT4A 3WNVA 3PFBA 3GRFA 3P0JA 2XKBA 1G2WA 3W0LB 1F1JA 4IKOA 2J87A 4Q9IA 3J7AC 4O1IA 1IULA 4PLYA 2QLNA 4RLHA 1N34H 2HF8A 3HACA 3RVPA 2QBYA 1PJTA 3QXGA 4DKXA 1GKLA 4TVSA 1UK7A 1GG2A 4HDQB 3OPYI 4WXEA 3V4SA 2VKQA 2W4MA 4DREA 3TQHA 4D9JA 3IIKA 2DFVA 4P54A 4PSUA 1V8FA 1K6IA 5DX8A 4EB6B 4JWTA 3WHIA 4G0OA 2IYYA 1IBSA 4TVBA 1D3AA 2A4MA 4C0LA 1JZSA 4CL3A 3HXOA 3V8BA 4H31A 3IEPA 1DC5A 4XJTA 3OCUA 1QG4A 3E9QA 3RBAA 2YHIB 3NYWA 3L7CA 4EZEA 4KH0A 2H7XA 4OQFA 2QZSA 1Y6FA 1QGAA 3F5SA 4E6PA 3V6MA 3AESB 3VPCA 4M55A 4I1UA 1BEUB 1RI2A 5BYJA 1E3QA 2ZIGA 5TEWA 1UC8A 1V9PA 1QV7A 1ZR2A 1X77A 3WXBA 4F72A 1R4MA 1VHWA 3NNDA 3IV9A 3TZCA 1U6JA 2O14A 2XLBA 3IVRA 4Y2UA 2CVPA 4Q45A 1JFRA 4O0LA 1MDBA 3G5AA 2A9FA 4HPWA 1GUFA 4QUAA 1VOTA 4KR9A 1KR2A 3OCZA 5DISB 4CEIB 1KTAA 5NLLA 4DIDA 2X7JA 3D4BA 1BMFD 5CFMA 1R50A 4L5JA 1YR6A 4FN5A 1C1HA 1T9GR 2EZUA 3AEXA 2ICAA 4JZKA 1EK2A 3V2HA 1E9VA 2LR0A 4MI9A 4CDNA 2B5WA 4E14A 3EG9A 1WZ2A 1L7BA 1TUGA 1T36B 3KAPA 1N33H 5FA5A 3I61A 1F6WA 1GRRA 2G6BA 1S0NA 1QQAA 2MU1A 2PMBA 3LP5A 4LFBB 3WQQA 3SQLA 4NZ9A 2KBFA 2A94A 4JC8A 3AY3A 3ZGXA 3OSUA 2PA0A 3F6RA 5GJVC 2GN0A 4AZ0B 5ENDA 2WWTA 3UK0A 2ZM5A 2Q4BA 1Y3HA 1A69A 4PQGA 4GGMX 3OZTA 5EGSA 2NXEA 2WVGA 3C5EA 4QAQA 5D3KA 3E8MA 1SZDA 3HB5X 2WE7A 1CUEA 1SQSA 1XK5A 2NTYC 1XL1A 4L15A 3T6KA 3FPHA 5JAUA 2OENG 3Q2OA 1RD4A 4JLDA 3PQCA 3L4JA 1FVIA 2R62A 5LYJF 2NZ8A 2HMTA 4FSXA 2FQWA 1HE1C 2ACEA 1CETA 5AW4A 3FCCA 2ETVA 4HGRA 4WOPA 4MLCA 4RW0A 2RGRA 1ISIA 3HEMA 1SKQA 2BEKA 2X2EA 3CUVA 4D5GA 1U8FO 4MVYA 3D4LA 4ZYTA 5EMKA 4FHZA 3G6YA 2QT9A 3QLEA 4B09A 2V7UA 1RM4A 2XQVA 3MSXA 3OMXA 5CEEA 3H99A 3SX2A 4O08A 5CDGA 4Q4LA 1X14A 1R27A 3L18A 1EG2A 5HX7A 4BQNA 3Q2IA 1JXQA 3HWRA 1E0AA 4KHPH 4DPMA 2AYZA 1Z13A 2YXDA 3CH4B 3AVOA 3DXZA 2EJTA 2JHAA 1U7HA 2ERYA 3COPA 4JI7B 3RROA 2GI4A 1XKXA 2BGMA 3N76A 4PE5B 4TT3D 1BH2A 1JVNA 2I7CA 2RHCA 4UQOA 5F78A 1R18A 2AQ8A 4A8TA 1Z0SA 1KP9A 1LLFA 3ET5A 4GMDA 3S2UA 1E2QA 4XWAA 1MD9A 5D6NA 1CY0A 2AEFA 1NV9A 2LD4A 3WZLA 3E22A 5KOJA 4QLBA 3GBVA 2AQ4A 1JTEA 4WXPA 1VKNA 2WWVD 3PSHA 4KQEA 4J7AA 2Q2TA 1JDPA 1XDDA 5COQA 1UDAA 1O6FA 4HATA 1P60A 3PFCA 1J5EH 3CVJA 2HNAA 3CYFA 2O3QA 4RPGA 4RAOA 1E0DA 1DG9A 1OZHA 4IOJA 2RGEA 4Y9RA 5TR9A 1HQYE 3PWKA 4R7ZA 