5C1VA

Crystal structure analysis of catalytic subunit of human calcineurin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
317
structure length
317
Chain Sequence
PPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcineurin Undergoes a Conformational Switch Evoked via Peptidyl-Prolyl Isomerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
total genus 105
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5c1vA00
3IB8A 4WWLA 4H1YP 1HP1A 3AUZA 1T71A 1Z2WA 4O4KA 4V0VA 4YKEA 2Z06A 4FCXA 2NPPC 2DFJA 1HO5A 4LACC 4XPNA 3THNA 3ICFA 3EGHA 1SU1A 2R17A 3H62B 4NZVA 2HYPA 2QJCA 1XM7A 4ZVZA 4MP0A 3C5WC 2XMOA 3HVQA 4FBQA 1OIEA 2HYOA 2IE3C 3RL5A 2WDDA 4MOVA 4H2BA 3TGHA 3CK2A 3QFOA 1T70A 2BQ8X 3GVEA 4IYPC 3KBPA 3QFNA 4JA7A 4HD0A 2P6BA 2USHA 3IVDA 3FGAC 5JPEA 5C1VA 2O8GA 5INBA 4OR9A 4O43A 4FBWA 4ORAA 2BCDA 2YVTA 5JPFA 2KKNA 1QHWA 2NYLC 4ZX2A 4DHLA 1S3LA 3H68A 1Z2XA 2WDFA 2WDCA 3H66A 4V0WA 1S3NA 1USHA 2IAEC 2HY1A 1OI8A 2IE4C 4H2IA 5HPEA 3H60A 3V4YA 2JOGA 5B8IA 2QFPA 1M63A 4KBPA 4TUIA 3DSDA 2A22A 2WDEA 1V73A 3LL8A 1KBPA 1XZWA 1WAO1 3RL3A 3K7VC 3QFKA 1IT6A 4M0VA 4O24A 4B2OA 4LU9A 5JJTA 4Q7FA 3E7BA 2AHDA 1MF8A 1HPUA 5F3WA 1S3MA 3IVEA 1NNWA 4UT3B 4J6OA 1W24A 5IOHA 3PSOA 4TUGA 3C9FA 4O5GA 3QFMA 4ORCA 4UWQA 3H67A 4KKZA 3QG5C 2BDXA 2Q8UA 1U32A 3ZTVA 3P71C 3DW8C 1WARA 1QFCA 2NXFA 4IL1A 3T1IA 4UT2A 3AV0A 4ORBA 3JYFA 4DT2A 4F0ZA 2GJUA 1OIDA 1S95A 2O8AA 3N5UA 4JA9A 4DSYA 2QFRA 4G9JA 3DSCA 3EGGA 4H1SA 1S8EA 2ZBMA 4LTYA 3IB7A 4I5NC 3H61A 4H2GA 4V0XA 3RL4A 3ZU0A 3E7AA 3H63A 1UTEA 1TCOA 1AUIA 1JK7A 4H2FA 5GTUA 3PSNA 4MOYA 4I5LC 3RQZA 2Z1AA 1G5BA 2CV9A 2NYMC 2Z72A 3H64A 3THOB 1FJMA 3H69A 3K7WC 1UF3A 1II7A 1S70A 4UT3A 5DNYA 5EQVA 4FBKA 5J28A
chains in the Genus database with same CATH superfamily
3IB8A 4WWLA 4H1YP 1HP1A 3AUZA 1T71A 1Z2WA 4O4KA 4V0VA 2ZO9B 4YKEA 2Z06A 4FCXA 2NPPC 2DFJA 1HO5A 4LACC 4XPNA 2ZOAA 3THNA 3ICFA 2DXNA 1SU1A 3E0JA 3EGHA 2R17A 3H62B 4NZVA 2HYPA 2QJCA 1XM7A 4ZVZA 4MP0A 3C5WC 2XMOA 3HVQA 4FBQA 1OIEA 2HYOA 2IE3C 3RL5A 2WDDA 4MOVA 4H2BA 3TGHA 3CK2A 3QFOA 1T70A 2BQ8X 3GVEA 4IYPC 3KBPA 3QFNA 