5C1OA

Crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
297
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
total genus 88
structure length 297
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1oA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1oA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1oA01
4IIJF 2W70A 5LP6F 4MA5A 4ZHQF 1A9XA 3U55A 3RUPA 5D8DA 5GONF 3VMMA 2YS6A 4XYMB 5DMXA 4YAJB 2J9GA 3R9RA 4O81A 2X0SA 3HO8A 4O7VA 1VBHA 2FB9A 1KUTA 3TW6A 5KX5F 3JZFA 3HB9A 5C1PA 2PN1A 3DF7A 2Z02A 1GGOA 2YL2A 3KALA 2I87A 1M0TA 4FFMA 4O4LF 1I7LA 2WYOA 3TINA 3KREA 1JDEA 3G8CA 4ZOLF 4C5CA 1M6VA 1Z2OX 4MAMA 2YWVA 3OUUA 2R7KA 5H80A 3K3PA 3U9SA 4O2BF 1VKZA 2FPGB 2R82A 2DWCA 5BPHA 4IZOA 4EABA 5FNVF 2P0AA 5CAEB 1W96A 1GSHA 1WR2A 1EUCB 1Z2NX 5EZYF 4MV9A 2W6PA 5JQGF 3I12A 4ZQIA 3SE7A 4J6EA 4HR7A 3Q2OA 3N8DA 4NYEA 4MV6A 1Z2PX 1UC8A 3MWEA 2ZDHA 2YYAA 1DV2A 3V4ZA 3R5XA 1KJIA 5J2TF 2GPSA 2YZNA 1CQIB 3JRWA 3BG5A 1KBLA 4HQ6A 2R85A 3V4SA 2V5AA 2C00A 4M99A 4YJ2F 5BMVF 3BSWA 2V58A 2NU7B 1EUDB 4O7ZA 2CQYA 1EYZA 4E4TA 1AUVA 2XD4A 5IYZF 5C8YF 5LXTF 2IP4A 2CZGA 4FFNA 4XYLB 4YJ3F 4EA7A 4HNUA 2GQSA 1C3OA 5CB4F 2R7LA 4O83A 1T36A 2W6QA 3MJFA 4EG0A 4EAAA 3QFFA 2NU9B 5JVDF 3WO1A 4WD3A 4DIMA 1BXRA 4FGRA 4FU0A 1BNCA 4TUYF 1PK8A 4I50F 2FPIB 3ETHA 3VPBA 1KJJA 2CNVA 1C30A 2XCLA 1JDBB 2NU8B 4DLKA 4O7NA 3MWDA 3GLKA 4O7TA 3TIIA 4O7LA 2R87A 3VOTA 4YBZB 4C5AA 1M0WA 4IHJF 3RV4A 2NPOA 1DV1A 1GLVA 5LOVF 3ORRA 5K2MA 2VPQA 5KKNB 3UFXB 5J2UF 4M9CA 1IOWA 4MV3A 1CQJB 3LWBA 1KC7A 2R7NA 4O7YA 1KJQA 4IWYA 2I80A 4ZI7F 5CA1F 3BSSA 4O82A 4QSHA 4XX0B 4M98A 4MA0A 4RZQA 3RV3A 5I47A 4MV4A 2ZDGA 2GPWA 2W71A 4YB8B 3R23A 2VHEA 4MV8A 2FPPB 1GSOA 2R6FA 3U54A 4M9UA 1CE8A 1IOVA 4O7WA 2YRWA 2GQRA 2HGSA 3K5HA 3E5NA 3R5HA 1A48A 4O4JF 1KJ8A 3R5FA 4O84A 5JH7F 3HBLA 2OLSA 3Q1KA 1E4EA 3VPDA 5JQWA 3WO0A 1CS0A 3OUZA 2R86A 4O4HF 2PVPA 5JVLA 4WBNF 1UC9A 4HNVA 2W6OA 3RFCA 4FFPA 5BPFA 3KAKA 4C5BA 2SCUB 3ORQA 5LA6F 4FFRA 4HNTA 1JKJB 5CA0F 1EHIA 1KEEA 4IWXA 1I7NA 2CNUA 4O2AF 1JLLB 3U9TA 1EZ1A 2NU6B 1KJ9A 4MV1A 4FFLA 4YAKB 2NUAB 2YZGA 3TQTA 2I8CA 1ULZA 2V59A 3AW8A 1DIKA 4EA9A 1OBDA 1PX2A 1E4EB 1SCUB 3NUAA 2DZDA 4O86A 2CNQA 4GGMX 4FFOA 5C1OA 4O4IF 4EGQA 1GSAA 2YRXA 2HJWA 4I4TF 4L1KA 3N6RA 5HBRB 4I55F 2DIKA 3BFPA 4ME6A 2R7MA 2GLTA 2YW2A 4O7RA 4Y8VB 2QK4A 2W6NA 4O7SA 1VBGA 3K5IA 4EA8A 1OBGA 2W6MA 2R84A 2YZLA 3VPCA 3BSYA 5LYJF 3G8DA 2DLNA 3JZIA 1B6SA 4FE2A 2FP4B 1AUXA 2ZDQA 2YZMA 3WNZA 4EGJA 2VR1A 3AX6A 2QF7A 2PBZA 3VA7A 2W6ZA 3JRXA 3LP8A 3ETJA 3TIGA 3KAJA 4XZ3B 2VQDA 1W93A 2Z04A 5HV6A 4MV7A 3GIDA 4TV8F 1B6RA 2YS7A 4TV9F
chains in the Genus database with same CATH superfamily
3R0JA 1JG6A 3R09A 3AO0B 1TUEA 2IZZA 4DJDC 5DMXA 3H65A 2HBQA 1GRNA 3PC8A 3RKRA 3SNHA 2IP1A 3SYMA 5LB2A 2VUUA 3Q5DA 2GCEA 3PXEA 1KI9A 2Z02A 4U5QA 5JZ9A 3CSSA 3K6KA 2WYOA 5G0TA 1SUCA 4UTVA 1AQUA 4PNZA 2IU0A 4MRPA 4PX2A 3UTCA 2CSUA 1SOMA 5KFXA 3ZWKA 2YWVA 2JGFA 3AF0A 3Q7RA 4NBWA 2UUAB 3AEKA 2JJYA 3WIEA 1TAEA 5KNDD 4MUMA 4IIUA 4RELA 2JK0A 4JBYA 4LV5B 2W4QA 3L01A 3ZQ6A 4NLGA 2GBFA 3OIWA 1VA4A 5JQGF 4KO2S 2OC4A 5BR1A 4O1HA 1F6WA 3GXOA 2DERA 2ZRFA 1LH0A 2FFAA 2FXIA 1EK6A 2XWJI 2JK1A 4JFRA 2VYFA 4NZNA 1FU8A 1YNOA 3KU4A 1P3JA 1I2LA 4Q3NA 1RP1A 4IOJA 3A0UA 4IQ8A 3VUEA 1MQ8B 1IG0A 4OSPA 4LQCA 2IEYA 1TUIA 5T14A 1LQTA 1CQZA 3NBZC 3TXXA 4BQSA 5K9ZA 1MABA 2QQGA 5JTTA 5A9RA 4E2XA 4CV3A 3M1YA 3O91A 3MWEB 2C4HA 1U2RA 4BGEA 5AKGA 4L0MA 4WRRA 1BXRA 4N47A 4H7FA 3NUQA 3JQBA 3HCCA 4QSMA 1OLXB 1YIOA 4F2WA 1TJ3A 4A6PA 4RZXA 5FH9A 1V8DA 2NTVA 3GAMA 4Z9YA 1TWCA 2ILVA 5GZ3A 1V96A 3JX9A 3WQHA 3GMTA 1VLZA 1X86B 4WFJA 3PPWA 1QDEA 3RROA 2FMUA 1E6LA 2H7XA 3DZBA 3T99A 1PSWA 4TN1A 1G9TA 2PYDA 3Q3GE 1RHKA 3ZQJA 4C29A 1ZJZA 4I99A 1VLQA 1JEEA 5DI9A 4LYHA 1GXSB 4Q3BA 5B12A 1OI2A 4N5MA 4C6HA 1R9TA 3BL8A 4TKLA 1VE6A 5JD3A 4LGCA 2I80A 1EFAA 4HGOA 3CKMA 4P4TA 4B6RA 4UAGA 4B1FA 4U00A 4Q4JA 2GPWA 1CNEA 4EEZA 3QLVA 2HJGA 2HA6A 4EKYA 3U16A 4MV8A 4BV2A 1P7VA 2R6FA 3CY6A 2XRZA 4FGZA 2AG0A 2WM8A 4M54A 1YRBA 3B8HA 3AF5A 3G2IA 1C0LA 5AKHA 3CTMA 4O84A 1B2RA 3ILVA 3JQDA 2IJGX 4J0QA 1L9KA 4TS4A 2QR5A 2V4ZA 2IMWP 5FTWA 2H51A 3QZUA 5KWIA 1M7GA 2A5LA 3W5JA 3FOFC 3PEYA 2ATCA 1NNI1 3CH5A 2A5GA 2RGBA 3CJRA 5J1SB 3T38A 2OCGA 4CLOA 2HBZA 3I73A 3A3PA 4QT0A 2PKCA 5H9VA 2ZJOA 2JASA 2CNOA 3I64A 2FG7C 2VBFA 3Q85A 1TF7A 2ZJ4A 4F1JA 3IOCA 1HDIA 4S35A 1ZW6A 3H3FA 3IEIA 4FFWA 2DHCA 2XUKA 4I1SA 4AZSA 3TTVA 4TQUS 4R5HA 4YGXB 3OZUA 4EQZA 1QP0A 4OA8A 2WIJA 4ZT4A 4TQRA 2UVUA 3CFYA 4IIBA 5AVZA 1Y9DA 3EYAA 4Q9LA 4G36A 2X5JO 4CM5A 1E1CB 4BKRA 4FS1A 4H15A 2RE8A 4BHTA 5ADHA 1XMSA 3Q8KA 2BMWA 5CH8A 3BCHA 3MS2A 3IOMA 2HO4A 5DGTA 4CKWA 1ZMRA 1WDMA 1QK5A 4MR8B 3W4KA 3UUGA 3PD7A 2XTMA 1THZA 1VE5A 5HKOA 1WG8A 3OQ6A 4CEHB 3EXFB 1YFKA 2SKEA 1E9FA 5JY6A 1BGWA 3KQHA 4XYGA 2E2WA 3ZZMA 4H6WA 2XQIA 4QUEA 3E9CA 1X1QA 2CNDA 3COZA 2UXCB 2JGJA 2Q6OA 1XN1A 4CKBB 2WZCA 5CIQA 3DAPA 3CVYA 2BZGA 4RK4A 1T10A 4WZAB 1YKFA 4FZJA 5DIFA 1IY8A 1CRLA 3T34A 2GO1A 1IPHA 2W2QA 4OJKA 5TR9A 4HGRA 2A78A 