5K8VA 4RK5A 2ZBEA 3RGGA 3N1UA 1BE0A 5CDFA 3MRXA 2IIVA 3L7IA 5L3SB 3KCQA 2AS0A 3AJAA 2IYWA 4M7WA 5K3BA 2XBUA 2P2SA 5H70A 2OQIA 2TRSB 3DEHA 4I9UA 2FP4A 3VZSA 4UTNA 3OFNA 1OFIA 1DIAA 4YPFA 1FX0A 2Y27A 4N8SA 4Q1BA 5DX0A 2GWRA 3ROTA 2WILA 2CW8A 4J9NA 4JV1A 3N0VA 2BEVA 4ZT4A 4PONA 4P4NA 3ZWWA 2A86A 3HA7A 2ADOA 3UEOA 5GJWC 3WKBA 3BK2A 3DDOA 3A3OA 3AU9A 5GAJA 2AD5A 2O1WA 1HG1A 3T06B 4QU5A 1WY5A 3TQCA 4ZOAA 2KW5A 2PKWA 3HR8A 2WB4A 3BRWA 3CRZA 5EJ8A 1BWPA 1W25A 3IP1A 2IRWA 3MSCA 2OKGA 2I67A 3UWKA 1NG9A 4OQ4A 4YC7A 2F1RA 3QU4A 2FJPA 4LMBA 5DBFA 2JA6G 2HHAA 1OXTA 4KVGA 1WMAA 4LFCH 1L7XA 5IYCG 2NXWA 3RSQA 1WW3A 2DHCA 4R68A 3TZ6A 3M9OB 1C0EA 2X0NA 2DFDA 4BO9A 1GCAA 2HBZA 4XLLA 4B2PA 4DZRA 4IFEA 1J9GA 2YBDA 4EL0A 3MLBA 3TINA 1W4RA 5BOVA 2AG8A 3AFGA 4RY9A 1F8UA 2I65A 4OHMA 4KVZA 4MQEA 3NW9A 2WV9A 1C29B 3ANTA 2X9LA 4MUXA 4MPTA 1Q2XA 3R7NA 3OQNA 3DAPA 1ABBA 3L6OO 2IY7A 3EJWA 3THYA 2VTKA 3FMOB 3PCTA 2Q6TA 4M0KA 5BMVF 3MOGA 5CDSA 3EWNA 2YY5A 3IXLA 3RUFA 2WYVA 5K3AA 4ZHQB 5LDHA 3CLRD 2XGQA 1KYVA 4X1IA 4RTPA 1N0UA 3H8JA 4JJ4A 4BAUA 2AX4A 4LBYA 4WN9B 2H16A 5EIHA 2ZBVA 3LZ6A 1UANA 4OOEA 2ZJ2A 3EGXA 2NU6B 1YZKA 1VSUA 2BT4A 5JNSA 1OLSA 3QEMA 1S5PA 3HCBA 4TX1A 3B6IA 5TVGA 4KR2A 1D6NA 1J1IA 4BXOB 1UBCA 3Q12A 1GA4A 5K8TA 1LLCA 2BJWA 3IOYA 1PNQA 5K03A 4Z7JA 4EFKA 5ITZA 1HX7A 4CC5A 1YS7A 4PBTA 1OC4A 4PO1A 4OLHA 2VT2A 1XEAA 4CGZA 1Q95A 3INNA 1ZICA 1FQWA 1AKTA 5B2FA 1KFJB 2QZ9A 4BFZA 4YUZA 2VPZA 3ZJ5A 2Y0PA 1H9BA 3O21A 4ROTA 3QF4A 1KH1A 3HOUG 3FUXA 5SYNA 3V33A 1EX6A 4LXYA 2CHGA 3EUFA 1X80A 3PPIA 4X1OA 2CL5A 1R00A 1N5LA 1ZH6A 1FJHA 3I04A 3ADBA 5EUBA 2J0EA 3DDHA 2GFIA 2LP4Y 1LCIA 1KOJA 2GXQA 5HJ5A 2AEMA 4UXHA 3N41B 1RRGA 3EK2A 1B93A 4MWBA 4JUAA 3WKEA 1GT91 4GU5A 2WIKA 4AJ9A 4YI5A 1G6OA 3B20A 1HTWA 1S8FA 3RVSA 1CUFA 3BAFA 1TUBB 4IQ0A 2NMVA 3K2EA 3TJMA 2N42A 1GQFA 3UGQA 1GGOA 2C22A 4YO8A 5KTNA 2D2IA 4BASA 2Y4NA 1CUSA 1N6HA 4Y2VA 1EP9A 1V1RB 4Q7QA 4UBOA 2QE7A 4AYWA 5FQNA 4OL9A 2Z30A 5C32A 4S12A 3WYDA 3QGMA 3VTFA 2Y93A 4KE9A 1GTRA 5EWLA 4HQ6A 1ZM3A 3DKRA 5A5DA 4UCFA 5CLFA 1U9IC 1KSFX 1NKSA 3TOXA 1U7UA 4OMFG 4CQMA 3NQ41 4UCWA 2XXAA 4KXQA 4NP6A 3F6CA 4ED7A 2D0PB 2JGEA 3L7OA 5FEMA 2PXCA 1C7QA 5AHWA 4E08A 2FEKA 1L3BA 1ZD3A 3R8CA 4MUAA 