5C2BL

Anti-cxcl13 parental scfv - 3b4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
SALTQPASVSASPGQSITISCTGTSSDVGAYDWVSWYQQHPGKAPKLLIFDVNNRPSGVSHRFSGSKSGNTASLTISGLQAEDEADYYCSSYTRRDTYVFGTGTKVTVLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a scFv-based biotherapeutic by CDR side-chain clash repair
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords scFv 3B4 heavy chain
total genus 25
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2015-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c2bL00
2J8OA 1UA6L 4GG6A 4CADB 2VYRE 1FCGA 1KCUH 3C6LD 1OGAE 4OZHF 4J3VA 4Q9RH 1FL5A 2HLAA 1O7SA 1DE4A 1VACB 1JF1A 5ICYB 3AB0C 1BBJB 4OZGB 1P2CB 4PBWD 3MRRB 4L8BA 5BCAA 3V79C 1JVKA 1S5HB 3NACL 1A6TA 1ZGLM 1ZT1A 2HKFH 4LSRH 1YN7B 2DQUH 4LCUB 5CCKH 4R90L 3WXWH 4FXGA 2OJEB 4X5LA 3I3EA 4JFEA 2BRQA 4HXAL 1AXTL 4CW1A 1KXVC 3BO8B 3LAFA 2XNAA 3WHXB 3IDIB 3QDJB 4N8VG 3BAEL 1XGUB 4UT6L 4L3AA 1OL0A 4K23H 4YK4C 3BIBX 1DEEB 4ZPTB 1U93B 4OF0A 2C26A 2MOVA 4DVRH 1DQMH 1W0YT 3RIAK 3KR3L 3QDMA 4OBRA 3WO4B 4YHML 1IGTA 3FB8A 4NQEA 2E8ZA 2OSLA 3K2UL 3SY0B 5GGRY 3S5LA 3ZDZF 1IAIH 2UY6A 5GHWH 5F89A 3R4DA 4RMRA 3K2MC 3T2OA 4LEOA 1WBZB 5C0AA 5IFJA 5ILTH 3SCMA 4X4ZA 2HRPH 3LMJH 3GZKA 4OI9A 1A3QA 2NLJB 4KHXL 3QIWC 4MXQC 2IPUK 1L9MA 5F9AC 4M4PA 3QA3B 5HYJD 3D3VA 1A7OH 2Y7QB 1OB1A 4R4FH 4HZLA 1W72A 2ZSVA 5KVMC 2O26U 4JRYE 5EU4A 1NCDH 3KXFE 4KTEH 5BQ7A 1H15A 3C6SA 1I1AC 3MSPA 1MCWW 1FC2D 5FOJA 1QLEH 1EUUA 5T3ZD 3VGHA 3UTZA 2D7PA 2FO4A 2VIRA 1S9XB 1AH1A 1ND0A 4N9GA 1YECL 5HDOA 4MJ2A 2Z35A 2AK1H 1R24A 2PXYA 2PKDA 4JFHD 3VFGL 1D9KC 2XPGB 3U6RA 2HH0L 5I1LA 1IZJA 5TDOA 1A4KB 1A6VL 1DBAH 1HCFX 3D25A 5CZKA 2Y25A 4LRIA 4RIRA 3ELAT 2IMNA 4HPYL 1VGEH 1KB5L 2B1HH 2FEEL 4YO0A 5K33A 3S96A 3EYFB 1TJHL 1LDPL 3P0VL 3VXQA 3VD7A 3T04D 4UINL 3U36A 3IRZA 3DSFL 3QB7C 4N0FB 4GKSB 3DXAE 5I73B 2ZCHL 5E8PA 1V5JA 3D6GA 4PBVC 4TOYL 2P5WA 3MOBL 1FP5A 