5C1OA

Crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
297
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 88
structure length 297
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1oA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1oA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1oA01
1EZ1A 4YJ2F 2FPIB 1KC7A 3K3PA 2VHEA 3V4SA 5GONF 2V58A 5BMVF 4O2AF 5JQWA 4O81A 4O7YA 5I47A 2W70A 4J6EA 3G8CA 2FPGB 1I7LA 3RUPA 4HNVA 3RV4A 4EG0A 1PK8A 4C5BA 1A9XA 4O86A 2YRWA 3RFCA 2HJWA 4O84A 1VBGA 2W6PA 2YS6A 1M0WA 4O4IF 4M9UA 1JKJB 5JVDF 5KX5F 1W93A 5JVLA 1GSOA 3Q2OA 4XYLB 3TW6A 2VR1A 2DLNA 2FP4B 1B6RA 4FFPA 1CQIB 2DWCA 1Z2PX 4XZ3B 3SE7A 1GSAA 2VQDA 4YJ3F 3N6RA 5KKNB 1KUTA 3MJFA 4RZQA 3U9TA 4DLKA 4DIMA 3AX6A 3KAKA 2R7NA 2SCUB 3GLKA 3BSYA 2R87A 1WR2A 3BFPA 4IIJF 3BSWA 5BPHA 1VKZA 2QK4A 4TUYF 2R6FA 4O7NA 5H80A 4O7ZA 3TINA 4MA0A 4MV7A 3U55A 4M9CA 3ETHA 1C3OA 4HR7A 1PX2A 2V59A 5JQGF 3HB9A 2WYOA 5HV6A 4IHJF 4EA9A 3MWEA 2PN1A 1VBHA 2I8CA 4FFRA 4FE2A 3G8DA 2Z02A 5BPFA 2YS7A 1DIKA 5EZYF 2W6OA 3KAJA 1E4EA 3TIGA 1KJ8A 2GQSA 4FFOA 5DMXA 2R84A 5K2MA 4FFMA 4O7RA 4EAAA 4MV3A 1AUVA 4MV8A 4TV8F 3GIDA 1DV1A 5C8YF 1EUCB 3UFXB 3VMMA 2CQYA 4I4TF 4E4TA 2HGSA 5LP6F 2NPOA 2W6QA 2GQRA 4O4JF 3ORQA 1AUXA 2FB9A 3KREA 4O2BF 4O7WA 2R7LA 2DIKA 2GPSA 2NUAB 2YWVA 4HNUA 5LOVF 1DV2A 3BG5A 3VPCA 4YAJB 3JZFA 1JDBB 4MV9A 1JDEA 2J9GA 2YRXA 4MA5A 4YBZB 1GSHA 4O7LA 3R5FA 1OBDA 2CZGA 2Z04A 3VOTA 1E4EB 2IP4A 3JRXA 4M98A 1KJQA 2GPWA 5JH7F 3U54A 4FU0A 5C1OA 2FPPB 5CA0F 1Z2NX 4I55F 5CB4F 1B6SA 2NU6B 3VA7A 1CQJB 3OUZA 1KBLA 3K5HA 3QFFA 4MV1A 2ZDHA 4ZQIA 2NU7B 1EUDB 1ULZA 5J2TF 5FNVF 5IYZF 3ETJA 1A48A 2PBZA 2P0AA 2YZGA 2OLSA 2CNQA 4I50F 4IWXA 2DZDA 4O4LF 3ORRA 4EGQA 4FGRA 3U9SA 5J2UF 2W6ZA 4GGMX 4MV4A 1IOWA 2XCLA 3HBLA 2YW2A 1KJIA 4HQ6A 2X0SA 1M0TA 3TIIA 2YYAA 1UC9A 1BXRA 1EHIA 3I12A 3WO1A 1CS0A 4O4HF 3DF7A 3OUUA 3R5XA 3R23A 3JZIA 3AW8A 2V5AA 2R82A 2PVPA 2I87A 2NU8B 1JLLB 2R85A 3K5IA 4ZOLF 4IZOA 2R7KA 2VPQA 4ME6A 1BNCA 4HNTA 1OBGA 4O7VA 3WNZA 5LA6F 1W96A 4ZHQF 1KJJA 1I7NA 3WO0A 4O83A 1C30A 4O82A 3RV3A 4FFNA 3TQTA 1UC8A 2GLTA 3V4ZA 4XX0B 4MAMA 3LP8A 3LWBA 1SCUB 2YZNA 2W6MA 1KEEA 2I80A 4O7TA 2YL2A 4FFLA 5C1PA 2R7MA 1IOVA 4Y8VB 4L1KA 4EA8A 5LYJF 2YZMA 4C5CA 4YB8B 1Z2OX 3R9RA 1CE8A 3VPBA 1GGOA 2NU9B 5CA1F 3E5NA 2R86A 2W71A 5D8DA 4WD3A 3JRWA 1GLVA 3NUAA 4IWYA 4EA7A 4O7SA 4M99A 4WBNF 3BSSA 4ZI7F 3KALA 2QF7A 4XYMB 5LXTF 3MWDA 1T36A 2W6NA 2ZDGA 4TV9F 3R5HA 2CNUA 3N8DA 2XD4A 2YZLA 1KJ9A 4NYEA 2CNVA 1M6VA 3HO8A 4QSHA 5HBRB 2ZDQA 1EYZA 4EABA 4EGJA 4MV6A 3VPDA 5CAEB 3Q1KA 4YAKB 4C5AA 2C00A
chains in the Genus database with same CATH superfamily
1GN8A 4OCZA 3EW9A 1HKUA 1Y4UA 3OJWA 2C7RA 1N2ZA 4QUBA 4J0MA 1KU0A 3VX3A 1GO2A 3NKVA 5FWDA 3QH4A 2XIQA 1P6UA 1XPRA 3E8MA 4IHAA 1YS7A 2BFBB 4D9IA 1GHTA 3FTFA 4YP0A 5IJXA 1SHUX 4DCMA 3WRVA 3EYAA 3H83A 4JMPA 3RU7A 4B1FA 2QY6A 3M1AA 3UZUA 3AKDA 3B70A 1GZDA 1UBSB 5B3AA 4QARA 3RB4A 1FP7A 2HT1A 4B3HA 5A3SA 2ECFA 2QZSA 3JU3A 2RBEA 3T3EA 4M9SA 3CLUC 1FJ2A 5I7OA 5JH7B 5F5LA 4MWGA 4B48A 4YMGA 3RB0A 5KFWA 1Q0LA 2JCYA 2X42A 3THSA 4FHCA 2CLIB 4DGQA 1VRWA 2AG5A 1QGDA 3QENA 5FI1B 4RE6A 1GDTA 5IKOA 3MBKA 1DGSA 1Q77A 2C8JA 5IF3A 2YRFA 3MCUA 5TB5A 4I50B 1DLJA 5F9LA 4K6GA 1DAEA 2RAUA 3ESZA 2WU4A 2CYAA 3DHWC 5FBKA 2Q5EA 1KZYC 3R9IA 2CV0A 5JUWA 3SYNA 3WIDA 4LHZA 1TJ3A 3UFXB 1R4ZA 5AESA 3O8CA 4NBSA 5LP6F 1PHPA 3L7YA 3H2KA 2UYYA 3H5NA 2HDNB 1S10A 1N48A 4UVIA 1BEZA 3HNOA 2HHAA 2J0EA 3HWX1 5CBPA 4FMBB 2WVJA 4JB8A 1J0EA 1JDVA 1ZUHA 1M10A 4W82A 2E87A 3ED5A 4KWHA 1E63A 2G7ZA 1DAGA 1PJZA 3T54A 5A0FA 1FBTA 1V43A 3JYQA 1EUZA 1CKOA 5IC6A 5IJ0B 4JT4A 2F17A 4AF6A 4KQXA 3O26A 1ZDMA 3HVRA 2TSYB 4IMIB 2AN5A 2VT2A 2A88A 3CX6A 4OYLA 3PJEA 4JX8A 4R1LA 3ZJUA 4MLPA 4DUPA 3AI2A 1EM8B 4MYSA 4EHNA 4PZ6A 1EK1A 4I3FA 2ZI4A 2QAGB 3A1NA 4HYEA 2VZ9A 3NAGA 4WNYA 4KK3A 2JNWA 1WULS 2JLSA 5AOCA 3Q7TA 2FZ5A 2YZGA 1GGEA 4OQFA 3A04A 1E96A 2W2VA 1SOVA 3ICQB 2MWMA 2X6TA 2XE8A 4K9QA 2VNSA 2I2XB 3COSA 1VPVA 1FJHA 4GMHA 2EIYA 5KFEA 2EGHA 1NOJA 4AJ4A 4DV1H 2YY5A 3FR8A 4N7MA 2C03A 2C8LA 1VCOA 2YYAA 1BA3A 1UKBA 3ZX5A 3WV5A 1S0UA 3U4HA 2CN1A 1EFCA 4CF6A 1YVUA 2UVWA 3TSOA 2FLKA 1S2NA 2JIDA 2PL9A 4H0FA 3QX3A 4FJ2A 2W2MA 3ZE8A 3G88A 5CBKA 4MQLA 2Q3DA 4L15A 2J6BA 2NAFA 2CMDA 5KFHA 4HNAA 1CJTC 3D59A 5LQCA 1MIOB 5EAIA 2W6MA 1WV0A 5BSMA 3RNLA 3R8XA 1Y1WA 5CD1A 1JGTA 1D1PA 2PK3A 4RKRA 2NM0A 1GTSA 3VR4A 4DV1B 2HHFA 9ATCA 3NDBB 3LT1A 1JKJA 2PGNA 2HREA 4PZ9A 4EF6A 3NVAA 4NZYA 4PYOA 3AEZA 4X62H 4A2WA 1J9ZA 1JMVA 2DP4E 4C03A 5A7GA 1SHKA 1SXJE 4AYWA 2XMGA 3NVDA 2F9FA 2Q3EA 1LS1A 1D0IA 4WCVA 4V0SA 2AN3A 3AHDA 3RQSA 4ZPXA 3SIPA 2GESA 4LC9A 2IEAA 1I10A 3E7DA 3MINA 4JMLA 3C43A 3V9PA 1T1EA 4QO7A 3MOSA 4IJ6A 4DARA 2SECE 1AC5A 4LRSB 3KQTA 1WB9A 3HH8A 4BY9E 5JY1A 3IKMB 4NBRA 4ER7A 5IABA 1M0WA 2CLMB 4EH1A 4J0GA 5REQB 3B6ZA 1W9HA 2X41A 2H5EA 5IAOA 1TM4E 4LWZA 2QBYA 1Z4JA 4UHDA 4XR9A 1YB2A 1G98A 1PGOA 4YRBA 4IR1A 1EUCA 4ISBA 3MJVA 1PD0A 4X62B 4LJLA 4X45A 5TQ0A 4GOKA 1HLFA 3BSYA 1PJ4A 1VSBA 