5C1VA

Crystal structure analysis of catalytic subunit of human calcineurin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
317
structure length
317
Chain Sequence
PPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcineurin Undergoes a Conformational Switch Evoked via Peptidyl-Prolyl Isomerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
total genus 105
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5c1vA00
3CK2A 2QFRA 5INBA 3H66A 2AHDA 2IE3C 3ICFA 2USHA 1IT6A 3THNA 1HPUA 2QFPA 1UTEA 4LU9A 3H67A 3QFNA 1S95A 2A22A 4MOVA 1USHA 1Z2WA 3E7AA 1UF3A 2DFJA 2NXFA 4I5LC 4F0ZA 2YVTA 1II7A 4H2IA 2WDCA 1T71A 1S3MA 4B2OA 3RL5A 4KBPA 1M63A 3QFOA 2NYLC 3KBPA 4OR9A 2JOGA 5GTUA 4JA7A 4IL1A 4YKEA 3H60A 1HO5A 3RL3A 4TUGA 4DHLA 3RL4A 2R17A 3IB7A 1HP1A 2BQ8X 2CV9A 4O43A 1U32A 3V4YA 4M0VA 4ORAA 1XZWA 5JPFA 4UT3A 3DSDA 3H64A 4MOYA 4H2BA 2IAEC 3AV0A 3C9FA 3HVQA 4V0WA 5EQVA 3H63A 3IB8A 4LACC 4LTYA 5JPEA 3H61A 1T70A 2WDFA 4H2GA 4DSYA 1WARA 4ZX2A 1Z2XA 4J6OA 2NYMC 3RQZA 4JA9A 1G5BA 2NPPC 3K7WC 5C1VA 2BCDA 2P6BA 3N5UA 1TCOA 1W24A 3IVEA 4O4KA 1OI8A 2HYPA 4G9JA 3QG5C 1S3NA 4FBWA 3PSOA 1QFCA 2GJUA 4XPNA 4ORCA 4V0XA 5F3WA 4FBKA 4UT2A 4DT2A 4O5GA 4KKZA 3ZTVA 4O24A 2Q8UA 3K7VC 3PSNA 1MF8A 1V73A 1KBPA 2HY1A 3ZU0A 1OIEA 3FGAC 1QHWA 1FJMA 4V0VA 4TUIA 2WDDA 3IVDA 5B8IA 4ZVZA 3QFKA 1S8EA 1S3LA 4H1SA 5J28A 3THOB 3AUZA 3DSCA 3E7BA 3QFMA 1XM7A 3EGGA 2IE4C 5JJTA 1WAO1 3JYFA 1OIDA 2Z06A 2Z1AA 3EGHA 4Q7FA 3GVEA 4I5NC 1JK7A 2KKNA 3C5WC 3T1IA 3DW8C 2QJCA 2Z72A 3LL8A 4UT3B 4H2FA 3TGHA 5DNYA 4NZVA 5HPEA 4IYPC 4UWQA 1AUIA 3H62B 2BDXA 1S70A 4ORBA 4FCXA 3H68A 3P71C 2HYOA 4WWLA 2O8AA 2WDEA 3H69A 4MP0A 1SU1A 4FBQA 2XMOA 2O8GA 4HD0A 2ZBMA 5IOHA 4H1YP 1NNWA
chains in the Genus database with same CATH superfamily
3D03A 3CK2A 2QFRA 5INBA 3H66A 2AHDA 2IE3C 3ICFA 2USHA 1IT6A 3THNA 1HPUA 2QFPA 1UTEA 4LU9A 3H67A 3QFNA 1S95A 2A22A 2DXNA 4MOVA 1USHA 1Z2WA 3E7AA 1UF3A 2DFJA 2NXFA 4I5LC 4F0ZA 2YVTA 1II7A 4H2IA 2WDCA 1T71A 1S3MA 4B2OA 3RL5A 4KBPA 1M63A 3QFOA 2NYLC 3KBPA 4OR9A 2JOGA 5GTUA 4JA7A 4IL1A 4YKEA 3H60A 1HO5A 3RL3A 4TUGA 4DHLA 