2UZIL 4JO4L 5DQ9B 1FJ1A 4GKZB 4FTVD 4K94H 4GXVL 2G2RA 2J8UE 4KI5F 5HYJE 4FHBD 4YE4H 3UTTB 2NW3B 1DVFC 3L7FA 4NQDB 2GJJA 3LEYH 2XPGA 1FFOB 3U6RB 3V52H 4FQJH 3NIGE 2MHAA 3TZVC 2A9MH 1Q0XL 5E9DD 2V9TA 3BEVB 3SDCC 1VERA 4Y4HD 1AIFA 5IESH 3SGEH 2VC2L 5CJXA 4XPFH 2HP4A 1I1YA 3L7FB 4NQDA 3BGFB 5TE7L 5FM8A 4D0CA 3AS3A 4PB0H 1U8NB 3QFJB 4X98B 4ODHL 5F1IB 3BT2H 1X6NA 2P5WB 3BD5A 2F5AH 4Z0BH 2EIBA 3FB7B 4KZDL 3UC0L 1FRGH 3Q1SH 4RWYH 4GG6F 3MREB 1UCBH 2X70B 1RURL 5EPMA 2MCG1 2EC9T 2VH5H 4U49A 4MD4B 2VB5A 5EZJB 5HGHA 1UACH 4OLYL 2ZCKL 3AREC 1NGYA 1H3UA 3MLVH 3TYGH 4NQVA 3S97C 4OGYH 4N8VB 4M8VA 3CSYA 2WBJD 5IB4A 3WIHA 3ES6B 4HG4K 2FX7L 2FSEA 1OY3B 3MJ7B 4HH9A 3IDGB 4UOJA 5DMYA 5CGYD 1EH9A 1QRKA 5FK9B 3T3MF 4DGIH 3T77B 3SE4A 5FYKE 1L6XA 2A6KB 3HRPA 1S5IL 3O3BB 2HLFD 4J3WA 1KJMA 3L5XH 5DJ0A 5HXMA 2HAZA 5JO5B 3G9AB 4HCRA 5BS0B 4N8VA 4K7FA 4MXVF 4JVPA 3DX6A 5EOTA 2JCCF 3SHSA 5CIPA 2VXSH 1F11A 3GHEH 3MRBA 5J11C 5BV7C 1EIBA 1U8OB 5LKNA 4XHJC 1JWMB 4FQCH 2ITDB 4HUXA 3RVUC 4BQCA 4ZOCA 4NFCA 3V0WH 4FFVD 2ESVB 2B1AH 4PLNC 1R3KB 5ECJE 1QSFB 3VFRB 2Q76A 1G0DA 3CXHK 3QUYA 4GT7A 1I8MB 3B2VL 4PRBB 5F7DB 2AJVH 3TBSB 1EEQA 3W9EB 3BISA 3N1QC 2AXHA 5C6WH 3G6DL 2DM3A 3G5XB 5E2WH 5CEXB 3KPOA 5F1NB 3C9NA 2J6EA 2NX5D 3OSKA 5C0AD 4I0CC 2LAAA 1V7NL 4FQ2H 4M7KL 4GXUN 1I9RH 1JYXA 1N3NB 2AJ3A 2PXYB 4WHDA 1S9VB 2Y5EA 3IFOB 5F9OH 1G1CA 5DK0A 2GK0B 5C7XL 3HN3A 3RTQD 3B9KC 3V6FA 1H3PL 1OAQL 1WEJH 5FYKU 4U0QB 4JN1L 2AK1L 2CUIA 4PY7B 3MCKA 5DEFB 2W9EH 1NBVH 5J7CC 1L7TH 5KSAD 1BJ8A 4JO2L 3BP4A 4IS6A 4G7YH 3B9AA 4M3KB 4HUVB 3HZVB 3KPLA 2DD8H 5ESVA 4IOFC 1G7PA 4EQ2A 3ZE0F 2L7JA 3DVNA 4MMZC 5AWNH 5E2TH 1XCQA 2IQAA 1DBKL 4MWFA 4F57L 4UDTB 2VDPL 4YDIL 3SOBL 4EZMA 1WC7A 3PWNB 4NBZB 1S7VA 4XP6H 5DK2A 1JPFA 1Y18B 4O2CB 5I1IH 3IETB 2FB4L 3M17A 4JDZA 5H94A 5HTSA 3U79A 4TSCL 2I07B 3VG0L 4TTDC 1QFUH 1OPGL 3PWPA 1HILA 3ZTJG 4TOYH 4LEOB 4M48H 1EHNA 5DJ2B 4M9PA 