2ZRAA 1FUEA 1BFDA 1DIOB 5BWUA 2WSYB 1G3UA 1R66A 2Y93A 4V38A 2ZRBA 3SBXA 5CB4B 2R4QA 3FVWA 4MQUA 1K9VF 4D2IA 1BGWA 3H6KA 1G9TA 3WKAA 3IODA 4BIMA 2MSLA 1UJMA 3OA2A 2B99A 2IEYA 3LT2A 2HTFA 2VA9A 5COQA 1U3DA 4G63A 4ECRA 1N92A 4XTCS 3RAPR 1QP7A 2HWUA 1SJ9A 3C45A 4X71A 2OBLA 4HL6A 2FK3A 1JA0A 6GPBA 1MB2A 3EG9B 3SOZA 3A4VA 1J7KA 1E2PA 2HEIA 1ISGA 1QIJA 5DG7A 5BW4A 2ZJ7A 2VG8A 3M9MB 2ORWA 2A0WA 4BZPA 3ZU5A 2G5CA 4TV9A 4BE9A 1SZJG 1DCMA 5A4MS 3ORFA 3WP1B 1E2IA 5KQSA 3DYVA 1TVEA 4OHZA 4A27A 2IEDA 2FSVA 3HJBA 5SZJA 4JK3A 4I2VA 4JQOA 5E1MA 3C6ZA 3I9KA 2VZ0A 1DS6A 2NIPA 2ODAA 3RGZA 4G5SA 3TIXB 1Z0UA 3KLBA 4ARIA 3LQSA 2A78A 4WL0A 5L6LB 2CV2A 1JYEA 5LYJB 5DI3A 2EJWA 3RAFC 1LCIA 1KK1A 4QOSA 4WOKA 2AJDA 1NXVA 3D4LA 5DGTA 2ZDHA 3QXHA 4U4AA 1QJCA 4EY8A 1HDIA 4B3MB 3PQ3A 2CNQA 5E4JA 2VH1A 3P2EA 5I9MA 1YL5A 4N49A 2XUHA 1Y9DA 3V1LA 1RI4A 1WMFA 1J0XO 4XSHA 4FS1A 1OH6A 2AMYA 3D3JA 3WIEA 3RKRA 2HMWA 5AUOB 1BXRA 5I45A 3A4NA 3FVVA 3L7CA 1JA9A 4L0DA 3W6NA 4TL6A 2C2ZA 4MWDA 4TLCA 5FBQB 4MLDA 4DTCA 2KPOA 3OZWA 1XZJA 1I36A 2WTAA 3SLGA 2LVBA 1OBHA 1M6NA 4UXIA 1TJPB 1YHNA 1VIYA 4KO1S 4AZ3B 4XYGA 3SYKA 2OMKA 3Q8MA 3GPCA 3OQVA 3FGNA 3C3PA 1CZOA 1T6YA 1D4OA 4Y2QA 1USIA 3REFA 4BNFA 2RGEA 4PVDA 3C4QA 3UJ6A 1HT2E 3UMJA 1KU6A 5KTYA 4GM4A 4OMFG 1R6XA 2BI4A 3JQRA 1WO8A 1T0HB 3ESAA 4ZVVA 5KMGB 4O3NA 1F4LA 1ZK0A 3GCGA 1BX1A 1AU9A 1Z4NA 2FY8A 1NKTA 1MZBA 3NHRA 4BMSA 1R0RE 3I3OA 1UXOA 4B4WA 4INAA 3P0FA 5I5VA 4GYWA 5CK5A 3PUZA 4G26A 1CKMA 1P74A 2YWGA 5LJLA 1PJ8A 5H81A 1Q92A 3BTUA 4US0R 3R5HA 2CNUA 2WJAA 3E2MA 3IOMA 1JYSA 3L8MA 4AZ0A 2HF9A 3QVXA 3UQZA 2JVJA 1HZZA 4YC7A 5TQ2A 4R8RA 2AF3C 2PTGA 1UEIA 2OBBA 4YWHA 4DDUA 4LPSA 1QK5A 3MD9A 5FUWA 3AL0C 1TTTA 2R1ZA 1O95A 5EWMB 2WD9A 1U5BB 4LRQA 1H69A 2CW7A 5AOVA 2R5NA 2BJWA 5H4GA 3KB1A 2IOFK 5AXCA 3OH8A 4AKIA 3TS1A 4NZ9A 5BSVA 5FI5A 2O3UA 5EIHA 2V7QA 5J4KA 3MERA 1ZD9A 3E9NA 4MITA 4BUJA 5AW6A 4WZBE 2QMUA 2VCHA 4C4AA 1W4LA 4HDKB 1Q16A 2GHQA 4I4NA 4QU5A 2CZQA 2VA8A 4KOEC 2Q3MA 1JSLA 5DSTA 3MCAA 3O2NA 5AW0A 1NVVQ 2Y0CA 4ZCSA 1C0EA 2D0IA 4PZPA 1OYVA 1V3TA 4U6QA 3JWIA 2PX2A 3PT5A 4CM8A 5CLIA 4S0ZA 1TAGA 3E7XA 1NYTA 2BTQB 4P08A 1R10A 1G5TA 1LSUA 3NDRA 1MC5A 3IP7A 1YNSA 3QWFA 1GRNA 1UINA 4NBLA 4GHWA 1M72A 3ZD8A 1BH6A 4FWTA 2E18A 2MU1A 2XNSA 1B43A 3FDIA 4R9NA 5IDWA 5DQHA 3MFYA 4KQKA 2PD4A 4FE3A 2AXEA 4DY6A 4L4XA 2G0AA 1DTEA 3H19A 3D4PA 2CXTA 3BABA 5AOBA 3OE4A 5LP6B 4C0BA 4JEIA 3QLVC 3DVQX 5DG9A 4LTDA 5EKXA 4DV0B 5C7LO 2I6XA 3ADDA 3BWMA 1MQSA 2V7VA 2Q4EA 3UNXA 3HXMA 4KXYA 3FUUA 1K7XB 2YVAA 1TTHA 3M3DA 1B26A 1W34A 2Y99A 4YRRA 2FF7A 1U0RA 3QSGA 4KU4A 1TWFA 3D8RA 4NYMQ 4B46A 3IH5A 2C5BA 3PDHA 1Y42X 2R6CA 3G2KA 4JJ4A 3TR0A 5JDIA 2ZI3A 3ILVA 3D3WB 1WLSA 2C22A 5JIBA 1G2QA 3WFIA 1ESNA 5CVTA 3RRXA 1RJQA 1NU6A 2GFIA 4ZQBA 2QT9A 1F8FA 4MS3B 4ED6A 1TF7A 1EUDB 1M2HA 2WT9A 3IQHX 5C1BA 5A3RA 2WKPA 3NHBA 4C05A 2O5VA 4PXSA 3HNRA 1Y1SA 1R8QA 3QVUA 4LRYA 4IDFA 4JHLA 4RS4A 2IXGA 1DI0A 3RLIA 2O0JA 3MWYW 4NJOA 3NBAA 2HY7A 4LF7H 1XN4A 2AQ8A 3PNBA 4E13A 4BKQA 3AEXA 3MR6A 2MR6A 3HFRA 2F1KA 4QDUA 1YC2A 1G9XA 2V7PA 2UUAH 3NH6A 5J63A 1HC7A 1MCZA 3L02A 3DT6A 2G8LA 2QSUA 4F92B 4GC7A 3KT8A 1YR3A 3FF1A 5IM5A 5COAA 2QG6A 2WIAA 3TOVA 1M2NA 2JHPA 4X90A 1FXWF 4OREX 5K4HA 3WYFA 1SXGA 3LWBA 5TVGA 3X2FA 4WADA 4YFYA 4OA8A 2RGAA 4WK0B 2P9EA 4F50A 3DCJA 4JBHA 5TS2A 4G8CA 1XTSA 1Z4OA 5CW1A 4TS1A 5C1IA 2RARA 1KAMA 1CY2A 1XZPA 5BRJA 2IIVA 4LF7B 3PUJA 1S9FA 3ACDA 2UYQA 4U00A 4EG7A 2W9CA 1T36A 1TMOA 4G4JA 5KDLA 1ESCA 2UUAB 1T0IA 2HN9A 2YDXA 5HKAA 1XU7A 4NCIA 1Z0AA 4ZYTA 4HYKA 2VOEA 4CKXA 2NT3A 2GYYA 2C00A 4GKJH 3DOUA 5KJEA 3E82A 2F3TA 3PUVA 3SGLA 1MH1A 1A3CA 5B7NA 1UJ5A 3H17A 1TLTA 1VPTA 5DQIA 3TLCA 4O2RA 5KOHA 2Y0EA 1XLTA 3ZK8A 1RTKA 2I6FA 1TVKA 1PN3A 2W5UA 3AFNA 4XRGA 1JLMA 1CQIB 4PLFA 5AI6A 1KI2A 2R1TA 5KFRA 1H4SA 1F9AA 1JT2A 3BAFA 1KVRA 1KUTA 2N46A 4KH0A 1K86A 2X76A 4JV5H 4FUQA 3IT1A 5T4BA 3UAVA 1J23A 3T1VA 2A7QA 2C42A 4RJIA 4BX2A 5CXSA 4Z54A 4ZODA 4JI6B 4GKJB 2WIBA 4UMVA 4GMFA 1J97A 3TB4A 3TTVA 2M32A 5F1PA 4J7AA 3SAJA 4D8VA 3W04A 4YV0A 1U7ZA 4GXNA 4PNPA 5A4FS 2QM0A 2LPMA 1ZHSA 5FA6A 2IU0A 5I5XA 3ZHCA 5DT2A 1L4BA 1NN3A 5JW6A 3VNUA 2BUBA 1QMGA 3VTKA 2HRDA 1L7VC 1QP0A 1ZHOA 2PFSA 3OZDA 3N70A 2NU6A 3GROA 3R75A 3D02A 1E2GA 4WK6A 2XI4A 4P7GA 2H2HA 4Q3AA 4QWBA 2FJUA 4OJNA 4FLMA 2WIKA 4PTLA 1T9ZA 1VKOA 4HYTA 1KEZA 3MFQA 3NC0C 2PZJA 3Q8RB 1QV7A 4JV5B 1EFKA 3RJ9A 1X13A 4V02A 1CT9A 5BWLA 1UBUS 1WVGA 3RAEC 1WMSA 1ZNZA 3DV9A 1ECPA 1FTSA 4ZXFA 2VAXA 1KAHA 1YZ3A 4OXIA 4WASA 1C4KA 2QQ0A 3EE6A 4FR2A 1YB7A 4QJ5A 3S40A 3FBWA 4BRWA 2NSDA 2FI1A 3M4ZA 4LEIA 3W05A 3IA2A 3WB0A 4RY9A 4YRAA 2PKXA 3BXHA 1NQOA 1AD2A 1N6KA 3M6UA 2FFJA 2RFLA 5BSHA 3RVMA 5FNVF 5BQXA 1MN6A 2RJ3A 2CL6X 1JU4A 5FJJA 1PJCA 1KK0A 3SYTA 4LF5H 4K8RB 4XIIA 2XIJA 3ZWXA 3S2SA 1T2NA 4FPXA 3EX7C 1GZVA 4QDKA 1GKYA 1N6RA 3TDKA 5B58C 1P7CA 4A1OA 1ZI9A 4BNYA 1U2EA 3LE8A 1KYIA 1KH2A 1G41A 2CMGA 3GBPA 3ZZ0A 4S24A 4Y2PA 1M2VB 3G5MA 3GJ3A 4DBLE 1QIGA 3HOYG 2AZ4A 3EQZA 4IDEA 4BN0A 1NNSA 3K5IA 3HBJA 1O94A 4KE6A 