3OLWA 4NAUA 5JOQA 2F1IA 3LQ2A 4NBSA 1PGQA 2B21A 1RYNA 1QLWA 1SC1A 1GUYA 1R4AA 1S1MA 4S0ZA 1U5BA 1MF7A 1WTAA 1KI4A 3TZHA 3PK0A 4AJEA 4I1RA 1P7YA 3L41A 3WISA 2P6OA 3AHEA 3I9KA 3P4YA 1BMDA 2F9FA 2C3OA 3QE9Y 3TH5A 3OM1A 4PQRA 3CH7A 2GCOB 3PW2A 1HDZA 5TPWA 4JBNA 1WB5A 1KH3A 1SHJA 1WU8A 4RCZA 4ZI7A 3GPCA 4JC8A 3C3PA 3AOEA 1ZJ4A 3PJDA 2HMUA 1RADA 1IAVA 4OHMA 1FP7A 3K9GA 3RWBA 1G8FA 4DY4A 1V7QA 2ZULA 3WLIA 1BFUA 4Y9DA 1G8YA 1T36A 4HNAA 1KOGA 4MCIA 5EHXA 2W2LA 1SGWA 3VXKA 2XITA 1M5RA 1OZFA 2PH1A 4RU9A 4WESA 3EEFA 4AN1A 4ZZ3A 2EQAA 2H4ZA 2PS9A 2PJRA 4UNQA 2QLFA 5IBPA 3R7WB 2CCKA 3VSBA 1TK9A 4FC6A 4C22A 4XCVA 3TAUA 4G8BA 3ACCA 2NPOA 1AS2A 1KOFA 5LCXA 1XQWA 5DDIP 1P0PA 5JSFA 4HPJB 2OGSA 2O2HA 5I5UA 4HWKA 5BQFA 4UNIA 3QK7A 2H59A 1PWXA 4L4ZA 1X1TA 2BFPA 2FMIA 1CUAA 1ZXXA 1C1XB 2I2DA 2NTYC 1ILWA 3I5AA 2ID8A 4LSXA 3PI6A 2AXEA 4PANA 3DDWA 1ADYA 1DQSA 4IUYA 3C4VA 2WSMA 3A1WA 1CUIA 2HHCA 3JQ8A 1P4RA 3TKAA 1X8XA 1MB3A 2JA5A 3CO0S 3RYCA 5C4IA 1GSOA 1KI3A 1LLFA 2A9VA 4V3CA 3KT3A 2LDXA 2RDJA 1WNTA 1KDVA 2DEUA 1AN0A 2CHVA 3HDHA 3UJ8A 1P77A 1A8IA 2C95A 3ZK8A 1JR3D 2OC9A 1ZOIA 3ZEIA 4EVSA 3EDMA 4AU1A 2VUSA 3DYVA 4OYRA 3N2EA 5M5BA 3UT6A 4P7KA 2DQKA 1VI6A 1WCIB 2B7BA 4MRMB 4ND3A 3RK1A 1ZICA 1ZD4A 1ECLA 3IQDB 1CF2O 1SC9A 2ZYTX 2P9EA 5BWUA 2ZVQX 4YRCA 3KS9A 3AW8A 4P4SA 3QMVA 2CT8A 4KQKA 3B60A 3IEUA 4PTLA 4U2EA 3OI7A 2R00A 2RHLA 3DMHA 3KVVA 1TZJA 4ZVRA 5IEBA 1U3UA 4AYBE 4O3SA 3ABSB 4M1MA 3V8PA 1ZESA 3ZCSA 3H2JA 4EFMA 3HB1A 3K31A 1KEEB 1ZPDA 4HJRA 2I6UA 4PXSA 2BTQA 2R84A 3R7NA 4BO2A 1RPJA 2KQUA 5EZYA 4DAOA 3UN1A 2CJFA 2K2WA 4TYNA 4LY6A 3V8QA 1NZDA 3KWLA 2ZP1A 3IQGX 4WTOA 1GZ7A 3WBJA 3UH1A 2AOUA 2YY5A 2ZE6A 1LNQA 3M9WA 3HEBA 1OBFO 4DCSA 3RUPA 2H06A 2RHTA 3C5VA 2OCDA 2WM2A 2BLLA 5JMOA 2A0FA 4C78A 3FDXA 1ZM4A 3OFSA 4ARIA 5FBLB 2H9AA 5FCDA 3HB9A 2D00A 3PXBA 4AKSA 4C3UA 2NVXA 5EESA 4DR6B 3L0ZA 3IPYA 4EKNB 1PR9A 4QGSA 4Q12A 2VATA 5EERA 3UJBA 3O7MA 4FFMA 5FFNA 5FL3A 4A2WA 1VLMA 1PRYA 1N6KA 2GPJA 4IDAA 1TKRA 3MWGA 4RYLA 4N48A 2R7KA 5HF6A 2C5LA 4XH9B 3HN7A 2AK2A 2VNHA 1NVVQ 2H1FA 4QVIA 1EFRA 4YP0A 3WGQA 3H0EA 2P69A 5KTOA 2QI9C 3UW3A 3T7JA 2D8AA 4I1UA 2Q5JA 3WYEA 3F47A 2O7QA 3I1FA 5DBHX 3O8NA 1G0NA 3QG5A 3H8JA 1JXMA 2BTOA 1EXVA 1JDPA 4KDCA 3ORYA 4F3KA 4KZKA 3SHVA 4AYTA 3ZBQA 5IZ4A 3LCUA 4XFJA 4GF5A 1IVNA 4O4LB 1U7DA 1Z6GA 2X5OA 1FX0A 2Q3BA 3NM6B 2IYEA 4NABA 1NVDA 4G1UC 1RWXA 1NQWA 4WKBA 4RLSA 1SH7A 4WNAB 3L8GA 4PU0A 1BMQA 2IP4A 4JJZA 1MCZA 1KK2A 3WIUA 2COIA 1I5EA 3VKFA 1D9ZA 5DPMA 1WV1A 4YCJA 2C4KA 4M7WA 2GQSA 2RC6A 4BYGA 3EGDB 2Q1SA 3TLYA 2A0XA 2H8GA 3A6ZA 2BHRA 3TB4A 5A2QW 2GB4A 3EH1A 1JHYA 3OZSA 3TWOA 1IWOA 3U31A 2ZQYA 3RARA 2YBEA 4F2DA 2GR9A 5DJ5A 1IY9A 1OYVA 1U0HC 5KQMA 5J2TB 4R05A 1U2SA 2V7VA 3GL9A 5EI5A 4B74A 5F1YA 4EMTA 1G38A 1NWHA 2I4OA 1WJGA 4IHJF 2YV3A 1PT6A 1EPUA 3OKPA 2WP0A 5LOVF 2QTLA 3EOAI 5JT1A 2PMZA 1WXGA 3DCIA 5F35A 1KVTA 4ECEA 4QNRA 1KZGB 3ED1A 4KE6A 4PSAA 3I92A 3VR0A 1P9WA 3IJEB 1Q1EA 4FS3A 3TNYA 4D8WA 3ZZUA 4FMCF 4KHZA 3DDUA 4BECA 4X7RA 3U0GA 2ZTSA 2LGJA 4WCFC 1E6KA 1YBAA 5E1OA 3S5UA 1ULTA 1D2RA 2QQ0A 1USUA 2FSGA 5LDHA 3G7NA 3LSTA 2CLIB 4QWWA 5IZCC 2HBYA 3LVBA 1K7XB 1XQVA 4JBIA 5EXXA 1CDZA 3AFOA 2WIDA 4L16A 4F4WA 1U6JA 3C1OA 3ROXA 4WLUA 4W5TA 3NCTA 3GEMA 1CZRA 1OWMA 2OBXA 4NZ9A 2YVLA 2RC5A 2AJTA 1WVGA 2MSCB 3FTEA 3A05A 1PTKA 3F6EX 3ZLUA 3KLNA 2YMQA 1NM5A 3H2ZA 2BFOA 3FNHA 3FNQA 4OK5A 3R8CA 3A4YA 1Y3DE 5IP7G 4D3DA 3MCUA 2HPVA 1L4HA 5JFOA 2B83A 3T7KA 2PCLA 3FPGA 2A3NA 3A1TA 4JJFA 1CZNA 3EAGA 3SYRA 4E5YA 3OPVA 4OPMA 3LO8A 1ZONA 1JLSA 5BWVA 1W0KD 5LLSA 2Z56A 4HT3B 1EVLA 1TUBA 3I37X 3P9QA 1C8VB 1M7JA 5LDDC 2R6HA 4WADA 2DIKA 4OKSA 3A1UA 1XAGA 2C7OA 1XXHA 2P9YA 4GGOA 3O83A 2JBAA 4BN4A 5FOSA 3IMKA 3Q3HA 3UWOA 4D0LB 1QR2A 1BROA 3WNZA 4QDXA 3DP9A 2F62A 2J5BA 1PHPA 2FW9A 4MWTA 2BI8A 3ZU3A 3B38A 2EP7A 3RGGA 4XE5A 1Z63A 3PXGA 3JAWA 2ZI3A 3KG2A 5LZ9A 3DHYA 3R9RA 5FBZA 2R1TA 1T6ZA 2R6JA 3WJ7A 1BHO1 1RVV1 3E1SA 1LU9A 3TLGB 4IRCA 4Y1RB 4XLZA 1DC6A 2QSYA 3D4BA 5E6RB 3VPAA 2SECE 4MQFA 2VPPA 4U2BA 4BLUA 3IHTA 3A9UA 3ROEA 1J8DA 5CDGA 1QYDA 1Y9AA 2FK3A 3KQNA 4L4YA 2YH2A 4LXQA 4DJTA 1CUZA 1F2DA 4FN5A 4MQLA 2F4NA 3RUDA 3Q7QA 1OXKB 1USKA 2H54A 5A4KA 3G9UA 2FK7A 2BJVA 3BS4A 4M53A 2KW5A 4EPYA 1NXOA 1U4NA 5FLXW 1U1FA 2HMSA 3Q7EA 4C88A 1L6IA 1YL7A 3HI4A 4EX7A 4W8HA 4DV5B 2BAGA 1PS8A 3AF6A 4ALMA 1BEEA 1B6TA 1UWKA 2NYUA 1QX4A 1ZVKA 4DDKA 1H22A 4ZJUA 3L49A 1V39A 1HE4A 3VKVA 5L7TA 2CV1A 2GZ1A 4Q7JB 3OQIA 3L3BA 2HHHH 2YIVX 2JGLA 4G5XA 2YWRA 4A2AA 5FA5A 3EFOA 4M0CA 3C6ZA 2O4UX 3G2QA 4WN9A 1UKZA 1UMBB 4CF6A 1LB1B 2I3AA 3KR1A 4YP6A 4ZFNA 1I9GA 2JLXA 2HZ7A 4DDMA 3I4CA 2GEDA 4JT9A 2EFHB 4MQBA 3CX8A 1YQDA 3GH1A 4KE9A 2Y27A 1N6RA 3VV3A 4FDMA 1QGUA 3E9MA 3UWKA 3EA4A 4HKTA 1AZSC 1S3SA 2Q8PA 2Z3VA 3OF2A 1G20B 1J4AA 2UVPB 4P2GA 3GFBA 4QTZA 1V9SA 1KE2A 4YLYA 2BGIA 1DFHA 4M49A 4HDRA 5JNLA 1AKMA 1XZJA 1DJQA 2AE2A 4TN5A 1P2BA 4RPKA 4PFSA 3KM0A 1QGED 4FDUA 3F3KA 1BYUA 5ALDA 3LCCA 2QL7A 3GZNA 5JVDB 2FKLA 1FIUA 1SHKA 5TV2A 4TL8A 1Z4QA 4DV6B 1KZHA 3VNQA 3PEVA 4CM8A 