5C1OA

Crystal structure of amp-pnp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
297
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 88
structure length 297
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1oA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1oA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1oA01
2CNQA 1C3OA 3GLKA 3BG5A 2Z02A 4YB8B 3Q1KA 5FNVF 1Z2OX 2VHEA 3LP8A 3RV4A 5K2MA 5BPHA 2CNUA 4O7RA 3R23A 3ORRA 1OBDA 3JZIA 5BMVF 2PVPA 4O7VA 3G8DA 1JKJB 4M9CA 1KUTA 4IIJF 2HGSA 1PK8A 4XYMB 3WO1A 4FFRA 1UC9A 1M0WA 2W6NA 3JRWA 4I55F 4M98A 4TUYF 3VPDA 3AW8A 1BXRA 2YZMA 3AX6A 3TW6A 2XD4A 5CA0F 4FE2A 3TIGA 1Z2PX 2V5AA 5GONF 2WYOA 3LWBA 3VA7A 4L1KA 5JVDF 2I8CA 2R7KA 4MV8A 4C5CA 1CQIB 1KJ9A 1M6VA 3N8DA 4FFPA 3BSYA 4TV9F 3I12A 4DLKA 4EA7A 1KEEA 4IWXA 4O84A 2GLTA 2W6MA 1EUDB 3ETHA 4M99A 2R86A 5HBRB 3BSSA 3R5FA 2W6OA 4MV9A 1KC7A 5D8DA 2YZLA 4WBNF 4O2AF 1VBHA 2ZDGA 1OBGA 2W70A 2R84A 1EHIA 5LP6F 4E4TA 3TINA 1WR2A 5KX5F 3NUAA 1GSAA 1JLLB 2IP4A 1B6SA 3R5XA 3MWDA 4MA5A 2YYAA 3N6RA 2W6QA 1ULZA 4O82A 3RFCA 3RUPA 3V4ZA 3OUUA 3ORQA 4YJ2F 3HO8A 2QF7A 1B6RA 1EZ1A 3TQTA 3WNZA 2GQRA 4EABA 1T36A 2W6ZA 4MV3A 2CNVA 1AUXA 2DIKA 3UFXB 4I50F 4EAAA 4O7NA 3V4SA 2R7LA 4M9UA 2R7MA 4O83A 4MV4A 2VPQA 1I7NA 3ETJA 4EA9A 2YL2A 5LA6F 3KAKA 4O2BF 1SCUB 4HNVA 2J9GA 3GIDA 3JRXA 5LYJF 4HNUA 4RZQA 1EYZA 4NYEA 2OLSA 1JDEA 1DIKA 3VPBA 5C1OA 2HJWA 1W96A 3WO0A 4HQ6A 2I87A 5DMXA 1E4EA 4DIMA 5JQGF 4I4TF 2YRXA 4WD3A 1Z2NX 4MA0A 1UC8A 4Y8VB 1VBGA 1GSHA 4O4IF 5C8YF 1M0TA 3RV3A 4EG0A 2DLNA 1GLVA 2YS6A 1VKZA 3TIIA 1KJJA 2W71A 1IOWA 4FU0A 1AUVA 2FPIB 3VPCA 2PN1A 4O7LA 2XCLA 4IZOA 2DWCA 4O4JF 4YAKB 2P0AA 4XYLB 1GGOA 2YWVA 4O7YA 2Z04A 5EZYF 3U55A 1KBLA 4FFNA 2GPWA 3KALA 2CZGA 4IHJF 5JQWA 3K5IA 2R7NA 2DZDA 4O81A 2FPGB 4ZHQF 2I80A 3QFFA 2VQDA 2YZNA 3U54A 4C5AA 3MJFA 4O7SA 2NU7B 4EGQA 4YJ3F 1CS0A 4MAMA 1IOVA 3SE7A 2X0SA 1PX2A 4ZOLF 3R9RA 3E5NA 2NU9B 4FGRA 4XX0B 4EGJA 3G8CA 4TV8F 4O7ZA 5LOVF 5BPFA 1JDBB 4HR7A 2ZDHA 1DV2A 2R87A 2GQSA 2W6PA 4C5BA 2GPSA 3R5HA 4XZ3B 4MV6A 5H80A 2QK4A 2V59A 4FFOA 4ZQIA 1C30A 4O7TA 2YS7A 4ME6A 1EUCB 3BFPA 5CAEB 4ZI7F 4O86A 2PBZA 2NPOA 3U9SA 5I47A 2R82A 4O7WA 3HBLA 4GGMX 2V58A 3HB9A 3JZFA 4HNTA 1CE8A 2SCUB 4MV1A 3KREA 2YRWA 2R6FA 5J2TF 4FFMA 2FP4B 4O4HF 2FB9A 2ZDQA 3DF7A 3K5HA 5JH7F 1A9XA 1I7LA 5LXTF 1KJIA 3MWEA 1A48A 5HV6A 4YBZB 3BSWA 3OUZA 1E4EB 5J2UF 1BNCA 4YAJB 4O4LF 4FFLA 1KJ8A 3VOTA 4IWYA 2NUAB 2NU6B 5CB4F 2YW2A 1DV1A 3Q2OA 1CQJB 2VR1A 3K3PA 3KAJA 4QSHA 5C1PA 1GSOA 2NU8B 2YZGA 2CQYA 3U9TA 2R85A 5IYZF 4EA8A 3VMMA 5KKNB 1W93A 2FPPB 1KJQA 2C00A 5CA1F 4J6EA 4MV7A 5JVLA
chains in the Genus database with same CATH superfamily
2WE8A 4OJQA 1GTRA 4HAOA 1ZCJA 1NVEA 4R84A 3MELA 5MFPA 2JEZA 1WY5A 4L4XA 4Q66C 3U3KA 3EDRA 1TW2A 2HWWA 1SCJA 3COSA 1VMAA 3Q1KA 2XC9A 3KPJA 3JQDA 3MWGA 4S1VA 3TDNA 2FW0A 1EFPA 3MFYA 4BNHA 1QZZA 3GDOA 2QL9A 5F51A 3VAAA 4RX1A 1HO3A 4A92A 3HRHA 4UATA 1YZTA 1ZOIA 1DJMA 2X0JA 2M05A 4LRYA 3V6LA 1OJLA 3U80A 4LRQA 4CC6A 3JZIA 2V55B 1B0AA 1DU4A 4HX5A 4O08A 1YZGA 1VE7A 4JB0A 2QAGC 3HYNA 3G8DA 2JANA 3NTXA 5I8PA 4O4IA 2AN3A 2J3LA 4KV7A 2KBEA 1YULA 3UUFA 5JC8A 3BORA 4GLFA 1N2CE 3HLYA 3SIRA 4L9SA 4FUTA 3P4UA 3AIIA 3RYFB 4LMYA 1V4BA 1KBQA 2ORED 1MPXA 2GVDC 1ZLYA 3VZRA 2BM1A 4ERXA 4DE5A 1F7VA 2W6NA 3ZWQA 2ZRMA 5I9IA 2AFIB 1Q1AA 2XITA 4WFQA 4AWBA 2R8IA 2BE9A 3OLVA 2D5IA 3RUEA 1ZMTA 2FRDC 2Q3MA 3TEMA 1YHZA 2HWUA 2VA9A 2PT7A 1EZ4A 4PPGA 4A2PA 1UP7A 3AX6A 5C32A 5K09A 5M2QA 3UBTA 5JXJA 4WI1A 4FDTA 2FK2A 1SKUA 3HFSA 2CDAA 1GTG1 1C41A 2XE8A 1VJDA 5CH5A 2X76A 3EIWA 4R8RA 3CFYA 2QR2A 4PFQA 2SBTA 1MX3A 1I6UA 3EPRA 2A3NA 3BM5A 5T7BA 5AIAA 3BTUA 1HSOA 1Z5UA 2IYZA 3G9XA 4JA0A 4P5PA 1Z2PX 3BB3A 1P7VA 3BBLA 1HNWB 3IJPA 1FFXA 4HTFA 1UXGA 1IUPA 2W6JD 3DMRA 2F55A 4PSCA 4P08A 4A0FA 4EQ6B 3ZYZA 2JJ1A 5FX2A 5JW6A 3R0XA 1AGPA 1XOIA 4FLFA 4KQJA 1J00A 1O7JA 2C2KA 2OZVA 1QH9A 5HJ7A 3MMSA 3RIHA 1HQCA 4C3OB 4BUJA 2Q46A 4DC0A 1NASA 2Z2YA 3C41J 3L93A 1P45A 4HPWA 4L1KA 5TF4A 1ULAA 2EKLA 2JDIA 2RBKA 1PZXA 2Y1KA 4A91A 3N3AC 1DEXA 4ZAVA 3UQZA 3VR6H 4LK3A 4ASUA 1Z8FA 5K3SA 5G2OA 3N44B 1PEDA 2KLHA 2R25B 2YVKA 1R9JA 3FFXA 4G1BA 3HDYA 3OQJA 3TLEA 2BQRA 4BHTA 4NI5A 2CW8A 1XROA 3TWOA 5IABA 1EX7A 2VTKA 2FXVA 2WF5A 2VH2A 3MGGA 3B5IA 4FGJA 2AWOA 2CLSA 2R8XA 1INLA 3QH4A 1HGXA 2O4CA 3DO8A 5IVDA 1CJKC 2IU3A 3AI3A 3WLQA 5KFJA 1GPUA 4BB5A 2DETA 2JGLA 3EEQA 1NW3A 1YB1A 3KCNA 3PIIA 1S7CA 4H7KA 3KPWA 1EUDB 2CXPA 4UCRA 1KOLA 3TQHA 3ZCTA 4YV2A 3VKVA 4M99A 5IKEA 2VN8A 2TMDA 1YCDA 5EEHA 5B53A 2QT9A 4DLTA 1H8EA 4KEAA 4JSRA 1E2LA 2NO5A 3H11B 2X0RA 3MJVA 3R20A 1X7YB 1WUYA 4K9NA 5ALQA 4I5FA 5BUQA 1MB9A 4GGOA 1I7SB 4FX5A 2AOUB 2EW1A 2JGMA 2WJ6A 3RHZA 4UU7A 1Q11A 4LRWA 3W78A 1M7HA 1TCCA 2N1BA 1XDBA 2OC4A 3ENNA 3LK7A 3M1IA 4I46A 5DFAA 1M2WA 4QATA 3BHNA 3BK7A 5EKTA 2QLFA 1S7GA 2HGWA 1MABB 1XTBA 2WWIA 3PHLA 2XIJA 4R9NA 3DCYA 3ENKA 3ZUGA 4OI1A 3U4CA 3C1OA 3RASA 5CLIA 1D1TA 2F3QA 1KPGA 1VA5A 1NMXA 3EZYA 4LQ4A 3V46A 4MKFA 1EHIA 2BV3A 4YCMA 1ZJ5A 4MKIA 2I7CA 