3RL4A 2R17A 3IB7A 1HP1A 2BQ8X 2CV9A 4O43A 1U32A 3V4YA 4M0VA 4ORAA 1XZWA 5JPFA 4UT3A 3DSDA 3H64A 4MOYA 4H2BA 2IAEC 3AV0A 3C9FA 3HVQA 4V0WA 5EQVA 3H63A 3IB8A 4LACC 4LTYA 5JPEA 3H61A 1T70A 2WDFA 3E0JA 4H2GA 1WARA 4DSYA 4ZX2A 1Z2XA 4J6OA 2NYMC 3RQZA 4JA9A 1G5BA 2NPPC 3K7WC 5C1VA 2BCDA 2P6BA 2YEQA 3N5UA 1TCOA 1W24A 3IVEA 4O4KA 1OI8A 2HYPA 3FLOA 4G9JA 3QG5C 1S3NA 4FBWA 3PSOA 1QFCA 2GJUA 4XPNA 4ORCA 4V0XA 5F3WA 4FBKA 4UT2A 4DT2A 4O5GA 4KKZA 3ZTVA 4O24A 2Q8UA 3K7VC 3PSNA 1MF8A 1V73A 1KBPA 2HY1A 3ZU0A 1OIEA 3FGAC 1QHWA 1FJMA 2DXLA 4V0VA 4TUIA 2WDDA 3IVDA 5B8IA 4ZVZA 3QFKA 1S8EA 1S3LA 4H1SA 5J28A 3THOB 3AUZA 3DSCA 3E7BA 3QFMA 1XM7A 3EGGA 2IE4C 5JJTA 1WAO1 3JYFA 1OIDA 2Z06A 2Z1AA 3EGHA 2ZO9B 4Q7FA 3GVEA 4I5NC 1JK7A 2KKNA 3C5WC 3T1IA 3DW8C 2QJCA 2Z72A 3LL8A 4UT3B 4H2FA 3TGHA 5DNYA 4NZVA 5HPEA 4IYPC 4UWQA 1AUIA 3H62B 2BDXA 1S70A 4ORBA 4FCXA 3H68A 3P71C 2HYOA 4WWLA 2O8AA 2WDEA 2ZOAA 3H69A 4MP0A 1SU1A 4FBQA 2XMOA 2O8GA 4HD0A 2ZBMA 5IOHA 4H1YP 1NNWA
chains in the Genus database with same CATH topology
3D03A 3CK2A 2QFRA 5INBA 3H66A 2AHDA 2IE3C 3ICFA 2USHA 1IT6A 3THNA 1HPUA 2QFPA 1UTEA 4LU9A 3H67A 3QFNA 1S95A 2A22A 2DXNA 4MOVA 1USHA 1Z2WA 3E7AA 1UF3A 2DFJA 2NXFA 4I5LC 4F0ZA 2YVTA 1II7A 4H2IA 2WDCA 1T71A 1S3MA 4B2OA 3RL5A 4KBPA 1M63A 3QFOA 2NYLC 3KBPA 4OR9A 2JOGA 5GTUA 4JA7A 4IL1A 4YKEA 3H60A 1HO5A 3RL3A 4TUGA 4DHLA 3RL4A 2R17A 3IB7A 1HP1A 2BQ8X 2CV9A 4O43A 1U32A 3V4YA 4M0VA 4ORAA 1XZWA 5JPFA 4UT3A 3DSDA 3H64A 4MOYA 4H2BA 2IAEC 3AV0A 3C9FA 3HVQA 4V0WA 5EQVA 3H63A 3IB8A 4LACC 4LTYA 5JPEA 3H61A 1T70A 2WDFA 3E0JA 4H2GA 1WARA 4DSYA 4ZX2A 1Z2XA 4J6OA 2NYMC 3RQZA 4JA9A 1G5BA 2NPPC 3K7WC 5C1VA 2BCDA 2P6BA 2YEQA 3N5UA 1TCOA 1W24A 3IVEA 4O4KA 1OI8A 2HYPA 3FLOA 4G9JA 3QG5C 1S3NA 4FBWA 3PSOA 1QFCA 2GJUA 4XPNA 4ORCA 4V0XA 5F3WA 4FBKA 4UT2A 4DT2A 4O5GA 4KKZA 3ZTVA 4O24A 2Q8UA 3K7VC 3PSNA 1MF8A 1V73A 1KBPA 2HY1A 3ZU0A 1OIEA 3FGAC 1QHWA 1FJMA 2DXLA 4V0VA 4TUIA 2WDDA 3IVDA 5B8IA 4ZVZA 3QFKA 1S8EA 1S3LA 4H1SA 5J28A 3THOB 3AUZA 3DSCA 3E7BA 3QFMA 1XM7A 3EGGA 2IE4C 5JJTA 1WAO1 3JYFA 1OIDA 2Z06A 2Z1AA 3EGHA 2ZO9B 4Q7FA 3GVEA 4I5NC 