3P3YA 1JYWA 4MA1B 3CU7A 1BZQK 5HJ3B 5F1OB 4OGXL 1NMCC 4IM8A 5C6PB 5JOPE 1VKXA 2DQDH 4E42B 4DZBB 5IVNA 2X89D 3HMWH 3EDFA 5D5MB 2WWMC 4CNIA 4IIQA 3ULUE 1U93A 1CFSB 1QO3B 3T0ED 1S7UB 5FV1L 1UXWB 1HHGB 2Z91B 1NFDA 5GJTL 4EDXA 2YPVL 3WHXA 5L2KA 1QLFB 5GS1C 1B0RA 2FRGP 4PJGB 2AS5M 1UM4H 3SE8L 1P7KA 4PB0L 3VXTB 2XXCB 3IU4H 4HWBL 1EDQA 3WLBB 5TGBA 3H9SA 4R8WL 3HE7B 4IIQB 1U92B 3CFEA 3OR6B 4LVNB 2A83A 5FYJD 2CJUL 3HZMB 2ZCLL 3OZ9L 4FQIH 1FRGL 3JUYA 5KTEH 4MXQD 3GKWH 3SDXE 3GMLB 5FA4A 5EUOF 3AU1A 1KB9K 2HFEA 2EC8A 1QKZH 4MNQB 2YKLH 1CXEA 1ONQA 4K8RC 1Y6MR 3BH9A 1ZTXL 3HR6A 1P4BL 3MA7A 4JPKL 5I1EL 5EULV 4OV5B 3WUWB 4NHCH 1PAMA 1AO7A 1KB9J 2MWCA 3IFNH 5EB9A 5FUZH 3RVTD 3ARDC 1KXQE 3QG7H 4U6HA 4JRXA 4OIIL 1I3GH 4QRSB 2YWZA 3KYNA 4UV4L 3UJIL 5LAXA 4UTAH 1OTSD 4Z7WE 2R56H 3AMKA 4JHBA 4R96A 3JV0A 4PJ5B 3A67L 4PJIA 5GGQL 1I8IB 2W0KA 1RSFA 1ES0B 1SJEB 3QPXL 4QRQB 5EU7C 2JTDA 3BZDA 4HDIA 5DD3L 4F80A 4XPBH 1QFHA 4FQCL 4GMSL 3HG1E 5FGRA 4WWKB 2JB5H 3P30H 3MCKB 4H25B 4DKFH 2YPLA 4KVCL 2ZKHL 1AGDB 4C58B 1XGRB 1E6JH 1R3LA 4WTZG 4KY1L 5FUOH 3BH8B 4IOIB 5TH2B 4CVZA 1CFBA 1WIUA 4YDKH 1IGYB 1FLTX 4PV8B 5HY9A 4JZJC 3CIQA 1GHFL 1HXMA 3S88L 1LO3H 2WV3A 3VXOA 2WBJA 4PGZA 3PIQB 3QUMA 1G7HB 4U1NA 3U0PA 4HJGA 4EBQL 1A9BB 4E9LA 2W0FB 1O0VA 4Z7OF 5HYFA 4WFFD 4FQXA 3B9VA 1QSEA 2C3HA 4PLKC 4PRDB 4HC1H 4DGVH 4U1GC 1A2YA 2WBWB 2FH8A 3WSQL 2BNRD 1DSFL 4K7FB 4PD4J 5C2UB 2UZXB 4G7VL 3QO0A 3L5IA 4DZBA 1FFPB 3P4NB 4MB5A 4Z7UB 4N0YH 4YDVB 2M26A 5J3HD 4O51A 4WI6A 5DTFA 4YDIH 5HVGB 2F74A 2VDRL 1U95B 5I0ZA 2V9RA 2V17L 4LNRA 4G3YH 1QACA 2ICWI 5FHAH 3HG1B 5BZWB 4F15C 1MHHB 1QQDB 3ARFD 3RBSA 2DLEA 1F4WL 4GAGL 4NM4L 3ZMRA 4EIGB 1PQZA 3S6CA 3BZEB 2VERN 1AR1D 3KDMA 2QQQA 2APWA 3LPGA 3VGBA 2UWEB 2Z8VC 4U6YA 1WFNA 4HLZH 4G42B 3VFUA 4MD4A 5EZJA 5HGHB 2KZWA 2IBBA 2CLVA 4RBPH 3HC3L 1T66C 5D2NB 3B9KA 1FL3A 4WO4D 2ZPKL 2CLRB 3IXTA 4LSPL 1QR1A 4QHKJ 4Z78A 2NZIA 