3RYHA 5IAAA 1OPRA 5KJ1A 4H2DA 3AETA 1H4SA 1JTVA 1O8BA 1E59A 5AXDA 4KKXB 1E3LA 2ZPTX 3DE7X 3IGFA 5J4HA 2ZVJA 1UOEA 1BIFA 3PWSA 4LJKA 2OYCA 4Q9DA 3HL0A 4Z51A 2PZJA 2P7IA 5HKOA 5KFVA 5KAPA 2H1OA 3K1YA 2OV8A 1DO2A 3G9TA 4ZT5A 5AVYA 1NXTA 2J6TA 2XRMA 1FFHA 1N48A 2FW1A 2G1UA 4XDYA 1MH9A 5KPDA 5KPJA 2BOVA 1MZVA 1QVAA 1VG8A 1KP9A 2ZGVA 4IXMA 4EBFA 1DBQA 4PR3A 3GCGA 4NNPA 2PH7A 4IEEA 1T94A 1Y80A 5LB2A 3OE5A 3A36A 3WIOA 3A31A 3AI1A 2VA2A 2XTAA 1YASA 3PI7A 1MMFB 4LDZA 1H2WA 5EHNA 4L9AA 3CGGA 4HMQA 4HPJB 5JDCC 2EG9A 4XWGA 1ZAKA 4NMMA 1G2IA 5DTQA 3F6SA 3ZX5A 2WF6A 2R1VB 3DZ8A 3EIFA 5IN5A 5JS6A 4RMJA 3FPBA 1B43A 1GADO 1P5RA 4Q7MB 1T36A 2VJKA 5GJVC 3MHTA 1I24A 4KQCA 4YWJA 3D8TA 4TMVA 5EKXA 1V9PA 4M7PA 3ME5A 2PQMA 2ZJ5A 4NDNE 4WASA 2HREA 2RHTA 1XWWA 4D56A 2GILA 3HUEA 1UPXA 1X1SA 1DIRA 2YXDA 4RZ2A 3T3EA 621PA 5HDBB 1GAWA 1YA8A 3EN0A 5AI6A 2FY8A 5LYYA 2G72A 2HG8A 4P54A 2DFPA 2OORC 3FOZA 1YACA 3VKUA 1QP8A 1MHPA 4IF6A 4MLPA 5IWAB 2A67A 5DTIA 2ECKA 1O4WA 3GIJA 1PGNA 3ESQA 3QG1A 1YJQA 1YI0A 5HE9A 3SMVA 3O0DA 2Z2XA 3O1HB 4EA9A 2YL2A 2EQ5A 5C46F 1TEVA 2GETA 3HOYG 1SK8A 2NU9A 1DO8A 3IEKA 4PYQA 2VQSA 1TTTA 4UM9D 3CZ9A 4NBRA 2VNJA 2FF5A 1WM1A 1ZUIA 1I2DA 4JLDA 2G36A 4FT4A 5F7JA 3EVFA 1EK2A 3KJGA 3UATA 5E2IA 4F8YA 1YFLA 2PUFA 4DL7A 1QU3A 4EDHA 3V1TC 5DYWA 3EGXB 5GAJA 3IUPA 1EG7A 3C8HA 2RSLA 3U3JA 5HM6A 4X65B 1MQ8B 1ZHHA 3DV0B 3U56A 4PZYA 4ECEA 1XQ6A 4RC9A 4E3ZA 4HUQB 1MP0A 2JLRA 3CXRA 1MJNA 1VPTA 3DWGA 3E8SA 1D7AA 4KP7A 3RTDA 3W3AD 3ZTTA 3ZZTA 4CLRB 2PL3A 5DMXA 2J9RA 4DMRA 2NUPA 3TL6A 4PC2A 4F1JA 3UK1A 3WGUA 4ENSA 2JHPA 2QJOA 3V34A 1EFPB 1PT7A 3PSAA 4A3GG 3PJFA 4U3JA 3ND6A 4MH0R 3EGVA 4O4HA 4Y8VB 5DYYA 1A9QA 4GICA 2HRRA 2CK3A 2C35B 1UK8A 1O08A 1FUYB 3CE9A 1K9VF 3AJRA 1NKTA 1BDHA 1Z0UA 2VO1A 3BAFA 1M6WA 2ACKA 1QDEA 2PXCA 3NXSA 4FYPA 1DKNA 4KTVE 4Y30A 3PJRA 1R0LA 3P7MA 3MR6A 1S4MA 3AEKA 1D9XA 4R81A 5K3CA 4YN3A 4DCNA 1L7EA 1UBUS 3TTYA 1E6WA 5BNZA 3QXXA 4UFNA 2V7VA 1OI4A 5ALIA 3VISA 2IS6A 5CURA 5EP2A 4E11A 1UKEA 4Q8FA 4KWTA 3F5FA 3K2IA 1EVJA 4BFTA 5J2UA 4E03A 2O03A 2GN0A 2OCKA 2QR3A 3R3XA 3PDWA 1FYWA 4MWTA 5A3SA 2Q4RA 3S40A 1P61B 2PUHA 5AD1A 5JAHA 2NVOA 3VKFA 1SU7A 1ZNQO 2Q41A 4NENB 4BKPA 2HMUA 2R00A 4LKOA 1MEEA 1UPUA 4S24A 3HVKA 2J6UA 1NPYA 3U13A 2NUTB 3LAWA 1G3UA 3DZHA 3DBHB 5AVQA 3T5GA 2NYUA 1FFSA 3T3IA 1Q1QA 2BBTA 4EY8A 3DMTC 5ICMA 2JLZA 2VF2A 3R5SA 2VJCA 4D4HA 3Q8MA 1C9YA 4ZXFA 3UAVA 4QIWA 2Y27A 4PX2A 4ND8A 5TMPA 4BJ5A 2R7ZG 3LTNC 4QQFA 3TXAA 1T8PA 2PRIA 4LJ4A 3SM9A 5KNCD 1JIXA 4ABTA 2X0FA 1SRRA 4AC9A 5LP6A 4PU0A 4YRJA 3T7EA 4WERA 3TOSA 4CCAA 3MBKA 3D6UA 2AJ8A 3TPCA 5KWEA 4G4SO 4RPKA 2H7CA 1T35A 4AIIA 4PG8A 1KZYC 4KWCA 1T2VA 3AEYA 1IYZA 2PQ2A 2NO9A 3MGBA 3KVNA 4H16A 4TL6A 1YKFA 4ESOA 2ZIXA 4OKNA 5KWSA 4KYTA 1NVXQ 2AD1A 3PNKA 3CLSC 4P5EA 3TRKA 2A5YB 4BFWA 1PUJA 1AGRA 1OB2A 1FDTA 3EUWA 2VYQA 5DISC 1SVNA 3DPSA 1IY1A 2GN8A 3NNSA 3Q7QA 4JBGA 4MVJP 2I4IA 3RG8A 1YUMA 3ZE6A 5HGXA 5F1YA 1LWOA 3OICA 4IH9A 5EG5A 2ZUDA 2F3PA 3G2MA 2VA8A 2X7HA 1J2RA 2WU1A 2VQDA 3DLHA 2JK1A 4Q4AA 4UCSA 1S02A 1U4NA 2P1ZA 2W37A 3A4VA 2UVDA 4EEQA 3TCXB 5CB4A 4GOJA 1M2OA 1N6RA 2Y2VA 4OU4A 4Z4FA 3CZCA 4G0QA 3BRSA 1IOVA 3H5TA 4R98A 4RSMA 3BAZA 1KS2A 5DLPA 1YJ8A 5CXUA 5DN6D 2Y4RA 3A2MA 1IM8A 4NBWA 4PNHA 1WWKA 3IKJA 4EW2A 4LG1A 1K08A 3DDHA 3ZBPA 3SR4A 4DPKA 4ZOLF 1XCBA 4EK9A 5JJBA 4BZXA 1RYBA 1UCFA 3KQSA 5KTOA 1ZUHA 3QWBA 1OHHD 5KFPA 4OOFA 5J5CA 5ALUA 5AK5A 5JNRA 4TMTA 4LZNA 3TNDA 1J9EA 3EQ6A 3GUYA 4GD3Q 2IEBA 3IMGA 2J0QA 4G01B 4BLUA 5ARBA 5J47A 1GHTA 4L4YA 2UXBH 2E3JA 2F1HA 3L0PA 4FC6A 2WJHA 3PGLA 1JDUA 3WL5A 5LOVF 1GAQA 1XI2A 1JWLA 2JJ2D 1PL8A 3WBKA 2FHPA 3UMYA 1F9AA 1XMSA 4MMZB 2GN6A 2GTPA 1KQNA 1XQVA 5HPYB 3KSZO 1BH2A 1PHPA 3CMMA 1T8YA 3I4CA 1YQEA 2C94A 5AUQA 1E1RD 1A50B 1IHUA 3K15A 5A9SB 5TPWA 3W7VA 5J1TB 3GRPA 2JNWA 5F5NA 1AO0A 3SC4A 3I3OA 1VB3A 3WNDA 1U1IA 2ZS7A 4J1TA 4EUSA 4UTPA 4ZVTA 2PX2A 1CHDA 1DJQA 1C8VB 2PWAA 2GKGA 4F1WA 1NBWB 4O0LA 4ZOCA 3WIEA 3GUCA 3D43A 4R8UA 1WW3A 4BGEA 4PGMA 2HHFB 4PLWA 4DLXA 1C3OB 1XEWX 2HLDD 5A9TA 3TLKA 2P2ZA 4LFBH 2Q28A 4EVQA 1RXSA 4QFDA 2A1UB 3QI2A 2DC1A 1NV8A 1CE8A 1BX3A 3MJEA 1XU7A 4GBED 4XOIA 2NM0A 1OVMA 4FDAA 4QLBA 2BTQB 2ZRGA 5J2TF 2H63A 4GECA 3W5JA 2OP1A 2VQ6A 1JAIA 1AQUA 3HDQA 4OKIA 2DUWA 2M1XA 4ZOLA 3LQRA 5JXIA 1E2NA 1NXVA 1ONOA 3EXHC 3HA5A 4YJHA 3T34A 4MW1A 1EG2A 3ZVLA 2PUGA 4HNSA 3G23A 3IAAA 4BKOA 4K2AA 1Z6GA 3DHNA 1TMGE 2I5PO 1KY4A 4GW3A 2GPAA 4IOJA 4O0MA 5DEIA 4A26A 4DDMA 4FQ7A 4NE2A 3TGWA 5LXTF 1QB7A 4C0HA 2F3TA 1HYHA 2Z98A 1DAPA 2YV4A 1YE8A 4LHEA 4UE6A 3WOVA 5KU7A 3GUZA 2C7VA 3O47A 4GI2A 5IEBA 2NIPA 2DKFA 3R74A 1OH7A 3GGSA 5EJ6A 1VYHA 2WUEA 4N03A 4NDAA 3SIXA 4TXJA 1WDWB 5DQIA 2QXYA 3U1TA 4FYYA 3L1JA 4B6SA 2WR8A 1NSYA 1Y3FE 1D5WA 5KFUA 4ZMBA 1JVBA 3UYYA 1C3VA 2WIGA 4KLRA 1QRTA 3I62A 1Z83A 2JA7A 2NZ8A 3L82B 4JT9A 2EJ3A 5TQ2A 5CAEA 3GLQA 4G41A 2A1HA 2HTEA 3IAEA 1FP7A 1S10A 4EYOA 3RR2A 4C21A 3AH8A 2F43A 3HADA 3MVEA 5CNMA 3KHHA 2XNCA 4GX2A 5DX1A 3V1MA 3FBTA 3HABA 4GVLA 3GH1A 2QTTA 4E5SA 1XL0A 2A9VA 1ZJ6A 1ZWLA 