4JA7A 4HD0A 2P6BA 2USHA 3IVDA 3FGAC 5JPEA 5C1VA 2O8GA 5INBA 4OR9A 4O43A 4FBWA 4ORAA 2BCDA 2YVTA 5JPFA 2KKNA 1QHWA 3D03A 2NYLC 4ZX2A 4DHLA 1S3LA 3H68A 1Z2XA 2WDFA 2WDCA 3H66A 4V0WA 1S3NA 1USHA 2IAEC 2HY1A 1OI8A 2IE4C 4H2IA 5HPEA 3H60A 3V4YA 2JOGA 5B8IA 2QFPA 1M63A 4KBPA 4TUIA 3DSDA 2A22A 2WDEA 1V73A 3LL8A 1KBPA 1XZWA 1WAO1 3RL3A 3K7VC 3QFKA 1IT6A 4M0VA 4O24A 4B2OA 4LU9A 5JJTA 4Q7FA 3E7BA 2AHDA 1MF8A 1HPUA 5F3WA 1S3MA 3IVEA 1NNWA 4UT3B 4J6OA 1W24A 5IOHA 3PSOA 4TUGA 3C9FA 4O5GA 3QFMA 4ORCA 4UWQA 3H67A 4KKZA 3QG5C 2BDXA 2Q8UA 2DXLA 1U32A 3ZTVA 3P71C 3DW8C 1WARA 1QFCA 2NXFA 4IL1A 3T1IA 4UT2A 3AV0A 4ORBA 3JYFA 4DT2A 4F0ZA 2GJUA 1OIDA 1S95A 2O8AA 3N5UA 4JA9A 4DSYA 2QFRA 4G9JA 3DSCA 3EGGA 3FLOA 4H1SA 1S8EA 2ZBMA 4LTYA 3IB7A 4I5NC 3H61A 4H2GA 4V0XA 3RL4A 3ZU0A 3E7AA 3H63A 1UTEA 1TCOA 1AUIA 1JK7A 4H2FA 5GTUA 3PSNA 4MOYA 4I5LC 3RQZA 2Z1AA 1G5BA 2CV9A 2NYMC 2Z72A 3H64A 3THOB 1FJMA 3H69A 3K7WC 1UF3A 1II7A 1S70A 4UT3A 2YEQA 5DNYA 5EQVA 4FBKA 5J28A
chains in the Genus database with same CATH topology
3IB8A 4WWLA 4H1YP 1HP1A 3AUZA 1T71A 1Z2WA 4O4KA 4V0VA 2ZO9B 4YKEA 2Z06A 4FCXA 2NPPC 2DFJA 1HO5A 4LACC 4XPNA 2ZOAA 3THNA 3ICFA 2DXNA 1SU1A 3E0JA 3EGHA 2R17A 3H62B 4NZVA 2HYPA 2QJCA 1XM7A 4ZVZA 4MP0A 3C5WC 2XMOA 3HVQA 4FBQA 1OIEA 2HYOA 2IE3C 3RL5A 2WDDA 4MOVA 4H2BA 3TGHA 3CK2A 3QFOA 1T70A 2BQ8X 3GVEA 4IYPC 3KBPA 3QFNA 4JA7A 4HD0A 2P6BA 2USHA 3IVDA 3FGAC 5JPEA 5C1VA 2O8GA 5INBA 4OR9A 4O43A 4FBWA 4ORAA 2BCDA 2YVTA 5JPFA 2KKNA 1QHWA 3D03A 2NYLC 4ZX2A 4DHLA 1S3LA 3H68A 1Z2XA 2WDFA 2WDCA 3H66A 4V0WA 1S3NA 1USHA 2IAEC 2HY1A 1OI8A 2IE4C 4H2IA 5HPEA 3H60A 3V4YA 2JOGA 5B8IA 2QFPA 1M63A 4KBPA 4TUIA 3DSDA 2A22A 2WDEA 1V73A 3LL8A 1KBPA 1XZWA 1WAO1 3RL3A 3K7VC 3QFKA 1IT6A 4M0VA 4O24A 4B2OA 4LU9A 5JJTA 4Q7FA 3E7BA 2AHDA 1MF8A 1HPUA 5F3WA 1S3MA 3IVEA 1NNWA 4UT3B 4J6OA 1W24A 5IOHA 3PSOA 4TUGA 3C9FA 4O5GA 3QFMA 4ORCA 4UWQA 3H67A 4KKZA 3QG5C 2BDXA 2Q8UA 2DXLA 1U32A 3ZTVA 3P71C 3DW8C 1WARA 1QFCA 2NXFA 4IL1A 3T1IA 4UT2A 3AV0A 4ORBA 3JYFA 4DT2A 4F0ZA 2GJUA 1OIDA 1S95A 2O8AA 3N5UA 4JA9A 4DSYA 2QFRA 4G9JA 3DSCA 3EGGA 3FLOA 4H1SA 1S8EA 