1JHRA 2X0JA 3ROZA 1JQLB 3EW7A 2NQTA 3ANLA 3ROPA 4EFMA 5CW2A 2QW8A 3CW9A 3IE1A 4FYXA 1QPBA 2W5UA 4FS8A 2K7FA 3VQTA 2WIFA 1ZHSA 2PK3A 2QL6A 1UWKA 1WL8A 1M2NA 1Q7CA 1UXIA 3SVZA 4UCQA 1BCRA 3E2PA 3WOHA 1DQRA 1SVNA 4DYHA 5CTJA 4AJ1A 2C58A 5COAA 3X2SA 2P30A 4TVKA 3T35A 1VECA 4Y6PA 1MRNA 1AUPA 1NBME 2VK2A 4ZVMA 4AS3A 1IOLA 1GGNA 1AUXA 4MAMA 3P9NA 5JO9A 1NTOA 1QHHA 3RFTA 2R8ZA 3FOAA 5CBPA 2JI8A 4B3CA 4NENA 3ICWA 1B15A 4YWHA 1JIXA 4K6OA 3JVVA 1EQ2A 4R2XA 2V4UA 2ACVA 3KOYA 4N9QA 1YI1A 5KU1A 1YQWA 4ZVNA 4Y30A 3U5ZB 3C3CA 4BO1A 3OZEA 3LCCA 4C0KA 3NBQA 5J4HA 2PKYX 5KB3A 5TIIA 1SHZA 5T4HA 2VZLA 5JYEA 3SIPA 2QUZA 5FLXW 5BR8H 4JVSB 3ZWKA 4OXKA 4QYXA 3KB2A 3ZDDA 4FB4A 4DM7A 5BSGA 3HCEA 5CIQA 3WV5A 1T15A 5KT6A 1O95A 4S05A 2WYWA 2AZXA 2HCJB 4YJHB 4F9EA 4B4DA 2R2AA 4IUBS 5I5VA 1VJ1A 1PVOA 2PNFA 5KOHB 2P2ZA 4YMGA 3KHRA 2XX3A 1V45E 4HNAA 4RM3A 4BEWA 3R9XA 3WS7A 3A36A 1AUOA 1MA3A 1G20E 4J3FA 2CCGA 3ANMA 2HDHA 3HZOA 2QZPA 3TW4A 1GGJA 4C7MA 2C42A 1DDOA 2H29A 2ZR7A 1SQ0A 1PDWA 4JB8A 3I12A 4YP3A 1FC0A 3NYRA 4RUCA 3UJ8A 3PTLA 4NBTA 3UAGA 3V8VA 2AKEA 3WYCA 4MAFA 4QJ5A 3BMNB 1XQVA 3GZJA 3FH0A 2OCYC 5C8XA 4U2FA 2G80A 3ESXA 3OZWA 3VR4D 1KK2A 3PR5B 2HMYB 4P6VF 4P84A 4LNUB 2RONA 2BM9A 3FOWA 3OU2A 1ZG3A 1TECE 5DFAA 3MG9A 5A02A 5IW8A 3D7KA 2JFWA 2JAHA 4Q4JB 4Y8VA 3MT0A 4FM9A 4RHTA 4QL3A 4QZVA 4YFYA 2NADA 2HIXA 1KGDA 1OZ0A 2Q5QA 1FFWA 4EA8A 1AOXA 2KI5A 3CUKA 3LV8A 3N07A 2OPBA 2CUKA 3TRFA 3FVWA 3FSGA 4YA6A 4CDMA 4MVJM 4OIMA 4EBBA 1W2HA 1WUJS 4WFKA 2WB2A 3WG9A 1OAAA 1ABFA 1N5KA 2H1WA 3FDFA 2NP6A 4PZCA 4HUJA 4YGXB 3C97A 3NV7A 3KAKA 4NVRA 2REXB 2B1QA 1V5IA 2HWXA 3DMRA 5BO5A 2GEDA 1U7WA 2VHWA 8MHTA 3F7TA 5EKDA 5LYJA 5ADWA 1T4CA 1FFYA 5JXHA 4MV1A 2ZSDA 2OH2A 1D03A 3PNPA 5BP7A 4D4HA 1DMRA 4QXQA 3LECA 5HBGA 5THKA 2YOFA 1N77A 4FGLA 2PGLA 1DLJA 3FDZA 3TRKA 1M6YA 1R9GA 3FPFA 3GMSA 3I9V6 4ARSA 2D74A 4BO0A 1TC1A 5K4HA 1QGZA 3JQGB 4D6YA 2QP9X 1ZWKA 3DVQX 2UZ4A 3PK0A 4HLCA 3EA4A 1FU4A 1JE0A 5IYZB 2XF2A 5C3EG 4PGHA 1XVLA 2ZCUA 2IJGX 3NEYA 4XIFA 1Q0TA 2DKFA 3VR3A 3QWFA 1D9ZA 3WK7A 3DTYA 1RYYA 3MR5A 3UK7A 4H7KA 1QS0A 4MSUA 2WKSA 2WR8A 2Y1LA 1PF7E 2POCA 4FLMA 4KITB 1NC3A 5EZSA 1E2UA 5F2EA 2BGTA 2Y1DA 4C29A 1NY6A 2XGPA 3IP9A 3KOWA 2IPLA 4OKIA 