1JK7A 2KKNA 3C5WC 3T1IA 3DW8C 2QJCA 2Z72A 3LL8A 4UT3B 4H2FA 3TGHA 5DNYA 4NZVA 5HPEA 4IYPC 4UWQA 1AUIA 3H62B 2BDXA 1S70A 4ORBA 4FCXA 3H68A 3P71C 2HYOA 4WWLA 2O8AA 2WDEA 2ZOAA 3H69A 4MP0A 1SU1A 4FBQA 2XMOA 2O8GA 4HD0A 2ZBMA 5IOHA 4H1YP 1NNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK2 A;  2QFR A;  5INB A;  3H66 A;  2AHD A;  2IE3 C;  3ICF A;  2USH A;  1IT6 A;  3THN A;  1HPU A;  2QFP A;  1UTE A;  4LU9 A;  3H67 A;  3QFN A;  1S95 A;  2A22 A;  4MOV A;  1USH A;  1Z2W A;  3E7A A;  1UF3 A;  2DFJ A;  2NXF A;  4I5L C;  4F0Z A;  2YVT A;  1II7 A;  4H2I A;  2WDC A;  1T71 A;  1S3M A;  4B2O A;  3RL5 A;  4KBP A;  1M63 A;  3QFO A;  2NYL C;  3KBP A;  4OR9 A;  2JOG A;  5GTU A;  4JA7 A;  4IL1 A;  4YKE A;  3H60 A;  1HO5 A;  3RL3 A;  4TUG A;  4DHL A;  3RL4 A;  2R17 A;  3IB7 A;  1HP1 A;  2BQ8 X;  2CV9 A;  4O43 A;  1U32 A;  3V4Y A;  4M0V A;  4ORA A;  1XZW A;  5JPF A;  4UT3 A;  3DSD A;  3H64 A;  4MOY A;  4H2B A;  2IAE C;  3AV0 A;  3C9F A;  3HVQ A;  4V0W A;  5EQV A;  3H63 A;  3IB8 A;  4LAC C;  4LTY A;  5JPE A;  3H61 A;  1T70 A;  2WDF A;  4H2G A;  4DSY A;  1WAR A;  4ZX2 A;  1Z2X A;  4J6O A;  2NYM C;  3RQZ A;  4JA9 A;  1G5B A;  2NPP C;  3K7W C;  5C1V A;  2BCD A;  2P6B A;  3N5U A;  1TCO A;  1W24 A;  3IVE A;  4O4K A;  1OI8 A;  2HYP A;  4G9J A;  3QG5 C;  1S3N A;  4FBW A;  3PSO A;  1QFC A;  2GJU A;  4XPN A;  4ORC A;  4V0X A;  5F3W A;  4FBK A;  4UT2 A;  4DT2 A;  4O5G A;  4KKZ A;  3ZTV A;  4O24 A;  2Q8U A;  3K7V C;  3PSN A;  1MF8 A;  1V73 A;  1KBP A;  2HY1 A;  3ZU0 A;  1OIE A;  3FGA C;  1QHW A;  1FJM A;  4V0V A;  4TUI A;  2WDD A;  3IVD A;  5B8I A;  4ZVZ A;  3QFK A;  1S8E A;  1S3L A;  4H1S A;  5J28 A;  3THO B;  3AUZ A;  3DSC A;  3E7B A;  3QFM A;  1XM7 A;  3EGG A;  2IE4 C;  5JJT A;  1WAO 1;  3JYF A;  1OID A;  2Z06 A;  2Z1A A;  3EGH A;  4Q7F A;  3GVE A;  4I5N C;  1JK7 A;  2KKN A;  3C5W C;  3T1I A;  3DW8 C;  2QJC A;  2Z72 A;  3LL8 A;  4UT3 B;  4H2F A;  3TGH A;  5DNY A;  4NZV A;  5HPE A;  4IYP C;  4UWQ A;  1AUI A;  3H62 B;  2BDX A;  1S70 A;  4ORB A;  4FCX A;  3H68 A;  3P71 C;  2HYO A;  4WWL A;  2O8A A;  2WDE A;  3H69 A;  4MP0 A;  1SU1 A;  4FBQ A;  2XMO A;  2O8G A;  4HD0 A;  2ZBM A;  5IOH A;  4H1Y P;  1NNW A; 