2ZBMA 4LTYA 3IB7A 4I5NC 3H61A 4H2GA 4V0XA 3RL4A 3ZU0A 3E7AA 3H63A 1UTEA 1TCOA 1AUIA 1JK7A 4H2FA 5GTUA 3PSNA 4MOYA 4I5LC 3RQZA 2Z1AA 1G5BA 2CV9A 2NYMC 2Z72A 3H64A 3THOB 1FJMA 3H69A 3K7WC 1UF3A 1II7A 1S70A 4UT3A 2YEQA 5DNYA 5EQVA 4FBKA 5J28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IB8 A;  4WWL A;  4H1Y P;  1HP1 A;  3AUZ A;  1T71 A;  1Z2W A;  4O4K A;  4V0V A;  4YKE A;  2Z06 A;  4FCX A;  2NPP C;  2DFJ A;  1HO5 A;  4LAC C;  4XPN A;  3THN A;  3ICF A;  3EGH A;  1SU1 A;  2R17 A;  3H62 B;  4NZV A;  2HYP A;  2QJC A;  1XM7 A;  4ZVZ A;  4MP0 A;  3C5W C;  2XMO A;  3HVQ A;  4FBQ A;  1OIE A;  2HYO A;  2IE3 C;  3RL5 A;  2WDD A;  4MOV A;  4H2B A;  3TGH A;  3CK2 A;  3QFO A;  1T70 A;  2BQ8 X;  3GVE A;  4IYP C;  3KBP A;  3QFN A;  4JA7 A;  4HD0 A;  2P6B A;  2USH A;  3IVD A;  3FGA C;  5JPE A;  5C1V A;  2O8G A;  5INB A;  4OR9 A;  4O43 A;  4FBW A;  4ORA A;  2BCD A;  2YVT A;  5JPF A;  2KKN A;  1QHW A;  2NYL C;  4ZX2 A;  4DHL A;  1S3L A;  3H68 A;  1Z2X A;  2WDF A;  2WDC A;  3H66 A;  4V0W A;  1S3N A;  1USH A;  2IAE C;  2HY1 A;  1OI8 A;  2IE4 C;  4H2I A;  5HPE A;  3H60 A;  3V4Y A;  2JOG A;  5B8I A;  2QFP A;  1M63 A;  4KBP A;  4TUI A;  3DSD A;  2A22 A;  2WDE A;  1V73 A;  3LL8 A;  1KBP A;  1XZW A;  1WAO 1;  3RL3 A;  3K7V C;  3QFK A;  1IT6 A;  4M0V A;  4O24 A;  4B2O A;  4LU9 A;  5JJT A;  4Q7F A;  3E7B A;  2AHD A;  1MF8 A;  1HPU A;  5F3W A;  1S3M A;  3IVE A;  1NNW A;  4UT3 B;  4J6O A;  1W24 A;  5IOH A;  3PSO A;  4TUG A;  3C9F A;  4O5G A;  3QFM A;  4ORC A;  4UWQ A;  3H67 A;  4KKZ A;  3QG5 C;  2BDX A;  2Q8U A;  1U32 A;  3ZTV A;  3P71 C;  3DW8 C;  1WAR A;  1QFC A;  2NXF A;  4IL1 A;  3T1I A;  4UT2 A;  3AV0 A;  4ORB A;  3JYF A;  4DT2 A;  4F0Z A;  2GJU A;  1OID A;  1S95 A;  2O8A A;  3N5U A;  4JA9 A;  4DSY A;  2QFR A;  4G9J A;  3DSC A;  3EGG A;  4H1S A;  1S8E A;  2ZBM A;  4LTY A;  3IB7 A;  4I5N C;  3H61 A;  4H2G A;  4V0X A;  3RL4 A;  3ZU0 A;  3E7A A;  3H63 A;  1UTE A;  1TCO A;  1AUI A;  1JK7 A;  4H2F A;  5GTU A;  3PSN A;  4MOY A;  4I5L C;  3RQZ A;  2Z1A A;  1G5B A;  2CV9 A;  2NYM C;  2Z72 A;  3H64 A;  3THO B;  1FJM A;  3H69 A;  3K7W C;  1UF3 A;  1II7 A;  1S70 A;  4UT3 A;  5DNY A;  5EQV A;  4FBK A;  5J28 A; 