2QGNA 1DDGA 3VO1A 1FRFS 3KJQA 2J3IA 1Y1KE 4IIHA 4BBRG 1FVOA 1PK8A 1O95C 1Z3IX 1YQUA 3NHRA 3V34A 1EU1A 1EFRA 4TWRA 2AE1A 1KY3A 5GJBA 2QRPA 5CT8A 4B6FA 1N7IA 5KVCA 1JAYA 5L6LB 3DNPA 4RADA 3D8UA 1RDFA 3W5IA 1NBWB 4KMOA 4ZAVA 1Z7WA 1QIFA 5CA0B 4G09A 5BWTA 1MW9X 2QRNA 4DAAA 1XTZA 3TKYA 4L0QA 3ZLTA 5DT2A 1YMVA 2ZTMA 3SZMA 4HXYA 1BNCA 2Z9BA 5AR1A 3HFGA 4AF8A 1X1CA 1SA0A 3BT7A 4D9IA 3AUXA 5M3BA 1KI7A 2IFTA 2PAAA 2I6GA 1Q22A 2TSYB 4FDLA 4BRSA 2V3CC 4QQNA 2V7QA 3RARA 2P3QA 3W8NA 3OLCX 1R74A 4EG6A 3L8GA 4N5MA 1Q15A 4AAYA 3PI7A 3JQDA 3KREA 4UFNA 1JFSA 3Q87B 3WRVA 4MDHA 3Q7EA 1L4FA 2QLTA 2W71A 2FEPA 3BIWA 2O0MA 3BXEA 4N76A 2VH2A 4A2BA 3OFJA 4JLSA 5JDIA 1W85B 3MS2A 4EA9A 4O4LA 4A8JB 4DLLA 4B4KA 3E7DA 4Q7KA 3VGJA 3AVQA 4BYMA 2XDYA 1FS4A 3L06A 2BFFA 2DSTA 4J9UE 1WDWB 3PFGA 4ECXA 1TB4A 5ALKA 4GBJA 4CEHA 2Z02A 5I4KA 4BQPA 3WIEA 2Y1KA 1TKAA 1TZ2A 5J3JA 3ZHBA 1CG6A 4KU4A 3Q4GA 3EZFA 3CUEF 2PS0A 4AU1A 2JARA 4C21A 4CKWA 4OA5A 3PZRA 1K8QA 3RABA 4HS4A 1P6XA 1WM1A 2NU9B 3M6LA 5K3FB 1ESDA 1EI9A 4FD2A 2M6LA 3QYPA 4ZTUB 3G9QA 3BXFA 2HW8A 3WL3A 3CRMA 2ZVJA 4X6LA 3MJCA 4UNQA 3D54D 2OHXA 4F9FA 1NYRA 4CHIA 4I3GA 2CNBA 1ZCAA 1VSVA 4CZ2A 2QD2A 2BFMA 1MXHA 5ESWA 2Q49A 3AT1A 5AW1A 3Q3CA 1J6UA 3FYUA 5HKKD 1CRZA 3W3AH 4JROA 4CIAA 3GV8B 3FZNA 4X45A 2ZRIA 3S1AB 4PFKA 3LHFA 2JZOA 4G26A 2UUCH 2FA9A 4X93A 1N2OA 1N5MA 1KBLA 3DMDA 1A82A 1RW4A 4M36A 3A2LA 2H00A 1NDHA 4CCWA 1KU6A 1ES9A 3T52A 2CDBA 4BWGA 3B1VA 2VDWB 4D0GA 3SC2B 4YV7A 4RKYA 1KT8A 4UMEA 1X8XA 4ED3A 1SUWA 2VK8A 4IO0A 1SXJE 5EDWA 3VZDA 3C15C 1ZGGA 7MHTA 4OJNA 2F9LA 4TUYB 4UUQA 3D59A 3AKDA 4KQ6A 5DHTA 1USVA 4Z0HO 4MQUA 1V9SA 5DQGA 3KLMX 2BQUA 4BTVA 2HQ1A 3BL8A 2AZTA 1WSBA 3C5VA 3HXKA 1KHTA 4WZZA 1U0SY 1TMGE 2VSFA 1EUDA 3ABSB 3AKZA 5B1HA 2REQB 5AUQA 1Y1PA 5H68A 4MVJH 1HDEA 4ZYXA 4Z49A 3X1JA 1Z74A 1ECLA 4EEXA 1QQTA 3UN1A 4JL8A 4DV4B 1ZAUA 2ZB3A 1SUCA 5IVDA 5F4BA 4BKPA 3QSGA 2OVFA 4HS9A 1Z33A 5JNLA 2YWEA 5I7WA 5EVJA 4LMAA 4OU4A 5IF3A 5JVLA 4RZ2A 1FRNA 1A97A 2J4DA 2CC2A 2O8CA 2GN9A 4W5TA 2PUGA 3BDIA 4GLFA 4PZPA 5A4KA 4O3OA 2A9JA 3OQBA 4JI0H 2B4KA 2VSYA 5AIAA 1R37A 2P4HX 3JARA 4YRRA 2XMSA 1P72A 1UF9A 1RM5A 1P9NA 2XWSA 5CXQA 2OBFA 3NEPX 3LP6A 1T9DA 4TV8B 1SBCA 3RRJA 5FR9A 3TD9A 5FPKA 