5FO0A 3VR6A 1FP4B 2AG1A 4AZ0A 5HJEA 4B3TB 1EEXB 3UYKA 3CR8A 4JUAA 1S03G 3V4OA 2OGUA 5EHXA 5JJ5A 2IITA 5JLAA 2LGJA 4U7PB 4WNAB 5JSZA 4I5IA 1V4YA 2AOVA 4K1LA 1LV7A 3AEUA 3LGXA 1QIKA 4CIWA 3R3YA 2QVZX 2Z08A 4JQCA 3PE6A 3OZCA 2PLWA 1V41E 2XQFA 2MSEB 4DANA 1V1JA 5I9NA 4X84A 3BMOB 4LF6B 3AM1A 3SGLA 4C20A 2DTEA 1N0VC 2EWVA 2JGIA 4ZVLA 4C7BA 1N8TA 1GAEO 3FSEA 5JY1A 4ZU3A 1Z29A 3OWHA 2YDXA 3SJAA 3E7PA 2JA8G 1RXIA 1YAJA 1O8CA 5K8IA 3VMFA 5DSXA 3DTVB 3P2EA 4L3VA 1AQYA 4YTEA 1G20B 1SCIA 3JQQA 4WUTA 1DZIA 3KZNA 4HBZA 2C78A 4HQOA 4LBVA 5ALDA 3LUPA 3UM9A 5KWJA 3KTOA 4PAOA 5AMXA 3HMQA 5KHLB 1E2JA 3BQ9A 4PZ6A 1B93A 4RGVA 3UAGA 2W2KA 3ADCA 1F20A 2CL7X 2C29D 2C2OA 1P5ZB 1CXZA 2OZLB 3OSUA 3T5LA 3IUJA 2IDMA 4ZYYA 1AHHA 1F2TB 4EZBA 5HEKA 2QM8A 1KU6A 1XTZA 2M6KA 2R60A 3L9XA 4H7JA 5JHGB 3DB1A 2DUUA 2P27A 4WLOA 2V9ZA 1Y9AA 4WHXA 1QH0A 1X8KA 4Q4CA 1A4RA 1W19A 3CX3A 2H4ZA 1F1JA 1VYUA 4G9BA 2Q2VA 2HQSA 1SVSA 4CKEB 1G7TA 1NONA 4Q16A 5IWCA 1CG6A 4P6VF 1EM8B 4X7MA 3DMYA 3KFXA 4YBZA 5BWMA 1Z5GA 2GA8A 2AMJA 1JX6A 2AT1A 2PBFA 2OYRA 3W9UA 1IXYA 5BRAA 3MGAA 1I1OA 1FYVA 2YC2C 1CERA 4L2IB 4XQCA 4EKNB 4CQLA 1XTTA 3KTMA 1FUEA 1YS7A 2GI4A 4YJ2B 1HMPA 1JI3A 1O94C 3G7SA 4HP8A 1IIBA 2B21A 4YJ3A 4UFPA 3HUTA 5JI3E 5BRJA 1TEZA 4BN5A 5K05A 5CEFA 3C6BA 3LT5A 5GINE 3KQKA 1E1NA 4A0RA 1YZFA 1RYRA 4ZAFA 2BTOA 3H8SA 2CSUA 5E8JA 3QPAA 1HEUA 3I5MA 4QNMA 3GQBA 1S2OA 1N2JA 5FEUA 4D4LA 4LYGA 4QUGA 1BMDA 4JBWA 2FSGA 1MVLA 1NBHA 2BGUA 4BZQA 2R68A 1QTNA 5I60A 1KO4A 3ML1A 1R9GA 2B8EA 1YBAA 4G8DA 3DEZA 1GYFA 2V9CA 3LH5A 2KS6A 3W8RA 4B6QA 1QQ5A 2ECFA 3MC1A 4KRGA 2F8SA 2RJ3A 2PX8A 3C70A 3KT0A 2O8FA 1NJ2A 2EJ2A 1F2VA 4WDQA 4MI3A 2XVAA 5LWQA 1YT5A 3G9QA 3RFXA 3ZCSA 4CEJA 2KX7A 1XPRA 3L0SA 1SIOA 4GMHA 3O9ZA 1TW3A 1HWYA 3SYNA 1ZH4A 3EY9A 1LDGA 1A82A 1UBCA 2FGJA 4PRZA 3D4OA 4GI5A 4ARSA 3ZVMA 4F86A 5DNWA 4I4TA 3NFYA 1JGTA 2QHXA 2FFAA 1WTCA 3G88A 5H70A 3DEIA 5BYJA 3I52A 1ISMA 1Q77A 1R0BA 1I01A 4CIYA 1LPPA 2PRJA 5ARDA 4G8JA 1B8PA 1JR3A 1KH2A 3I4MG 2ATIA 2O0JA 3RBDA 2PSEA 3MEQA 4MMXB 4LQCA 2W6ID 5KFZA 3IR7A 3OZXA 5KFYA 3H4DA 3TMKA 2M1ZA 1CF9A 2HDNB 1FZTA 2WW8A 3OAAA 3FJYA 4QD3A 4F04A 5D3MB 4EJ6A 1EI9A 3WV5A 5DGHA 1NF2A 2GLXA 2ZYWX 3FPAA 3PQ6A 5H81A 5F9LA 1WXHA 2HSJA 5C37A 1XXHE 2Z1DA 1UWVA 3BMQB 2VAVA 1UZLA 5TARA 3ZU5A 4MKXA 3WLMA 4DCGA 1NHWA 1NXPA 5AOCA 1THGA 1KI4A 2R2GA 2X9GA 1P1JA 3WGJA 3D64A 1SFOA 1XE3A 4ZAWA 1F6WA 4K6GA 4CNQA 1S1MA 2ZJZA 4E33A 3U17A 3LBFA 4N0PA 1D04A 3K5PA 1CZHA 3RF2A 1AZLA 3N0TA 4GWKA 1KVUA 1SXJE 1QHHA 1MJFA 2YHIA 4H31A 3R7WA 2VP3A 1H2ZA 4BQRA 3HDTA 3FIUA 3SXUB 3HG7A 3TK1A 2VPTA 2VL7A 4CG3A 4ZGBA 1BGXT 1IJKA 4X63A 5EXXA 4OTZA 3WGKA 2OH2A 1HFEL 3TMAA 3UV3A 7MDHA 3BWVA 1DJLA 3KOXA 2W7PA 2A0KA 3FF1A 2YASA 1E5QA 4JXXA 2YKGA 3F97A 1Z2DA 1LZLA 2C8VA 2CN1A 1QO0A 2WWHA 2JJ2A 2F3SA 3PVZA 3O83A 1KHHA 3MRSA 3M3DA 3TZCA 1PNTA 3W6UA 1D6SA 4WT7A 5FQNA 1O9GA 4P33A 5C8YA 2W70A 2NU7A 4ZV4A 4IDNA 1XMJA 4JP3A 4BC1A 4PG7A 7REQB 2VH5R 3H1GA 4X54A 5GVSA 2VJQA 5GTDA 3P9KA 4ZVNA 5JDCA 1B0ZA 3HCFA 2R65A 1E6UA 1FSZA 1L7BA 1IYEA 1P74A 2HGZA 3N41B 1NNUA 1PL7A 1SK9A 2IHVA 1E0DA 1KO8A 3PHHA 4NDZA 3AJAA 1W4LA 3N87A 3FPGA 4TVKA 4OD0A 5TQJA 3BXFA 3OEHA 1U7WA 3BGOS 4TL7A 3GMIA 3ND8A 1ML4A 1DBVO 3DYBA 1JG6A 1FW8A 1QX4A 2P3OA 3A6DA 3IKMB 5EN4A 4EBDA 3FNHA 1YNOA 5FWYA 4J9UE 1OFIA 4H0CA 1RE1A 3WOHA 3P2KA 4TSRA 3AXTA 1Q84A 1RSZA 2CLCX 2Y0DA 2QNBA 3ZW7A 4EUHA 1GP2A 1G4HA 2ZETA 3L0OA 4O2AB 3TKYA 1VMIA 2Y1FA 5JYDA 1DQRA 4YJHB 4PGGA 1X19A 4EKYA 4CVNA 1EZ1A 2CV1A 4G8CA 3TTUA 4ADSG 1Z12A 2BFFB 3QPUA 4LNHA 1RJQA 1G3IA 3H4MA 4H15A 2DWQA 4EABA 3CZ5A 4LUCA 2PKYX 4AZWA 1O97C 4Y0NA 1YFJA 1AZSC 4B3JA 1KDOA 1ENYA 4FN4A 1TMOA 4RVHA 3BULA 5DNYB 3DFUA 5FJ8G 4I50F 1YUNA 1TX4B 1AM4D 1GGFA 2HXSA 4LXGA 4EAAA 5LLDA 1IN1A 2GBFA 3O94A 2WWRA 4MRSA 2Z58A 1AXEA 3R6GA 4D6PA 4M9SA 3LLSA 1KZ7B 1R8XA 1AQJA 1PUIA 1USGA 1P1BA 2IHTA 3UJCA 3JQGA 4G0XA 2PQ0A 2ZI3A 3F67A 2WJPA 3TJRA 3ZQUA 2JBHA 3HJGA 1SQ6A 3F7NA 2P78A 5EOVA 1SHZA 4CHIA 2PGAA 4B6JA 3V4PB 4EHJA 3NDBB 1TAUA 1GGVA 1UEJA 1UJ6A 3MIIA 4Y3UA 4A2CA 3THRA 4CF5A 1EXVA 3F2VA 1KI8A 5A4DA 1Y9EA 3N7TA 2HJ9A 4WACA 4BDSA 2HMAA 1LRKA 1H2RS 3PD7A 2IEZA 3WP1B 3AHJA 2F67A 2EBHX 2IFTA 3BL6A 2ZYVX 2ZIFA 3BRWA 1UDXA 1IN7A 3EMBA 2HNKA 4YWHA 4BWFB 3PX2A 3O5AA 2DE0X 1SUEA 3WDLA 2V74B 2W2XA 5AIBA 1AZWA 2JHGA 1Z4LA 1V39A 1AS3A 1NF3A 1WQ4A 2BLLA 1CUVA 2P9CA 4HNUA 1ZQ1A 3GRFA 5FFNA 1EYZA 3FYCA 5A1TA 3AIMA 4I5EA 3I2JA 1G5IA 2V4UA 3E7WA 3D6JA 1DRKA 4NL4H 4ZV7A 4C4AA 5JMWA 5COAA 4C4OA 2B5VA 1K6EA 2QT0A 2YFYA 3AERA 3NHAA 1GZ3A 4X8OA 4WOCA 1E60A 1G0NA 4OJMX 4D9HA 2WM8A 3QELB 4YRGA 1IBKB 1U1DA 1VL0A 1PF7E 1MW8X 5E38A 3LHIA 2F00A 1VGQA 1HPLA 1UDAA 4KJZA 3VDXA 3WISA 3DMNA 4GPIB 3K0EA 4JJ7A 3TW4A 2WY2D 3WQQA 4B82A 5C7OO 5IJ9A 2IYXA 2WQ6A 2JLAA 5BQXA 3T9CA 1G20A 1CR2A 1MJHA 2WOJA 3FKSD 1DBWA 2C2GA 4KW7A 3OMLA 4TTVA 1AGNA 3HP7A 4BX9A 1FDUA 4CEIA 1AUQA 3OPVA 2QPLA 3PJEA 3H1BA 1QHYA 1JI0A 4IIBA 5K0EA 3S55A 1JR3D 1T2NA 4M60A 3SBDA 4WLFA 4I4TB 4Q4AB 3ZXIA 2IW1A 3KT8A 4MTEA 1GRCA 1C80A 1ESCA 3MTJA 