4FGLA 4LWOA 3SQOA 3DE4X 5GM2A 1TYDE 3SSAA 2CMFA 5L8VA 2DY1A 3U7EB 4ZVKA 1UDXA 3LBYA 5TS2A 4BO8A 2YHUA 2XCTB 5A62A 4Q8FA 2VJOA 3DWIA 1YDMA 3IV7A 2PTHA 2RGDA 4YRSA 1DT5A 5JVLA 1A82A 4J7XA 3TZLA 3NDJA 4H6VA 3HLTA 3IP3A 1OUMA 4LSWA 3F9CA 2X9NA 1K88A 4TGLA 4RKQA 4DSZA 3VBCA 3B7WA 1Q0UA 2MHCA 4E2FA 4PTYA 2ASEA 1HNXB 2JLBA 2PKQO 2VBGA 1X87A 4GPIB 1GU1A 3PRHA 3W4JA 5CCBA 1MXFA 5FL7A 1X13A 1L7NA 4OL0A 1N5KA 1XK7A 4QG3A 1Q57A 3TY5A 4UU0A 3IQXA 4HDKB 3GVXA 1NVFA 1XMPA 1ONSA 3JY6A 4DLTA 3FCOA 3DM9B 4XWTA 2QK4A 1VCHA 5AVKA 3BDIA 3Q11A 1PG2A 3JQAA 4FVTA 1SA0B 2VR1A 5C4XG 1DWOA 1P0QA 3KAJA 4O3QA 1UH5A 4PHHA 4NC9A 1LQUA 2Z04A 2Y0CA 5KTPA 2KBFA 1UKVY 2AG1A 4QW8A 3ROZA 2FDRA 3AY3A 2B20A 3RGZA 2QD1A 3RYHB 1BS9A 1S89A 2BKXA 3RI3A 5CFZA 3H8VA 2BBOA 1RXCA 3HVUA 3OH8A 1OJLA 5HILA 5EYPB 3LCVB 2QP9X 4YECA 1FZQA 1HFKA 2AFHB 2CCJA 4MUYA 4H08A 3GU3A 1C8BA 3L1HA 2EXXA 3AR2A 3OX3A 3K73O 1JT2A 1U0RA 4UBNA 4LFAB 2GRAA 1I1OA 4R71A 3LBNA 1E62A 4NPHA 4ICIA 3Q15C 2RBKA 1WMSA 2HCRA 4FE3A 1ZHHA 1J00A 2GJKA 3FB1A 2CNKA 3DOOA 3CLUC 2FPWA 3GROA 1DO8A 4JJAA 1HSZA 3WK8A 2NVBA 3NEPX 1KVSA 1TQDA 2CNWA 2OMKA 4BFZA 1RXIA 2QBYA 3R3WA 3NONA 4AJKA 2AC4A 3HMKA 1DC7A 1OTHA 1WXEA 2VTBB 4IJMA 5A4AA 3G88A 2QYZA 3TOCA 5EEHA 2GDJA 3TKLA 3H83A 4EFDA 5AOBA 5CEFA 3L40A 3ZCVA 3FDFA 3NQ41 5FOTA 3IPRA 3CLVA 3DE1X 3N28A 3UV7A 3GJ0A 3JALA 1DKMA 1Z08A 2GGSA 1QOQB 5C3EG 4H1VA 3U4QA 2WAMA 4OTZA 3OFJA 3HT5A 2B35A 3OT1A 3IVCA 4PZ8A 4BBAA 1T6BY 4XX1A 4ZJZA 1CJKC 1TTPB 4P5PA 2P5UA 2GYUA 3AFGA 5A4FS 3S2IA 1K5DA 3O2NA 4P7GA 3CVVA 3AZOA 1SRRA 1MOPA 2PX0A 1Z29A 2QPTA 1EEHA 3V1LA 1C30A 3PTZA 3ETCA 2XB2A 1UC4B 1YJXA 1MXHA 3PPIA 3HHEA 5IWCA 2X13A 4M1QA 1ZVJA 2RHRA 4W7IA 2JJ8A 3OETA 1L5GB 2E4XA 4MKIA 4WK2B 1Y14B 2GN2A 1JW9B 4EKDA 4L08A 1WR8A 4L9SA 1JQEA 1YDEA 2CXOA 4MS3A 1R8SA 3R8FA 1G19A 2QJTA 3V8RA 3ZK9A 2ZCVA 3L2OB 2PUWA 1W59A 1WNFA 4J4HA 3BIJA 4HL6A 1NV8A 5IJ0B 5DHFA 4CQMD 2PKEA 1Q7EA 2FN9A 3GV5B 2ZUCA 1YVEI 4LQDA 2Q2OA 2E82A 5EMLA 3BPSA 5JAQA 3FFTA 4A8PA 1WXQA 2PKRA 5ES3A 2DMRA 4WZZA 4H3SA 3DE7X 4RNOA 3G7UA 1ZISA 3AIIA 5DNEA 3M4IA 2RAFA 2J0UA 4QJ4A 2O8VA 2YV2A 1E3MA 5FUWA 1U8FO 3PQFA 3TG8A 5LIRA 3BFXA 4R98A 4LJRA 1RWQA 1N3BA 3MRVA 4HLDA 1FP4B 4XD2A 3TJZA 2BGUA 1O03A 3PZRA 3NS7A 1EIZA 3B5JA 4IO0A 1NXWA 4HO1X 2HUNA 3TKYA 4J0KA 4RA9A 1ADJA 5HBRA 4R2XA 4DBLE 4RO0A 2O2DA 4XTRA 4FFPA 3VNVA 4RZSA 4R0MA 1AY0A 3TEJA 3EIFA 1NG9A 2JFUA 1Z2CA 1QAQA 4PYOA 1KY5A 5KQLA 4RORA 5JAPA 4M86A 3RC7A 1Z6ZA 1KAEA 2V59A 3I62A 1IB6A 3BN3A 2Q6KA 3M2PA 5JCJA 2JARA 4Q44A 1GA1A 3W5HA 2GWRA 2Z9DA 2MOKA 4CHTA 1RJWA 5CURA 3C5HA 4E2ZA 4JLMA 5AJVB 3QNUA 4EKEA 5KYUB 1XYYA 3RK4A 2GM3A 2FFRA 3VOAA 3BFKA 5AW6A 2QUKA 3Q3IA 3GT3A 1H4VB 1MORA 2B63A 4GLLA 1HQDA 1VMEA 3WLRA 1A7UA 1KAQA 1WXIA 3HACA 1FS4A 3AK4A 4TVSA 1NUHA 1BHQ1 5ICFA 3PWKA 2II6A 1TXGA 3BXXA 4QREA 2DFTA 4YJHB 4C0AC 4EYOA 3K70C 2JIMA 1L7QA 1Q12A 1PJ3A 1M9NA 1MH9A 1ZMBA 4HNGA 1NHWA 3O8QA 1WZCA 1H2EA 3U0VA 4WDQA 2JHPA 2V7WA 2V4UA 3GHHA 2P0YA 2IF0A 3GUYA 3C14C 2IYRA 1WY7A 3FMPB 4QJIA 5D84A 1P2VA 3QA3E 2AK3A 3ZJ4A 2Y2VA 4LTMA 4MWDA 1Y3IA 2C9CA 1F7VA 4D5EA 3L4BA 3PHIA 2XTJA 2OFOA 4HFRA 4O08A 1ZOOA 2TS1A 1OQAA 2A1TR 3Q3CA 2NVUA 3SD7A 1FXSA 3E3AA 4UNRA 3MJEA 5G0SA 2YHAA 4XYBA 3NH9A 4OQNA 1SIWA 3GIWA 1W34A 1YMVA 1N0IA 2OUKA 4LMYA 1E94E 2GFQA 1G1AA 1UDAA 1SCDA 1P1BA 2OFXA 2J6IA 3BHIA 2PX5A 3EH2A 3THYA 1TJPB 4E4TA 3WKEA 5JS2A 4CKCA 2Q3DA 1SBTA 1K8YB 2QTNA 2BGJA 1TCAA 3I8SA 5LKRA 2VYCA 2J3JA 3DOCA 4DJEC 1KNQA 1V3QE 1VHLA 1PJRA 1IB0A 3EXG1 1TJNA 4LFCH 3EDQA 4WBSA 2XD9A 1S3GA 2YV5A 1QHEA 1LRJA 5HWSA 1JLHA 4FUTA 2XE7A 2QMUA 2ZI7A 3KP1A 3D6JA 2ZPAA 3QKSB 2Q9CA 3JQGA 4RM2A 1YZYA 5JJ5A 1YZGA 3EFBA 4B4KA 1KEZA 3B2NA 3EFEA 4D9FA 3IIMA 5ER6A 2AFRA 4MYDA 3OEED 2A7XA 1U3WA 4XWAA 1ZGJA 1WP4A 4B7XA 2J0VA 1W4LA 3PGLA 1NP3A 3L7CA 2CY0A 3PUVA 5I7FA 4R8SA 4G26A 3V97A 1Z0FA 4LZJA 2F8SA 3HDJA 3BQ2A 1S9HA 1BMTA 1XEXB 2YQ5A 5JFTA 1DXHA 1BDIA 4H4DA 3P0IA 4W63A 5HJ2A 2C88A 4RTPA 1X9IA 2PGXA 2WY2D 1IUPA 4D96A 4MOWA 3CUTA 5AW7A 2NUAA 1Q2UA 4BMYA 4KYUA 3UXMA 4C0JA 2Q6TA 3UT0A 2PZLA 1DINA 2LE0A 3AQ4A 3BA6A 2QVCA 1E3SA 1EGVB 2JFQA 3DFFA 4RMJA 2M6RA 3UC9A 4L5CA 1QPGA 2JGIA 4BKUA 4YJFA 2HQOA 1Z15A 4JI0B 3RFCA 1CC1S 4MRAA 1H8HA 1DCFA 2Z4SA 4FFRA 1XF1A 1EM6A 2ZG6A 1BKDR 1HC7A 3IUNA 1FFDA 4R2KA 3GBSA 1R16A 2H08A 3H5OA 1YQ9A 3EIQA 5GZ6A 3AILA 2Y3IA 4FDLA 1G4AE 2G1KA 3DLTA 1M8KA 1XZ8A 3B3QA 1VL2A 1E2HA 4DCJA 2H1OA 4G0OA 2HK9A 1LSUA 3NUAA 5I5EA 4LF5B 2HPAA 3AR7A 4W9RA 1N7JA 4BE7B 1DBIA 2WB1E 3FNGA 4WLNA 1KGDA 1SUEA 1JNXX 4U02A 3MRXA 5KEIA 4UZEA 1V8FA 3QBTA 4EB6A 1CVRA 1HYHA 2Z4RA 1UBJS 2CC2A 4QLAA 1BWSA 4EUEA 3HVJA 4EFNA 3N6VA 4PF1A 2BUCA 3AW9A 2YCBA 2YFKA 1ZFNA 3OEHA 5BNFA 2DLNA 4PR3A 4P84A 2BISA 1QCDA 1EK5A 4BJHB 4CLXA 2AMJA 1WHTB 4Q01A 3UENA 4UHHA 4EZEA 1D2NA 2ZLBA 4C6TA 1L4YA 1U1GA 4MCAA 5DI3A 2JLWA 4HQOA 4L8WB 2JLYA 2X1LA 1NJSA 3AESB 4I55B 1TDJA 1MU0A 2QP3A 3MTAA 2BUBA 4I1VA 1ZI8A 3E6AA 4DR3H 1O4VA 1KAGA 5DW3A 4UKDA 5P21A 1XDWA 1EZZA 4TQAA 4DJAA 4O4LF 5LYJB 1F4LA 3OCCA 2XDYA 3RBVA 1INLA 