3LQAC 3ZE2F 4JDVB 3BP4B 5JTWA 2ZG1A 2CD0A 1ETZA 3VW3H 4J4PC 3ZKMD 1U8QA 4IMKA 1AGBA 2X4NA 4P48A 3FO2B 2B0SH 2YPVH 3WIHL 4WIQA 3KPSA 1RK1A 4KKLD 3GUTA 1T5WB 2RGSA 3IFPA 5DHYB 1LEIA 3KPPA 3FB5B 4JPWH 4YFDB 1LD9A 3L7EB 1XH3A 2Z4QA 2HMIC 1LP9E 1W0VB 2ENYA 2QBWA 5FO7B 5DVMA 1G9MH 1FGVH 1C5BH 1HIML 4WV1C 3FQNA 1MUJA 2YUZA 5CEYB 2ICES 4H8WH 5DR5H 5HYEA 3D18A 1ZHLA 4PRBA 4YHMH 4LAQL 2RCSH 3BKJH 5ERWB 3ALWA 2EDWA 1HQRB 5FCUH 5MEQA 4PFEA 2DQUL 4ZS7H 2ZUQC 5FYLE 3K4AA 1SEQH 2G60H 4HS3A 3NZHH 2DQTL 4Q58C 1Q38A 4M1DH 1B3JA 4LKCB 4X8JB 1JYNA 1CLYL 4HIXL 3PWUB 4H8WC 3DRQB 4L3EE 4MNHA 3D2UD 3HZYB 4LNVA 5JO5A 4U1GB 3GFUA 5F1KC 3BKMH 5IVOA 3C87A 1Y6KR 4PB9H 3RGHA 4OM1H 3STBA 5JQ6H 3VWKB 2FL5B 4HV8A 1N4XH 4OZFG 3INUL 1P1ZA 1ORQB 2QEJA 4OCWL 1NQBA 5DUPL 3VCLA 4X6FA 3KGRA 2H3NA 1BOGA 3MNVA 5F21B 3VI3F 4GMSH 1AO7D 2QKIB 4YHOL 4KMTL 5I76B 5EO0B 1NCDL 4XNUH 1UENA 4WVRA 4AIZB 2NX5B 2VABB 1KCUL 1FNEB 4QYOA 1QP1A 1OTUD 2ITCA 4S1DD 1GAFH 4WY7H 2JE8A 3WL9A 4FQXC 5D7LD 3LMJL 1DUZA 4X6CB 3E6HA 1UJ3A 3FHAA 1FFRA 3RAJH 3VFSB 2W0FA 2FZ3B 4OB5H 4YGVB 4O4YL 4ISVA 4R2GD 3RUGB 1CGSH 3ARDB 1U91B 2KL6A 3CFBB 1QA9B 2CLVB 3MMEB 4JZJA 1NFDE 3QFDB 4GW5A 5I1AA 4XPTL 5A2FA 1T21B 2B4CH 5IB3A 1A1NB 4HUUB 5SWZE 4X5WB 4K7PX 5FXCH 2A6IA 4TVSa 3RWEB 3DUUA 4UIMA 1MCLA 1BVZA 1F3JB 3G04B 2VZ3A 3T2QA 3BDYH 4AJ0A 3TIDA 4UT9L 1BECA 5EO0A 3LHPH 1HYSC 1TCMA 4LPYA 2YSSA 2AW2A 4Y2OA 5F1SA 4NQEB 4GRWF 3RA7L 4KHTL 1OGAB 1T2QH 1U8LB 2QADD 2FEDC 3SY0A 2DLTA 3TT1L 2BVPB 1JTPA 3CZFA 5D7JD 3BFOA 4MA3B 4XX1G 4ODSH 1X9QA 2C7UA 5J56B 5GRYA 5C0IA 3O6FA 5DQDL 5D2LF 1DBAL 4XNXL 1FSKB 5ID1B 4G9DB 4YWGH 3NIFE 4LPVA 3ZT7A 5GRJL 1YMMA 4LAJH 1DBBL 2F8VA 4OF3A 1CFTA 3VWJA 1K4CB 1ZEAL 4D0DA 5MEQB 1YEEL 5CGYC 3QDMD 2K7QA 2GTWB 1D9KB 4OSUL 4NNYA 2PNDA 4J2XA 2ZCHH 1F2QA 1XGPA 3HCVA 4WNQA 5IV2B 1YNLL 4N0UB 1ZA6B 5EU3B 3MRJA 1HSAA 1IGYA 3GSWA 1I1AA 4MQTB 1R3JB 3ISWA 1INDL 5TDOB 4DK3A 1M7IA 