3T7SA 4HUJA 1TUGA 4E22A 2W11A 1ZIDA 3HA7A 3HZOA 3K96A 3RRBA 2YXPX 1T9GS 2IZ6A 3QU7A 3QU4A 5IDVA 2OXIA 4F4CA 2MR6A 1RWVA 3PW2A 3GJXC 3TIIA 3WL3A 4WBNA 2HK6A 2FWAA 5DOVA 1H3FA 2ZQ5A 3OURA 5IKOA 1K92A 3GXOA 1JJBA 3JYOA 1IOWA 5C3UA 1TKBA 2AJLI 3PA8A 5IVKA 3A26A 3F3KA 5TJ9A 2EX4A 2FPIB 3L4SO 3UJ7A 4ZO8A 4Z3DA 4MS4A 1G3QA 5I45A 5KINB 4OLJA 4O7LA 4FFVA 1URPA 2XDWA 3IPXA 4X8LA 4IZOA 1DBPA 3EDQA 2AG5A 5L95A 1ZR2A 3B2EA 4GX0A 4F0JA 4YAKB 2WEKA 2WNSA 3D8UA 4HWTA 4TTSA 2N47A 4MPTA 4AP6A 4YRBA 5BUSA 2VRWA 3EULA 3KNZA 1GGOA 2IYFA 4LFCB 4NMLA 3UAWA 4P3PA 1ICEA 3FVQA 4O33A 4B71A 5LR6A 1K3FA 2HA6A 5JDIC 4X60A 3RHTA 3HZHA 1ARZA 2XGPA 2JIRA 1GJRA 1IYDA 3KV1A 5I5YA 3OTIA 3RREA 4N6GA 2CZGA 2ZJ3A 4IX9A 1PNQA 2NQTA 3AR4A 2J32A 3G1TA 4ND5A 5G1OA 3H6KA 1ZJWA 3KOWA 3OZBA 4KE6A 1K2WA 3PR4A 5AM4A 2WKSA 2VUHB 1VKOA 4GQIA 4EHAA 2IZZA 1KS9A 1S8AA 3N43B 1YKSA 1OT3A 2R8ZA 1JXLA 4LS3A 3OKCA 5CBPA 1XVTA 3GJRA 3IJEB 3ZE2B 1G1AA 5HTOA 4D26A 4O59O 1I6MA 2PJUA 1QYWA 2O52A 5BSRA 5EPEA 1QS0B 5IC6A 2VP5A 4BFZA 5CT5A 1YC2A 2AFRA 4J4BA 3ZHUA 1WE2A 1TYZA 1GQQA 3HYSA 4C0LA 1CNMA 1TUBB 5JD5A 4H35A 5F1OA 3PO2G 3PNLA 3LD9A 1WXEA 3EYWA 3QJ5A 1I1HA 5KNBD 3QYPA 3PQFA 2QBYB 4WA7A 3SSNA 2JFXA 2DSNA 4GLLA 1SH7A 3RC3A 4XSHA 3FCUB 4MQ4A 1B16A 2MYUA 1KJWA 4AJEA 2Z9DA 4HFJA 4EB6B 4DQUA 4DAAA 5IH3A 2UVQA 1J97A 1G9XA 1QG0A 1XKQA 1S3FA 3OF5A 3BEDA 2XV1A 1BEUB 3A6LA 1NI4B 1ZH2A 3OFJA 5AJXA 3RS2A 2RHBA 5BWWA 1CKMA 3QLTA 2XYPA 3AY7A 3I9OA 2UZ3A 1SKQA 1LNSA 1NUHA 9ABPA 1EGAA 3SNOA 1Q5PA 3HXTA 4S1WA 4ZQBA 3WLAA 5K5EA 2BMAA 3PVSA 2BTQA 2YCLA 2GQSA 4F85A 2NT4A 4YCJA 5AQ1A 1WF3A 1YB4A 1M2EA 3AFIA 5AW9A 1MC5A 3M6WA 3ZCXA 2PMZE 1NV9A 2GCGA 3AFHA 4FEGA 4TQAA 4DL6A 2R5NA 3RU2A 4KRYA 1H4VB 3TD9A 5I4KA 4NG5A 3K9CA 3PUHA 5B7GA 2VUMA 4DL5A 3RODA 4DTCA 4CEJB 3D0RA 2TYSB 3RAQA 1OY1A 2YS7A 3OZSA 4JBLA 3VVBA 1BROA 4Q4JA 1CB7A 1FTYA 1LX7A 1MLDA 1FS6A 1L4BA 4MQFA 4PANA 3S7ZA 3CHYA 1NC1A 4IFTA 3GFGA 2W42A 4E1AA 4C76A 5JFOA 4OHYA 4QECA 2AFHA 2G1JA 5G41A 4N12A 3B1XA 3HU2A 3FVVA 1J25A 1KY3A 1NDUA 3AZOA 1F2DA 1Z82A 3GNTA 3H9UA 1I2MA 3HQ4O 4J49A 1COWD 1U0HC 1X14A 3I09A 4RWZA 2IHBA 2JBAA 3JX9A 1N5LA 2RGGA 3WYDA 2LV8A 5I7AA 1UFOA 2DQSA 2EEZA 1O0SA 2J3MA 1YDHA 1E6KA 2MT9A 4LY9A 3L02A 4TS9A 1A7AA 1PR6A 2EL9A 4A8PA 4RHFA 1MPTA 2FWRA 4RH3A 1ZAYA 2RC5A 1SFRA 4QFCA 5E9AA 1C4XA 5MHTA 2V6FA 2X6RA 4G5XA 4LQDA 2A84A 4P7GA 3OT1B 2C28A 2XUHA 4RCZA 4R0NA 4WZAB 5DMHA 3MCVA 2Z1NA 4H1UA 3UMJA 1EVKA 4JR2A 1LY1A 2VDKB 4YJFA 5I4CA 4PN3A 1QQAA 2JCSA 3W6ZA 3BSWA 5FWAA 1FJXA 2OLJA 5D1OA 2FN4A 3KKEA 4I8DA 4MW6A 3UJ8A 4CRWB 6ABPA 2C42A 1EKPA 3ZHQA 1WZCA 1OVGA 4J3JA 2QTZA 3VOTA 2GN1A 3O4RA 3R5KA 3FHOA 2FQQA 4S1TA 4BLWA 5I8WA 1YNSA 4GAEA 3DNPA 4UAVA 3BMCB 1Y8RA 2HK8A 3PPIA 5E25A 4Q01A 3IP8A 3V9PA 4UBLA 3CCCA 4IEFB 1ULSA 2P30A 3L0DA 4WLUA 4AJNA 2G5CA 5EFOA 4D8XA 4LIPD 3JZDA 1LX6A 4C87A 1S9FA 1HT0A 1U04A 2ZKLA 3S5UA 4JYAB 4DCTA 2XOEA 1KAGA 3H9EO 4D0NA 2C5FA 1DEKA 5L7WA 1SCDA 3FCSB 1N6LA 1TM3E 2O3QA 4L27A 2ZYRA 3B1YA 3EWSA 3O2QB 3QLUC 3UAYA 5CA0B 3WL6A 5T4EA 4B80A 3VMMA 4EJ0A 1OTHA 3WNCA 4D9JA 4MR8B 1M54A 5LQMA 1P75A 5BNIA 1H66A 4D57A 1T4CA 3OPYB 3P8ZA 4XQGA 1J8YF 4D98A 2D7CA 1NGSA 3PNPA 4DRYA 1H85A 5J40A 1I3LA 1OBHA 3ST7A 1ABBA 1ZRHA 4DA8A 2XYRA 4DA7A 1R4MA 2JGEA 3MAJA 3N2KB 2IXTA 1KAOA 4KJXA 1KJQA 1KEEB 2C77A 2YU9A 3LYHA 2Y1GA 4LMRA 1TPYA 4PE5B 1M1ZA 4QXMA 5CYGA 2D6FA 1PYDA 4RVSA 1RXVA 1U9IC 1HFJA 3GTGA 5K0GA 5JAUA 1RU3A 4Z9YA 1G16A 3HFGA 4DRFA 4J91A 3LP6A 2FE3A 1L1QA 3GOQA 2PZAA 3ROZA 3C45A 1KYXA 4IOKA 1W5EA 3E3LA 5EQFA 1R5OA 3I23A 4AQ7A 4OLHA 5JMTA 1DELA 4BQOA 5DNDA 4RIGA 4K03A 4TROA 1ORWA 1SUWA 1Y5LA 3ZE8A 5KNBA 2X6QA 4D8UA 4F45A 3LP8A 1PG2A 3RJTA 1NZFA 3FYUA 1PN3A 1VPLA 2ZYDA 2YJ4A 3OAAD 4R3UC 4YAFA 4JI0H 1E58A 3RSLA 5DHUA 3DVSX 3LY5A 3PTZA 1DAHA 2FEKA 3SJCA 1IQRA 4EATA 4AS3A 4F6LA 5F78A 1QGDA 1U1EA 2B7LA 3RTBA 5A4FS 5ES3A 1H2FA 3W77A 3KXIA 4M9CA 4ML3A 2WJ3A 5DCWA 4JITA 3C5WP 4EVRA 2A1IA 3TOXA 5AW4A 1Q20A 2JDID 1K63A 3CUKA 3OP4A 3L6DA 4JYZA 3S2EA 3NM4A 1S89A 1VG0B 4YROA 3VBEA 4MA4A 3G2OA 3EVTA 2O7SA 1QAOA 4FR2A 2PBLA 5TDHA 3WXMA 1EVZA 5AI9A 3DZKA 3RUHA 4WBNB 1PZNA 2WPDA 3KUKA 2X5OA 1DTEA 4DHEA 5K9ZA 2VP4A 5C34B 2K6GA 1E62A 2VCHA 4EEXA 3AM3A 4EG3A 3FDXA 1AA6A 3RIEA 4RHCA 3MR3A 2A1UA 4MMYB 1BRTA 1R9MA 4X1YA 4XIIA 1V8OA 4QJ5A 1U8TA 2O8CA 3A2LA 1S4QA 5BYKA 4JYPA 4DR4B 1AD2A 2O1XA 1A2OA 4FE2A 4PHCA 1Z25A 2IIVA 5AI8A 5AICA 1E69A 3QPBA 4PCAA 4R1PA 1L5GB 2JRLA 5TVGA 1NFRA 1KMCA 3MFIA 5AK4A 2ZVDA 4DLPA 2FK3A 5L1IA 4N82A 3IBGA 4O3SA 2ZUTA 3M83A 3MB8A 2IPAB 1R50A 2ZVQX 2CV2A 2EF1A 3WE7A 4JBNA 1H05A 3KE9A 3AZQA 4LGYA 2Y0SE 3FCOA 2PGJA 2R8OA 3NC1C 3H9QA 4M87A 2RHLA 4AKSA 2OCPA 3UCFA 3TECE 3GHYA 3TSCA 5KJEA 3VUEA 3H40A 2HMSA 2QNRA 4A2QA 1Z74A 3ZLVA 2NN3C 3RE1A 3IVXA 4FFBA 1XNGA 3RC2A 3TVTA 4O4HB 4U7GA 4E4RA 4CFYA 2EZUA 5LU8A 2PL9A 4YXFA 2AEEA 1JLRA 1LF5A 1XD8A 3TRJA 1TAHA 1UMKA 2PZ8A 1UXIA 1V45E 1ZX1A 2FFRA 2VZ8A 4IV8A 1H9BA 5DTJA 3IB6A 2IUUA 2VJOA 1SXHA 4CUKA 1Y82A 5D6NA 3FPJA 3C8UA 4IIUA 1N1EA 5BQOA 1N9GB 5JD6A 5KFQA 5I7VA 