#chains in the Genus database with same CATH topology
 3IB8 A;  4WWL A;  4H1Y P;  1HP1 A;  3AUZ A;  1T71 A;  1Z2W A;  4O4K A;  4V0V A;  2ZO9 B;  4YKE A;  2Z06 A;  4FCX A;  2NPP C;  2DFJ A;  1HO5 A;  4LAC C;  4XPN A;  2ZOA A;  3THN A;  3ICF A;  2DXN A;  1SU1 A;  3E0J A;  3EGH A;  2R17 A;  3H62 B;  4NZV A;  2HYP A;  2QJC A;  1XM7 A;  4ZVZ A;  4MP0 A;  3C5W C;  2XMO A;  3HVQ A;  4FBQ A;  1OIE A;  2HYO A;  2IE3 C;  3RL5 A;  2WDD A;  4MOV A;  4H2B A;  3TGH A;  3CK2 A;  3QFO A;  1T70 A;  2BQ8 X;  3GVE A;  4IYP C;  3KBP A;  3QFN A;  4JA7 A;  4HD0 A;  2P6B A;  2USH A;  3IVD A;  3FGA C;  5JPE A;  5C1V A;  2O8G A;  5INB A;  4OR9 A;  4O43 A;  4FBW A;  4ORA A;  2BCD A;  2YVT A;  5JPF A;  2KKN A;  1QHW A;  3D03 A;  2NYL C;  4ZX2 A;  4DHL A;  1S3L A;  3H68 A;  1Z2X A;  2WDF A;  2WDC A;  3H66 A;  4V0W A;  1S3N A;  1USH A;  2IAE C;  2HY1 A;  1OI8 A;  2IE4 C;  4H2I A;  5HPE A;  3H60 A;  3V4Y A;  2JOG A;  5B8I A;  2QFP A;  1M63 A;  4KBP A;  4TUI A;  3DSD A;  2A22 A;  2WDE A;  1V73 A;  3LL8 A;  1KBP A;  1XZW A;  1WAO 1;  3RL3 A;  3K7V C;  3QFK A;  1IT6 A;  4M0V A;  4O24 A;  4B2O A;  4LU9 A;  5JJT A;  4Q7F A;  3E7B A;  2AHD A;  1MF8 A;  1HPU A;  5F3W A;  1S3M A;  3IVE A;  1NNW A;  4UT3 B;  4J6O A;  1W24 A;  5IOH A;  3PSO A;  4TUG A;  3C9F A;  4O5G A;  3QFM A;  4ORC A;  4UWQ A;  3H67 A;  4KKZ A;  3QG5 C;  2BDX A;  2Q8U A;  2DXL A;  1U32 A;  3ZTV A;  3P71 C;  3DW8 C;  1WAR A;  1QFC A;  2NXF A;  4IL1 A;  3T1I A;  4UT2 A;  3AV0 A;  4ORB A;  3JYF A;  4DT2 A;  4F0Z A;  2GJU A;  1OID A;  1S95 A;  2O8A A;  3N5U A;  4JA9 A;  4DSY A;  2QFR A;  4G9J A;  3DSC A;  3EGG A;  3FLO A;  4H1S A;  1S8E A;  2ZBM A;  4LTY A;  3IB7 A;  4I5N C;  3H61 A;  4H2G A;  4V0X A;  3RL4 A;  3ZU0 A;  3E7A A;  3H63 A;  1UTE A;  1TCO A;  1AUI A;  1JK7 A;  4H2F A;  5GTU A;  3PSN A;  4MOY A;  4I5L C;  3RQZ A;  2Z1A A;  1G5B A;  2CV9 A;  2NYM C;  2Z72 A;  3H64 A;  3THO B;  1FJM A;  3H69 A;  3K7W C;  1UF3 A;  1II7 A;  1S70 A;  4UT3 A;  2YEQ A;  5DNY A;  5EQV A;  4FBK A;  5J28 A; 