3UGTA 4Q9IA 1J2EA 3BE4A 1RYMA 2ODWA 1UQTA 1XZKA 3T06B 5FULA 3QKIA 3D4OA 1OXVA 1TO2E 4EGAA 1SOUA 1O94D 4PC6A 1EM8B 2QX4A 4TL6A 2JVJA 4O6VA 3CPSA 1HR0H 2VF7A 3CGWA 4NNOA 2XUJA 3GK3A 5J2TF 4IIDA 3V2GA 4QXAA 5FI1B 3T9BA 2YU9A 4UTPA 1R5NA 3IEPA 1KI2A 4J76A 4KBGA 4F6RB 2VYND 3ULKA 1XQ9A 3IN5A 3C3YA 2H63A 5JEEA 4ES6A 4J3NA 4WJLA 4KYIB 4I19A 4P82A 4B2IA 1I24A 4QOEA 4S12A 5I4CA 3VZQA 2AXNA 4R0VA 5LWHA 3T1OA 5BSMA 1BCSB 4Y9RA 1P2DA 1NLMA 4DY6A 1PW5A 2FZ4A 1JH9A 1VG8A 4FYIA 2PCJA 1YJ5A 4JHXA 5DT9A 2WB4A 2XT0A 2DFNA 3HADA 1F3LA 1LFAA 3CEAA 1F2TB 3NHFA 3DNFA 4R2JA 3N8IA 3QFCA 5IC5A 2QW1A 2WRZA 3F5DA 1NQTA 4RSHA 2H2IA 1A4IA 2KYRA 3RSOA 2I34A 1KC7A 3N3BC 1G21B 2ZIAA 5T6BA 4O7YA 2XWBF 5K0FA 2XWSA 4BFSA 3FTPA 5AW1A 4YRGA 4JFAA 1I2CA 1NY6A 4QFBA 1Z0UA 3CZAA 1QG4A 4MA0A 4PLTA 621PA 5GAJA 3NKFA 2D4HA 3GILA 4DL2A 2X41A 4N0EA 2HRCA 4L4XA 2YNMA 3KYCB 3KKKA 4F2HA 4AW9A 5CNIA 3KYHC 1H2RS 5ADVA 4PWYA 1M1YA 3IB3A 4CMIB 2BCJQ 4ZPJA 1R5BA 3RYIB 4QWBA 3SC3A 2PWYA 2BELA 4L57A 2HMYB 3BM5A 4HJXA 5HBGA 5A4DA 5KNDH 2YVUA 1KDOA 4ZRMA 3NMUF 3QELA 3JQFC 1P2SA 1MIOA 2VDNB 3ME5A 1XHFA 1M1XB 4RIFA 2V9WA 1V9CA 1EHIA 5HIIA 4CR8A 1M72A 1CDDA 2NU6B 3BICA 1O87A 1AS0A 1X6VA 4D8UA 1W8DA 4LV8B 3KT8A 1X1SA 1P7WA 2OAEA 4ZVLA 1VXRA 4Y2HA 1L9XA 2WSSA 1OHHA 2O0LA 4QU5A 1XCOA 3BIXA 2YWDA 2W4IA 2WAXA 3BK7A 4UD2A 3LUKA 3FWZA 1IY1A 3E05A 4L28A 4REQB 4DCCA 1NNEA 4YAJA 4G0PA 4I4TA 5JWOA 2ZAOA 3UJ6A 3D31A 3OBBA 2P2CA 3DOIA 2EGGA 1BOFA 2Q0SA 4RNCA 4ZOEA 1U3FA 4LGYA 2GCPA 2PJZA 2YXBA 4G25A 4Q3OA 2FEWB 3ED5A 4DPLA 3GQCA 2FMXA 2PRKA 1XLUA 5ED4A 3MWKA 4FQ8A 1VG0B 1SCIA 2MINA 1THGA 3EIEA 4MGEA 1BVRA 1VGVA 4G3IA 2RHWA 2JLCA 3WFZA 4NOLA 4UFNA 2NQ2C 1Z4IA 3OX1A 3KUXA 2O0HA 4EG1A 2X2PA 4P4GA 1EDDA 3IMGA 2QM7A 2DETA 3TSCA 1LJUA 2ACVA 2IE8A 5KTSA 3KLPX 4DA9A 2HK8A 1MDBA 2BP7B 5H3LA 4EEQA 1QE3A 4UHFA 5A7GA 4KR7A 1NLZA 1Y4ZA 4EPWA 5K6AA 3G8CA 1PS0A 3QE0A 1S3FA 3FOZA 3GD5A 5EXTA 3NU1A 5CBPB 4XIGS 4QPPA 3ICOA 1G6Q1 4R1TA 3N6XA 5B2ZA 3V9AA 4IUBS 2WAQE 3MD0A 3HKCA 1QHXA 1RQRA 1LD3A 3JZ6A 4ZANA 3CBQA 1N1DA 3V4ZA 5KQPA 4KDEA 2UUCB 2QTVB 2WJPA 3VDQA 2KPOA 4GWKA 4MUGA 4KXWA 2GJSA 3C6YA 4KR2A 5FEMA 1PLLA 1O97C 2E2IA 1UWCA 3K7EA 3OIGA 1HG0A 4RQTA 4WDRA 3O1IC 3FYHA 4I3GA 3PRYA 4MQ5A 1VLJA 3Q8SB 1KE1A 2TMDA 3B3AA 1QG6A 1NJ6A 5JVDF 3RUIA 1LLDA 1NHGA 4PZPA 2JA6A 3VNNA 5T5QA 3MAGA 5IVPA 3DOEA 2CDAA 2NU8B 2P8JA 4P4LA 1F1JA 1I6LA 1NQOA 4EY3A 2P9GA 4C4ZA 3FSGD 2BSXA 1X3SA 1ZHSA 3KTDA 3VZPA 3DE2X 4I8XA 1M1ZA 2F6RA 1UOQA 3W9YA 4A8JC 1ZINA 3TSOA 4S05A 1AMUA 3WBKA 3CNQS 5BVGB 3IKLA 2DC1A 5HE9A 5DEOA 1P5FA 1NUPA 1PLJA 1YTUA 4S1OA 4QSHA 3ZCUA 4B9AA 3HN2A 4XYMA 3PWZA 2BMJA 4L9AA 4DKXA 5B57C 3WGTA 3E7WA 1LK7A 1Z39A 1C7EA 2ZDGA 221PA 3DTTA 4ZIRA 1HY3A 3WYGA 3W5UA 2RHJA 5ALIA 3JVIA 1RSZA 1DWUA 2WYHA 2GJAA 1O6FA 4Z0TA 5JLJA 2R8EA 1TVCA 1U8UA 4CL0A 1UPAA 1QVWA 4F0JA 2I3DA 3OZRA 1R0LA 2DF8A 2VP5A 3RRBA 1MAAA 1KQGA 3ZWPA 4K28A 3T1HH 5C5IA 1J8QA 1T3HA 3JV7A 3Q4GA 4H1TA 1H9CA 1AB6A 2W6OA 3GCXA 3HR7A 4EFBA 3O4JA 3DDNA 2FZ5A 3GTQA 2MR6A 1YJBA 1VHTA 4BB5A 3BH0A 4IIEA 1ZNYA 1U2DA 5AJYA 1Z25A 5JDIA 4UUNA 2XSZA 4NV0A 1ZH8A 1LRLA 5FBKA 6YASA 3OM9A 2YWHA 3H0GA 3LS2A 3UVEA 4PW0A 3CS3A 2NZVG 3WB2A 3EA5A 8AT1A 2ZUWA 3FPCA 3BMNB 5FOUA 2YRXA 2VSNA 3BL5A 1TM2A 4CUKA 4AUKA 2Q2TA 2H4XA 1B14A 1PV4A 3INNA 1DQNA 3OAAD 2HF9A 4UOQA 2BGWA 4BX9A 1CT9A 5KNBD 2OGUA 3WDSA 1GTZA 2RSLA 3FYUC 2ZDQA 3VYRB 1TU4A 5BQ5A 3PNQA 3TLCA 1JR6A 3K1YA 4KSYA 1HTWA 3ZZNA 3C0FB 1PBTA 4I1PA 4IZHA 3EG9A 2PM8A 1XVUA 1OU4A 1CY2A 2A92A 1NW6A 1NX9A 3TGLA 3REQA 4B3TH 4B4UA 3DTFA 3WRVA 1MB0A 4GP6A 4ND8B 4AJ9A 4GZMA 5E6UB 1J0CA 3NIFB 1A9XA 3QLUA 4ZD6A 3OIVA 4B6EA 1JVNA 3UOAB 1OH6A 1VP3A 4JUDX 3KTMA 2I7CA 1MVNA 4DRXA 3UPTA 3GV7B 3MR5A 4OFBA 1T3SA 1YWGO 2CYBA 4DA7A 4YMSA 4AJ2A 5BSEA 1IE3A 3F6BX 1LC3A 4LZZA 4C3OB 3C8UA 3C70A 4PPNA 4OLBA 1S9FA 3U2QA 3O21A 4O3RA 3D6TB 3ZI7A 4BP3A 4QJFA 4Q02A 1R88A 3I45A 4ZU6X 2P4HX 1TYAE 5JPDA 3ELYA 4NQRA 1YR9A 3DVRX 5DG9A 2J5XA 4N18A 4F84A 4XCQA 1BOOA 4NATA 4NTZA 3L46A 1YZLA 3RVJA 3F9IA 1NQAO 1QGDA 1MUUA 1C4OA 4WXPA 3HL4A 3LP5A 4OEHA 4FS2A 2AEFA 2G80A 3MC1A 3Q1LA 4YRLA 4NP6A 4X65H 4ARSA 1YRLA 3MINA 4Z0PA 5KS8A 2O6LA 3CVOA 3BRQA 1SFRA 1TCUA 1OSNA 3CKYA 3HRIA 3OICA 3P94A 1WLSA 3RSQA 2QUZA 3CURA 4JUFA 2YW9A 3VO1A 1NBIA 1H1TA 3ZCTA 3RYTC 1EX6A 1RLOA 2EF0A 3HXPA 1KJJA 2IYFA 2VPZA 4B6OA 4RHTA 4NFYA 1M2JA 2ZT7A 4N54A 2WPDA 5TGZA 4KC0A 1C1DA 3T6KA 1SWVA 1QFYA 2FHPA 4LKRA 1W9MA 4JKYA 5CFRA 3FKIA 1SK8A 1OFUX 2COJA 2PX3A 1QNLA 3PYLA 1G5TA 1XJCA 4LXIA 1VB3A 4GUDA 3I30X 4XD7D 2D1FA 2HD4A 4MKXA 1BRMA 4GVXA 4UUBA 3NAGA 4OU5A 5KWVA 2IL1A 3AEKB 4MV4A 4AICA 1X7YA 2VAXA 1RLJA 3MHPA 5SZJA 5TEVA 4W1PA 5A1TA 3RJMA 3OFKA 3M49A 3CR3C 4J9KA 3GN2A 1JKJA 4RNNA 1O6ZA 1PNRA 1AHIA 1AG9A 4YI3A 2R62A 1KJ8A 1MAHA 3H9BA 5JZOA 2DY0A 4MUNA 3MR6A 3GB9A 4Q9HA 4B6QA 2ANBA 5B4UA 3B1JA 3H2KA 4JC5A 3K0FA 4TLBA 5F21A 1U9ZA 1MDFA 4UU7A 4JI2B 1SEVA 1N25A 3CZPA 1OV6A 1JNYA 3WIDA 1FMLA 3LZCA 3PUZA 1C1HA 4FFLA 2FMTA 4H7KA 4E5NA 1IAQA 1GCOA 2Z5FA 4FYVA 4YV1A 3AGPA 4GZ5A 