4DA4A 4P22A 3P2IA 3VHQA 3AB3A 3WSVA 2XMBA 3I28A 4WZAA 5K3WA 3ZBUA 3RGXA 1GUFA 3PFGA 1UBLS 4K0KH 3CRZA 5HIKA 3ERCA 5K8VA 2W48A 2UZ4A 2WU4A 3CPHA 4LCJA 4YYZA 4PAMA 1RAIA 2Z5LA 2OGTA 3N58A 3TNJA 1R5BA 4BVAA 4K0RA 2AMYA 5IBPA 1C4WA 2XXAA 4X9XA 3TQRA 1OSNA 2AQ4A 1BXKA 4KGZA 4LKRA 4ND7A 5G0WA 2OV3A 3LX6A 4XYLA 2E37A 3JQAD 4BQSA 2R92G 3GCXA 4YDSA 2EJUA 4YRKA 3WQRA 3MS4A 1NSFA 4ND2A 5LNK6 3UMCA 1J21A 1L7NA 5I5WA 1EMDA 1GY8A 2C54A 2OO7A 8ADHA 3K6SA 2I7VA 1KRWA 2C5AA 4GG1A 3G8BA 1OAOA 1G2QA 4J7UA 4QLOA 3VDNB 2OVBA 3QYAA 5K03A 4TYYA 1W2WB 3X1ZA 3L0ZA 1JTEA 4ITUA 3SJUA 1V1MA 3FXAA 2I3BA 5KX5F 3H42B 1MFPA 3T9EA 1U7OA 1C8BA 5CA1B 3ZDBA 4B3TH 3AEXA 4DR7H 4OHKA 1W48A 4L8LA 4F4FA 2ID7A 3DC2A 4RF5A 2VT2A 2OC9A 1MT3A 2UUCH 2G4CA 2NACA 2EG5A 1HY3A 3O8DA 4D9MA 1OX5A 2GCEA 3ITEA 2FRVA 3PNQA 3U37A 3MK31 1AMNA 1HE2A 4EMTA 2D00A 4DV0H 3ETGA 2B83A 4ZK6A 3B9QA 2K7FA 1E2KA 4RPLA 2WHPB 3B52X 4K9PA 4TKVB 4X8MA 4PSDA 5EIWA 3C74A 1M1XB 3P0RA 3KFVA 1RPTA 4I3GA 3PIRA 2GCOB 4J9NA 4FYKA 3BICA 4C6TA 4XWYA 4W9NC 1Q50A 1XK5A 4U7WA 1DPGA 4TLAA 4AU1A 1F8YA 1E94E 4FYWA 5CPBA 4KI0A 2XSZA 1E2EA 3E3MA 4IV0A 4LBYA 1IZ9A 2OBNA 2B7CA 1JFVA 4EBCA 2QBYA 5L7TA 3IT2A 3KJIA 1XN1A 3BIWA 3T4EA 4UQLA 4PO9A 3B1ZA 4LDNA 5IUKC 4HVCA 5AFSA 2ZR9A 4ZICA 3QOWA 4N7MA 5AM5A 4EFNA 5KYWA 1VCMA 2EL7A 2GO1A 2F8MA 3DLIA 1NA5A 1PQPA 3X1MA 2HR1A 1V35A 2ABWA 5LJLA 3MWYW 4KPYA 1Q0SA 2DULA 4O02B 4MVYA 3P97A 2DWUA 3OKAA 4GM4A 1I3MA 3WA6A 3LQ4A 4KBFA 4REQA 5A0FA 2Q07A 3A05A 2B35A 4EARA 4M0DA 1U0BB 1UDRA 3M49A 5KC8A 3H2YA 2EDAA 2FCRA 1II8A 1QSGA 3GGGA 2ZP1A 4IS2A 3B53X 3ROTA 5GADl 1U8CB 1YB7A 1SQFA 4TMKA 4ZCMA 3T0GA 2V98A 3KPUA 3H11A 5JIBA 2Q6VA 1KFEB 4QPNA 1S0MA 3BHMA 5TQ2B 5C7IO 1YWGO 3THYB 1RKQA 4ZCPA 2WFLB 1JSRA 1LJLA 1N2GA 2BHSA 5DLGA 1CF4A 1XEFA 4TKZA 5B1YA 2ZOSA 3JYQA 2OHGA 1OQAA 3AUYA 4MQUA 1EFUA 4G0OA 1NJ1A 3GI1A 2YNMC 3WIDA 1T6BY 3MJHA 1H65A 4YX9A 2W2MA 1W96A 3JD4A 3A1FA 2COJA 3KHKA 3DLPX 1JAYA 2ZBUA 4HGNA 4IQ0A 2I87A 3P32A 2PT6A 4CIVA 3FPFA 1JB9A 2E7ZA 3PFIA 4JJ8A 3PPWA 1PYOA 1GSIA 1TWCA 2PKQO 1T0HB 2P4SA 1FDWA 3VNVA 4K88A 1ZHOA 3DL2A 3JU3A 5SYAA 1OYVA 1S5PA 3MWEB 3CURA 4DLBA 5BQ3A 4J9MA 4L85A 3OTWA 2BDTA 3ER6A 1M72A 1YS6A 4LFCH 1LPBB 2XLBA 3BWDD 2Z5VA 2WAMA 1S2DA 2CYAA 3QY9A 3GC6A 3TJMA 3RV3A 3Q8XB 1Z15A 5IJAA 2J6BA 1TADA 2GQ0A 2H6EA 4KXNA 3RKSA 4MQ6A 1YZYA 5HKBA 2VDQB 2HZ7A 4CM4A 3S2UA 3ZWKA 1FTWA 1F4PA 1ML3A 1XNJA 4X65H 1FLAA 1Q0LA 3ESBA 2I71A 3H5VA 1TI7A 3N70A 3RARA 3RRJA 3RFUA 3ZZ0A 4L7VA 4CF7A 1E9EA 1VI5A 4FJ2A 1M0EA 1XMIA 3FCYA 4D8VA 4GEGA 1X2BA 1HTTA 1K5DA 1GTJ1 3IDZA 4OK6A 4RPCA 1R18A 4MZDA 3PR1A 2IZOA 4NLGA 3OHMA 4IQ8A 3S2IA 2UZ0A 1UOQA 1R0XA 3RRNA 1W4RA 2O0MA 3RLFA 2HIGA 3I9LA 4Q9LA 5IYZA 1HUQA 3RF7A 2I33A 2O5VA 3G2NA 4G8BA 4I8XA 4KWEA 4TMYA 3TFOA 2E2WA 2AGVA 3T35A 3HNRA 4O7YA 4BCBA 4HV4A 5ALXA 2TMGA 3OVMA 4FSHA 2C82A 1KEUA 3D3EA 2W2LD 4Y98A 1EFVA 2PNJA 1T15A 4ZVMA 4QGHA 3OTGA 1G6HA 3PWTA 4D92A 4BNGA 2ODNA 2HC9A 4AAYA 2VDLB 1V71A 4Q4DA 4EHKA 1PT5A 5HZKA 5L53A 4MJXA 1W47A 1AZTA 4M1OA 5EMJA 2QG9A 2AW3A 4HSEA 2Z8YA 2LIVA 3ESZA 4JLWA 2VUGA 4GXTA 4G1FA 4KIWA 5C51B 4LFAB 2PZGA 4LSWA 4EW6A 1GEGA 1TJPB 1LS1A 2WZQA 4AO7A 4B84A 1TKRA 2GM9A 3DZFA 3HKDA 4CCWA 4QXAA 2VRCA 2PPVA 5HG0A 2PUTA 3RC7A 3T7IA 5A5DA 4MDFA 3C6ZA 3AR8A 4HQLA 4XJSA 3RYIB 3O2SB 4TWAA 2VQFB 3OT5A 1S0NA 4M9ZA 5ALEA 3ZHTA 5JPCA 3SQOA 4QQ8A 2BM0A 3D4LA 4EY6A 5KFGA 4MJ7A 2PWYA 1IBLH 4WMLA 1PG5A 2BI8A 5CDGA 1DOHA 2O7NA 2QSUA 3Q7SA 4IDBA 5BQFA 4QOEA 1XAIA 3HDJA 4QEDA 4R1SA 2RHMA 4OHFA 2Q6LA 3EF1A 2QRUA 3S2GA 1EKXA 1Q19A 4AZSA 3O26A 1SBNE 4FTWA 3BZUA 4RKWA 2ZRIA 4A3MG 1OAAA 4YAGA 1Y9JA 3MOSA 1GPAA 1E9FA 2ZS9A 4OP2A 1KJYA 1EEHA 2JFPA 1QMPA 3DL7A 4MI6A 1KIAA 4XVHA 3ZWOA 1FSFA 1AKMA 4ON9A 3NASA 1SMKA 2VC2B 1X0VA 3RU9A 5IN4A 3E3AA 1ZRMA 4PAQA 3T7KA 3WS7A 4EGJA 1ZS9A 4NFSA 4XIGS 3BBPA 2LP4Y 3PU6A 4J9QA 4JS0A 4DB2A 4JV2A 3HVIA 3S27A 1Z5OA 1RZRA 3ZGOA 1YZVA 2HLPA 1VLZA 4A10A 3U3DA 5IP7G 2BT4A 5L9XA 2EGGA 2XODA 4OHWA 1PWXA 3AC0A 1YFKA 4FNOA 4XGQA 1N0IA 2NZYA 3AEUB 5HIIA 1BCSA 3FJ1A 3FUXA 5MN6A 4AS1A 2B98A 1CZKA 3I9MA 1SKMA 4XZ3B 2FLNA 1DRUA 1H2EA 3LDHA 1PD0A 3DFZA 2RHHA 4AL4A 2VSNA 2I2XB 3OD1A 3X43A 3BMQA 2WD8A 3EVAA 1UZUA 3K2EA 3C43A 2CBXA 3FA2A 5GY7A 1D2CA 5BWNA 4O7TA 1QK3A 1QWSA 2FWNA 4HDSA 4KR0A 1A5ZA 4M3NA 1KYIA 2H48A 3TLXA 3NVDA 2OGZA 4HI0E 2OL4A 4PS0A 1Q57A 3R0QA 5DO9A 1QKIA 1GQOA 3BFPA 1WUIS 4G37A 2P3SA 1IBCA 2VCYA 3GLTA 3Q7EA 4POAA 3UTDA 4ZQGA 1JSCA 1FEZA 3N8GA 4OQFA 2FUEA 2NPOA 1IPHA 4ZZ3A 2W9BB 1KO7A 3U60B 1M8KA 3BXXA 3NNNA 3IFSA 4MP3A 1Z7YA 2O2SA 2KSWA 1WHSA 3R9KA 3SR3A 2RK3A 1RYSA 5YASA 3TTWA 4ZQEA 2II6A 3ON5A 4AN0A 3BE4A 4QGBA 2Q1UA 4J7XA 4BQFA 4AKHA 1A8QA 2UDPA 1ZGJA 4O3NA 3QVGB 5FTNA 2WG0A 4B73A 4BXXG 5CA1A 1K4YA 1ZVMA 1RWXA 4HO1X 1G8AA 4CKEA 2ZTLA 1LZKA 1VOTA 2HA0A 3GG2A 2J9XB 4EHFA 5WRFA 5CB0A 4LNAA 4RMGA 2HHJA 3P9ZA 4Z0NA 3V8QA 4IQFA 3U31A 4NEHB 4KR6A 4I5GA 3N8KA 3V48A 5E3JA 3PC6A 4FE7A 3N05A 1P2UA 4M8KA 4AB1A 3C6KA 2NXWA 1K4KA 3MWEA 3DTFA 3L8DA 5HV6A 4UTRA 2HH9A 3OQIB 5AM1A 4XDGA 2XQGA 