5FHQA 4R3UC 2NNLD 3AB8A 3KEMA 4IIVA 4GC6A 4Z7NB 2B4AA 2HHCA 2VDWA 1Q12A 2ZE8A 3HUUA 1U6KA 5KJCA 4FFNA 2DTXA 4HH1A 3R20A 2AXQA 4OHUA 4QICA 5BNWA 3LP8A 3BCHA 2BI8A 4H7JA 2AMJA 3U39A 3GGPA 4C04A 5IWCA 1G16A 3A6FA 3E9YA 4J7XA 3D6TB 2CNWD 2OBMA 2UU9B 3AGQA 4K0KH 3HJGA 1C3LA 4OB6A 3KQHA 2IY7A 5EE1A 2DT5A 4TKVA 2JFBA 1MFPA 3ZD6A 1E32A 1C8LA 4TZ0A 3LO5A 3L4BC 1PK9A 4E1AA 2JGIA 1XCJA 1Y48E 4IX1A 3BF8A 1REQB 3HPRA 3K53A 1AM4D 4P4LA 1IM2A 3PU6A 5DOVA 1CU1A 3RG2A 3HO6A 1M34B 2J41A 1EAMA 2E4WA 3SQXA 1PLJA 3NHFA 2NV0A 3Q6MA 1FP1D 4JQZA 2WVGA 2JGJA 4PQRA 3CLTC 1ARZA 1HT1E 5EEGA 5EHZA 4I4TB 3C3XA 1SG9A 2PRKA 5BVHB 3ZBTA 3IQIX 3PUIA 1VBGA 2O4UX 1BW9B 2GXAA 4K0KB 4QUDA 2G6BA 3I0NA 2QNBA 1NW9B 5A4AA 4HXFB 4D4MA 5MN5A 1LY1A 4V03A 1Z5UA 3ENQA 3M89A 1YVDA 2C82A 5I6DA 1U6IA 3EWAA 4IKPA 2Y0SA 3EPGA 4HVCA 1WV1A 5IHXA 3H7AA 5JANA 3OLWA 4CIDA 2GF9A 1EVJA 4GP6A 3TECE 2XCSB 2YUTA 3AZPA 4RKWA 2ATIA 2G40A 5LCXA 3HA3A 4UNSA 1EXVA 5KYUB 3ZK9A 1FJXA 2HM7A 1B6TA 2CBZA 2ECQA 2G71A 1ZL0A 1SBQA 3B6EA 4KXFB 1EWRA 2NNWB 1T0UA 3EPKA 2VF4X 4KLAA 4FYVA 2AFHE 4JZYA 4MS1B 1R5BA 3KNZA 4JC8A 3F1LA 5JU6A 4HGYA 5L51A 4DKXA 2ZZKA 4P4TA 4TRJA 1N8KA 2HBZA 3AEKB 3VR1A 3A31A 1TYDE 2Q5QA 3RGXA 1Y14B 2WHQA 1H9BA 3D4IA 1GY8A 1TM7E 1X0VA 4KK4A 1E1CB 3IBGA 3HYTA 4Q1BA 4GI1A 2PBLA 2TRSB 4A6EA 2WJ4A 1UJ2A 4WXEA 1YDGA 4QFBA 1W85A 3K0AA 3PJDA 4Y2HA 2XGQA 5BXQC 1JLSA 1A8HA 3G6YA 1F0NA 3ANTA 2MYPA 3QX7A 3SLRA 4YJGB 1GLNA 3RO7A 1YZFA 2W6ID 4CLRA 4QYWA 1RRGA 3PITA 3VA7A 5B1HA 3J7AC 2Q9BA 2DM6A 3VO9A 3H9QA 2DAAA 2A58A 5KWIA 3BD7A 3I0MA 3WIUA 4GI3A 2XOKD 5T6MA 3SCZA 2ZIGA 1XQVA 2FW6A 3JR7A 4FCTA 3GIWA 2P90A 5I4KA 4BUCA 3IPXA 3UATA 4Q9NA 4F0JA 1K4YA 4JI1H 4ZFNA 5I5GA 2W6ZA 1T9AA 3KC2A 3O92A 5DN6A 3NBYB 5H3CA 3LJKA 2HSEA 2L0XA 1NBIA 1Y1PA 1WA5A 3FYSA 2GBLA 2GO7A 4C87A 3EIOA 2ZAYA 3K5WA 3HGTA 5FPTA 3JASA 5ITZA 2GPBA 4L4UA 2CFTA 1J8QA 2NUTB 1GKLA 4EPVA 2OSBA 4TM8A 2EEPA 2PPVA 1AGRA 5KFVA 5BYBA 4PGFA 2W37A 2ZROA 1QVAA 1IYEA 4L5YA 2DB3A 2EF1A 3UK6A 4I7EA 4Q3EA 4BNLA 1UPTA 1T1SA 1EKFA 5L3QA 1I2DA 4B4KA 1WNFA 1AURA 3DYBA 4C3ZA 1S1MA 1UP4A 4LZNA 4U7JA 3L7NA 1QGOA 1KNQA 1L5RA 2RHWA 2AFIB 4RF2A 4TZTA 4MTDA 4Q7QA 2RAFA 3HO1A 1PTJA 4ARVA 4KKXB 2FN7A 2V6GA 1FVFA 1VJ5A 3NUAA 1XV5A 2X19A 1EK6A 1I14A 5KG3A 2IS6A 4R2JA 2VDQB 4N9QA 4A8JA 2IDJA 3TW4A 3MCWA 3FVRA 4ZOBA 3DDUA 4FWIB 3PPYA 4L9SA 3V7NA 1OH8A 1DEXA 2A57A 3ZGNA 4YR3A 3O47A 2GAFA 4M86A 5IRCD 4TSKA 4B6RA 3NYWA 4CMEC 1W0KD 1BU5A 3WB9A 1UXHA 2M6RA 1UPFA 3IA7A 4PO9A 3BS4A 4G0MA 3HXKA 2YKGA 3IVAA 2PZKA 3IEXA 3QU5A 1M2OB 4E5MA 3MW8A 4AIRA 1SHTX 4AICA 3MS2A 2EU8A 2ORIA 5FI0B 1G5PA 3ZC3A 5AVVA 2G77B 3WV4A 4YP9A 1ZO8A 1MDFA 2XUQA 2FWIA 2F1HA 3MTDA 2A1IA 2IRWA 1UM8A 2IYSA 5T4FA 2IYZA 4AD8A 4V39A 4EQ6B 4YT8A 2H1IA 4Z5XA 1XAJA 1IULA 5JG7A 2OHXA 3AFOA 3N75A 1OFTA 4KC0A 2XF8A 3ELBA 2JIRA 1M1UA 4YRQA 2FZGA 1XX6A 5GJBA 4B2PA 1YDEA 2XUOA 3ONVA 1ZH6A 1KKMA 1KBZA 1PR3A 2ZJZA 4PAQA 4G0NA 1ET0A 3VR5A 1SELA 3DF9A 2JFGA 3EIEA 2J3EA 3BWCA 3L05A 1M2JA 3H65A 1FXSA 3E2IA 4DG5A 1Y4ZA 3S44A 5BWMA 4O7RA 1H2BA 3BILA 3BRWD 2KSQA 2WWVD 5JS1A 1S2MA 5AFSA 4K9RA 1KH3A 3H42B 1N32H 1AXEA 1U2PA 1WBDA 4ZYVA 2NZYA 1J1UA 1X7XA 4XEUA 3O0DA 3U2QA 2GZ3A 2DSNA 2EJ2A 1M0SA 2P9CA 3PZRA 4EM6A 3ZDRA 2JPDA 3A4MA 4P58A 5HK9A 3OLCX 3KKPA 3IHLA 4R51A 4OQLA 4PCVA 1NTOA 1OJLA 5EPUA 2ZANA 4HVTA 2R11A 2GN2A 3GTQA 2P5TB 2G0NA 4M38A 1CY8A 1GIAA 3BA9A 2MYUA 4YAKA 4D25A 3C24A 1DKUA 5KYYB 4O5OA 1GUYA 3AR2A 4DN6A 3NYRA 3AF2A 2P3LA 1JU3A 4RAOA 2IYRA 4XQEA 2X14A 5KT6A 3ZHZA 3NVKI 3WHPA 1SNYA 3JD2A 2Q45A 4REMA 4IKOA 1V1JA 4DBVO 2Q2WA 1CUCA 2IDKA 1D4FA 2OD9A 3LXMA 1TUBB 1NJ8A 3UW3A 4GOJA 3VHRA 4A16A 5G02A 1O9HA 4EX6A 3A9CA 4QUJA 1DG9A 2IF0A 1YS1X 2JATA 4TMKA 4IDQA 3UAYA 4ATNA 4Y0AA 2EWMA 5BV7A 2ZPTX 4LJ9A 3TIIA 1W19A 1WVIA 2QENA 1Y3DE 4DTIA 2O57A 2H6EA 4KSCA 1Z0ZA 1PZEA 2PRYA 2NU8B 4DSZA 1SM4A 1QIMA 5FF9A 2WF8A 3PX7A 5C5IA 4ECXA 2P9FA 1SG0A 2ZREA 2P5UA 4XWGA 3GZJA 1G5HA 4WLFA 3B9RA 2GN9A 5A9TA 4O82A 3T3HA 3V2UA 4MAAA 4DR2H 1WSWA 3EQ8A 1K7YA 5EJFA 1YDWA 6NULA 4ENRA 2DT8A 4GO1A 4WESB 4Z7JA 4UATA 4UZSA 3WGMA 1JEQA 2VHTA 5DYTA 5L3RA 1YKSA 4LIPD 3VPBA 2ONCA 3UZOA 1NFQA 1MW9X 5E1DA 2X9VA 2O6HA 3SZUA 4GXRA 1OU4A 2PRIA 4X95A 1O0BA 5AM0A 1ZA1A 3OPYB 1Q0ZA 3GJYA 5LLDA 2FP4A 4IY1A 1IUOA 4KR7A 1K08A 2MINB 2QTVB 1FMTA 4YCLA 1E92A 3H5IA 4OUKX 4EECA 3OOEA 1A8QA 1AA6A 1DEKA 1M7BA 1RC0A 1D2CA 3SXJA 1XFAA 2HU7A 4DLTA 4FGLA 5E3IA 3VV3A 1SD1A 4QRIA 1MNAA 5CM2Z 5DGDA 2XUPA 5I01A 2J9RA 5HX7A 3RIGA 2UVPA 4NMXB 1JLHA 1ZOSA 4WJKB 2X5JO 2QM3A 3COVA 2X8AA 2VHCA 1MA3A 3M3PA 5KT4A 1W75A 3GLUA 4I6GA 4V2UA 4F97A 3RWOA 5K8JB 4IM7A 1OKKA 4KPYA 4HAYA 1OH7A 3T4UA 1SCKA 4HAVA 3LBNA 1A3GA 4BB0A 1ZR2A 1O87A 4D79A 3R8CA 3NDJA 2HMUA 4KEAA 1OWMA 4YA6A 4B3CA 4BKRA 5KIAA 3F2IA 5I8PA 1FRVA 5CA0B 3KKQA 3U3RA 3ZDZB 4MR8B 4DA8A 2BL4A 4F2PA 2YC4C 3VH2A 3X1DA 1RYDA 2LIPA 2DU8A 3N0WA 4AQ7A 4U9IS 3O94A 4WINA 2GJ4A 5ULLA 5K3SA 3T5JA 4GMKA 1PGJA 1Q95A 3TFQA 4DDWA 1CUWA 3DR3A 1DCFA 5KVSA 3E3NA 5LB4A 4X65H 3KLNA 3LKZA 4KRGA 3VQTA 3WSTA 1U1GA 