1ADGA 1DIKA 2Y6VA 3UUFA 1QE0A 2HSZA 3OJFA 4L6AA 1ZA2A 2CFMA 1BXRB 2OO5A 3PGJA 5FAKA 4GKVA 4PVDA 1PAUA 2RMKA 4BKMA 3V32A 5JMTA 5FLMG 1HFEL 2AFIB 5IH7A 3KDPA 4ZYVA 2CLHB 3EE6A 4FBLA 1TWHA 4R7RA 4KRFA 2PRYA 2C5EA 3TFQA 4MDFA 1ECPA 5J4HA 1W36B 3PYMA 4Z0HO 1VYUA 3O1LA 2G0AA 4IY1A 4DKJA 1M54A 1IDN1 5CX1B 4LECA 1GA4A 1M34B 2YFQA 1J21A 4FZRA 3UW1A 4UDYX 1R10A 2PBZA 4RD1A 4RTJA 1QRDA 1ORDA 2C2KA 1ISHA 5ALHA 3A6GA 1FXWF 3T12A 1E7SA 5FWAA 3QSYA 2YJ6A 5E0OA 4IX9A 3N8GA 3TRJA 2W70A 3TLEA 2C8JA 4PIVA 4ZYXA 1PF7E 3HBAA 3W77A 4DYDA 3T7EA 4JI5B 4XR4A 1PR4A 3NEYA 4R01A 3TUJC 5K7SA 5KREA 3QUSA 1XR3A 4DV1B 1DAPA 1DCTA 3P2EA 2ZBQA 2J7KA 3EVEA 1E1MA 1K9SA 5C7IO 3NOQA 4F93B 3GLIB 4EMSA 2W2NA 5JBNA 3RIMA 4OM8A 1ZMXA 2P62A 2X58A 2EX1A 4MAMA 1UBRS 2I62A 3RSGA 4Q82A 4N6OA 1UWVA 4Y2YA 2ZSDA 4AQYB 4X44A 3PTAA 5JJCA 4DBLC 1XZLA 5U9CA 3DQZA 1JJAA 4HLQB 1FU4A 4O3FA 4CLOB 2HDOA 3N5CA 1Y89A 2NM0A 4URZR 1A7JA 1B0AA 5CITA 3U39A 4MV6A 3FYDA 4D9KA 3ZGOA 4J2HA 4KV9A 3LY7A 3K0KA 1SC3A 4DR1H 5FLXA 1XF9A 3GC6A 3LUGA 4JMPA 1T2NA 3KD3A 4EO4A 1E2QA 1NXQA 1QQTA 4A26A 4LG1A 1VSUA 1J09A 4A1OA 3EUFA 1XVAA 2VXYA 5C37A 2WFZA 2FX3A 3ZKAA 5JG7A 4BGVA 4P0TA 3QXGA 2FW8A 3Q0TA 5KHOC 4BGUA 3ZDYB 1P2TA 3TQIA 5FORA 3PPXA 1KJWA 4F97A 2RHHA 4C9BA 4W9NA 4EAAA 4OHXA 4TPKA 3PLRA 4Q7MB 3KQMA 1FYWA 4R51A 2XAAA 1JHDA 3GVIA 4P93A 3S3TA 3SZMA 4LJ4A 4N01A 3H4VA 2A9PA 2ETXA 5LQJA 3UMGA 4US1R 5L53A 3MR2A 2RK4A 2H1HA 3AV3A 1NN5A 1SUPA 4E0BA 1QKJA 1J2TA 4C1BA 1XKQA 3CN7A 4EVIA 3UMMA 1RRPA 3N2LA 4HXEB 2NACA 3E9EA 1ZDMA 1PZXA 4WOJA 3WADA 4L07A 4OFWA 1EK1A 1K3UB 4JV5B 3FKJA 3RS0A 3O94A 1NJ8A 1K3TA 1MX5A 1KO5A 3RV3A 5LJIA 3VR2D 2JEJA 3CZQA 2OHGA 2UZ3A 3SG0A 3IX7A 1OH8A 2W9BA 4DV0B 4LAFA 2G09A 3UPUA 3SQLA 2P40A 3K5HA 2P3QA 1SN7A 1H3NA 3PD1A 1MJFA 1EWQA 2QTFA 3ZUGA 1FRFS 1YNSA 3QHPA 2GXSA 5HKKD 4JBLA 2H07A 4E5SA 1ESMA 4TV9A 5DK4A 3HSYA 1A5TA 1CKOA 4MVJF 3WA7A 3GRUA 2E5LH 4MCHA 4PINA 1AS3A 3Q7IA 2GYVA 4JV1A 3QU5A 4FSHA 3GJ5A 4DR7H 4JLWA 1SO8A 1BEZA 1GQ2A 2P9ZA 2Y1DA 4Q45A 3R41A 3G9XA 3OQBA 3QPAA 2HGXA 2QV0A 4HNAB 2JNWA 4C89A 1FDOA 1K89A 2WTMA 4FFOA 1MRZA 5H16A 3SSNA 5I9IA 4WESB 2IA5A 3CRRA 4TSFD 1KY4A 5F3DA 1GGVA 3ZXYA 4I55F 1YONA 4GD3Q 4BJ1A 5AH0A 4J2OA 4R2WA 3DM5A 3GRKA 3F3SA 3TSZA 3CNHA 2VP0A 1ZJWA 5LYJF 2D2XA 1TA8A 4B43A 4U0KA 4DCOA 4L4SA 2F2TA 2YN2A 1P72A 5ALFA 3MTQA 3R74A 1YZHA 1IPEA 1N32B 2WW8A 3CUWA 2OOKA 3C85A 1J39A 3D5QA 1BYIA 1U3CA 3G8AA 5FEUA 1DAAA 2PGNA 1ORIA 4MA5A 1JMYA 1SY7A 3JQ8B 2HU8A 5GJWC 5J23A 4CQNA 3I0ZA 4MVYA 4AM8A 1TO6A 4CC6A 3H9JA 5DEIA 2IGBA 3W1GA 3OJOA 5L3QA 3Q7PA 4JEIA 2HF8A 3CVXA 2A9JA 3W2IA 4MR7A 1YJ8A 3AKEA 3ESYA 1BE1A 1S2OA 1HE1C 5L3VA 2CXQA 2ZRKA 1R37A 1YL6A 1V71A 4PZ7A 4WSOA 2VBIA 4RZ2A 1HDRA 4FTWA 3T3HA 4DMHA 3EQ7A 3V8EA 4IZOA 4FHCA 1I7QB 4IDGA 4JI6B 3M9NB 4BP1A 5KFSA 1GUDA 4UCRA 4LWZA 4RLHA 1W2GA 3GNLA 1YASA 4F4FA 1WF6A 3KBOA 4PCVA 1OIWA 3V80A 3BMOA 2HXYA 4RA6B 2E0IA 3P0JA 4P4SB 3WNQA 2YJ4A 1ODIA 5LU8A 3CHYA 3TRKA 4GW3A 3A2LA 1C8KA 4NVRA 5L1KA 1GSIA 3HFJA 4HXFB 3ZVNA 4QU8A 1AGYA 4BB0A 3ZQ4A 5KYXA 4EF4A 4NFSA 4TM7A 2H11A 5EFZA 4KACA 5FADA 1JLLA 4P4UA 3ZS9A 2CW5A 4DWVA 1J0XO 2P3SA 5I9SA 2R6AA 3ZHCA 3ZCQA 2VAPA 4GLWA 3IURA 1FTSA 4NYMR 3IDAA 3F3MA 4JT4A 5EZYB 5E2BA 4DGQA 1EX7A 3RHSA 3MIZA 3SNKA 5JH7A 1PK8A 1DBWA 3RAQA 5IAOA 5BORA 2WU1A 3HBJA 3UB3A 3CVJA 2GHIA 2O2JA 3UXYA 4H77A 4BO6A 1JXAA 1ISRA 2AOUB 4PO9A 3IEKA 4V0ME 3OJWA 1GTJ1 1TC2A 3VOTA 1AXEA 2FE4A 4HAYA 3GLGE 1XBTA 2OSBA 3HVHA 2J0EA 1H0SA 1NUQA 3F9RA 5BMVB 1NZFA 3JQEA 3GA0A 3OHBA 3UANA 3VZSA 1EVYA 3U9LA 2ORIA 1XE3A 2DOKA 2FE3A 4MVJM 2B1QA 4XQ0A 4J9QA 4G84A 4QAQA 4BNGA 1N36B 4B35A 1P6XA 4YQFA 3BCUA 3JQ7B 1PFGA 1LW6E 4LJ9A 2REQA 2WVJA 3D4IA 3D6AA 5DTQA 1LTQA 5L7WA 2VJMA 5F9MA 1Q44A 2ERYA 3UXHA 1FF9A 2VHEA 4AKEA 2FR8C 4KK3A 2XE6A 3AF4A 5P8WA 3E7FA 4CE6A 2V7QA 1SQFA 4BCDA 4II7A 3FOEC 3MUFA 1MKYA 2G88A 3O6VA 4P4NA 4ILKA 2Q49A 4RB2C 3NIBA 1VBNA 3TW0A 4D7AA 3ER8A 1D5CA 5LBIA 4RABA 5JJIA 1XROA 3IAEA 3IHWA 4V0RA 5CP8A 2GI4A 1Q6ZA 4EENA 1T8PA 4JP2A 3GEIA 2W90A 1J9ZA 3W7VA 4IMIB 2CXPA 4YUAA 3MWFA 2XTNA 3R6DA 4RUKA 2ASJA 1QWSA 1KMHA 2D54A 4LDRA 1Y1WG 1BWPA 3GNSA 3CU5A 4ENQA 3VAYA 1KMMA 2FRVA 4UD6A 1A97A 4EX6A 3B5EA 5L45A 4XGNA 1GRRA 3LUHA 2BFMA 1G2OA 4AUEA 4Q1CA 4NEGA 3ES9A 4W7HA 4O2BA 4V1CA 2QSJA 2Q0XA 1MIHA 3EAQA 2XYGA 2Z6AA 3D8NA 1KQ3A 3B3JA 4PDBA 3V42A 5JALA 5K3FA 4LJ7A 1A72A 2VVTA 5E2IA 3JZIA 4S1TA 4LOHA 1XZNA 4JENA 1IFXA 4OQMA 4DNQA 4W8GA 1W6UA 2DCUA 4YFYA 4ZVSA 1OFVA 1Q95A 5BVHA 1BVUA 4MP3A 2WF7A 3VU0A 3NYQA 2ZUFA 3DKIA 4NFLA 5F7JA 1RPNA 4ZMBA 1SC6A 1QVVA 4Y2XA 2HHLA 3FFBA 3U13A 5KUTA 2XBLA 2FRXA 2OORC 1V5IA 3FF4A 4RMHA 1SHUX 3SSMA 4UVEA 2Y4NA 5B7QA 2VKQA 5F98A 3ZE8A 4QUBA 5GIPE 4D4HA 2B1RA 2FEKA 1CJMA 1PGPA 1SBNE 2HFKA 3A58B 1MV8A 2DTDA 4N0PA 4K9PA 2EX4A 3DTVA 3OPYB 2FFBA 3ROPA 3IVRA 3WFJA 3HG7A 2BKUA 3NEAA 3Q3EA 4TLLB 2HUPA 1HV8A 2VLIA 2ZE8A 4QTYA 5ALUA 5JE8A 3R9IA 3VSDA 5DCWA 3PLAE 2KX7A 3HE3A 1M8JA 3DLHA 1JSCA 4ZZ2A 3B3GA 5TARA 1U8CB 1E99A 1BJRE 4Y9UA 5BOSA 1OFTA 1L7EA 1R8YA 4HXYA 3R77A 