4WGGA 3U2QA 3ER9A 2IEDA 1ZK2A 3G13A 4MEBA 2M98A 5AW0A 3QUBA 4PPQA 3SQDA 4LFBB 1JB1A 2CFRA 1R4AA 1I0ZA 4KR7A 2GK7A 4ED9A 1BH6A 2MR5A 2G09A 2PK3A 4RD6A 4Y9SA 1E9VA 1NW4A 1TL7C 2EIHA 2IOQA 2OVFA 2R2AA 2QRHA 1DRVA 1SJ9A 3I45A 3LBIA 2GNPA 4FYXA 4KU4A 3VSCA 2QL5A 3SC3A 4K28A 4LEIA 3GVXA 3FR7A 5G4KA 4O1HA 2BHNA 2ZM6H 2WUVA 2YNMD 1AKVA 1R5JA 1T29A 2NO0A 1M2VA 4H7FA 4PX9A 3GPIA 4UJ5A 3SLGA 4AUMA 4I1VA 3F9CA 3CR3C 3FWYA 4FWBA 1SXPA 2ID4A 4AKIA 1U8AA 3VR2D 4UUAA 4KQGA 1Z17A 5KT6A 3KHLA 2C1EA 1LDMA 2D54A 3FI0A 2R85A 1BS9A 1ZJZA 2WU8A 3IEXA 5DB4A 5EZYB 4E12A 1L7DA 1ZJ4A 2X1MA 1ONSA 2AFVA 3FX2A 3SLRA 4CM8A 5B4VA 2Q4EA 1Z9BA 2RMKA 2JFUA 121PA 1FYDA 3CMCO 2XB4A 3PVCA 2O2ZA 2CJWA 5EHQA 1EWTA 2HPAA 3R3JA 1R37A 3MOGA 4GUDA 4DRXB 4ZEOA 2IP2A 4TUYB 2CVZA 2Q0SA 4IZ6A 5IYCG 4YP1A 1U2TA 3KOOA 4DT1A 1GGMA 1Q7BA 1N7IA 5KYUA 1ACMA 5LUAA 3DKIA 2B1IA 5IARA 4BNDB 4DCCA 2JD0A 3HA2A 2HO4A 4PYMA 4TMFA 3STVA 6ADHA 5L6LB 4Q0YA 5EERA 3T3PB 3ZWNA 2H2WA 4E2FA 5BURA 1C81A 4CXMA 1LA2A 1T9DA 1U2DA 3I37X 2ZAOA 4IGKA 1JILA 1E8DA 4RQTA 4D8TA 1A8UA 4YP5A 2I4NA 5F2NA 5E3HA 1IVNA 2E6KA 3INTA 5LFAA 1I14A 4K3VA 3MFHA 2ZTHA 1EVIA 1NPDA 4M1EA 1XDSA 4UEWA 5TGZA 3W5BA 4EVSA 1Q92A 4MO9A 4BMXA 2WTEA 1VL6A 3BGDA 1GYQA 2CJPA 3NATA 2OBXA 4M1ZA 4DUGD 1DARA 3RT1A 3AL0C 3I9KA 5EDWA 4PZUA 1XEWY 1NZJA 1L4NA 1U99A 3RO7A 4N5MA 4D2IA 3M0EA 3VU9A 5CDSA 1DIOB 5BMVF 3K8ZA 2XUDA 4IZHA 3NBXX 1G18A 1AURA 1G64A 1Y3BE 1IN5A 4V02A 1DINA 1A77A 1P81A 1DQNA 1X86B 2YJNA 3CLRD 2O8DA 4Q4JB 1Z8HA 3LPCA 4FT2A 4JC5A 1KUTA 4JHXA 2I6XA 3F7MA 2Q5IA 2O8EA 4QTTB 3ICQB 2PKEA 1Q3TA 6REQB 3GZ4A 4JI5H 4QVGA 3G0CA 1W4ZA 4BNVA 2OP0A 5BXQC 3ABZA 1FVHA 5LZ7A 1O3YA 2GEBA 1Q83A 5IDXA 4HL6A 4EJFA 2J4CA 4DZTA 3ZK9A 4HX9A 3JV7A 4AMZA 4EZEA 4M98A 4DJJA 5HA5A 3DLAA 3BFXA 1OWLA 1PDVA 3ADPA 3JD3A 3DHYA 2BCEA 3LQFA 4YLYA 3BT7A 2WG2A 4WKPA 2E4UA 2RAFA 1ZISA 3EMDA 3IQXA 1WSBA 3C24A 4BGUA 3JZAA 3H1PA 4OK5A 2VOBA 4LYHA 2XD4A 5LZ5A 1Z36A 1ISFA 2ZSEA 1BZYA 3IMFA 3WGYA 5FUQA 4NXNB 4OMUA 5L4LA 3IODA 1P80A 3QGMA 3RC1A 3RAGA 3HDVA 4JU8A 4PQYA 4DR1B 3COVA 2P35A 4AYBA 2I66A 4XVQA 4YRTA 4OH1A 3C98A 3EVNA 4V1CA 4I1OA 3TZ6A 1Z8NA 2ZM6B 2C58A 3GQVA 4OGWA 4CMGA 1XZGA 5KYYA 2B2CA 4C1BA 3DAPA 3L77A 2XKJE 3LWBA 4BKQA 4HB3A 1MF7A 2YWGA 4OFXA 4HFMA 2W8ZA 3OZWA 3RIMA 3ZKWA 3RIGA 4Q9JA 5FD5A 3TLJA 5BXYA 3CPEA 5I7SA 3EAFA 1FVIA 2JI6A 3IVRA 3QUAA 1LVUA 3OIGA 1U2GC 3E7DA 3FNEA 1QPBA 5A7GA 4B45A 2IXGA 4E94A 2AQHA 2XB6A 3FPLA 3MR2A 1IL0A 2C4VA 3SICE 1BHO1 4GZ6A 3TQIA 4E21A 3IVCA 4EAQA 4XB2A 3I30X 4TM7A 4NU5A 4U7JA 3TM5A 4KQHA 4EUNA 4G65A 3D6VA 4M0KA 5ESWA 3TW0A 4WOPA 2OPBA 3LT4A 4URXR 1A1VA 1XAGA 2V7EA 3WR5A 2BONA 5L45A 4JYBA 2BP7A 2HCJB 2Z56A 4XPZA 3T5PA 3OJLA 3AIOA 1BQEA 1FVFA 3B89A 1A96A 1LQUA 1M1YB 2RGNA 2WHYA 3C1UA 3LUBA 4HVAA 1KDYA 1M73E 3ZX4A 2IY7A 3O6VA 4KR3A 3TBKA 3UH0A 2WQ7A 2QPTA 3DGEC 3Q3VA 4W5HA 1WCMG 1A72A 2GEFA 2NZ2A 4QGAA 4YP7A 4DR7B 1GKUB 2J3QA 3IPRA 4W8OA 4YA6A 4TV9A 5EQJB 3O0TA 3SEQA 2VJYA 3E81A 1VGVA 4XPIA 5TXGA 4EFDA 2YZLA 5HF9A 2C1XA 4MEJA 3W05A 3WIVA 3FHTA 1IPEA 3HN6A 3U49A 3AHIA 5JFTA 4HDSB 1JV2B 2MSCB 1SZJG 4C7XA 2J59A 3I8SA 4M0EA 4QXQA 2CJYA 5F7XA 2H07A 1LK0A 3C7AA 4EHIA 3HB4X 3N8HA 3EDYA 1YFZA 2IBMA 2VJPA 1SYXB 3FVRA 3RBXA 2ZDGA 1RYNA 4FK8A 1DEHA 3DLTA 3OCZA 1CW2B 1VG1A 2BFFA 3OT1A 3UHFA 1NN5A 1Z88A 3E2PA 1MEOA 2F1KA 4OH7A 2Q0XA 3IE1A 1GRQA 3EEFA 3VPFA 1P31A 1NLUA 1GZ7A 2YQZA 3ZDXB 4CL0A 3IPAA 5C31A 4INJA 4ZO7A 3ROKA 4UU0A 1C7QA 3HVHA 1YDWA 2O8NA 3A0RB 5FYDA 4C0WA 3PGXA 2AZDA 2D4HA 2GH1A 2IX9A 2QLTA 3S4YA 3F5QA 2DABA 1W0JD 2WHXA 3C15C 2XVXA 4Z7NB 4M53A 5CT4A 3FVTA 1U0RA 4FCWA 4AJJA 4MHTA 3R5XA 3ITDA 1JFSA 1M7GA 2TS1A 4B87A 4QUHA 1RM0A 5K45A 2BQ3A 3AVXA 2WWWA 4OQ4A 1JSLA 2ATLA 2NVXA 2UZ1A 3AKCA 4RIIA 3KQYA 4HFRA 5EJFA 1EWYA 4AM8A 3NVAA 4BMOB 4Z4CA 2Y4NA 3RYCA 2GXSA 1P2GA 2C2MA 1NQVA 1VFNA 3WJ2A 3V4ZA 3AQ4A 4IUDS 1JVSA 3DAOA 5EUBA 4FR5A 2QTBA 3WLRA 4OFBA 1U1GA 1UADA 4WFJA 2A7XA 5HK8A 1UMCB 1YJBA 2WB4A 5JR3A 1NBEA 1U3VA 1HOTA 1VG9B 1N6NA 3ZLBA 1SHTX 4LJ5A 2HT6A 2IE8A 1IY8A 3G0BA 4DIEA 3SYRA 5HW0A 5CXXA 4GYWA 3VH3A 2W6ZA 1YH3A 1CUSA 1I1KA 1ODTC 2PY6A 3DYVA 5H7XA 5HFNA 5CE8A 2JIOA 2A58A 4LZAA 1B3BA 4PRYA 1DIHA 3V8NA 3M8KA 3C5EA 1L6IA 4AKTA 1ZSYA 1XTPA 4ZVVA 4KRXA 3BE6A 1AN7A 3L05A 4FVTA 4J16A 4RMIA 4DPLA 4ZGGA 1YI8A 3Q5DA 1YL7A 3RYHB 5AI5A 3K0SA 1RAEA 1WCIB 1VMEA 4TSKA 3SPXA 3P0HA 2D5BA 1UDCA 3DO6A 3RLIA 3VHXB 3LVFO 3U4MA 3KUDA 1BD4A 4RUCA 3GPDG 3NO4A 5K8UA 3EB9A 2Y1XA 3ENWA 1PX0A 3HJNA 1YK0A 2X40A 3DB2A 5E2AA 1MJ5A 2JJ8A 4KXQA 4LYDA 5JEEA 5FPRA 4V2UA 1TK9A 3QXGA 5JYBA 3GEPA 3C0FB 1HURA 2G28A 5LM3A 5HRCA 1OWPA 2E55A 3DMHA 4JI1B 3UJ3X 3A32A 3DZIA 4FXPA 3FW1A 4Z3KA 1Z0JA 3M6FA 5E0KB 4A82A 1S9DA 2ZJAA 3PQ3A 2WDZA 5DM2A 4FB5A 1WLYA 1Y1RA 3W9SA 3CC8A 1V2HE 3E53A 2NU8A 5AESA 4BP9A 3EZ2A 3CRMA 3URKA 4BJHB 2BFBA 4YCDA 4F8JA 1X77A 1EDDA 3K71B 3KDAA 3LC1O 2GZDA 4FMCB 1X70A 3GLHE 1KJZA 4HBGA 4MPJA 2VQEB 3TLMA 3BKXA 3DW1X 3LI2A 2JIMA 4JMPA 2FE4A 2IYVA 3C5CA 4OI2A 5DM0A 3GGJA 3MJSA 2J9YB 2ZTVA 2NAFA 2PXAA 1KVRA 1TUEA 