#chains in the Genus database with same CATH topology
 3D03 A;  3CK2 A;  2QFR A;  5INB A;  3H66 A;  2AHD A;  2IE3 C;  3ICF A;  2USH A;  1IT6 A;  3THN A;  1HPU A;  2QFP A;  1UTE A;  4LU9 A;  3H67 A;  3QFN A;  1S95 A;  2A22 A;  2DXN A;  4MOV A;  1USH A;  1Z2W A;  3E7A A;  1UF3 A;  2DFJ A;  2NXF A;  4I5L C;  4F0Z A;  2YVT A;  1II7 A;  4H2I A;  2WDC A;  1T71 A;  1S3M A;  4B2O A;  3RL5 A;  4KBP A;  1M63 A;  3QFO A;  2NYL C;  3KBP A;  4OR9 A;  2JOG A;  5GTU A;  4JA7 A;  4IL1 A;  4YKE A;  3H60 A;  1HO5 A;  3RL3 A;  4TUG A;  4DHL A;  3RL4 A;  2R17 A;  3IB7 A;  1HP1 A;  2BQ8 X;  2CV9 A;  4O43 A;  1U32 A;  3V4Y A;  4M0V A;  4ORA A;  1XZW A;  5JPF A;  4UT3 A;  3DSD A;  3H64 A;  4MOY A;  4H2B A;  2IAE C;  3AV0 A;  3C9F A;  3HVQ A;  4V0W A;  5EQV A;  3H63 A;  3IB8 A;  4LAC C;  4LTY A;  5JPE A;  3H61 A;  1T70 A;  2WDF A;  3E0J A;  4H2G A;  1WAR A;  4DSY A;  4ZX2 A;  1Z2X A;  4J6O A;  2NYM C;  3RQZ A;  4JA9 A;  1G5B A;  2NPP C;  3K7W C;  5C1V A;  2BCD A;  2P6B A;  2YEQ A;  3N5U A;  1TCO A;  1W24 A;  3IVE A;  4O4K A;  1OI8 A;  2HYP A;  3FLO A;  4G9J A;  3QG5 C;  1S3N A;  4FBW A;  3PSO A;  1QFC A;  2GJU A;  4XPN A;  4ORC A;  4V0X A;  5F3W A;  4FBK A;  4UT2 A;  4DT2 A;  4O5G A;  4KKZ A;  3ZTV A;  4O24 A;  2Q8U A;  3K7V C;  3PSN A;  1MF8 A;  1V73 A;  1KBP A;  2HY1 A;  3ZU0 A;  1OIE A;  3FGA C;  1QHW A;  1FJM A;  2DXL A;  4V0V A;  4TUI A;  2WDD A;  3IVD A;  5B8I A;  4ZVZ A;  3QFK A;  1S8E A;  1S3L A;  4H1S A;  5J28 A;  3THO B;  3AUZ A;  3DSC A;  3E7B A;  3QFM A;  1XM7 A;  3EGG A;  2IE4 C;  5JJT A;  1WAO 1;  3JYF A;  1OID A;  2Z06 A;  2Z1A A;  3EGH A;  2ZO9 B;  4Q7F A;  3GVE A;  4I5N C;  1JK7 A;  2KKN A;  3C5W C;  3T1I A;  3DW8 C;  2QJC A;  2Z72 A;  3LL8 A;  4UT3 B;  4H2F A;  3TGH A;  5DNY A;  4NZV A;  5HPE A;  4IYP C;  4UWQ A;  1AUI A;  3H62 B;  2BDX A;  1S70 A;  4ORB A;  4FCX A;  3H68 A;  3P71 C;  2HYO A;  4WWL A;  2O8A A;  2WDE A;  2ZOA A;  3H69 A;  4MP0 A;  1SU1 A;  4FBQ A;  2XMO A;  2O8G A;  4HD0 A;  2ZBM A;  5IOH A;  4H1Y P;  1NNW A; 