1QGUB 4J2OA 3H18A 3FVRA 3Q41A 2FZGA 1L7MA 2IXTA 1R0XA 1XXHE 1SZCA 4CCYB 2HUNA 2WWWA 4K2AA 2GZSA 2BR5A 2D8MA 1L4LA 3A4TA 1UAYA 5JLAA 4GOMD 5I9SA 3H05A 2XKKA 3NKFA 3DDNA 1I1HA 3JWEA 3HKEA 4IRXA 4R5HA 4NXNH 4MP3A 3OBIA 1KQOA 2A5JA 2BI8A 5H9WA 3USES 1WSAA 2ZRFA 2VP4A 4Q1DA 4PSAA 1T4BA 4OXQA 2IDJA 4I50A 4GI2A 5EPOA 1TU0A 3SYNA 2O6LA 2ZM6B 4DV0B 2E4UA 1PSZA 1Z7EA 4EH1A 2C7GA 4PYQA 5AJZA 3NBFA 4L5AA 3VOAA 2HSDA 5C46F 2CFSA 3G85A 1R6XA 3PPWA 2PS9A 2G5TA 3Q98A 3NPMA 3BAAA 2UXDB 1QF6A 2AOUB 3E2MA 1PEDA 3EOAI 1GNPA 3CF0A 3U4IA 1H1TA 1KO8A 4IS2A 4U9UA 2CYBA 1GAWA 3HQ4O 4MEJA 1DEOA 3GLTA 3JQCA 1T94A 4PXYA 5HJ7A 2X8AA 3FI0A 1CRQA 5JQWA 2AFHB 1Z5NA 4N5DA 4IRCA 3X1YA 5L4LA 1DS6A 4U5QA 5IVKA 1GAEO 5D3QA 2WZBA 2XE7A 2BFDA 4W82A 1L6IA 3B38A 3KUUA 2K2WA 3LQYA 1TO2E 3WLOA 4PTYA 1CUXA 1MVOA 1GL7A 4EUSA 2ZTLA 4OUKX 4L0DA 3O1JC 3OECA 2R87A 1X7YB 5HCUA 4G0QA 6AT1A 2E4VA 4DQ0A 5HUQA 2OV4A 3OKPA 4IPTA 5MF6A 3PLAE 2HA6A 3CUTA 2R11A 4KGXA 4WINA 2VHEA 4YHHB 4JMLA 1RJ9B 4IDAA 3VOSA 1KMHB 1SIUA 2R8XA 1UR5A 4OA8A 5ESXA 4FYMA 3PRJA 4CE5A 4L5YA 4RQBA 1N2XA 2JKZA 2VRCA 3TZBA 1DBQA 1E98A 2QNIA 1IEQA 3OM0A 3QJYA 4UTRA 1U98A 4AURA 2BC9A 4QULA 4MRVA 4D56A 4E03A 4J7UA 2FW7A 4ZOEA 621PA 3AM5A 4P8RA 3LDAA 5ECYA 4KO4S 3CJTA 4X95A 4YAUA 1FP4B 4QFMA 1GR1A 1OV6A 2HLPA 2R6AA 4FYIA 2F8MA 3ZE0B 5LIRA 3H42B 5A7FA 4FMCF 2J6BA 3DCJA 3DV0A 5AKKA 1RHUA 3VPXA 5BWOA 3VUEA 4BIIA 4HFNA 5EIBD 1A0GA 4JL6A 4NMMA 4G8DA 3LFHA 2P65A 1VLVA 5G4LA 5AI4A 3GZNA 2Z4TA 1YOVA 5TXGA 4LZWA 1P3DA 2HLDD 3T3IA 2VBGA 4BFWA 2C5SA 4QSMA 4RD3A 2O3TA 2BHRA 4AD8A 1CDZA 1YI0A 4OLFA 3SJAA 3EZ7A 1Z8FA 4FJ0A 5CM0A 4K9PA 3HO6A 2B4QA 2BGIA 3MJDA 3TIVA 4BN5A 1HWYA 3C7TA 4I1IA 5DTRA 3UJCA 1OA1A 2ETXA 3AGQA 2IS1A 2Z98A 5EJMA 4YT4A 4KEAA 1ZRSA 3CLSC 3DTTA 3DHVA 1E2BA 3MM4A 1A5TA 1QJ4A 5DHFA 4EUHA 3IH5A 5K4AA 4HV4A 4A2WA 4NE2A 2IMWP 1BXRB 4O4JA 4HRAA 4NCNA 5BYAA 2GUWA 3TPZA 1H2RS 1XNRB 1SVMA 2UZ1B 2JJYA 5DMHA 1UK6A 3L04A 3GIWA 4CMHA 3EGDA 3C6MA 2WFLA 4I1YA 1QK5A 4HAOA 1IVNA 4X3OA 4I66A 3D7SA 1WIWA 2E48A 4RA9A 4UZEA 3SNHA 2XIJA 3A58B 3WLIA 5FHQA 4LW8A 2CNKA 3IPRA 4QHYA 4MVJP 1I24A 1YWGO 3QENA 1P4RA 4Z9BA 1JJBA 4U7FA 5AHRA 4JODA 2EOAA 5IK2A 1JP7A 3B53X 1JR3D 4NIMA 1GTSA 2XE4A 4B82A 1V35A 