5KFGA 1ZQ1A 1NPYA 3IUQA 1OI3A 4DEYA 4DJTA 3VZPA 1XEWX 2HPZA 1Q7TA 3C3JA 3G2PA 3AM5A 4RU9A 1TFRA 4QPJC 2AQKA 3PXCX 2PGJA 2ABWA 1G21B 4F6RA 3PE3A 4M36A 1AN9A 1DARA 5EZ6B 5FOSA 2C4UA 1QJ4A 4H16A 4M0KA 1O6FA 2FDRA 1FS6A 3KTAA 1T5IA 2O20A 1NJFA 4C30A 1THTA 3MJTA 2FUG1 1MAAA 4G5FA 2IY9A 3W5JA 1KHHA 3OIUA 221PA 3MR2A 1P1KA 3HR8A 5FBLB 4J9UE 3DPUA 3LK6A 3FKIG 3L6EA 3ZIDA 2X8WA 1FVIA 3VYWA 1U7PA 3X1MA 2B2NA 3SQWA 4K88A 1XLUA 1HMYA 2WHYA 4X65B 4R9RA 5CB0A 3K1TA 4YJHB 5DV9A 4OKSA 2C98A 4J1TC 1XVAA 3O8NA 3IQWA 5TPZD 4IQ8A 2JAPA 1BKSB 3GG2A 1I4OA 1G63A 1L2TA 3DMFA 2PH3A 1PGQA 2VHWA 3FOBA 4AK9A 2RGYA 4FN5A 3CSWA 3QMMA 5C32A 1HBJA 4KQJA 4RVOA 2J9FA 4RHXA 1P2FA 2OHVA 4I7HA 3NP7A 2EATA 1KKUA 1GZ7A 5ELLA 2EJVA 4ZCIA 1I3OA 2CHEA 1QFYA 4ME6A 2WWFA 4HGRA 2IXAA 1IMJA 2RGGA 4A15A 4NQZA 2XGSA 3GP8A 3QTBA 1FNNA 5KSWB 3JZ6A 2BR4A 4KMSA 4ZHQF 2FUG6 5CDHA 1DT3A 1XQ9A 3P26A 4G65A 3RUHA 2D2VA 1P1FA 4RVHA 4KVFA 5DK6A 2PX6A 5JS7A 3KHTA 4AMZA 4O4IB 3VX4A 3OAAA 4XGNA 3U7RA 3OPNA 1BE8A 1VLZA 2Q1WA 2BEVA 5F2EA 1R0CA 1GEGA 3WDKA 2QIPA 1KL7A 3EIUA 5C8YA 3INRA 3SMQA 3RU9A 1OFIA 5KFBA 3AIKA 1CS0B 5F7XA 1YAJA 1WUKS 4BBZA 1XEAA 4O4JA 3JATB 1MAWA 4WK2B 3FOEC 2VNKA 4PO8A 1SVNA 5HJ5A 1OZGA 1GYPA 3EJ6A 1M6WA 3U7HB 4WZBA 2JI4A 2ZRNA 1P4HA 3JQCA 4UEWA 4TTAA 3TVDA 2FOIA 1AGPA 1XRQA 1IHYA 4AN1A 4L75A 4L9AA 4Q02A 2O59A 1FKAH 3M9LA 2R48A 1EHCA 4CF4A 4CMBA 4C7OB 6PFKA 2P65A 2RKWA 3BHMA 1E0DA 3STVA 3PWTA 4BXOA 4OYYA 2RBGA 4H9GA 3T41A 1H1LB 2BEUB 2PMZE 3N74A 3IILA 4C5BA 4C1BA 3G2IA 3VVMA 4JI5B 1Z17A 2PVCA 4LH6A 1QYVA 2WYVA 2O3TA 2CF5A 4PWZA 4I5FA 2YMPA 3IB3A 5HRAA 3KR1A 5KU1A 3FDSA 3HJNA 5K05A 1DC6A 1SAYA 1U2TA 3BWYA 2Z8YA 3MLAA 1PT9A 5F1OA 5FPHA 2GKSA 4M4SA 2K5UA 2P62A 3LUFA 4B3IA 4Z4QA 2EJCA 4OSPA 1EFRD 5KG7A 2XNJA 4J75A 1NSFA 4E4YA 3ETGA 3VR2A 4MQ6A 1E3DA 4MUHA 2EOAA 5TPWB 5AM1A 1W581 2R68A 2XTMA 5HV6A 4G1UC 1U0SY 3MA0A 1DC5A 4NBNA 2WD7A 1NI4B 3ZIAA 5F9MA 1ECBA 3G82C 2VXCA 1WMAA 1U0GA 2XWBF 1JVNA 3OLYA 1CDDA 2G76A 4N1AA 1L8QA 3N86A 2HQBA 4L8VA 1A2OA 5LWHA 1OTXA 3QW2A 1G20E 1PHRA 4GOND 2H7VA 3ROZA 2CNKA 1TF5A 2IHYA 3ZI0A 1ZISA 4J2HA 1O58A 4O4HB 2R8OA 2JAHA 1AGYA 3AY6A 3MRVA 2F3RA 5LR6A 5F33A 2NSJA 3VKWA 4DSNA 3GLHB 1V9SA 5JAUA 1UDXA 4F38A 1MPXA 1CZHA 3UCEA 4QPPA 3H8SA 4YO8A 2RGBA 5BQPA 3BQ1A 1JHPA 2Y1EA 4G24A 5FOUA 3DNFA 1V71A 3ZJ5A 1B8VA 1GR0A 1QYDA 3KQUA 2G6TA 1VE3A 3JWEA 2NWQA 2ERCA 4MUFA 4BLVA 1NJ5A 1GL9B 1QF7A 1PWEA 4HWPA 2BY4A 1C3EA 1T5DX 3ODGA 4R8VA 2VN8A 4IBOA 1U11A 3TZBA 2QR3A 1AZLA 4OK6A 3LWDA 1KXZA 4ZIRB 4LY3A 4K5QA 1XD2A 2OC9A 1YBMA 3AF1A 4IGFA 4DZZA 2EG5A 1G291 2YUIA 1SURA 3E7WA 4FS2A 4ZAZA 4I1YA 3LTEA 4N7BA 3WG9A 4N3CA 3HRIA 1QO7A 3FMIA 3PNKA 2E82A 1VECA 3I4FA 1ZPDA 1LNZA 2NU9A 5AM2A 4UZEA 3A6GA 1I3MA 1WX1A 2PGOA 3KVRA 2WWIA 4HTFB 1I4LD 5ALTA 3AK4A 3PRKE 3H6HA 1GQ2A 4V0QA 4EW1A 3N2IA 4FNOA 4GE0A 3MPUA 2I2FA 4E2XA 3U62A 3MUEA 2C2YA 3JQFA 1KOJA 1RNLA 2B8EA 1GUDA 4GPAA 1NX6A 4EF4A 2E55A 1I6UA 3E05A 1QGZA 5J59A 2PBRA 3GJXC 5AW1A 4B74A 4C4SA 2EKQA 2A5LA 1RYNA 3IKJA 2PUJA 4H1UA 5AJWA 1T9DA 1V6SA 1ADBA 3PVXA 2CFSA 4N01A 3FMAA 3D8SA 3PF8A 1B93A 4MDHA 3PNSA 3PW0A 4B3SB 5D1NA 1GPNA 3IPLA 4LPKA 1KJWA 2K4MA 1Z6ZA 5IS2A 3QBTA 1U31A 1BGVA 2VUIB 3DOIA 4R0MA 4Q7MB 3VC3A 4PBRA 2JBAB 3C5HA 4J4TA 1OLUB 4AKHA 3L06A 4DSTA 3K96A 3WL8A 4CIAA 3TDNA 4HG2A 3DE5X 4MDFA 4JLPA 4MI1A 3JD1A 1MG5A 4G5XA 4P9NA 4Q4JA 2V58A 3B3JA 4B3MH 4JL5A 3KZNA 4D5EA 5IC5A 1XYVA 1EFUA 1FW8A 3FYUA 3EGXB 5H68A 2HLNA 3FLMA 1UWCA 4G1FA 2C8VA 1J42A 2GOYA 5EG5A 4QHYA 4ES6A 1VE9A 4FXPA 5KX5F 2B7BA 2QXTA 4C0QC 3KYIB 3LTNC 2BV3A 3MUFA 1Z2PX 2CLOB 4A2CA 5TX7A 1KQFA 2XB2A 4YMIA 4ZC8A 1B0AA 3J7AK 1SIOA 5AJYA 3NHUA 2JGEA 3U1VA 4HGNA 4K6FA 1JQEA 4LVUA 2P0EA 3QPWA 3TQFA 2AR0A 1I13A 3OIYA 3N59A 4DB2A 2XHEA 3A6ZA 3LW7A 3ED1A 3CZ4A 3ZQ4A 1SQFA 4EBBA 2QRNA 3JQQA 4RPKA 2ACEA 4QIWE 3Q15C 3BXZA 4HVAA 2OVFA 4XSVA 2A5YB 3M6VA 2WWWA 2M05A 1N6OA 2AC2A 5B4TA 2VRCD 4GXQA 2PSSA 3RRFA 2AD1A 3TR6A 3EGCA 1USGA 3NX4A 2GAJA 3NOOA 5GIPE 5GOTA 1LC3A 4BNZA 1CRZA 2ZGIA 1BHO1 1K66A 1T9GS 2IUEA 1ZGZA 1PJSA 2JA6G 1WCIA 2CMKA 2GJ8A 2FUKA 3P9NA 4FNMA 1L1EA 3RB8A 5JZ9A 5I9SA 4JOCA 3KXYT 1IWBB 1UDWA 1V47A 1L4HA 3DNMA 3A10A 2ZYUX 3FGOA 5TR9A 3PJGA 1AN0A 2GN8A 4TL9A 4EB0A 4TLLB 3KSDO 1Z07A 2E21A 4PPYA 5CFZA 2JL1A 3L1HA 1KSGA 4F9FA 2D54A 5AVYA 3O4IA 3DPSA 1Q1EA 3R3SA 1KI8A 2ZYDA 5IAAA 1GTRA 4ABYA 4APMA 1E3TA 3FPHA 2QS9A 5DLGA 4IVQA 4HUQA 4UBMA 1JR2A 5D87A 2V4ZA 4LH7A 3G1TA 3GGCA 2B4RO 3PFWO 1UEJA 1OGYA 3E8SA 3I62A 1VI2A 3TG2A 1ZLYA 2Z9BA 2CVFA 4QG3A 3MBIA 4OHXA 3ZV5A 2DULA 4BLSA 1D6SA 4DJDC 2DWQA 2ZRGA 2HYDA 3HHEA 5TE9A 4XYMA 2CJWB 1ESDA 3LYAA 5CG2A 3G0CA 1MQAA 3AEQB 1FPMA 3CNEA 4KNYA 4EMSA 1KJJA 1MX1A 5AK4A 3AJ9A 1KERA 3DTTA 1ZC4A 4RLQA 5EWLB 1FFBA 3TQ1A 3ZBQA 2J6UA 1LPAB 3L7DA 5IMBA 1E9AA 3IG0A 4EHDA 3GILA 1GAJA 3M82A 3U7QB 5DIZA 2CNNA 4QELA 3E3LA 4XSGA 3MWMA 2P41A 5CFOA 1S01A 4DV0H 1YTLA 1S2IA 3HJHA 4IRDA 1VJTA 1TMGE 1WNTA 1DWPA 2L69A 2JFOA 2V96A 4CE6A 2EJ0A 3I6IA 1LGYA 3ZEIA 2VF2A 1Z0DA 3WLKX 2Q8PA 1PWZA 2F00A 4GNKA 3I8SA 