#chains in the Genus database with same CATH homology
 3D03 A;  3CK2 A;  2QFR A;  5INB A;  3H66 A;  2AHD A;  2IE3 C;  3ICF A;  2USH A;  1IT6 A;  3THN A;  1HPU A;  2QFP A;  1UTE A;  4LU9 A;  3H67 A;  3QFN A;  1S95 A;  2A22 A;  2DXN A;  4MOV A;  1USH A;  1Z2W A;  3E7A A;  1UF3 A;  2DFJ A;  2NXF A;  4I5L C;  4F0Z A;  2YVT A;  1II7 A;  4H2I A;  2WDC A;  1T71 A;  1S3M A;  4B2O A;  3RL5 A;  4KBP A;  1M63 A;  3QFO A;  2NYL C;  3KBP A;  4OR9 A;  2JOG A;  5GTU A;  4JA7 A;  4IL1 A;  4YKE A;  3H60 A;  1HO5 A;  3RL3 A;  4TUG A;  4DHL A;  3RL4 A;  2R17 A;  3IB7 A;  1HP1 A;  2BQ8 X;  2CV9 A;  4O43 A;  1U32 A;  3V4Y A;  4M0V A;  4ORA A;  1XZW A;  5JPF A;  4UT3 A;  3DSD A;  3H64 A;  4MOY A;  4H2B A;  2IAE C;  3AV0 A;  3C9F A;  3HVQ A;  4V0W A;  5EQV A;  3H63 A;  3IB8 A;  4LAC C;  4LTY A;  5JPE A;  3H61 A;  1T70 A;  2WDF A;  3E0J A;  4H2G A;  1WAR A;  4DSY A;  4ZX2 A;  1Z2X A;  4J6O A;  2NYM C;  3RQZ A;  4JA9 A;  1G5B A;  2NPP C;  3K7W C;  5C1V A;  2BCD A;  2P6B A;  2YEQ A;  3N5U A;  1TCO A;  1W24 A;  3IVE A;  4O4K A;  1OI8 A;  2HYP A;  3FLO A;  4G9J A;  3QG5 C;  1S3N A;  4FBW A;  3PSO A;  1QFC A;  2GJU A;  4XPN A;  4ORC A;  4V0X A;  5F3W A;  4FBK A;  4UT2 A;  4DT2 A;  4O5G A;  4KKZ A;  3ZTV A;  4O24 A;  2Q8U A;  3K7V C;  3PSN A;  1MF8 A;  1V73 A;  1KBP A;  2HY1 A;  3ZU0 A;  1OIE A;  3FGA C;  1QHW A;  1FJM A;  2DXL A;  4V0V A;  4TUI A;  2WDD A;  3IVD A;  5B8I A;  4ZVZ A;  3QFK A;  1S8E A;  1S3L A;  4H1S A;  5J28 A;  3THO B;  3AUZ A;  3DSC A;  3E7B A;  3QFM A;  1XM7 A;  3EGG A;  2IE4 C;  5JJT A;  1WAO 1;  3JYF A;  1OID A;  2Z06 A;  2Z1A A;  3EGH A;  2ZO9 B;  4Q7F A;  3GVE A;  4I5N C;  1JK7 A;  2KKN A;  3C5W C;  3T1I A;  3DW8 C;  2QJC A;  2Z72 A;  3LL8 A;  4UT3 B;  4H2F A;  3TGH A;  5DNY A;  4NZV A;  5HPE A;  4IYP C;  4UWQ A;  1AUI A;  3H62 B;  2BDX A;  1S70 A;  4ORB A;  4FCX A;  3H68 A;  3P71 C;  2HYO A;  4WWL A;  2O8A A;  2WDE A;  2ZOA A;  3H69 A;  4MP0 A;  1SU1 A;  4FBQ A;  2XMO A;  2O8G A;  4HD0 A;  2ZBM A;  5IOH A;  4H1Y P;  1NNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...