2JJ8A 4UE2A 4JK3A 3V8NA 4LY3A 3J80W 5FBRB 1I7QB 2ZYGA 4WY5A 4JKIA 2FSFA 4HEA1 4IHAA 4R31A 3O8NA 3SAJA 5AUNB 5JCPA 5JAIA 4MTLA 3PHJA 3DSRA 2CD7A 3L46A 4K0KH 3ZHRA 3UG7A 4BTEA 2PLAA 1G21B 3KCNA 4IIFA 2FF5A 4Z4QA 3JS5A 1UM9A 4PVDA 1DTWB 1E3TA 4P7KA 4DILA 5AOVA 4Q9AA 3JQ7A 3VKUA 4N7MA 4MS3A 2JGFA 1C0KA 1SRRA 1H5NA 4AZWA 1AA9A 2CDRA 3AFIA 1W4CA 2PH3A 5I7RA 1JPVA 2AB0A 1Q2UA 4Q1FA 2R8BA 3GIKA 2VIIA 3MBKA 5B5SA 5IC5A 1WB6A 1EVIA 3VAAA 2EIXA 1QFSA 1L7RA 2C54A 1QFXA 5LU8A 1KWKA 3LVBA 3BJMA 1A27A 3QE9Y 2JJQA 4G0PA 3VSEA 1XJ0A 4WV3A 3NHJA 5AM0A 1K83A 1P5ZB 2DY1A 2I4IA 1BG6A 3TLYA 3AIMA 4DT1B 4GKKB 4LZLA 2VDVE 2GM3A 2X3FA 1QKIA 2O8BA 4XAQA 4D1YA 1RK6A 1SQGA 1L3IA 2ZZKA 1NVWQ 3S27A 4JOCA 5K8JB 4YYEA 3PKJA 1GPH1 4C88A 3QVGA 4Y9UA 2Z95A 4LPKA 3CA8A 5DEOA 3PWTA 3MR2A 4F11A 2ORYA 2ECPA 4O4HF 2VYVD 1ENYA 3F67A 3TNJA 3BXZA 1C1DA 3KKQA 2RI6A 4D82A 1QTRA 2Q9CA 5BPHA 3HJBA 2A5YB 4I7EA 4EO4A 4GKAA 1FQKA 4TLEA 5KG1A 2O3RA 1YB5A 4FU0A 3NGLA 4MH0R 4F93B 1MQ8B 3OQ1A 3B48A 3RYHB 3TAXA 1BE1A 2P69A 2XD9A 5TQ0A 3T61A 1QGYA 1R2QA 1VG0B 1L4MA 1OAKA 5T8KA 3BHNA 3H5TA 4PG5A 5C8ZA 2RCYA 2CN1A 4B17A 1HQKA 3TZLA 3AF5A 3FX2A 1KDZA 5KQPA 4OBWA 2C9ZA 5F9FA 2BHLA 1VPLA 2HRQA 1OIVA 3PQDA 4GLBA 2M98A 2CXPA 1G0OA 4PLPA 4QBIA 3ZOKA 2PKEA 4H6PA 1II9A 3DF9A 2I03A 2XPCA 3EEFA 4XUGB 4QUGA 1SB8A 4RPKA 4JJ6A 2PLRA 2XYRA 5JATA 1OYYA 1BX1A 4L5CA 1K7EB 4DL9A 2P91A 2DERA 1X6VA 3GH3A 1DIOB 1ND6A 4H4EA 2NQ8A 2HFJA 3HI6A 3KSUA 5EOVA 1LPNA 1M6EX 3NM5A 4O81A 2G25A 3EGEA 4BP1A 4KPUA 4Y6QA 2GN2A 2DGDA 1E8NA 4EFEA 1QDEA 1IN5A 1FJGH 3BIOA 1OC2A 1BIFA 3LUPA 3W5JA 5CM9C 4F7WA 2O07A 3SXJA 2JGNA 3ZE9A 3NT2A 3CJRA 2ZI4A 3THWB 3BGIA 4K7JA 4JOBA 3VHXA 4L8WB 1G0NA 1DBSA 3VX3A 3K1AA 3MJEA 4GWKA 1ETHA 5EP4A 1ULHA 2MR5A 5C4GB 3OEYA 1WXWA 4OOFA 2AYYA 1OWNA 1EXMA 1RQPA 3DKIA 4M6WB 4XPIB 5EQDA 1WXGA 4JX8A 4LRTB 4ODIA 3ZWAA 1VB3A 4UUOA 5IHXA 1HT0A 1AG9A 3AMVA 5EJFA 4YRBA 4RELA 3KEOA 2CMDA 3VKVA 1R88A 5BT9A 3VRHA 5JS6A 1DJOA 2MINA 4OCZA 2O2IA 2G04A 4B3GA 3T8YA 4AM8A 1L5YA 3EBPA 3SM9A 3K20A 1AV6A 4UBIA 4CDGA 5IP5A 1N57A 3G88A 1DEAA 1WXIA 1FQOA 2GJ4A 1GUZA 5I5WA 1RPTA 4L72A 3CNEA 3B36A 1FTWA 1Q7EA 1VGVA 5CCBA 2IOHA 1GUYA 5KREA 2HFKA 2O5CA 3D2AA 2EDAA 3IHWA 5CXXA 4L76A 