3GHBH 3JTTA 4EVNA 2HLAB 2Z4QB 5C0FB 3SDDA 3AFLA 3MJ9A 4V1DB 1UH3A 4MVBD 5CKGA 3IDGA 4NOFA 2BJMH 3DROA 1FFPA 1YECH 3P4NA 1HXYA 1UCBL 5FO8A 4NNXB 3I3BA 3T1FA 3G5ZB 5DJYB 3O3AB 2HT3D 4QKXB 2Q20A 4OD1L 1HQ4B 4GUPA 4OZHA 2FGWL 4MJ6A 3ARGC 2A73B 4PGBB 3RWIA 1UKTA 5T33L 5DS8A 3RZCC 4LCWB 3IJHB 5ICZA 3S37X 4H5SB 3V5KB 1IBGH 4ZMAT 5A3ID 5D4QA 1GPOL 2BXZA 4QXUH 1RIHH 2EE2A 4WTXA 3AXLA 3TN0A 4LVOB 5HYSB 5T1LB 1VFMA 2AK4B 3U48A 3X3GL 1JGVH 2PTUA 1UYWH 2NW2A 2NLJA 4M1DL 5KS9F 1H9VA 2VH5L 4XC3H 3QULB 3GI8L 1RZKH 2KUTA 4IBLT 3QXAB 3K46A 1DLFH 3TYGL 2QKIA 4LHUB 3H7BA 2EH8L 3Q3GA 1DDHA 3BXNA 1WBXB 1JGDB 1Z9OA 5EZLA 3QH3B 3DO3A 4TRPL 4YBHA 5BVJB 3TJHC 5IMMA 4KMTH 4ZSOB 3V5KA 5E8EA 1MJUL 2XQBH 2DI7A 4I4WA 1RZJH 1LO5B 4HUWA 4FQLH 4HULB 4Q6YA 1Z3GL 1KLUB 2CH8A 3O2DA 4Z8FH 3V6OC 4N5EC 4ZFZB 1GSMA 4GSDH 3HPJA 4P23C 3MRPB 3L3HB 4KK6D 4FS0A 1SMAA 4KJYB 3PP4H 1H3PH 2NY6C 3MUZ1 4Z5RB 4OB5L 5HD8C 1G9EA 4ZAKC 4NT6A 3SKMA 1RHHB 43CAA 3FO0L 4V2BA 3BH9B 1TQCB 1PLGH 1GGIH 1EJOL 2AJ3B 4A6YL 2V9QA 3SKOB 3GK8H 3OWEA 1QEWB 1ZHKA 3LDBC 3MUY1 4NKMB 2XRAL 3O4LA 4GFTB 4RGMB 4NUGH 5E00B 4LHJB 2APFA 1A7RL 2QQKH 4UV7L 3NGBB 4F7PB 2AK4D 4PR5A 2Q6WA 2QSCH 4FXKA 4U2ZA 4H25A 3SKMB 5C08D 1MLCA 3HUJE 4QRRA 1O5DT 5LGHL 1SYVA 4HHAA 1D6EA 5JPMB 4HUXB 3TA3D 5T3XD 5J6GB 1Q9OA 3A6OA 1S7UA 2CKBB 3DXAA 4Z76A 4XVUD 3DX8A 2G5BB 1LEGB 2GJ6D 5JW5A 1SM3L 3UZQA 2DQDL 4Y4FA 4UT7L 5T1KD 2Y7QA 2HJFB 1ZAGA 2CIKB 3RNKB 3DVIA 2P24A 4PJFB 2XG5A 3RKPA 1INQA 1DP0A 3ZDXE 4QRPD 3JWOH 2ATPA 1JZ6A 4NP4H 5DK0B 4R9HA 1RJZB 4NKOB 3OAUL 5LBSL 1KFAH 35C8L 1QFUL 3RP1A 1OPGH 3RRQA 5F9WB 1AY1L 4XC1L 2OL3L 3LQAL 3EDKA 3QULA 3RWEA 4NNPL 1F6FB 5JOFA 1NUNB 2YS4A 5B4MD 3AS2A 3QEQD 4O51B 1X7QA 1KJ2B 5ABDE 1D9KD 5CBEA 1RIUL 2NY2D 3CFEB 1IC5L 5GIRB 1UA6H 3WFDL 2KPNA 1FYHB 5F1IA 5KVEH 2MPAH 2ARJQ 5C0DA 3VFNB 5JW3H 3WS3B 1LO0L 3FONB 2VOTA 5GJTH 1NSNL 1KCSL 3ESUF 1ADQH 1A6AA 1BAFH 4Z95L 4HS8L 