1DV2A 4EUFA 2PUCA 1QRSA 2PLWA 3GDHA 1PZNA 1T3NA 1EFDN 4HH4A 2AZTA 4AS1A 4HB3A 2IY9A 1TUBB 1YL5A 3VR4H 4P33A 4OGWA 3L79A 4RZIA 2VPSA 3KNZA 5EWMB 4X41A 4JNKA 2O20A 2PS0A 4GGPA 4EL0A 3IH5A 1Q0LA 1QV9A 2XUQA 4INAA 1XXHB 3O31A 2FN4A 4EK9A 5JASA 2JBAB 1ESNA 4LN1A 4XASA 5KTNA 4BVBA 2ZTLA 5A05A 4EHNA 1B8NA 1XZGA 3CZMA 4GBMA 4DW8A 4CMAA 1L8AA 5AW5A 4QOFA 2AGQA 6AT1A 4K6CA 3L06A 2GLUA 3JAWB 2RHOA 4QOJA 4GRDA 1OILA 1JHVA 1ZSNA 2RHMA 3G8YA 1H3EA 2R1TB 2UUOA 4LRWA 3SJZA 5EIWA 1ELOA 1G6OA 5DHPA 2ZVPX 4P5DA 3OESA 1RWPA 2QN6A 1AKUA 1YCGA 3A9RA 5EIOA 3GJSA 1ZXLA 1SC4A 4L5BA 3G6WA 3GZTB 1WB4A 4MQFB 1G4HA 4L4RA 3VR6A 2DH5A 3FIUA 1I3QA 2Q5FA 3CRQA 2QVLA 1J8MF 4HI0E 2NUTA 5C52B 1EKPA 2YTZA 4EY5A 4TT8A 2FSPA 4EZIA 3L7KA 3AR5A 1N2OA 3AZPA 1MFZA 2WNHA 3LQKA 3R3XA 3M4JA 1ULBA 4ENSA 5I8PA 1GT6A 7ABPA 1ZRHA 5ERYA 4LRUA 4XKJA 1EP1B 3USES 1CXZA 4DDTA 3O74A 1QYXA 4HH1A 2DR2A 4QU0A 5AW8A 4ZQGA 4G1FA 1OREA 4NULA 4N6GA 4HB2A 2I1LA 3OQIB 3RKUA 4J9VA 1P4AA 5DOVA 4A3DG 4H1HA 4BMDA 2NYAA 1Z26A 1NMQA 3M3DA 2OWEA 4OOFA 1NVXQ 4B87A 3H6GA 3HOWG 3DEZA 2XBUA 4JOSA 4FDTA 2JFZA 4D8TA 1N3LA 1FRNA 4GM0A 3UTDA 1ADCA 1IXSB 1U0NA 1XZBA 3OTOB 4EGQA 1EFVA 1N9KA 4L5IA 2X7HA 1K08A 2P4QA 2F67A 3KX2A 1JBKA 4LMPA 2HOQA 3I6BA 5LD2C 3IAS6 4XUDA 1Y1SA 4B09A 5KDOA 1QGUB 1U1CA 3BX1A 1UQUA 2Q1TA 1F7UA 2DPMA 2EZUA 4HXGA 3PDHA 3TY9A 2IYWA 2JW5A 4GPTA 2OB2A 1CX9B 3I9MA 2RJ3A 4E1VA 2GOYA 2KWIA 1SOVA 5CJ2A 4PLHA 1JEQA 4F6LA 4P5EA 1KIMA 4PX9A 5TGTA 1T9BA 1Z5VA 3TIGA 4NF2A 5KFAA 3KJEA 4G4JA 2WJGA 2FV8A 3O92A 1MOSA 4RNDB 2DPIA 3W8DA 5CLGA 2FSFA 1WQ3A 2FUCA 3BJIC 2GXAA 2Q46A 2JGNA 3BQ0A 5SZHB 1E9DA 2WAYA 5AJUA 2FY8A 3EVBA 2XDWA 4GECA 4UM7A 1JDNA 1MX1A 1JAHA 1IYDA 2VA8A 2X9VA 4LK3A 3FYTA 5LP6A 4DHEA 1VECA 2W11A 4MJLA 3HP7A 2J4FA 1L8LA 1Z47A 4KEAA 4AN4A 4JEMA 2BH2A 1VSBA 4YPOA 5KT2A 4U6QA 2HCTA 1FEZA 1K63A 4D82A 3K3PA 4LWPA 3K0CA 4XFDA 1BKSB 2WWHA 4Z1MA 4DB2A 3LLMA 4ZV7A 3OP1A 5HIMA 1GGEA 2XC9A 2FX2A 4KXMA 4UFPA 5KYYB 4ND6A 1HPLA 1KXZA 2CK3A 3WL3A 3ROMA 3FDSA 2IXGA 3T1YB 3VR5D 3N2ZB 4QPDA 4HD8A 1V8OA 3OTWA 2VPWA 5IF3A 4IUCS 3IXQA 5KCMA 3W7BA 2HU7A 5KZMB 1G3UA 4TZTA 3CWZA 2IKQA 1KPIA 1V3UA 2DWOA 5AI4A 5KCZA 4YP5A 1GP2A 5A3JA 3TCXB 1JIJA 2QP4A 4JQYA 1DBVO 1ONNA 5CFNA 5I3CA 4JMLA 2WAAA 3GARA 4K03A 2WWIA 3F49S 3UMFA 4DIUA 3FDJA 3SQDA 5AT1A 1IDOA 3NAQA 3WL6A 1X7ZA 1X1DA 4MP6A 3FD8A 1R0BA 1FUKA 1ZUHA 3UK1A 1CEEA 2JZOA 1P5JA 3LUBA 4RS3A 3E9DA 4GNRA 1G8GA 1WMAA 1DS6A 2PKQP 4GMHA 4Q3LA 2OHJA 3V46A 1XCPA 2R6ZA 4KO3S 3DQPA 1ZD1A 1UT6A 4E32A 5HRAA 4E1AA 4EO7A 2OH2A 5H5JA 3DWGA 2I3BA 3ROQA 1FMJA 2CCGA 4JX8A 4QC2A 4JVMA 2ATLA 3PU6A 1GLVA 4EW1A 3LH5A 4KN6A 4HQFA 3EZ9A 1NI5A 2BRUA 5HK9A 2D7JA 1R0YA 3HGTA 3W9BA 4PLGA 2IHUA 2YJ3A 2NAPA 2YXEA 5B1EA 4GX5A 1X39A 4X1KA 3NC0B 2JATA 2R6GA 5CB4B 4COKA 5ALJA 1XLWA 3WQRA 4INJA 1T9GS 5AO9A 4E6EA 4TRNA 4GYJA 4F4HA 1QH8B 2G1JA 4DHWA 2EBFX 4KJXA 3WLJA 1K3FA 5BN3A 5AUQA 2W7TA 2QIOA 3D54D 1NRIA 4RPLA 1T2CA 4ZEVA 4L72A 3ZWCA 4LH7A 2IA6A 2CF6A 5AHWA 1M2GA 2Q3LA 2QZ9A 1Z4KA 5IFLA 1GAJA 3CH6A 4BFVA 3ZGLA 4JB3A 2ZYDA 2A0UA 1H5NA 3Q1KA 1FCJA 1LBHA 2AFVA 3QITA 2JGAA 3OZWA 3FR7A 5I9LA 2BZ0A 4MJXA 1Q2XA 5TVKA 1WSAA 2G1AA 4MIYA 4M1TA 1PNTA 3IGFA 1M6NA 2Z0MA 3JALB 4EO9A 2RHGB 3HEMA 2G67A 1ESZA 1NR1A 3U4QB 4EMBA 2V55B 3GUZA 3B9RA 3OT1B 3DNMA 3WIVA 3BD6A 5FQNA 3KELA 3OPYI 4R9SA 3QPCA 5IFKA 3NIGB 2UXDH 3EARA 3RAXA 1GKLA 3VZCA 1YR1A 3EZGA 2C3UA 5FPTA 1UZLA 4G07A 4KBFA 1C30B 4OBWA 2B4TO 4MUXA 1WSBA 4GXRA 4ME6A 5TMPA 3O26A 7MHTA 2EJBA 2FPKA 1S4MA 3D6UA 4J9PA 1FDSA 3ROTA 1MEJA 3ZIDA 1AKVA 1B6SA 4EJ2A 4MS3B 1RZVA 3GR6A 4UHKA 4MKFA 4P3OA 5JS8A 5TPZA 1EQ2A 1CZHA 4MQ6A 3X2SA 1W93A 5C18A 5JXJA 1B6RA 4M89A 4OJTA 1G8MA 2IXBA 1SD5A 4UVIA 2W4MA 1Y81A 4F5DA 3DPSA 1N6IA 3HCRA 1FFXA 2ATEA 4LRSB 3BMXA 2HAEA 4IIJA 1CZOA 1ZN8A 3A6JA 2IUFA 1H8EA 3I52A 4QQKA 2BEWA 1VBFA 3M4XA 2J0UB 5FXMA 4XQEA 1GNSA 3W79A 2IYNA 2HDWA 2ZPUA 1A3CA 4LF9H 4JBWA 4JI4H 1UBUS 1YK0A 2A86A 4EY6A 1L8OA 3KOWA 2ZRDA 4RA9B 4BO3A 2IUYA 2WC1A 2BGLA 3SI8A 2WSBA 5DXAA 4PNHA 4RD6A 3OLVA 2ZIGA 5FI0B 3SE7A 1XC7A 5AUPB 3P7MA 1Z2PX 3ZWMA 3AHCA 4XGQA 4BN5A 3T7AA 3R5XA 4X6YA 4PG7A 3V3TA 3BORA 2C5SA 3EPHA 3GB8B 3TAXA 5FR1A 1Z37A 2R44A 4FEEA 4CU5A 5JDCA 4G56A 3EK2A 3COWA 1IHUA 3ZJUA 4DV3B 1S2DA 3PQ7A 1XPUA 2B61A 4BTEA 2H3HA 2WT8A 4EYHB 2PR2A 1RAFA 2GSDA 4E5VA 5DNYB 4JXZA 1C3OA 1Y1PA 1I2MA 3WLHA 1FYDA 1D1PA 1R6VA 1TK3A 4E31A 3O9ZA 2PL1A 4LDPA 1TJ5A 3AG5A 2XCLA 3HC7A 3NTRA 3OCVA 2W7OA 3EVTA 4DANA 2R65A 4DVJA 2QYHA 1XAJA 1GQFA 2YHIB 4D9BA 2ZUEA 4K86A 1WUHS 2A5FA 2J9XB 4YRNA 3O3NB 2J08A 1AX9A 3NHJA 4Q4LA 3IUEA 2FMKA 1E2NA 4IMRA 2VK8A 3C7CB 4FMBB 2Q1UA 2D1YA 3LOQA 4DLSA 4ZI7F 3WMEA 4OSOA 4M8IA 1O8CA 3DL4A 3EISA 1EB9A 3WIBA 4LVUA 5B4TA 3VJMA 1F1BA 1W4ZA 2JD2A 4PTZA 1SZJG 1ZZGA 1BH2A 4HDAA 1W7AA 3F5MA 3CEJA 4YNBA 3TNJA 3SXPA 1IJKA 2NNLD 3LG2A 4TL7A 3ZIAA 1JIKA 2WILA 3L1UA 4PSCA 2PGDA 3HKEB 2PUGA 4AYBA 1MO5A 1I9CA 1OFHA 5U1PA 4AS2A 2X8AA 4QBKA 3UWSA 3O8OA 4BIMA 1UZAA 2PS1A 3FI9A 1GVHA 4PN7A 3BQNB 2RH4A 1SVMA 2JFBA 1VRCA 4AURA 3I2JA 