1IBKB 3EVZA 1PL7A 1YRLA 2KE5A 4PSKA 2BN4A 5K3WA 2FOXA 1DC6A 4KUEA 5IM5A 2BOVA 3GWGA 2QPAA 1TAGA 2VXYA 1E2HA 1KAOA 3IP5A 3HN2A 5HQ3B 4QPJC 1G8HA 4KDCA 1PIWA 3RB4A 2R7ZA 4LF7B 1H4SA 1R0SA 4A5OA 1S3GA 1CUJA 3OESA 3FYHA 1SCIA 2Y2UA 3GLHA 3PITA 1ZBQA 3I1FA 4X3PA 2EL7A 1Q1NA 5KFLA 1KH2A 3DF7A 2C5LA 3P52A 5AVYA 1U2ZA 1FUKA 5G41A 2VNIA 3OCYA 3NETA 5TMDA 5LZ9A 4H7PA 2XKJE 5T8KC 3RHZA 3D4IA 2ZJ3A 4H59A 4RFLA 1GO2A 1XVAA 1LPOA 3IHTA 2F62A 4CM9D 5HHTA 3VTZA 4A3BG 1T0PA 3ESRA 4KBFA 4JJIA 3VSAA 4CMAA 3UCEA 2A8YA 2B4TO 3H8SA 4HBZA 1P5RA 3IGFA 1J09A 1R5BA 5JCXA 4GOXA 2IYVA 4ARZB 5L45A 2H5JA 2ZOSA 1HNNA 1USWA 3FB4A 4WDQA 4JYMA 5FWXB 5DVZA 1L8OA 4QNMA 4R71A 2P0AA 1NJSA 5EE1A 2QN7A 1L5NA 1X19A 3DAHA 2RKOA 1B2RA 2AT1A 2PWBA 3IC5A 3BCHA 2WKQA 4ZDWA 1GPBA 3AI7A 1WMSA 4M83A 3LO8A 3I01A 3BQ9A 1I4TD 3T99A 3ZK7A 3RC9A 4MW2A 2CZCA 5KNDD 1DGSA 4IZHA 4HAVA 2OUKA 1Z4OA 1JE1A 4RKRA 3F1LA 4GW3A 3PWSA 5JXIA 1BROA 4XTRA 1GTJ1 3QX9A 4GXTA 3TVYA 1G4HA 4B0PA 1N5IA 3M7IA 2AA3A 2EYQA 5J1TB 3C3YA 2GILA 3BMCA 4FSDA 1JAHA 2CZQA 4NK4A 3PQ6A 1N6IA 4ZO9A 4NJMA 3DLTA 2JIBA 3WISA 4CKCA 4CV3A 1RVV1 1KBOA 3LOUA 3FSJX 1MC4A 4D6XA 1TZBA 1RLIA 3II6X 2AR9A 4O7ZA 1ORDA 2CJWA 3BXGA 2I2WA 1Y8RB 5ESDA 3D1VA 1YCFA 2C3YA 1HNZH 1T3NA 3N44B 2FZCA 3IUBA 4RHYA 1BN6A 1DAGA 5JMWA 1MO6A 3RHTA 1Z4MA 4G0YA 1N8NA 1M5UA 3UHOA 3FIUA 1NFFA 3N2ZB 1R7RA 2HU8A 5B64A 2GB4A 1WXXA 1VBMA 4G85A 4FNAA 2C2MA 4UVEA 2ZRCA 2PE5A 5B57C 3BA8A 3NDIA 2Q1YA 4B6EA 3QI2A 4FWIB 5CT6A 2GYUA 2GTIA 3HV2A 3UOAB 1T2EA 1JF8A 3KYDA 4ETNA 1I1KA 5H8WA 5DWDA 1IXZA 5KSZA 4NAVA 1RI3A 1DOZA 4MYHA 1GNVA 1T9ZA 3DD5A 3QU5A 1LC3A 2N1MA 3GJ3A 3DFUA 2A7XA 3HLTA 3NP9A 1L8AA 4CL2A 3IAEA 4PINA 1HYGA 4CCAA 3WWDA 1OBVA 5TMPA 1FFXA 2NZXA 3G8YA 2NXCA 2BLNA 1TC2A 3IXMA 3R2JA 3GPLA 5AW8A 1RYMA 2WJWA 1OY1A 4OAQA 1Q3KA 5CBKA 3EEYA 4YJ3F 2VJQA 3W2TA 2NIPA 2YV1A 3HJHA 5DLEA 1E2KA 1QKKA 1JU9A 3M2PA 3EE6A 3A4NA 2JLYA 2YWXA 5B30A 4GM4A 5K5EA 3VU9B 4N4AA 1M5TA 2Z8XA 5K6RA 2YW9A 1E1QA 4HYQA 4CMKA 4U7GA 3L7AA 2PRSA 1A8UA 2YVUA 4GR4A 4ITVA 3ZZTA 3O8OA 5JVDF 1JHDA 4B6OA 2HIAA 1WEKA 3RWBA 1PEKE 3MNFA 2A1UB 5EJEA 2YXEA 1S4QA 2ZITA 5A6VA 3UVEA 5JEDA 1P1BA 1P29A 3ZDRA 1UXHA 4WJZA 2O3SA 2X22A 2WOJA 1UXKA 3LTNC 5G1PA 3ZZ1A 3V6JA 