4DJJA 1KI6B 3TUIC 4MCHA 2BFOA 4WT7A 4EHHA 3QSYA 5CAEB 4E5SA 1EPUA 1DXQA 1ZU4A 3QEMB 2I78A 3PGVA 3D6AA 2H4HA 1WUYA 3II6X 2XW6A 1RZVA 1N77A 5IVIA 5TNXA 3AXSA 3T4EA 4YR2A 2OFFA 1G2PA 3FOCA 2HF8A 1EFVB 4DR1B 1XK6A 1H3EA 2OLKA 3HZOA 2JHAA 2YV1A 1VB5A 3KS9A 4MPRA 1G4UR 3NIWA 5M34A 2IHBA 1ZONA 3MCZA 1E2JA 2NP6A 2ZQYA 4UFOA 1H94A 4DIEA 3ISVA 4KRXA 3TXXA 2PZLA 1FDIA 1FTNA 3LFUA 4IIJF 2CWWA 2H57A 3GMDA 4QW8A 3WLFA 3E9RA 5BQ3A 2V4UA 4K9SA 1SUDA 3TLGB 1LDGA 1OXKB 1QIEA 2P4UA 3ZV7A 2C4KA 2VKQA 5LBTA 1G7SA 3N8NA 3GY0A 5K0FA 2NXNA 4MCAA 1RI3A 2C1EA 3EBOA 1P80A 4PN7A 1RIFA 4F5EA 1A9OA 2E5FA 2VWPA 3P0RA 1CRWG 2ZU6A 1NURA 1UBJS 5GGXA 1H6DA 2QJTA 1JDJA 2CK3D 3I6ZA 4JUZA 3HCFA 3PHGA 1OXMA 3DMDA 1JEYB 4Z8XA 1ZZGA 3WMFA 3R0XA 5HF8A 4LSGA 4LXQA 3WLJA 3ZVNA 3ZS8A 1UF9A 5ALJA 3O91A 3HY4A 1LDYA 2BJHA 5KYWA 2R7LA 3K1AA 4X93A 2YYSA 2IV7A 4J9PA 2IH2A 4URYR 3IL2A 4G41A 2CSUA 4HWSA 4WNIA 3TZHA 5JAQA 1W8IA 1C8BA 2P27A 1M7JA 4PGMA 2DHQA 2XYVA 3VVBA 1JSCA 4EEYA 4QREA 1BVHA 4U2CA 4J0IA 5HFAA 4DILA 1K3UB 3V8BA 1OWPA 4ESHA 1FYWA 4P2GA 3EHEA 4IW3B 1B8NA 3OOYA 1A95A 2HWXA 2AWNA 4Q1FA 1UM9B 3C98A 4AWBA 1GU1A 2NAPA 5JR3A 2HA0A 2ZP1A 3VJMA 4FDTA 3WMEA 2YW2A 4JP8A 2Z3ZA 3HY3A 1T8PA 5A5VA 3UHOA 4JI6H 5L3VA 3I5YA 5HNEA 3EWNA 4ILKA 3RRJA 4D9GA 4EGCB 1W76A 3ZY2A 1RSZA 2FG6C 1JLLB 1JPNA 1Q74A 2M98A 4DDMA 3L8YA 2FEOA 5EJ9A 2XA1A 4CFZA 3QBEA 4EIWA 3ZTWA 1WXEA 5HM8A 2EFYA 1A9ZA 4M9QA 2AUTA 3EASA 3MOIA 3GEIA 4DV6B 1SVMA 1BN7A 1JFSA 1Q50A 4NZMA 2PSEA 3AJEA 1JHYA 5DB4A 2C7PA 3KQPA 3P71T 1U65A 2AR9A 2ZJ0A 2F4NA 4B47A 2XYQA 3U16A 1ODFA 1ZH8A 3LDHA 3EAQA 3CE6A 4XCQA 2OOSA 5D8DA 4C7MA 1QU2A 3QFCA 3ZS9A 1MZVA 1B76A 1H8EA 1OJ7A 2HA7A 2R5WA 1J09A 4MKRA 2OHFA 3IC5A 1JMYA 3R7DA 2VA2A 3G7NA 1ADFA 4X64H 2FPSA 1MABA 5I9NA 1USVA 4HF7A 1FYFA 3T94A 4EGJA 1ISRA 2ZAGA 3GH3A 1NJSA 3PKIA 4BZZA 3RIXA 3D6FA 4CU2A 1PZFA 1RJEA 1TNDA 4AZTA 1Z2DA 2P6OA 3LUPA 4B3GA 4R7GA 2C5FA 3FI0A 3N2KA 2BM0A 4F9GA 2GK7A 1Z7YA 4DAEA 2A92A 3O9VA 2V1UA 2XVZA 4YDSA 1WZNA 5J4LA 1SH7A 1WXXA 3LWZA 4J9KA 3BXPA 2DBZA 5FOQA 2B5WA 1F12A 3AYXB 1JXLA 2ZJ4A 3GJ6A 1UWLA 5AW4A 1U0LA 1IQUA 1CUJA 1RKVA 4QAQA 4BCDA 5B7QA 3D2CA 5FPKA 3TDMA 3R76A 4RH3A 2QMZA 2VL7A 4X8HA 4UCOA 1EVQA 5KKNB 3GUZA 3L4SO 5LDDC 4MQFA 4X64B 3FWHA 4IR7A 4KLCA 1AF7A 4Q1AA 3K1YA 5KSPA 1FNMA 4DMMA 3FYCA 1BCSB 4N03A 5U9CA 4B7XA 4WFQA 1OFUA 5DNDA 5C4GB 2JCXA 4ZCMA 1W46A 1ONBA 1QZTA 2PXXA 3RRNA 4TMTA 4ZVQA 4ROTA 4DRFA 1DRKA 3LY8A 4CDNA 3WS7A 1XZMA 2UU9H 2G04A 4MMXB 1FDOA 2C28A 4IXMA 5FUXA 4BRZA 3MTGA 5CT9A 2IOYA 1OXSC 3OHPA 3DKRA 1ISHA 3P9PA 4QUEA 3NP9A 3IKVA 3SN6A 2JEIA 5H82A 2O1WA 2WE6A 3L7BA 4F8JA 3EOBI 4UJ5A 2VO1A 4REQB 1VSQA 2GQRA 1C3XA 1T29A 1GGFA 4IR9A 3STHA 3LP5A 2X8JB 5I48A 1N2JA 4ZI7A 2WWRA 1J33A 1P7WA 1ZMRA 1SCIA 4MR7A 1QWSA 1TQDA 2OUIA 2EBUA 2EQ5A 4G0VA 2VKTA 4DQ0A 2BM8A 4I14A 2KM1A 1MJNA 5K9ZA 1XAGA 4Y1RB 1QZZA 4EQZA 2DHDA 3GGJA 2QG9A 2G25A 4H6XA 5CD9A 3FG9A 2F48A 4YAEA 4BYGA 4POOA 2A6PA 3DAFA 3AIOA 4BEBA 4YMVA 5DWQA 1QLJA 1A8UA 4K40A 1FRZA 3TAUA 3HCBA 4V1CB 5LLTA 3DW1X 2XB4A 3WMRA 2BFNA 4P3OA 1G4HA 5EE0A 4WCDA 2Y1GA 4L3OA 1R4MA 1UAYA 1GNTA 3B8EA 3SIRA 1A4IA 1U2DA 3KV3O 4R71A 5LU8A 2K7ZA 2OP0A 2QZJA 1YULA 4F04A 3KU1A 2JFNA 3ZY6A 3IV9A 5IUJC 1KC3A 2R8YA 3RVSA 3B5EA 4TYYA 3EULA 5DZSA 4RGVA 2IYUA 4Q3CA 3WGKA 3DTVA 2F43A 1HG0A 1EP1B 2XGJA 5AICA 2H17A 1AVTA 3I05A 4R7TA 3I5AA 3SNOA 1ADCA 4DMLA 3EF0A 1BNCA 2J59A 3CO0S 3V7YA 1VLQA 1JRLA 3BIJA 3R7LA 5DTJA 3LFHA 3ZVMA 1JDUA 4QEZA 1ENZA 1EXMA 2IEGA 3EA4A 3IQFA 5B7PA 1YZQA 4NZNA 1COWD 2Q5FA 1RWOA 1KEEA 4MPJA 1U04A 5TGTA 1U1EA 2DHRA 4KUEA 4BQEA 4ZYXA 1SC3A 3EDYA 2XR1A 4KQGA 8ABPA 3IOYA 4X1YB 1RAEA 3CNQS 3WYBA 2Y8EA 3W34A 1NXTA 4FJ0A 3O95A 1YWGO 4M88A 3M6WA 3QE0A 5K51A 1DDOA 5CLJA 4L3VA 1MJ5A 1GKIA 5K6TA 2EZ4A 5CB6A 5DYIA 4YJFB 2M6KA 4BFTA 2L18A 1VA5A 1J5PA 2ZDQA 1PQPA 3TPZA 1DXHA 2HADA 1YFKA 3HUEA 4GX0A 3K0SA 1I1LA 1CR1A 3EVCA 3NV7A 3GOQA 4D9BA 4EJSC 1CEQA 4O7YA 1MX5A 2RONA 2GBPA 2VP5A 3RUPA 1FX0A 3DE7X 2YY7A 4WN3A 1HDRA 1FUKA 1TFUA 3H2JA 4FLFA 3CRW1 7MHTA 4W8HA 2CVOA 4QUAA 3PRHA 1VSTA 2VP6A 3W0LB 1XCPA 2WIGA 2RGDA 1FMFA 4KR3A 5CEJA 3HKBA 2ASEA 1B6RA 2H1RA 4RS3A 1IVYA 2XECA 3SE7A 2JLAA 3GMSA 1GSAA 4X1IA 4R5MA 3F6RA 1RHMA 2AFVA 4DM7A 3VPFA 1TRHA 1JFVA 3CR8A 3C3KA 1ISIA 2VDLB 1WEHA 2RI1A 3D81A 5DHPA 1Y5IA 1NQXA 4EHFA 3PGKA 2LRHA 1PS9A 2HF2A 4IOMA 1YR6A 4LXUA 3LZCA 4RZUA 1E2EA 3TVYA 2GM3A 2FZWA 2V03A 1YIOA 2ACWA 3AHEA 4J91A 3EZ9A 5IZCA 3QOWA 2F2TA 2C3UA 4Q05A 4GNRA 1MVOA 5E7IA 4I5GA 4FFMA 3ZYZA 4XFDA 2MHCA 2XF2A 1RJ9B 4CDGA 4GW3A 1R5NA 2ZFUA 4J1QA 1I51A 3IHWA 2R25B 4B80A 1WS6A 2QVGA 3R8FA 3A1UA 3IUPA 2ZS7A 2UXDH 5DHUA 2GHTA 1QAOA 3IERA 4O5AA 3UF0A 5F64A 1YQWA 2X7JA 4WK4B 3KREA 1NW6A 3LS2A 1SFRA 1F38A 3E70C 3FN4A 4YAJB 4O1MA 1WY7A 4D9NA 4XQ9A 3USES 5JO9A 4HDNB 5IXSA 3IPRA 4M0MA 4FX5A 2HLDD 4OIFA 2WW8A 4I99A 4R0NA 4XYEA 4UVGA 1IG3A 2Q1TA 1TPZA 3U54A 2UZ3A 4U7DA 1BDIA 2HU2A 5M7EA 3FPLA 3V8NA 3GFRA 4D9CA 3WDLA 3WISA 3DTFA 2Z1NA 2B37A 1WR8A 3DP7A 1ODJA 4D26A 3T4PA 3OIVA 1EH5A 1CJUC 4WIAA 4NYJR 