4II2A 4BV8A 4KH1A 1JG4A 1HFJA 3THYB 2OEPA 2GZSA 4P3KA 4I9UA 1I2AA 3GTMA 1RZ3A 4C05A 2QL5A 2RGCA 1UBNA 3QWFA 4GQIA 4BL5A 1X7XA 3CIFA 4DCPA 4LJLA 2D1TA 1TKCA 1WETA 1UFQA 1JFTA 2DGDA 4Z9AA 1BEUB 3W3AD 4XZ3A 2QJRA 1ORWA 1Z4JA 4YV2A 2ZWPA 4DILA 3TW8A 3QV1A 1SEIA 3UAYA 5I8ZA 2EX0A 5ICMA 2NUPB 2B8WA 4CDGA 3LHFA 3EVNA 2GARA 1WUJS 1J0EA 3SZOA 3WGIA 5IJWA 1NBMD 3G0CA 3JQGB 4HMQA 2VH1A 1KO4A 1U7ZA 1P62B 2Q4TA 2DR3A 3WDKA 3T5CA 5EWJB 1S2IA 4BO4A 1U90A 3QYJA 4MIKA 4R9VA 3AINA 4ND4A 3EWAA 5LVAA 3GRCA 1WEHA 4JIGA 2O03A 4Q0MA 4L51A 2NPIA 3GBVA 5KMGA 5KJFA 2W8KA 4MW9A 3TQHA 1AVTA 4C0WA 4CIXA 4DMGA 5E8JA 5JR3A 2R0QC 3J80W 2F7SA 1T2UA 1HUQA 4ZRDA 2AOXA 4ZAZA 4OQPA 2FPGA 3OE4A 1VJ0A 1FRZA 2XXAA 4MW0A 2Z5VA 4YP1A 4M9QA 3K6JA 5GVRA 3H8SA 4Q39A 2Y93A 2V9ZA 1RI1A 2Q2VA 4D92A 1ZBQA 1NXTA 4DABA 4ZP1A 1I7LA 4ITUA 4RDXA 4EGFA 3OQOA 1W46A 1YOVB 3AWDA 1HDEA 1J23A 1UBMS 4KVZA 1PJ4A 1AE1A 3BJYA 3D3WA 2JI9A 1D3AA 4FW9A 1ZAKA 2JDIA 2O2GA 2FPPA 4EABA 2GMWA 1H5UA 4MV0A 4MPPA 5ADWA 1K8RA 3MWMA 3HCDA 4DSAA 1Z0ZA 3HPRA 2RK6A 2RIPA 5AM1A 5EZYF 4MV9A 3L0BA 4FUQA 4UQLA 1COZA 3R7DA 4DGSA 5HX7A 3I09A 2QGFA 4ZPXA 1CVIA 3PN1A 1YBHA 4OBEA 4Y98A 1FVFA 1ECGA 1C1YA 3H7IA 3JD0A 1B8VA 4OKNA 3ZE6A 3UYLA 4EDFA 1X80A 3HTXA 4PZZA 4MVJI 5BMVF 3GJXC 3FPKA 2O2EA 5J47A 4G4IA 3M9MB 5C53B 1VPEA 4B85A 3SZGA 3EY4A 1F9AA 1RZUA 1XZCA 1VZ3A 3BAAA 4UC0A 4KQIA 4BZZA 4ZJPA 4Q1BA 1DGQA 2OT3B 4E1BA 2XEDA 3EMBA 2BE9A 5CXSA 4YXWA 2XYQA 3E9YA 4NS4A 1EKXA 2CHEA 3LT1A 4C6TB 3BMCA 4NV1A 1YJAA 2FZGA 3WLFA 1LPNA 3PKIA 5C4GB 1JR3E 2C57A 2WWFA 3BKXA 3U62A 1SVWA 1ZUIA 4HATA 3T1QA 4R9NA 1RI2A 5GJBA 4MW6A 4OMCA 2LUOA 2XQKA 3OA2A 1Y8CA 1KS9A 2ZXUA 2JF0A 3ZD9A 1DMSA 3WMRA 1XZQA 3EUWA 2IX3A 3FPHA 4HN9A 4CM6A 3TMAA 1A8HA 3GFPA 2DBQA 1OFIA 1R3DA 3ZTYA 1B15A 1EUYA 2YVQA 1GQSA 4PEVA 2Y1KA 2FKNA 1SVKA 4G1VA 2NGRA 3VKWA 2OZVA 4UASA 2ZU6A 3NHKA 1QAMA 2YWFA 1L3CA 3GUUA 5L3RA 4OU4A 5MF6A 3BACA 4JJGA 1SG6A 5BR8H 2D5CA 3UO8B 1JJFA 1DAOA 1OAOA 4GWLA 3CZCA 3LWDA 2AX4A 1RQLA 2Q21A 4PM4A 2O8CA 1X1AA 2C03A 1FYXA 3ADPA 4AP6A 3CE9A 1REQA 1XEWX 3O2JA 1NE2A 2HNAA 3VDRA 4K46A 4OAQA 4PBSA 1XNRB 3GTKA 2P5SA 1KMIY 4WBNA 3B1KA 1Y9JA 3ND8A 1OGYA 2Q9AA 3LQYA 5KX5A 2JG3A 3KETA 3HV0A 2ZT6A 1T3GA 3LLCA 1Z2AA 2PT5A 1KTIA 1PFWA 1ZCZA 4HVLA 4RDIA 2YJNA 5CT8A 5EUQB 3RF2A 2EFJA 3A9WA 3GNTA 1K2VN 4WJKB 1KYWA 1J1UA 4E15A 4A27A 5EP1A 5ETJA 2A57A 4JGIA 3REGA 2PZEA 4NCKA 2J31A 1GPUA 3KTOA 1QU3A 5CG1A 2JCGA 2YN4A 3KL4A 3F8NA 3LP8A 2QT0A 1NWCA 2Q4DA 2P11A 1E60A 4BFWA 3H11A 1T3LA 5LM3A 3QA9A 4TRJA 1NLFA 4XOIA 3T5JA 4B75A 5AIAA 1JHXA 3PC3A 3UJ3X 2GKSA 2J6HA 5CLHA 4TOIA 2HHAA 1B00A 3OOSA 1E4VA 5GONA 3ZOKA 2HV8A 2CVHA 4B2LA 1EG7A 2MYTA 3D4LA 3GOQA 1IUKA 4ECWA 3EF0A 3QXXA 4BWYA 1VZ2A 2PY6A 4KB5A 5A2QA 2G25A 4JLSA 5KYNA 2P0EA 3WL5A 1MVLA 2CV0A 1VFNA 1O9BA 3AYHB 2G7MC 4RAZA 2WLSA 1C3JA 4O33A 2I9PA 3UHFA 2BDUA 3SFZA 5IVKA 3JSAA 3QELB 3H5AA 2VG8A 1Y4AE 1RR6A 2O4CA 4C76A 1TAQA 3DF9A 1EVKA 4KAXA 1JKXA 1F48A 4H31A 2ZI6A 2D7DA 4NX2A 4HQKA 3HCWA 2FPSA 4NCBA 1G98A 1WXHA 3COSA 4RHCA 4RFSA 1UBSB 2ADOA 1N33B 4FFBA 1EIWA 1CR0A 2FSSA 2H7YA 3ESAA 4BUCA 2IOFK 4X85A 5EHQA 3NORA 3NDIA 2DT5A 1NF8A 4NBNA 4HRYA 4ZGWA 3TZ6A 3DV2A 3I2HA 4NE7A 3HDVA 3T35A 4ZOAA 3VR1A 3OX4A 2FSVC 4F60A 2V0GA 2X6RA 3EC1A 5ALNA 4ZTZB 4KGZA 4JC0A 3E8SA 3G13A 1XTRA 1CDEA 1I3CA 2PZMA 2PBLA 2JIZA 2MCFA 2NYVA 1IN6A 2C82A 5CM9C 3CF0A 3ESCA 5FA6A 1XP8A 1UL1X 3GLKA 1E6UA 4AZ0A 2FNAA 2MINB 2I2AA 1MABB 2L42A 1IY0A 1T5SA 3ET5A 2J59A 4CQLA 4YB8A 3RHTA 2EBWA 1DJNA 2AIRA 4IXNA 1U02A 3KZVA 4WFQA 3RB8A 4MV3A 4FNGA 1JQAA 4KOAA 3LCRA 4DV2H 2QU8A 5IP5A 5EUCA 1WUKS 3M83A 4YRKA 3RAFC 1ZETA 3IDZA 3E1GA 4JT8A 3KCNA 3TX2A 1O08A 3L7YA 2JGKA 3FROA 2QTGA 1J2RA 1TF5A 1N8NA 4RUCA 3H0CA 3IT0A 2G7ZA 1IN1A 1QQBA 3SDSA 3BJZA 1NC1A 1PJBA 1ND6A 4WVFA 3BTOA 4BNTA 4AROA 4CFZA 3DULA 2B1GA 1DCKA 1N7GA 4C7OA 4G86A 2BJWA 4XUGB 3WG9A 5AKIA 1JJVA 2GK3A 4L8VA 2ZRQA 1ENPA 4R16A 4GP7A 4Q4JB 3FHCB 4IH4A 3PFIA 2EZ8A 1EWKA 3JCZA 1E3TA 4J03A 3GJ7A 3UJHA 2B37A 5DGIA 3HU5A 5LMUB 4I3HA 1WL8A 2NZWA 4GZ3A 1EZ1A 5EQTA 1Z18A 3CRZA 2OO7A 3IMFA 1N6NA 4J9UE 3WY9A 1SBIA 3K0SA 2XVXA 3MFYA 1LZLA 2R2GA 3K9CA 4J9SA 2N1BA 2PHZA 4ED6A 1P1HA 3U09A 2J0SA 5ICGA 3E1KA 4ZYZA 2ZREA 1JL3A 1AXGA 2MYUA 3NHRA 4CIVA 4R6XA 2BE7A 4AZTA 1U7OA 4Q3KA 1TMYA 2EJCA 3BGDA 3BEDA 3QKWA 4INZA 4HEA6 5FNVA 3H86A 4TMVA 1KL7A 4LSZA 1HE8B 3DBLA 3WJ1A 5CH5A 1PDWA 3ANTA 4X66H 4R3UC 2H1VA 2C84A 4JA0A 2QM0A 1D1TA 2CMKA 5F73A 3WLAA 3UKDA 1H2AS 5H4HA 4IAJA 5A0VA 1YR8A 3KZCA 3A4IA 2X2FA 1E1RD 2ZYHA 1SU4A 3ZGVA 2ZJ1A 1SVUA 1HOXA 1IHXA 3FR8A 1P29A 5D8DA 1T13A 4XYMB 5KO2A 4NOMA 1NYLA 4A3CG 3AFMA 1TAHA 3KJHA 4HSGA 4AZWA 3TQQA 5K8LA 1IC6A 5J4LA 4U6NA 1CLUA 5FFMA 2LWIA 4NBTA 3ENZA 4N5DA 4PFQA 2FR0A 3C97A 3JWJA 4CKWB 5KBYA 3IVXA 1E1QD 3LCJA 4IDDA 4IKEA 2Z1DA 3PUHA 1A9YA 4GOLD 1HDXA 2XGGA 3KJZA 3R76A 2AW3A 5CRIA 1M6VA 1YZQA 3RTGA 2H0RA 3IVAA 4TMFA 4IDFA 1W5FA 4DDWA 1JKIA 5DBEX 3TTTA 2AX3A 3QIAA 5ALSA 1OZAA 1RRGA 5DK6A 3H1GA 4L5YA 2GLXA 4J1TC 1YZFA 2IC5A 2GFHA 1JPVA 3DXFA 3RTXA 