2V5UA 4C0JA 3GRCA 4L8GA 3SZOA 2JLWA 8OHMA 1OE0A 4ZOAA 5BWCA 1YSCA 3L8YA 4LVNA 1P1KA 2OO3A 1UAGA 1K68A 1YBVA 2E4AA 3DHWC 3QUQA 4HGYA 3HVRA 8MHTA 3OMXA 4K87A 1OC4A 1VC2A 4M86A 3RVJA 5BV1A 3U81A 2MMGA 2YHAA 3ZWAA 4D96A 4YR2A 1CUYA 5FOVA 3UPTA 4JJKA 3FOWA 1SXJA 4P9NA 4TSFD 3IDOA 3EX7C 1GSHA 4O4JB 1CHNA 3HKZA 1JU4A 1RI3A 2JKZA 2L19A 3IV6A 3ECCA 2I7XA 2ZRCA 3VOAA 3VR4A 3T99A 4ECSA 4P3YA 1QAQA 4CM3A 1DHRA 4EG0A 1ISHA 4MCHA 2DLNA 4N01A 5AKZA 3ONVA 1J0AA 4LOAA 5DYNA 1SUSA 1IHYA 3V6MA 3OIYA 2A30A 4Z4QA 2UVWA 2EFCB 3TY5A 4KGVA 2RE8A 2CEAA 3R77A 2ODAA 4JBIA 3ICCA 2W71A 4FU0A 4J94A 4JI4B 2XBMA 3FDZA 3LOPA 3NQ41 2JCBA 3QKSA 3RJ9A 2OB2A 5JXGA 2B4QA 4C05A 2I3DA 3B51X 3WK5A 2P11A 4HB4A 3S99A 2WP8J 1JG1A 4RA9B 4XX0A 5EE3A 3SK0A 3W8EA 1WXWA 3TFQA 3EGCA 2ZUFA 2P0AA 1NOJA 2IF0A 2R751 5ECDA 4C3UA 5F98A 2CFSA 3ZGYA 1J6UA 2IIBA 4YALA 4JI2H 1U31A 3BVPA 4DV7H 4URUR 4DEXA 1ISJA 1SEPA 4D9GA 2XQJA 1IBLB 1ZOLA 4HRAA 3IV7A 3UXHA 3OWXA 1K3UB 1IDN1 4JGBA 3ENZA 4RW0A 2PKXA 3SNHA 3VSEA 2IUSA 1DAOA 1OXVA 2ODWA 4MB6A 5C4IA 4M1MA 3H3JA 1PZEA 5ALRA 2X41A 4ZVPA 3ESDA 3C6MA 4FFBB 3M9NB 1UBRS 5E6RB 1AN9A 4R69A 2ZFUA 3JCZA 2HL6A 2P79A 4Q1AA 3SEZA 3EXFB 2YYSA 2KI5A 1H42A 1KGSA 3L6CA 5ESDA 4B33A 3ZKWB 2G1KA 4DM4A 1VIAA 3AVWA 2DVMA 3RBVA 3UANA 4KE8A 1YF3A 1YXMA 2BFEB 4CETA 4BP1A 1NQTA 4S12A 4QWBA 3AHEA 5KFDA 1B6TA 1NBAA 5CCXA 1PLLA 2A4KA 2CNWD 1FJGB 1WPGA 4CM9A 1NVTA 2PH3A 2W90A 4A8JA 4N3AA 2NUAA 1VECA 2BIFA 1CJTC 2QP3A 4P53A 5BN5A 3I5YA 1JHVA 2INGX 3DKVA 3HXOA 1P1IA 2DX7A 1IG0A 3MF4A 1PR1A 4MVCA 1TZCA 5A03A 1U2DC 3QUCA 2Y1DA 5FCDA 1UPCA 3Q8RB 4HYKA 3JR7A 4BMNA 2RH8A 4YJGA 3W5IA 1OHHA 4ECUA 2RD2A 2QN7A 1V7CA 3SF0A 2UYQA 4JT8A 4UFZA 4R2XA 3R9RA 3ZC3A 4DEVA 4X7RA 3OZAA 4EHLA 3E5NA 4IVNA 1K7SN 3KM0A 4ZYXA 3R9WA 3F0TA 5BMVA 1XD9A 2X22A 2A0YA 3BL5A 3UJ6A 3WLNA 4DWWA 1XPOA 3DMPA 1T2UA 3LY9A 1SU6A 5FBWB 4FGRA 4NSNA 4BV3A 3KC2A 3HB0A 5C8DA 3DDNA 3IRUA 3LOQA 4RIHA 1R3UA 2AOUA 2B82A 2CLHB 4YCNA 5JQGB 1FRZA 1RJ9A 1XYVA 4Q7LA 4A3BG 4YLGA 2OHOA 5DIZA 3U1BA 5A62A 3O73A 5T14A 1CQZA 1Q7TA 1DV2A 2PYDA 2X2PA 2XIQA 3FWPA 1A9ZA 3A4TA 3K1JA 2GZ1A 4DBZA 4EPWA 1G19A 1EE9A 1QVVA 1V7QA 5HHTA 3HOVG 1U3CA 5JXHA 4MGEA 4L5YA 4KXWA 4CN9A 1NIPA 5H80A 3FHJA 4LVOA 3RVKA 1JR3E 1GZUA 4JVMA 3ONWA 5U1PA 2OHFA 2ERYA 2I4RA 1S2GA 4F8EA 2UAGA 1TXGA 3AETB 4YJ2A 5KFKA 4P5DA 1KAMA 3O4FA 4WJZA 5BWOA 1PW7A 4YRLA 3RTGA 5FR2A 3HL4A 3ZN2A 1KVSA 1CFZA 2C5HA 1ECBA 1TF7A 1T3SA 4JKIA 4A5OA 1I7PA 5BP7A 3K2QA 2QD1A 4PPYA 1OLXB 1BVHA 2HMWA 2QTNA 3DUFA 4FWIB 4GNRA 2Z43A 4CMEC 1G8GA 3AV0B 2QJTA 4UOQA 4MW0A 2RHOA 4A6EA 2O06A 3FZYA 4F50A 3HB9A 2JASA 2R00C 3GBPA 2D1FA 4IDQA 3RU7A 1E4VA 3W34A 1YQDA 5IP9G 1UPFA 3A06A 4QPPA 4F4JA 5A0VA 4QJ3A 1G3MA 3AHCA 1XLUA 1Y4AE 4RM3A 2OZKA 3DV2A 2B3DA 3E8MA 2ONKA 2N42A 3LBHA 3ESYA 4EHDA 3FN4A 1V1MB 5CLQA 1XVAA 2YX1A 3I83A 3U39A 1CWUA 3D31A 3EMVA 1NF8A 3BXPA 3QVTA 4KACA 4RY8A 4MWSA 1NYLA 5CA0A 3VZPA 1X1BA 4DB4A 2GM3A 3LO5A 3PC8A 3NOXA 3UXYA 1KJIA 2W8LA 5L7YA 3V7YA 1K7FB 1ODJA 1E2QA 2NG1A 2QNIA 4ZC8A 1ZM4A 3WK4A 2QXUA 2VRNA 3UOAB 4X1KA 4KYUA 2WJWA 4A23A 1A8HA 2Z30A 1JXOA 3LUGA 2V3CC 4TLMB 1JDPA 1ORVA 3LVRE 4MQBA 3GU3A 5KT5A 1NP3A 2VVTA 4KREA 2G6BA 1QBGA 2GEUA 3JQBA 4PVDA 5DG8A 1BDMA 1IXSB 2PYZA 2C9MA 2IK8A 3O9MA 5IT5A 2IOYA 5EUMA 1G6KA 3DULA 3BIOA 2GFQA 4LOJA 2VR1A 2QYTA 3OM0A 1MENA 2OENG 3MT0A 1GSOA 5T6MA 3DKPA 1W0JA 2VJMB 4ENRA 4CG1A 4NE7A 3KT6A 2ZE7A 3U5TA 2QW8A 4NK5A 4ZEMA 4YQYA 3I2KA 4FKMA 1OWNA 4RD3A 3WIUA 4II3A 1QIFA 1K27A 2EKPA 4MLCA 2QJWA 5JVDA 3RAXA 1YJXA 3CM0A 5JXWA 2HA3A 4D3DA 4E5MA 5MGNA 2MHCA 4CMFA 1TCAA 4Q93A 3GIIA 3F3MA 2V7GA 3EGEA 1M6NA 3Q0EA 1WY7A 3A1WA 4UAGA 3HOWG 2EJBA 4MUEA 4P3KA 5EWGA 1WB4A 3ZHZA 2BGLA 4A0QA 5KCZA 4GEKA 4J4TA 1JG2A 2XDQB 3N42B 1KQ3A 1SHLA 5AWFC 3BGIA 2C00A 1JL3A 1VBKA 3PGKA 3SC2A 1NQAO 5FPOA 2B4TO 3EF3A 2C2YA 4LH6A 2G76A 4GRDA 3FUCA 2C3OA 3UOGA 3SBEA 4I3HA 1SOVA 3ZK7A 3UJBA 2RH4A 1DS6A 1F17A 4HZUA 4BNKA 3Q7IA 1UBSB 4YR3A 2C5BA 3NTQA 2AGQA 3GARA 3PC4A 4WLNA 2RI1A 3QTBA 5LVAA 4F9FA 4XWWA 4HDRA 1KAEA 3HEBA 5DCLA 2G71A 1ZUNB 3L7JA 5KDOA 5DLFA 4HPXB 2JBWA 2H5EA 3DL0A 1SVLA 3EZLA 5FAXA 3UKDA 2CXHA 2OV1A 4GIBA 1KDVA 4BIIA 1LSUA 2VSOA 1KEKA 2WJZB 4BC0A 2JEIA 4MJLA 5HKKA 3WLOA 1DCKA 4QULA 2E4ZA 4KO4S 1UM9B 2DT8A 1DC6A 1TVCA 2R62A 4OYYA 3HH8A 3HU5A 4NYIQ 5FTLA 2VQFH 2WAYA 3HCCA 2ISSD 4Q03A 2GFHA 5JLJA 1ZGBA 2FOLA 3D4NA 2C4HA 2HWXA 4JLJA 3GPBA 3UWKA 5BWTA 4CG2A 5B7PA 1EM6A 3V80A 3W5DA 1NYTA 2FWIA 1W30A 3DHEA 4MLDA 4MYRA 4DMHA 3DBHA 2HO5A 1M6YA 4EBEA 1Y5MA 3FOBA 4Z53A 5CUQA 1N0UA 2E49A 5THQA 4CKYA 1GVHA 1NN0A 3UT5A 1VB5A 3PC7A 3S68A 4RTJA 4YV0A 1H0SA 3WLTA 1I30A 3QW4B 4NENA 2SECE 5ESXA 2TRSB 3GLIA 1FXUA 3CRVA 1UT6A 4QYIB 5BV2P 2ZZMA 3NDPA 4GQAA 5KVQA 1TO6A 2CL0X 2R97A 5KCMA 5D1PA 1XU4A 2HIAA 3FYTA 4YJDA 1CUEA 4OP1A 2XZDA 4DGSA 4GMDA 4X6YA 6PFKA 2NXEA 3VO1A 3HS3A 4GPAA 4OHCA 5C5EA 1Y7HA 1QPGA 1C7JA 4IEIA 3WGQA 2DOKA 2WJAA 1Y1SA 1EX1A 2H1RA 4YCLA 3K9HA 2J6SA 3RTEA 1BVUA 1S8NA 2XXBA 2H08A 2WUWE 3MMXA 3JQ8A 3RH0A 2H1IA 5IH7A 1XZIA 3ELUA 4DADA 4WHMA 