2WAMA 3GFBA 1WDWB 2WQ7A 2UXDB 4P3NA 4ALIA 4NMLA 4HYQA 1ZS9A 4ALNA 4TQSA 4PZAA 1Q83A 3EXIA 1E6LA 3AJDA 1DX9A 1PUJA 3WWJA 2O14A 1EHIA 1E77A 1ID1A 1XWIA 3Q8PB 4B83A 1EBUA 4M1YA 3T7CA 2ZIWB 1ULSA 2PVPA 2P68A 3OOHA 1GT6A 3A1VA 1OYYA 1B0ZA 4HDAA 3H11A 2VHXA 4Y9TA 2ZTUA 5CH5A 4EHKA 2Q7OE 3UJ7A 4AY3A 5AQ1A 5TDHA 2GEUA 4RTSA 3DUFA 2INGX 1OBFO 4U7HA 1BMQA 2EW2A 2JIZA 5D6OA 5F4ZA 1YQDA 3AUSA 2AJLI 5IKMA 3NANA 1VKJA 3GW8A 1I94B 1CUVA 1RYBA 1J07A 2KBEA 2XQKA 2B3TA 4TMYA 4HDMB 2W2QA 4Y6QA 1DHTA 3DFIA 3DE2X 3MVEA 2PO7A 1LC0A 5LNK1 1ZQ7A 3OFKA 1PR6A 4RAZA 5DLEA 4M1KA 3HV0A 4C7XA 3IE1A 1Q1QA 3JQ8B 1A9TA 2V8OA 2PYIA 4UNIA 2WNHA 3EXEA 1Q0PA 3G17A 3PEUA 2EKBA 1WCMG 4N48A 4OV6B 3T7TA 3HO8A 2YHAA 3K32A 1KC1A 3VOBA 1BZYA 2ZSHA 4P6VF 1EX6A 3KYCA 5DLPA 4PZUA 1W44A 4PFQA 3S29A 3GD7A 2XUGA 4F7DA 4P22A 2BE7A 5CP8A 3S81A 2IPOA 3DAHA 2YJZA 3BMQB 4LS3A 2HO5A 4KVGA 2Q5JA 2J6HA 3GR6A 3SC2B 2FWJA 4G0UA 3TLZA 1NZFA 1AA9A 1PW7A 1J00A 5ARCA 5KTRA 1ZMBA 3SP1A 4V0OA 3IJ5A 4I4LA 3M0EA 2YNMA 3F4BA 3ZVLA 4Q24A 3RIYA 3EYWA 5D3MA 3ITDA 1R6BX 3RFVA 4AKEA 2PUFA 5DCWA 2ATLA 2Q27A 5IM4A 3JTMA 3WZ2A 3G7SA 5TIIA 1FIUA 2B2CA 2YCBA 3GVHA 4K6MA 3PPXA 3FTEA 2K87A 2A4MA 4CTNA 3VKGA 3K9QO 4G25A 1MO3A 2R87A 1G8YA 3C6XA 3DTGA 4G0XA 3X2SA 1G0NA 2FPLA 4LV5B 5FO0A 3G0HA 2FSUA 2C1ZA 1RYHA 1FVOA 1QF9A 4HPJB 4RTKA 5FNVB 5FLYA 4DYDA 4LV6A 4NU6A 1DRWA 3QFRA 4TYMA 2B20A 4NYIR 2NTYC 1W36C 3MIIA 4FI3F 4LMAA 1O5OA 1AKWA 4G36A 2ZULA 4QUKA 3WK6A 1HKHA 5DDIP 2O03A 3JVEA 3AY0A 3O93A 4CLEA 1VHJA 2C54A 4JN6B 1CRLA 2W6QA 3AONB 3ZWAA 2YWDA 1RWNA 1YVRA 5CPFA 4M8IA 5AIBA 2JAWA 1JQJC 4OJQA 1JH8A 3KHHA 5EUCA 3RHSA 4ZVKA 5JXJA 4RPCA 4LSMA 2IX9A 1SXJA 1XJ0A 1R3DA 3HS3A 2BHNA 4DS3A 5BWVA 4X44A 3TL6A 2WVAA 2ES4A 4Q4HB 3IAFA 3L0YA 3C8HA 2ZR9A 3TSCA 2Y6VA 4YUXA 4BO6A 4F6CA 3FCUB 4AROA 4PGGA 2Y1LA 3CEBA 4X3PA 4AW9A 4ECSA 1JECA 1M3SA 3LQ4A 1RLIA 4HX9A 2BFDA 1ISSA 3ETJA 2PBZA 4W5JA 1TYCA 2BFCA 2BONA 1BMFA 4ZAXA 1YNOA 1FW6A 2ACKA 1AN7A 2R2GA 1QOQB 1ZH0A 3QEOA 2X0DA 4B8YA 5T3UA 4YUVA 5AD1A 4ZTUB 3WKDA 1SPBS 1O77A 1X6VA 3DBRB 5KFAA 3JWGA 3CZPA 2ASJA 3K2IA 1LNSA 4BDTA 1XZQA 3VC1A 4BJ1A 1F8UA 3DO8A 1G4AE 3V34A 4D9MA 3WNZA 1W2WB 3Q8QB 3LKVA 5F7ZA 3KJZA 4R01A 2Q6VA 3SZ3A 3OE1A 2ZYIA 3UMGA 1PDOA 3CX8A 2Q2OA 4IZ6A 5LQRA 3I72A 2OP1A 3JSLA 3B6IA 3MLEA 3IOEA 3CA8A 5C1PA 2TMDA 1IQ0A 2FMAA 2C2XA 3MWKA 3QXJA 2V4QA 3N1UA 1PZHA 3NDPA 2Z8ZA 3ZDXB 4BV9A 2W2KB 1RXYA 2Q8NA 2VEOA 2HGXA 1UWKA 2KJQA 1U8FO 1AIPA 4LXXA 2O0MA 4F4FA 1WQ3A 4RV5A 2OXRA 4OI0A 2FLPA 2PKRA 4BAZA 1DO2A 5CIWA 2UUBH 3VSDA 3O83A 1WW2A 3AESB 5ALUA 3W3AH 5JFTA 4LJ6A 3QMPA 2YFHA 1QHHB 1KJ9A 3SMVA 4JI7H 1GFWA 4IOKA 2VRNA 4LJKA 4CKZA 1TWGA 2HK9A 3OX1A 3Q1KA 3RFUA 4JJ7A 5F73A 3PEEA 1GTMA 2OGSA 1J0DA 2C4MA 2PT9A 2FYTA 5HQTA 1IY0A 1JHAA 3Q7RA 1P61B 1AKNA 3G5UA 4TLAA 4C22A 3O8BA 4MKFA 5HF5A 4W63A 5JT1A 1KT8A 1TZKA 4JP1A 4EELA 1JFFA 4OGWA 3A2KA 4G0QA 2Y68A 5EE3A 4C2TA 3G9QA 1P3JA 5KZMB 1ZRMA 4Q4CA 5I7SA 1NP3A 4QIWA 2FK2A 2HH9A 5B36A 5K6AA 2UUBB 4CWAA 3OZFA 2R47A 2GPTA 2H4FA 1H2XA 3I9LA 1SVIA 3LUAA 1ZSYA 5FB3A 3C3BA 2BZ0A 4TROA 2XIGA 1HEYA 5LSAA 4RVFA 4JI7B 5ALEA 1NJ6A 2IPXA 1Z8DA 4PS0A 2C4HA 3CXRA 3SSAA 3ND9A 1OB2A 4XPIA 1NFRA 4ZOLA 3AR4A 3TINA 2G9VA 3DZDA 3RBDA 4P31A 5IBPA 3D8NA 4ZQGA 2XDQA 3MFHA 4RJTA 4RPIA 1LKZA 1WHSA 2I4OA 1WOMA 1I1MA 1C81A 3N42B 1Y8RA 1GJRA 5BPFA 3PHIA 3IAXA 5CVEA 4YACA 3BH7A 4A26A 2GQSA 2GEBA 2LDXA 5CPBA 3ZXIA 1HFEL 1AKMA 2GDZA 3USZA 3K3VA 2BSAA 3QVTA 3Q1LA 4ZJPA 4TRMA 3W6UA 4UHBA 3NRBA 3QKSB 4TMZA 3SLKA 2N42A 4TWIA 3PW2A 4IQ0A 1JDZA 1YR8A 1Z83A 1HNZB 4EW6A 4ZYLA 4DV4H 1NQTA 2W9XA 3I37X 1U9CA 3HFGA 2VQFH 3W5OA 1IOZA 2FPUA 2DTEA 2BKXA 3CZQA 3TVTA 4ZGWA 2VT7A 2P9JA 5FI3A 2P6PA 3F8WA 3P8ZA 3A6LA 5ALWA 3FTQA 2WLTA 1J2UA 1KFCB 3PZBA 5CIQA 4MGYR 2P69A 1MAUA 3JQBC 2CZGA 2I2DA 3JRXA 3TZLA 1XXLA 5JNRA 1W49A 4O63O 4JFAA 4AX4A 4XD7D 3KVNA 5DH9A 4R16A 2ETVA 1IN7A 3CVYA 3WP0A 1T9HA 4JI5H 4DA7A 4DXAA 4M22A 4RD4A 1U3VA 2AN4A 4DZRA 2EJTA 4ZVRA 3LXRA 4P4GA 3IJEB 1QRSA 1UADA 3OO1A 1QQBA 1N36H 4HLUA 1SHLA 4Z0HO 5DI9A 3HYSA 3C5WP 2KLBA 3BQMB 1P75A 3HKEA 4DV4B 4Z1OA 5JWRA 5AVJA 1HG1A 2VQFB 1JLRA 4OYHA 1NRWA 4IGIA 5G3YA 3TW8A 1OZAA 3W9YA 2ZRLA 1DBWA 4P3PA 4FHEA 4J0DA 3JQ7A 1WWKA 2C92A 3AL2A 3GLHE 4FQ7A 5AKHA 3ZK7A 2PUAA 2B3DA 2ZXEA 2I87A 1XN1A 3AYZB 4D56A 2NZJA 1HNWB 3SYMA 2I9PA 5HGJA 4IV0A 1ZN8A 3UC5A 5EIXA 3AH8A 4XDZA 2Q21A 3FSJX 3ADBA 5EZYA 3ESYA 2GR9A 2YZKA 2G1PA 5EJ6A 1HK7A 4QAJA 2P9HA 4D5GA 1ZHFA 5H4HA 3M7IA 1N36B 3SR4A 5CCEA 4FHFA 5DJ5A 3KKZA 4P92A 4OHRA 4RC9A 2IWRA 1F3OA 4RB1A 3GDWA 2J5BA 4AY2A 4QIHA 4DJEC 5A1TA 1UCFA 4QYTA 5I9IA 4MKZA 2B98A 2PYZA 4LF4B 1MBZA 3RDPA 2PPLA 2WA1A 1X1QA 2RKBA 3VFDA 3SYLA 4G0ZA 5CHEA 4B3RH 4L16A 3IP8A 1KK2A 3FHLA 4TS3A 2W83A 2GRUA 2J3HA 4EHJA 4DPLA 2ZSFA 1Y6RA 1N1DA 3V8EA 1JQ3A 4IS3A 2R66A 2BHSA 3QGMA 2FSPA 4FS3A 4J3NA 3WRXC 1CRQA 1NN0A 3VOSA 1VHDA 1DAPA 3AETB 4BTEA 3TTXA 4RTQA 3OZGA 2D6FA 4HH3C 1D0VA 3Q3VA 3I76A 4QPCA 1KMHB 5BORA 1K7CA 5DBIA 3BQNB 1L8XA 1T4CA 4R8KA 5JSZB 3DDHA 3RHTA 5T3YA 3OKPA 4BLTA 