2XJ4A 3VYUB 4QZVA 3HJBA 4B48A 4HYQA 1M0EA 5AVQA 5JRZA 4BATA 4DUZB 4I8DA 3DAAA 2J5QA 4BEVA 3DEJA 1QO0A 1M5UA 1DT3A 5FBHA 5KWEA 1Y63A 1U5BB 1KK1A 821PA 3Q8RB 4AXXA 5DF1A 5CT5A 3CXRA 3SLRA 1ZD9A 4RF3A 4ZVPA 5AM5A 3V1NA 1KFBB 1NXXA 5D2CA 2R11A 4NRDA 4LMAA 2WOJA 5CB4F 2P35A 3S70A 1M6HA 4C07A 5LQSA 3MSXA 4DIMA 1PV2A 2GAJA 5TPWB 1HRDA 4JNCA 3B51X 3E9RA 1QGYA 1YD7A 4DV4H 4BFXA 3EG9B 1RYBA 4MB0A 1JWLA 1CY1A 4ZI7B 2R25B 4KNVA 1C81A 4PS0A 3OCYA 5CD9A 3VVMA 2QTHA 1HA3A 4HX9A 2J9YB 2HLDD 2PEZA 4W99A 3HKBA 3O95A 2Q2QA 4PBRA 5BWRA 4BNDA 3RVDA 4MAFA 5K2MA 4MKHA 1T36B 3OY7A 2AZ4A 1J8VA 2FU5C 1GN8A 2D2IA 3URKA 3R0VA 1J5PA 1KZYC 3IERA 1GZSA 2OD2A 5K8UA 1JJBA 1FVXA 5DASA 4ZU3A 1RQXA 3NTXA 1XNQB 2B82A 2QSZA 2IBSA 2IZ1A 1C9EA 5FPOA 2Q2UA 3VJKA 3PPVA 2WJJA 4AJPA 3FVTA 4UU8A 1Z68A 4N39A 4CTJA 4WCFA 2JGDA 1Q50A 2JBWA 5SV2A 3ETEA 2D5LA 1R6AA 1YKSA 4XA8A 3IBFA 4NYIR 3U4IA 4LGVA 1PG0A 3AYZB 3HV2A 4EG4A 5JQWA 1O94C 1CS0A 4ECRA 4FWIB 3MJVA 3VX4A 5IZCA 4GBGA 5B55A 2VCYA 1V47A 1EXWA 4MB2A 4ZQCB 3RJZA 3RYCB 3HOZG 2H9YA 2JAOA 4AXBA 3R20A 4B3RH 1JGTA 3B9BA 4DCTA 5LBTA 1HXHA 4FI3C 3NYRA 1Z34A 2YJTD 5KC9A 3H8WA 5JXGA 5AWFC 3I23A 3S1AA 1V35A 2Y1OA 3EOZA 4FE4A 4N8DA 4OHFA 1VMDA 2HHFA 3OE7A 1D9XA 4FP9A 4X1YA 3W90A 3FWHA 2J3LA 3S8EA 5DO9A 1E18A 4OXXA 2IYTA 1LKZA 1IM5A 3OZTA 4ZGBA 2I4NA 4GKJH 2MSWA 4FZVA 2P2NA 3FHTA 3G2OA 4DEVA 3KXIA 4N5HX 2E6UX 5DLPA 3AFHA 4X62H 1TA4A 4BY7G 1Q11A 2QAGC 4C01A 2R66A 3PT9A 3FPBA 4ZREA 3ADCA 4JU9A 1UEJA 4FJ0A 3KXPA 5JCOC 4D56A 2OCYC 7REQA 3KTAA 4L0DA 4ZKDA 1EBFA 1AF4A 2AUMA 3GZJA 3KKNA 3T8YA 4GC6A 3FGZA 1IZ8A 3VQTA 1XMQH 3W5IA 3JRNA 2B92A 5CYGA 1WHSA 5ILOA 2OBLA 4XIIA 3IAS1 3QBEA 1D2AA 1VLHA 1GPH1 2BTQB 4ED2A 1YTLA 2RF4A 5I51A 1X7YB 3ER6A 2OWDA 1SKBA 2UZIR 1RYDA 4GLOA 1FU7A 1HETA 1YS4A 3D5EA 1FSGA 3U3OA 1FBNA 2ZU0C 4RETA 3AUAA 1UBLS 1NVBA 3ECSA 1U6IA 3LRPA 4WINA 3L9WA 5IKEA 2YMLA 4I46A 3PFGA 4A6EA 4GP9A 2EL9A 1K98A 3MUOA 2WDPA 4B47A 3K0FB 2EZ9A 3KB2A 3GYGA 4UVGA 4GKBA 3LJKA 5HM6A 4Y0VA 2GTPA 4QEZA 5DYIA 1KH2A 2C4NA 1N0UA 3SICE 4Y2PA 4MK4A 4OOEA 2DG2A 1NOJA 3UBMA 1KYTA 4YVFA 3UK6A 3ZWDA 3HKZE 4R54A 3V9PA 2GBPA 2ZCJA 1PL6A 2P1DA 3AH8A 1ODKA 3RRFA 2WTNA 4P98A 2EJWA 2IPNA 2R85A 1Q7TA 5D5PA 1BMFD 4RFLA 1YS9A 1PUIA 1Z45A 1XQXA 2QMQA 4MW4A 5HMMA 5DP2A 2G9QA 4RFVA 2IYXA 3TE7A 4Q5IA 2R8PA 3N2YA 4K5QA 4JT2A 2QZ4A 2WTUA 3HO6A 4FHZA 1FMTA 1NAIA 2YRFA 4QULA 3HP1A 1Y34E 2XYRA 3QPBA 2NVYA 1FX0B 2J7PD 1XDUA 3IELA 5JSZA 5IWAH 3ELBA 4RV9A 2PD4A 2F17A 2XDQA 3N2NA 2DWPA 1VMAA 3HXKA 1NZJA 4PCUA 4OYLA 4AL4A 3KQTA 5IC6A 4AY6A 1PR1A 2COUA 3ZI4A 1XI2A 3UAGA 1FQWA 1ZY2A 1JEDA 3NJ4A 3BA1A 4M6WA 4R8KA 1OH7A 1ZS9A 2GJ9A 4RGBA 2GN8A 1N78A 3QF4A 2VJYA 3LNTA 4DUPA 4MVJG 2XEXA 1GO2A 1KSJA 1DOHA 4COOA 4ML3A 1XT6A 2L18A 5JYEA 1Q91A 4RVFA 1NV9A 1U3GA 1XYVA 1N77A 2JA7A 3PSAA 1V6AA 2GERA 1APBA 3C3CA 3IAFA 5A6SA 1U63A 4HNRA 3OLQA 4F45A 4ECZA 4J07A 2LCIA 3CLSD 1BX0A 3NBKA 3IVMA 1KY2A 3R5TA 1ZM3A 3S99A 2X4IA 3IIEA 1YBVA 1PD1A 1X42A 5ISMA 3IPCA 3UHAA 1H5QA 1P6UA 4J8PA 2WB1A 4QHTA 2B3TA 1P4HA 1IWBB 4LCJA 4TTRA 4TTSA 4B7ZA 1LSJA 4V0NA 5KOIA 3WLLA 1GPAA 1RPAA 3ESZA 3LOUA 4F3RA 3SEQA 1SXJD 3OPXA 4NONA 1D1QA 5EWEA 1VG1A 3AHIA 1XUOA 1Z2DA 1D8AA 1T3ZA 3WGJA 2PMEA 4Y7DA 3RJ0A 2R8BA 4YCAA 3UA3A 1QF7A 3AKZA 3UUEA 2QE7D 5KTMA 1W75A 3ORHA 2P2SA 2O5EA 2EWMA 2NZYA 3BQ1A 4BV3A 1N4AA 3C7AA 3UQYS 1WDKA 4E46A 1GZUA 4OQZA 4YRIA 1W25A 3IPAA 1W87A 5AVWA 3ZV6A 4NCHA 4ZEOA 3EIUA 4D4KA 3ZBUA 3PC7A 2JFGA 4EYIB 2Z2KA 1OI4A 5JWHA 3KUKA 1X7HA 1HZJA 1IBSA 1I4TD 4M83A 2ZUVA 1Q7GA 2WQZA 2Y1LA 3WYCA 2ZKLA 4EG7A 4QDTA 3A9CA 4DXDA 2YKGA 1GVNB 5KSZA 3BXPA 1X8LA 4NJMA 4WY8A 1K97A 2VS1A 4BEWA 3CM0A 1I4OA 1OAKA 4ED8A 4P3PA 3R75A 4K0KB 4MHTA 4YRQA 1X38A 3HFSA 3K15A 2QRGA 4F38A 3PQ5A 2VHUA 1J99A 3S8YA 5BW6B 3IJRA 2C9YA 1BVYF 3AKYA 3K5WA 2AZDA 1JJ7A 2W9BB 4D3SA 3RUEA 3N2IA 4BNUA 4AUMA 4OP3A 1FFWA 2IWHA 3GLQA 4TTJA 4GOOD 2QS9A 1IEXA 2C78A 1WDWB 3A9TA 1ECJA 3WB9A 3L6UA 3ZJTA 3MCAA 4PRYA 4RJKA 4J9OA 3KREA 1JDEA 2PZKA 3NWOA 4DNXA 4RHYA 4M0DA 4L5AA 2J0QA 3BCRA 1XDNA 1TU3A 4YY3B 3PZBA 1G60A 3RTDA 2ASLA 3N0VA 1KK3A 4OA5A 4TV9B 1RACA 2O2SA 2R60A 3NBAA 3K9NA 2RKWA 4BCCA 2FEXA 2CL5A 3MMXA 5TVGA 1OC4A 4MWGA 3P2KA 1WR2A 1WCXA 2DAPA 4FIDA 3ZDEA 3R0ZA 3LT4A 1E2FA 3B3FA 4AY5A 5HF9A 4G65A 4XOUA 2ZJ0A 3HUTA 2AR9A 4AZ3A 4MVXA 2VJPA 1HMYA 2C4TA 3B8EA 1MP0A 1MAUA 4ER7A 4LJKA 4JP3A 4R2LA 2VYQA 1MC8A 4A3EG 3IAM6 1JDJA 1DP4A 4PC7A 3NR2A 5CM0A 3RWOA 5IAJA 1ZZEA 4G09A 3FKQA 3DLIA 3AUJB 5ITZA 3BJRA 5MN5A 3NHBA 3L0OA 3FW1A 2EFEB 2WP8J 4C4RA 1K1EA 4HYYA 4Q6WA 5CVCA 1XU9A 4H7DA 1VKHA 3B53X 3I83A 3OIUA 3HR4A 1RVDA 4F92B 1JG2A 3O0DA 4DLWA 3B1VA 1YR6A 1IVSA 4O02B 3AVPA 2FR1A 1CUUA 4O8CA 4OXRA 3WAJA 4XB1A 3RS2A 1XZDA 3PHJA 3RVOA 3H2IA 3EFOB 3TDMA 3VC1A 4IR1A 3VSEA 4IIHA 3WKBA 3NWEA 1DKRA 4WN9B 3CGGA 5EVJA 3K6RA 3WDMA 1JE1A 4RBNA 1TEZA 5L3QB 1XMXA 3K1ZA 3FPAA 2WOOA 1GL9B 2X0NA 4O1IA 1PE0A 3W2GA 4MR7B 1A9OA 1X9HA 4MRVA 2E4VA 2F9MA 3QYFA 3RTAA 5E3HA 2BYTA 3V7UA 4ZI2A 3ZLVA 4ASUA 3WP0A 2CWDA 1VM6A 3IDSA 3GFVA 1N9ZA 1SCJA