4AD8A 1N6OA 3FMPB 3KUXA 4FHEA 4GUAA 5T67A 2XCIA 1F8FA 3L6OO 4R01A 4TTTS 3HA3A 1PJ3A 1XF9A 2XPCA 4WE3A 3G2JA 1QJ4A 2H31A 5KG3A 1Y4DE 1T1RA 3DR5A 4FE3A 4KXVA 1R9NA 3L7YA 4D79A 1KYTA 5AVSA 5LOVA 4A3KG 4MWZA 4L0MA 1VP9A 2VLBA 2ZVPX 3DE6X 4IAOA 1Z2CA 1R64A 3UCEA 4RTSA 1OBOA 4L9RA 4G9EA 3U09A 1W8DA 1KP2A 1OLXA 5DYIA 4LQLA 2G1PA 1VHWA 4LMAA 3WWHA 1A5TA 1PU2A 2XMGA 3DONA 3FYUC 4G56A 3CUTA 4JMLA 3EXG1 4PSAA 4EI7A 5LMZA 4QYWA 5CDTA 4BNLA 2E2HA 2AYYA 3UHAA 3VR4D 4RB1A 5JH7B 3LVQE 1ZVKA 5DLEA 1SC3A 1H3NA 5CHYA 5EINA 5IJ0B 3RYCB 1MFZA 3T5BA 3TLBA 2KQUA 2W9CB 2BD0A 3KQVA 1QIHA 2J7PA 4BKMA 3I12A 3L7AA 4RTQA 4D81A 1WCYA 3KL2A 1SC4A 2W4IA 2QLLA 4GC6A 2AOTA 2FTKE 4N7RA 4CG0A 4BOYA 4ALNA 3KLBA 3G2LA 1ENPA 4TWRA 4EKIA 1JMYA 1GPJA 2XYQA 2VF5X 1RPAA 5KTSA 2JLXA 2GK3A 1A69A 1C0PA 2EAUA 1IZ0A 1KZ9A 4DDUA 2Z95A 1DDIA 4KQXA 4UCFA 5HSGA 1CCWA 1ZHQA 5HNEA 4URZR 3RSHA 4U2DA 3ZWVA 2AU0A 4ZC1A 4FBLA 3NOQA 4MQFB 3ZDRA 4WJKB 5F76A 2WTAA 1U4SA 1KORA 2P5UA 5D8DA 1E2GA 3I8OA 3LUCA 5KFMA 2QE6A 4JLNA 3SSAA 3PDJA 2ZR0A 1Y63A 1ZGZA 3WLEA 3E5RA 2ZR8A 2A0WA 4L4SA 2D1RA 4XTCS 5D85A 1DT3A 4O3QA 1GQRA 3DE3X 2YFKA 4L6IA 3VPGA 1TUIA 1A97A 1U1CA 3VU1A 4ZJUA 2DECA 1QHFA 4WUVA 3CZ4A 2N1MA 4UUBA 1BAPA 3W1EA 4UC0A 1J0CA 1PFWA 2HPZA 2CLIB 1SNYA 1V4VA 1Y1KE 3G59A 4ISBA 4LRTB 4UBIA 4YRCA 4ILKA 5GPBA 1JDJA 1TM5E 3TLGA 3HPQA 4N40A 1IHPA 3PQ8A 3T5TA 2D2XA 2NW6A 3OU6A 2H0AA 3K1AB 2HQBA 4PR0A 5CU7A 4FW8A 1Y98A 1FL9A 2TECE 4R2IA 1RKBA 1SHKA 4YUYA 1BQ3A 5IMSA 5FULA 2PS3A 4R2LA 2BJWA 2VLIA 3OEHD 1ZIXA 4X1KB 1RWPA 3W9BA 1ZD8A 4EGCB 1E9CA 3ZIUA 1ZLXA 2BW0A 4NP6A 2NNWB 3REQB 2V0NA 3TDKA 1AHNA 2FLVA 3NCHA 5IPFA 4H7DA 4ALKA 1ZVVA 3RK1A 3QLVA 3DKKA 2R6CA 3OLWA 4L78A 3WLPA 1XZJA 9LDTA 5DGTA 3H99A 5K6TA 1PJBA 3F6RA 2XDQA 3IA2A 1PSWA 3EEBA 4DL2A 3M34A 2XZTA 4HGOA 3KWLA 3DLCA 2CJFA 1RWNA 5KNLA 4AJ1A 3H2HA 1YOVB 2O1EA 3HCAA 5K3AA 4DCVA 4C4ZA 4YJ2F 3UHOA 3LG2A 1CY1A 2HD4A 2NUPB 2UYYA 3CX7A 3PNOA 3TEJA 3TBFA 1RYDA 3IVAA 5CDFA 2XJ4A 3EIHA 4LAFA 4PAGA 1GFIA 3QYJA 2UUPA 1A71A 1NVFA 4YASA 5JO9A 1KE2A 4CMKA 1MZBA 2QMOA 4YMGA 5C2JB 2Q2UA 2FPGA 3TPFA 4CT5A 2B37A 3VYWA 2ORWA 4DPMA 3N5KA 4QDXA 4RENA 2F3RA 1X1CA 4LOKA 4G4SP 1AUXA 4J9SA 3D2CA 4DSUA 4O2RA 1JP7A 5DWQA 5HQTA 3S81A 3THWB 5CBPB 3W4KA 1B7GO 2A3RA 4H0FA 5EIBD 3TQOA 5KTPA 1O94A 2DB3A 4XLZA 3HKEB 1ANKA 1JPNA 3LOUA 4O29A 5K8CA 4BGDA 3MERA 1JQAA 1OFUX 4RLFA 4ZU6X 4EW1A 2XOXA 1GFSA 5D51S 7AT1A 1HTWA 4NZNA 1KH3A 2A7QA 3AK4A 4OBXA 1VSQA 1BC5A 5A4JA 3KOUA 1U0SY 1B42A 4Q34A 2ZJBA 1UK6A 1Q95A 2X4DA 3TVDA 4DXHA 2P2GA 2MYTA 5ER6A 1EKVA 1R6XA 4UCVA 2Z3ZA 4X20B 1X13A 4X93A 3TI9A 4HAWA 3UIEA 5CYFA 1NI4A 2YV1A 5B58C 3NWJA 3IPCA 3K0KA 5HZHA 3I53A 1QE3A 3IXQA 5EXPA 1VMDA 4QW8A 3H04A 1L8AA 4A27A 1G17A 5E1DA 5I7HA 2FMKA 3R3ZA 1HZJA 1M10A 2GZ3A 3PYXA 3D4IA 3NJRA 3O93A 4B3CA 5ETJA 3A1SA 4KUEA 5KX5A 4YR7A 5G53C 3BD7A 4XDZA 4C2MA 2C2HA 3CX4A 4NLLA 5JS7A 1B1AA 4KZKA 4G97A 1YB2A 4O4LA 4UQOA 2FN8A 3NBYC 2JB9A 3M6LA 3CPJB 3C97A 5DW3A 5B3KA 1JDEA 1DIKA 1M74A 1JA0A 1VTKA 2QVGA 2QY6A 5CYOA 2FK7A 5C1OA 1JHUA 1U9CA 2W93A 3RJMA 3LU1A 2I1WA 1TKAA 1RM5A 3NWEA 5GGYA 4Z0HO 3Q8LA 2PO7A 3Q2KA 4DLUA 1FNBA 2OMKA 4RSRA 3K05A 1Z73A 2Q3JA 4LXYA 4WCFC 3VR1A 3WZMA 3K0FB 1Z2NX 4GNKA 4XR4A 1JQBA 4UBMA 4BP8A 4Z0PA 4O25A 4MA0A 4GKKH 4FHDA 4M2LA 3OMWA 4RK5A 4TTQA 3UKOA 4A9AA 2ECQA 3QEMB 3CVUA 1P7PA 3GQCA 1P6XA 1W5SA 2O1SA 2IDZA 1OYOA 1MW9X 2YMPA 1HNNA 4U3JB 4DV7B 4GL2A 1T3ZA 1YCHA 4FYVA 1JR6A 2IPXA 1OX4B 5CJ2A 4HDMB 4UBKA 4UTVA 1UBEA 4IX1A 3EZNA 4D3SA 4Q1VA 4UCUA 2BFEA 1YAHA 1XK6A 4UJ3A 4RAZA 1NJ6A 3JR3A 4G1VA 1JBEA 1KK1A 1LFDB 2DAAA 4A3EG 4Q47A 3ROMA 4AY2A 2F9LA 3NCTA 3FH0A 2OYSA 1FMLA 4EKEA 1AUVA 2W8KA 1U8YA 2R7ZA 3GDHA 1FLDA 4F3RA 3BH0A 2BKEA 5G1NA 5DKFA 5JNUA 2BFCB 2C2WA 3GEMA 4JC8A 4UDYX 3TGPA 2FJZA 1WKVA 3AL2A 3HBNA 1MIOB 1SOUA 1PEAA 2HFJA 4Y2RA 5BN1A 5C8VA 3F47A 4FDLA 3R4VA 5CIWA 3G82C 4Y2JA 4A6DA 4G6ZA 4D02A 2BEUA 5JOQA 2ZSFA 2WD7A 1XDDA 3GLIB 1RTKA 1RQPA 4FFNA 2PSFA 3D6TB 5ECYA 4B7UA 3QWUA 4DG8A 4IDOA 5JAPA 4ONEA 2ZBPA 2FRDA 1OBFO 1L5YA 1RAGA 2OAP1 2AA3A 3L3BA 4W8HA 2BGNA 4R7GA 4DLLA 3B1JA 4EPTA 3NJ8A 4OU5A 3TD2A 1O6ZA 5JALA 1X7DA 3VUFA 3CUWA 3B85A 5LDHA 3FTQA 3RVRA 2JA6A 2JIQA 2RFLA 4X64H 3C3KA 5DV9A 3O84A 4I8IA 4J6FA 2E5LB 2UXDB 1TJ5A 1FP6A 3GCWA 1Z5WA 2HHLA 2VNAA 5LN1A 4E70A 1G291 3GCZA 1ZK0A 1YU6A 3X1DA 4ER3A 1UJMA 4HT3B 1IWBB 3GW8A 1SD1A 3F90A 3X2SA 2PLRA 1N2CA 1BWSA 3LC0A 2C83A 3IMKA 2D7JA 5BVGB 4E6NA 2PEZA 1DWQA 3OJOA 4B4VA 2EXXA 1CZUA 1V47A 5ENZA 4ENWA 1FY2A 3PW5A 4QG3A 1XVIA 2BFDB 3AMVA 3SIPA 2JIBA 3TRHA 5H0IA 4BNIA 1VLHA 5BR7A 3VQTA 5CFZA 5JMOA 3GEBA 4JCOA 1Z35A 3A2KA 3CZRA 3O8OA 3WRYC 4V0NA 4F91B 4TWJA 1SD2A 3PE4A 4H4EA 1IHXA 3Q10A 5EIBC 4Y7DA 2M6LA 3RVMA 4WY8A 5AM3A 1PX2A 1T6YA 1Q6YA 4FOPA 5JSYA 3WWDA 3K53A 4I4CA 2Q7XA 5EWJB 5HXAA 1BS2A 3QKTA 1E0JA 2P8SA 1TM4E 4QUBA 3EZ7A 4JSTA 1GCUA 4KKVA 4MGIR 5EUCA 5K0LA 4G4IA 2C5LA 3SKXA 1GM5A 1HNZB 4EECA 4I9HA 2WFMA 5FLYA 4F12A 2EZ4A 3O4VA 1OXSC 3WGGA 2DQZA 1JMKC 4N9QA 4W1RA 4JI3B 2J7PD 1DI0A 2BEVB 3GZTB 2WNIA