2Z3WA 2CY0A 3DULA 4EYSA 4IOJA 2WTFA 2HC9A 2DLNA 3IR6A 5FEMA 1N9GB 4CE5A 4B3RB 1Y6ZA 3QW4B 1ORWA 2Z09A 4QXRA 4CKCA 5H9VA 1P9NA 3BFPA 1H0KA 3T9FA 4PHFA 2HV9A 2OQIA 5K5EA 1D2GA 1JHMA 4NX2A 2GS9A 4K26A 4N3BA 2JZNA 1B6GA 2IGTA 1TK9A 1VM6A 4XUCA 3GVCA 4MI3A 4MRMB 1P8AA 1ZUIA 2C8KA 3CURA 4AY4A 1PT7A 3E5RA 4OB7A 4JP3A 4UM5A 3OQHA 4Q16A 3QOFA 3RKSA 3NT5A 4FNGA 1JE0A 1E3QA 2AI2A 4WCFB 4GKVA 3K0FB 1LI7A 1UFOA 3DMTA 4D0RA 2IUYA 1XMOH 2WYWA 4MV8A 2V7UA 4FOLA 2OHOA 4B3SH 3OT1A 2FKLA 2IYOA 1QF6A 3AZOA 3H16A 2P2YA 2E4YA 3ASVA 1A98A 3BSFA 5CH8A 1S3FA 3VJLA 3EISA 2RHMA 3B89A 4NNJA 4P0TA 3AEYA 1GPH1 1UC5B 1FUYB 1C1DA 3PXGA 4E1BA 4ZAVA 4FYJA 2GEJA 5K0SA 3CYFA 3OBBA 3D7MA 4CF5A 3LC2O 4KG7A 1VGVA 3IUEA 3NC4A 1ZIXA 5JROA 1JIKA 1QKKA 4EG6A 1OBDA 3HYNA 3U4QB 2PMCA 4PZYA 2R8RA 3GZTB 2IW1A 4OHBA 1SC1A 4DRXA 3DKPA 5BUQA 4I1PA 1CQJB 1W0CA 2IHTA 3WBKA 4ZCQA 1XMOB 1XZKA 4BTLA 3ZNOA 4A91A 4ZVTA 1W25A 1XZLA 4GX2A 4BBAA 1EDZA 4IRXA 4EO9A 5HIMA 3E1SA 2BP7B 6ADHA 3H7IA 1W8DA 2EFCB 5LQKA 2WZBA 2WV7A 1QHGA 4RHCA 1DE0A 3DTNA 2EGUA 4EY3A 1K4KA 3OZRA 3QXXA 3W3AD 4PANA 3DAOA 4OQEA 1EK0A 1JSZA 2QW8A 3IUJA 2HD4A 4ER0A 3ZDBA 3R5XA 4R7RA 3R9XA 1PL6A 3BMNB 2V9PA 5KWVA 2YTZA 3LBHA 2H2FA 3PR1A 3WY9A 4F4UA 4QSMA 1KMCA 4NLLA 2A5JA 3PDIA 3R3YA 2N47A 1R0SA 4KREA 4LYHA 1NVMB 4YCCA 3M6IA 2WAAA 5DHRA 4OMUA 3K9BA 2P2NA 5P8WA 2OHIA 1LK7A 1DT5A 1FC0A 3ITNA 4TLDA 5JMWA 1RTTA 4TSFD 4I36A 5BWXA 1O6ZA 1W1WA 5EHQA 1U8ZA 1KO5A 2ROQA 4B6SA 4MSUA 3ILYA 4IEEA 2JK0A 5PGMA 3TKAA 4ENVA 4HCJA 1LTKA 4X66H 1JILA 3HL4A 2GBCA 3V6JA 3MGGA 3UENA 2AW3A 2WWHA 3DONA 4OQZA 3RFFA 4QSHA 5E0KB 2DCUA 4OXNA 4JNCA 3L7KA 1L5MA 1JIXA 3HR4A 3PJFA 2B9EA 3NM4A 4K28A 5BO5A 1WMEA 5T7BA 2VRBA 2C5EA 3R5TA 3T7DA 4KMMA 3V1KA 3ANNA 1SC6A 2XT9A 1SU8A 2PUHA 3SQDA 3G0DA 2VDNB 4AG6A 4D0NA 4MO2A 2GCOA 4JXZA 2X5XA 3COPA 3DBLA 3HCDA 1H4VB 1TJNA 3M49A 2VFAA 3TQQA 2WPDA 3BWBA 2OLEA 5T67A 3I01A 4NJEA 4QA9A 1X42A 4HS9A 4LOKA 3SSNA 3DV0A 1UFKA 4X66B 3C3YA 4PYLA 2Q6LA 3SR0A 4XCVA 3D3KA 3VU8A 1DIBA 5JRDS 4R1MA 2SCUB 3PYLA 4ALJA 3E8XA 1VBMA 3FIJA 3WK5A 2RSLA 2OV8A 4CQJA 3A8TA 4DPMA 4L02A 3UWKA 5KTTA 3G9UA 4YGXB 3VH3A 3PE6A 2QMQA 3FE2A 2DPXA 3QUQA 1Y4DE 4RQBA 3LPMA 2IYTA 2VQ3A 4NFLA 4E5PA 1GPMA 4IILA 3E6AA 2EKPA 3W8EA 4UQOA 3EWSA 4H7EA 4JJEA 5CFLA 3TGWA 3DEJA 5TMBA 1XLTC 1V5EA 1N3BA 4R3WA 5KNCA 5TC4A 4BO8A 3LHKA 5ETJA 4BFZA 4DFDA 4LMPA 2R93G 1F3LA 2AOXA 1C0PA 5CJ2A 4A3FG 5K0JA 2NU7A 2VPXA 3BPSA 4E33A 1QTRA 3L6CA 5FAKA 4LHYA 3IUSA 5AT1A 3K31A 1Y5RA 5CFRA 4UNNA 5TT1A 5LOVF 2X8BA 3G2OA 1IM5A 3W8RA 4ZHQB 1WQ1R 1NSTA 2FPKA 1P3DA 1SK8A 1HE3A 4Y1FA 1TQHA 3ASUA 2QZ4A 3LNTA 4EO4A 1PL7A 1YBAA 2IBKA 3V6HA 1ONNA 3AKCA 3GP3A 3EF3A 1U0NA 1GTVA 4MRSA 1NLFA 3IMGA 5DM60 5EESA 3G68A 4I55F 4JENA 4MW9A 1ZKDA 4DR1H 4I5IA 4DIDA 1UBFA 4J1NA 4ENUA 4LDAA 1DKQA 2CLFB 1VOTA 4QZVA 5B6IA 1E7QA 2DE0X 1HGXA 4IDPA 2ZW9A 2MJLA 4F3YA 2GETA 3FDXA 2PXCA 4O4LF 4R81A 1NUUA 4LDRA 2L42A 2Z2YA 2IFTA 3MQ4A 4M9RA 5IAGA 2ZRKA 1FU7A 3LH5A 4WEOA 4UHHA 4U8HA 1ATIA 2X0SA 3AZQA 1UJ6A 2HDKA 1RLTA 3TKYA 1I80A 2F9LA 1R6VA 2BMVA 1ORVA 2GN6A 3EIXA 2O3SA 4F2HA 3R23A 3WLEA 1CYEA 2ETXA 3WLLA 4B31A 1FTWA 1XZBA 2R7KA 1RWWA 2H31A 3HPQA 2AG6A 2FQYA 4BMYA 5BSGA 1MORA 4ARSA 4E6NA 1YZYA 4HP8A 2X2PA 1HFJA 1DAFA 2H4WA 3QUSA 1E4YA 1LA2A 3X1ZA 4B44A 1RPAA 1VL6A 4HAWA 4QJIA 2Y77A 2AFHA 2JI9A 3IT2A 2Y0BA 3P52A 2XJ9A 5LBUA 4EA8A 1HWYA 1KIFA 1TCBA 3E0XA 1DPFA 4NDAA 1QH8A 1PV1A 4HQKA 4B3BA 3G0OA 1T8WA 4YECA 1D09A 3TEKA 3HFSA 4R9SA 2R86A 3TTUA 4N8EA 1P31A 1YR7A 4Z0NA 3EH2A 3HDHA 3PB3A 4PZLA 5LJIA 4NYEA 4I1RA 3F6SA 1ZM2A 3QVJA 1FFXA 2V6FA 1MV5A 4RTLA 3FDZA 1JL3A 3P2MA 3F8NA 3G2QA 4QYMA 2XMBA 2APJA 3F9RA 4M54A 2ZVPX 7REQB 3GRYA 5GONF 4OHOA 2XWQA 4MICA 3R41A 4BZQA 3VTFA 5EGSA 1I6WA 1RYYA 1TQ6A 4L27A 1A9XA 1OE0A 1BIFA 4KXVA 2XNDD 1Z2EA 2EXXA 5IFKA 2OZLA 2DR2A 3LCUA 5E9WA 1LSSA 4XYLB 4CT5A 4D3ZA 3CGGA 3TQIA 1OZ0A 3G1WA 5KT2A 2FWBA 4OX9H 4PLZA 3MMXA 4BJ5A 1ZAKA 1XD9A 4MX8A 3H9UA 3NRJA 4O0LA 3NTOA 1SY7A 4YRGA 3JSNA 1NXOA 3NIFB 2VH5R 5A6SA 1A76A 2WSSD 1HQKA 1GA6A 5FT9A 3PFNA 5ENZA 1WCXA 5FOWA 3VNVA 1AS0A 2X3YA 4K7JA 5FD5A 1JA1A 4DV6H 3N7TA 4LQCA 4YIKA 1RHJA 2HBRA 2IUFA 1OUMA 1I6LA 4G1VA 3FTNA 3AU8A 4JIGA 3MMPA 4CR6A 2D3TA 3KV1A 1JR6A 2AOTB 2OORC 2QI9F 3KAJA 3UOWA 2ZR7A 4RDCA 1UFVA 2Q62A 1J9GA 1C4OA 4DMFA 1RHUA 1PDWA 3CUYA 4H4EA 3PYMA 3WWOA 3GIDA 3RJZA 4PRLA 1XTZA 4ID9A 4QXOA 1XTUA 4OX9B 4D96A 2AOUA 2IYPA 4CJXA 4LK2A 3QNUA 2FW8A 2FB9A 3UAZA 2ZB7A 3F7NA 1V11A 5B3KA 3ON5A 1TUEA 3PDJA 2NUAB 2JA1A 2C9YA 2E2HA 3BGOS 3UT6A 2AQIA 4NC9A 5L8VA 5KKCA 3ZOKA 2JJYA 2ZCUA 1RBMA 1ZVQA 4BFUA 4ZQHA 2IE0A 5AXDA 4IJVA 3AF4A 1L7EA 1XK5A 2Q1UA 1OTYA 2D7DA 3VPAA 3VO1A 1ZINA 3GFGA 3CEAA 3H5WA 4WXHA 3VSBA 2CVQA 2OBFA 1LD3A 2PGLA 3WLRA 3EDRA 4S1VA 1RJDA 1YBVA 1S3IA 4ITRC 4AO8A 1CFZA 2DFVA 2WABA 2OXFA 5T5QA 1CJVC 1T8RA 3W4JA 2JEGA 2VUMA 2LDBA 3F3YA 1KTIA 2P4QA 2JIPA 2PCJA 4L6IA 1DNPA 4F4JA 2YXDA 4E0BA 2ID7A 4NAVA 4N3GA 3UB2A 3E0QA 3Q5GA 5IK2D 2NT4A 3VYSB 1OW3B 1N2HA 1ZYUA 4W1PA 4PIVA 4DA6A 2O8BA 3BD9A 1UZAA 4LZJA 