4KFTA 2V4MA 4TMKA 3ESCA 1U9IA 3NASA 3EPKA 3D4PA 4U7HA 5AJWA 3CE6A 4PHFA 3LT5A 4D4MA 1TVKB 4JSTA 4RPHA 3GQBB 4BNHA 4U3JB 4YLGA 3PQ8A 3KQQA 3OPQA 4LFAB 1ZVVA 3TDNA 2WWGA 1YC2A 1FBTA 3B8EA 4NYMR 4LQ4A 1L9XA 5CDUA 5EMMA 5KOIA 4YY3H 4Q16A 3GIDA 1CWUA 4QE3A 5FFFA 5CH5A 1TL7C 2CUZA 1Q16A 5CCDA 1UBLS 3PTAA 4JV2A 2QQ0A 2OBBA 1KK3A 2XZOA 3ER8A 3QWAA 3N75A 2K2QB 2VUGA 4K03A 3EZGA 3R7DA 1V48A 1W30A 3QG5A 4C2TA 4J1SA 1U3FA 5FOTA 4BLVA 4BLSA 3TXAA 1E7WA 1GITA 5FLEX 2PR7A 4OYLA 2GD2A 1XZAA 5LYYA 4CWAA 5T14A 2YMLA 4GLJA 5IVIA 2QWXA 3LM8A 2HRRA 3ZKWB 1DTSA 1GQRA 4NBVA 3SIRA 1GZ5A 1WHSA 1SKYB 2F8LA 4MVJE 4DCVA 2XQJA 3BA6A 4JC0A 2NO6A 4LGMA 3P2OA 2VDKB 3Q0IA 3BHMA 3VHQA 5BSKA 1P2SA 1DUSA 2PWPA 3FLMA 1EB9A 4QEDA 3HN7A 2PS3A 4EEYA 4MNTA 1IAVA 1UBHS 1FXWA 2VDNB 1I3QA 2FCRA 4XOIA 4OP3A 5BN4A 13PKA 4OQDA 4E2FA 1IHOA 2H1OA 4YUVA 5KFGA 5DBIA 4BNLA 4E2YA 4RZUA 4YJ2B 3QZ8A 3OT5A 3ZQ6A 4HDMB 5BQPA 3RQSA 3NUAA 1Y9JA 1JDZA 1UINA 2VEOA 2PWZA 3ZJTA 1Z8NA 4QO8A 1CBUA 2PRZA 2AI3A 5LMCA 1SCUA 2FZ5A 2VO1A 3EB9A 3HYLA 5FORA 3KQSA 2CSXA 2AN4A 1QYXA 2IEYA 3QX7A 5JAPA 2UYQA 4I2NA 1T8UA 3P20A 4B81A 1VAJA 5FUVA 4JVOA 4X91A 1ZI6A 3OCCA 1ABEA 3TTUA 3MRSA 5EJ5A 4DLNA 1WB4A 2MYNA 2XGOA 5ILQA 1F0YA 2BR4A 5SZKB 2QV0A 1Q0RA 4KGDA 2C5FA 4QWWA 3UT6A 3JAKA 3O1LA 4G1MB 2YIMA 3RUCA 2GF0A 1ZRNA 2NT3A 1JQ3A 4A3GG 1JLSA 1XZIA 1E6MA 4NARA 1E9EA 3AUUA 4LHSA 3HWWA 4BL5A 4U9HS 1A95A 4XIYA 3SE0A 4YXFA 3KR9A 3E23A 4BCBA 3VDMA 1G5PA 5JXJA 4DTIA 1IBLH 5TPZA 3HKCB 6GPBA 4KFUA 4NFSA 3PXDA 2JGJA 4EBCA 3VR5D 3A1NA 5E3HA 1FVFA 4PG6A 1PEYA 1E1RD 2B34A 4EVSA 1ZKDA 4YRCA 3EY4A 1U0HC 1P9OA 3A4IA 4UTXA 4QBTA 1HY3A 4ZMRA 1YFLA 4A92A 1RWBA 4IDHA 3O4RA 1U9JA 1P3JA 2J3JA 3EEBA 4JI6B 4BVGA 2WTXA 2XCRB 4C9BA 2CFMA 5DHUA 5FPYA 3PDJA 5DSXA 3ZWBA 3WE7A 4RNOA 3QVKA 1V4YA 1LI5A 2P2YA 3TVTA 5CX1A 4RGBA 3OTQA 5F5XA 1EFVA 3CR7A 2KSWA 1P91A 3H40A 1AA6A 3OIGA 5KAMA 3EF1A 2GCGA 3WYAA 5IT9A 3AK4A 1K8ZB 3VYUB 3KOXA 3JQRA 4Q03A 2X6RA 3GNTA 4MAAA 2AG0A 3FZGA 4TM5A 3TLZA 3LA8A 3QKTA 2QD1A 2W6JD 4NATA 2J8ZA 4AXXA 4KOEC 3PIIA 3PHBE 1N1MA 1GGMA 1LPSA 1TPYA 4MQLA 2XOKD 5BYKA 2FNAA 1D4ZA 1FZQA 2BTQB 4HVAA 2BFCB 4NHOA 1LI7A 1M1ZA 2VWPA 5I01A 2GMWA 1PT6A 1W5FA 4FC6A 3EFOA 1CE8A 4U2DA 1NBMD 1Q1GA