#chains in the Genus database with same CATH homology
 3IB8 A;  4WWL A;  4H1Y P;  1HP1 A;  3AUZ A;  1T71 A;  1Z2W A;  4O4K A;  4V0V A;  2ZO9 B;  4YKE A;  2Z06 A;  4FCX A;  2NPP C;  2DFJ A;  1HO5 A;  4LAC C;  4XPN A;  2ZOA A;  3THN A;  3ICF A;  2DXN A;  1SU1 A;  3E0J A;  3EGH A;  2R17 A;  3H62 B;  4NZV A;  2HYP A;  2QJC A;  1XM7 A;  4ZVZ A;  4MP0 A;  3C5W C;  2XMO A;  3HVQ A;  4FBQ A;  1OIE A;  2HYO A;  2IE3 C;  3RL5 A;  2WDD A;  4MOV A;  4H2B A;  3TGH A;  3CK2 A;  3QFO A;  1T70 A;  2BQ8 X;  3GVE A;  4IYP C;  3KBP A;  3QFN A;  4JA7 A;  4HD0 A;  2P6B A;  2USH A;  3IVD A;  3FGA C;  5JPE A;  5C1V A;  2O8G A;  5INB A;  4OR9 A;  4O43 A;  4FBW A;  4ORA A;  2BCD A;  2YVT A;  5JPF A;  2KKN A;  1QHW A;  3D03 A;  2NYL C;  4ZX2 A;  4DHL A;  1S3L A;  3H68 A;  1Z2X A;  2WDF A;  2WDC A;  3H66 A;  4V0W A;  1S3N A;  1USH A;  2IAE C;  2HY1 A;  1OI8 A;  2IE4 C;  4H2I A;  5HPE A;  3H60 A;  3V4Y A;  2JOG A;  5B8I A;  2QFP A;  1M63 A;  4KBP A;  4TUI A;  3DSD A;  2A22 A;  2WDE A;  1V73 A;  3LL8 A;  1KBP A;  1XZW A;  1WAO 1;  3RL3 A;  3K7V C;  3QFK A;  1IT6 A;  4M0V A;  4O24 A;  4B2O A;  4LU9 A;  5JJT A;  4Q7F A;  3E7B A;  2AHD A;  1MF8 A;  1HPU A;  5F3W A;  1S3M A;  3IVE A;  1NNW A;  4UT3 B;  4J6O A;  1W24 A;  5IOH A;  3PSO A;  4TUG A;  3C9F A;  4O5G A;  3QFM A;  4ORC A;  4UWQ A;  3H67 A;  4KKZ A;  3QG5 C;  2BDX A;  2Q8U A;  2DXL A;  1U32 A;  3ZTV A;  3P71 C;  3DW8 C;  1WAR A;  1QFC A;  2NXF A;  4IL1 A;  3T1I A;  4UT2 A;  3AV0 A;  4ORB A;  3JYF A;  4DT2 A;  4F0Z A;  2GJU A;  1OID A;  1S95 A;  2O8A A;  3N5U A;  4JA9 A;  4DSY A;  2QFR A;  4G9J A;  3DSC A;  3EGG A;  3FLO A;  4H1S A;  1S8E A;  2ZBM A;  4LTY A;  3IB7 A;  4I5N C;  3H61 A;  4H2G A;  4V0X A;  3RL4 A;  3ZU0 A;  3E7A A;  3H63 A;  1UTE A;  1TCO A;  1AUI A;  1JK7 A;  4H2F A;  5GTU A;  3PSN A;  4MOY A;  4I5L C;  3RQZ A;  2Z1A A;  1G5B A;  2CV9 A;  2NYM C;  2Z72 A;  3H64 A;  3THO B;  1FJM A;  3H69 A;  3K7W C;  1UF3 A;  1II7 A;  1S70 A;  4UT3 A;  2YEQ A;  5DNY A;  5EQV A;  4FBK A;  5J28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...