4MKXA 3QLUA 4I1UA 4QU0A 2GNAA 4BQQA 4JVOA 4HDSB 1PGPA 4XB2A 4YLYA 2J85A 5JDCC 1CERA 3U44B 3RF7A 1KMMA 1MQ9A 2VBCA 5GY7A 5BW6B 2PS3A 2J6TA 3KCNA 2W9BB 4UM8B 4OAPA 1RI5A 4U2FA 3QU9A 2XVXA 3E3AA 4EJ0A 5KX5B 2GKOA 3LRPA 2QLMA 5AP9A 2R7ZG 1H65A 4HT3B 3JAWA 5KOJB 3R9RA 4WECA 2ANCA 1IHPA 3AWDA 1D7AA 3E22B 4K03A 3H1GA 2HVSA 4Z99A 1PVVA 3E03A 2LBPA 1MUUA 5IG2A 3GWGA 3F71A 3ENZA 2ZIXB 4WD3A 1A2QA 3PEVA 3C14C 2Y4NA 4BP1A 1GUAA 1KAQA 3G8AA 8MHTA 3L0CA 5I7WA 3MWDA 5E7QA 1NX9A 5EYPB 2XUAA 5EUQB 2J07A 4P7FA 5ERYA 1ZOPA 4YRNA 2H4ZA 1UT6A 2OZEA 3ROMA 1M34E 2YVKA 2JLUA 1P1BA 3BFJA 2HPHA 4LCJA 3IAAA 2A1UB 4C14A 4KN9S 4BVJA 3C16C 4BBJA 5ESRA 2DLCX 4NPHA 2RH5A 4IQGA 1CF4A 5AJZA 2A8YA 3RC7A 1XNQH 2ZJYA 4QYXA 1U1DA 4NR0A 3V3TA 5DTQA 1PTJC 3CH4B 4HGQA 2DFNA 4JGGA 1JV2B 1EP9A 3OJCA 3OPVA 1D2HA 4GMXA 4RZ3A 4WEQA 3IIKA 4JJ6A 1ORIA 3H9GA 4ZALA 2GK4A 1EA7A 1IY8A 4PM4A 2XE7A 2C0PA 3L79A 1NUHA 5KJ6A 4PRKA 5EXPA 2J32A 5CT8A 3GNLA 2WF7A 1P0CA 1XLVA 5DP2A 2V0CA 1P7VA 1U3GA 2ZI7A 2VOJA 4ID3A 3K8YA 1JKIA 1E1LA 5KG5A 5LQAA 4NV1A 3ZEAA 1VMDA 4JXKA 3IAM1 5EJ7A 3B1JA 1WPXA 4NNPA 1YR1A 1XNQB 1NG9A 4WZ6A 4Z0PA 3NCTA 3CF4A 4UULA 4MV3A 3GMIA 4B43A 2DVMA 4HMQA 2EWVA 3EMVA 1EFPB 3T4XA 2R8BA 4D8WA 2YXNA 2C7GA 2BFFA 1XSEA 4X0EA 5K3FA 3MTJA 2R3SA 1L7QA 1US8A 4JB2A 1CKEA 1HDGO 1CZUA 1ZI6A 4KH1A 2E4UA 1AQIA 1AZTA 5C7IO 1VJ1A 1DIRA 3LUBA 3WLOA 1HDCA 3BZBA 3THYB 2J0UA 4PHTA 4L7QA 3G89A 1JX6A 4Z4IA 2GPWA 2Y92A 2A84A 3NBZC 3E4DA 1Z7BA 4HN4B 4A0SA 1QQTA 1CUEA 3W3ZB 1S3SA 4GPZA 2D0DA 2ZITA 2VSYA 4DCSA 1N5OX 1WP4A 4EGAA 4NE2A 5F7OA 1HLPA 2W7TA 1OOEA 1UOQA 2QLBA 3QKRB 3IO5A 1B8PA 2GN1A 3GVXA 3E81A 5JVDA 2JZOA 1X1BA 1NZDA 5B6JA 5T4EA 2WE7A 4JSRA 5BP7A 2VTBA 2G08A 1V41E 3BC1A 3OT5A 3BULA 3GUCA 3AP3A 4BECA 4FC6A 2IU4A 3THRA 4YJ3A 1CEXA 1Z8FA 1EEXB 4WFKA 3UHPA 1IVNA 1KRHA 4EYEA 3QY0A 5K3OA 1PWHA 2RCYA 3CX3A 4L4ZA 3NBKA 1NL3A 2QW1A 4IPTA 4TUYA 4J9MA 3OZIA 5EXXA 3W8DA 3FHOA 4PYMA 5ESWA 3L7AA 1LSOA 1T4MA 2ZEJA 4LWOA 4Q1EA 4ZT6A 3OCUA 3QELB 3ABRB 1C30A 1WDMA 3G9ZA 3CMMA 2PV0A 2ZJFA 3DFUA 2WICA 4DOMA 2OLJA 1DGQA 3I9NA 3A1CA 5B1SA 1HRDA 4G9EA 4B45A 4KCGA 2AFIE 2HFKA 3R9WA 3WLHA 2QN1A 4NAUA 1Y5NA 4D4GA 5AI0A 1C80A 5HJ7A 2COIA 1PZGA 1VMKA 4TLBA 3Q9UA 1QG2A 3JRWA 3HP7A 4IIJB 2BFBA 4ZCRA 5A5DA 2ZJOA 1NC3A 3BQ2A 4KGDA 1RRPA 2CLDX 1WF6A 3MTQA 2AG1A 4B3TH 3ILXA 2ODQA 4HPXB 3B6KA 2I6QA 4GIBA 2YCLA 4RNCA 2HIAA 3DDCA 3MG9A 5EMNA 4G0WA 2BZ1A 3G6WA 4YRFA 3AHGA 2ZJ1A 5EZQA 4YQFA 4PC3A 2ID9A 5JH7A 1OLOA 1R6DA 4NCNA 2B61A 5DGIA 7ABPA 5G1OA 1C2TA 2I2AA 3KR9A 1TO1E 4F9EA 3ZWBA 2ORED 2NQTA 4IZHA 4JLDA 3DLIA 2B1JA 5EFZA 3WJ1A 3RRZA 1OAOA 5F35A 2WEKA 4I50A 1SHZA 3W5VA 4EJFA 3I1YA 3TCXB 3FZEA 3GBVA 4GZMA 1TC1A 1OWNA 3R5KA 3H5VA 1T1GA 1ZK2A 4OFBA 5JISA 4XGKA 5LMCA 4CQMB 3UFXA 5JD5A 2DY0A 1Y7TA 4B3TB 2FUCA 3TOZA 4Z2AA 4IXNA 5LZ2A 4EPXA 5J4VA 3OCWA 2XVAA 2R8IA 3ZKAA 4JWTA 1TADA 2WM2A 3OMLA 2M6SA 1JIIA 2Q1SA 4LHXA 1C1XB 1ZVVA 3NRCA 2OBXA 4IH9A 2AKYA 3VR0A 3EVEA 3UO8B 3MBOA 2DMRA 1I94H 4QDJA 4CLHA 4A3MG 3P19A 4UBNA 1V4YA 4XIFA 1RVDA 1XXHB 4JL6A 1P5FA 5DBEX 2GQ0A 3FYDA 5JNTA 1E7WA 3EVFA 2XKKA 3MJSA 1YRAA 1A0IA 1JQLB 1QCCA 1GYRA 2GD0A 3T5CA 1EM8A 3WQRA 2CDRA 2CB0A 2QAGA 1I1QB 1KYQA 3DO5A 4CEIB 1QQ7A 1YS6A 4O2BF 1VL1A 2X1HA 1Z4PX 2BKEA 2HQRA 2ZUCA 2B1IA 1YRWA 4JH0A 1M1YB 5FV4A 3F5FA 3GQBB 1FMCA 4GZ5A 3ESRA 3FMVA 2HCRA 4J16C 3O9MA 4C6SA 4DM3A 2F8LA 3AUXA 1JQDA 3KQYA 1P8JA 3Q11A 1P2VA 3TH5A 1PQUA 4CNQA 3R3XA 3EIHA 1JT9A 4O02B 4HQ0A 1JEDA 4C43A 4N3NA 4N47A 1PS8A 2NV6A 1OVGA 4U5QA 3AILA 4O2LA 2PMZA 2X3UA 1C0IA 2XQJA 5E6UB 4DLSA 1X1TA 1FYXA 2GUWA 4A3DG 4CHGA 1MIOA 2J5RA 4G09A 3LXXA 3PR4A 3FB1A 1ONPA 3I45A 4HSEA 5T8KA 3UV7A 2WHPB 2XCLA 4DAAA 5JRZA 2OBYA 3BX1A 5FAXA 1NJGA 1IPFA 1YE3A 1O4VA 1GPLA 2G67A 1TCUA 4MGIR 1TRKA 2J3MA 3MUOA 1ODLA 2A9JA 4OOFA 5A1JA 4BX9A 2VPQA 5KG6A 2P2LA 3PENA 5JNVA 2ZUBA 2G0TA 3E7FA 2B25A 3ZV3A 1GPDG 5JCOC 5JCJD 3PZPA 2ZT6A 5IMSA 1M1XB 3OJLA 3F6BX 2EKZA 1O8BA 3V4ZA 2CUTA 1GU0A 5LNK6 5FFNA 1ZCBA 2FPRA 3WRYC 2FE1A 1UK6A 2CFMA 1M2GA 3H5TA 4DL2A 4BATA 4MNTA 5DYNA 1G20A 4ZVMA 4IJUA 4DLYA 1KJNA 1QPBA 2D13A 1FQJA 4Y7DA 3GIIA 4QQNA 1TA8A 2WNIA 4ENQA 4AYXA 3H1BA 3C8DA 2W57A 4IIDA 3TZCA 1ECJA 2ZRMA 1GAWA 3GLIB 2ZS8A 2JHFA 2P8JA 2XADA 4TVBA 5HDQA 5REQA 1P72A 4B7UA 3GAFA 3EUWA 1L8AA 3H0GG 3OVMA 4EBCA 1YOBA 4Z1MD 2WHRA 3EZYA 2PT6A 4FONA 3NMUF 3VH1A 3U26A 4A5SA 4HPWA 2YJNA 1QK3A 4BGUA 3DDWA 4FMDF 4A73A 5IASA 1H22A 4ZOEA 5JJBA 3D6NB 2GB4A 3JARA 4UPEA 3O4GA 4TMVA 1ZMTA 3WLAA 1U6JA 2R8JA 2DBRA 4UPVA 2HO4A 5F3RA 1N0WA 5E9QA 5CB4A 3PD7A 2MDTA 1UKZA 1NPDA 2BI7A 3GB9A 4ESVA 2VK4A 2Z30A 4HB2A 4BS9A 3R7BA 4BPRA 2HIXA 5IJAA 3ULKA 3U6KA 2W6PA 5L1KA 1LDEA 4KX3A 1PSWA 3B1VA 4LGMA 4R40A 4RH1A 2XRFA 2YVUA 1HX7A 1Z6PA 3RS4A 2P79A 1H2HA 2NVXA 3H9EO 2B63A 1L5SA 2UUPA 4QD3A 3RD5A 3V2HA 1A5TA 3VI4B 1XT6A 2YINC 3ZGOA 3EG9A 3U80A 3EGIA 3UXMA 2C83A 2YV4A 5KG0A 2N3ZA 4RZQA 2PKWA 4D97A 2J87A 2O2SA 2H16A 2BH9A 2BEWA 1DRVA 4MA0A 1GAXA 4FDVA 5KCZA 2PD3A 4R41A 3TSZA 3HB9A 2IKQA 4S3MA 3FRJA 1XVIA 2ID4A 3KBOA 1IJBA