3UO1H 3V6FB 1OTTC 1ZSDA 4YHNA 3GSRA 1UWEH 3SE9H 1VA9A 3NA9H 4OQTH 2MNUA 3SDDD 1NCWH 5CWSB 3D85B 4HS6A 1BBJA 4OZGA 4J4PD 1MCHA 1JUFB 4TSCH 3VG0H 3VU2A 3BVNB 5IG7A 1FFNB 3D5OF 2ZG2A 2VN4A 4WNQB 1FL6B 3GBMH 3UPCA 4HEPG 1QKZL 1HSAB 3HZYA 4JR9H 2NY1B 3B83A 1G7MB 3RWFB 3KPRA 1PD6A 1EHAA 2XZCL 8FABB 1CGXA 4WUUD 3BGAA 3PNWB 5EIVA 3RNQB 3D39A 1FBIL 3OHXB 3KAAA 1E6JL 3RVVD 3OKKB 4FQ1H 3I6KA 3VXQB 3UP1A 5D93B 1KLUA 4OCSL 2YA2A 4HGWB 3SQOH 1AJ7H 4HKXB 1NMBH 1VFBA 5C0CE 4IMLB 3MROA 3KYKH 1U8NA 4YXKH 4LOUC 2XA8L 1PVHA 4RGND 4E41E 1G7LB 5AYUL 3RL2A 1KF9B 5CJOL 3T2PA 3OAYK 5J06A 4ZNEE 2JCCE 4FFYH 2R1WA 3TZVA 5ALBH 4KXZI 3MO1A 1KEGL 5F7KC 4PJEB 4LRNL 3VXUB 5J1SC 2HRLA 4L4JA 4OCXH 4Q6IA 1LE5B 4OV5A 3Q3GB 4QTIH 1YEHH 4Y4KB 1CG9A 3TBTA 1TZHB 1LO4L 1VSCA 4KVCH 3RWDA 5DEGA 5KSVA 1WV7T 3OB0K 4FQIL 3C09B 5T3ZE 4NQVB 3EKCA 3GSVB 4GW1B 4P3CH 3VI4E 3CAFA 4AMKL 3E3QC 3OKEB 5CEXA 2YD3A 5FA3B 1TJIL 3MREA 1UKSA 1CXFA 4YPJA 3VI4F 2YWYA 4JPKH 3L5WA 3T0VA 4P59H 2F53E 3IDNA 3CLEL 2JJVA 2FR4B 2A38A 3QHZL 4NIKB 5HVHC 1S78D 4RSVA 1RZFH 4GRWE 4S0SD 3PGFL 3QAZB 1JYVA 3UBXI 5I1GH 5B8CC 4PRPE 4FQQB 5DJAB 4RRPA 4PGCA 2ITCB 4MNQD 1XIWD 3W81A 3OKEA 1U3HD 5KBNC 1F58H 1TPXB 3WN5B 3SDAD 3RVWD 2ADFH 3DETC 4HJJL 4G8GD 4Y4KA 3MRLA 4TVPD 3MLTA 3UTSE 32C2B 5IBTH 3MV7E 1CLCA 1IAOB 3GMPB 5DD6B 4XI5D 5C08A 1EGJH 4GG6E 3MYJA 2D3VA 2EYTA 1G1YA 2DMKA 3RTQC 4PJGF 1TFHA 3HLAA 2CUHA 3JTTB 1A6WH 1JHKL 4EVNB 5DMKA 3I84A 3MJ7A 5CMAB 2OTWB 2P8LA 4NO2A 4ZUVB 5GGRB 4G3YL 4LLVB 5E6IA 4LVEA 2NXYB 5FUOL 3RY6A 4JPIB 3ULUL 4HWZA 2VLJD 5FAAA 3MUJA 4HPOL 3R06A 2BSRA 4P5MB 2GJ6A 4LGPB 5BQ7B 3PGCB 3BKCL 4YEEA 5TJWK 3F8UB 3QYCA 3VH8A 2NY6D 3PNWA 1RIUH 4RCAA 2DWEB 3JUZA 1CK0H 1OB1B 5KVGL 2BNQD 4Z7WB 1A6VH 1S5HA 4YHLL 1A6ZB 3FQNB 3V4UL 4M7JH 5CEZD 1EVTC 3GSXA 3V4VL 3QRFM 1MUJB 1JN6B 5CEYA 4Z0XB 4M6NH 2OTPA 1QBML 3WSQH 4ZOBA 3CCHB 5DD1L 3K81A 2EDBA 2FBOJ 3WYRA 1CVSC 2P8MB 4JRXD 1OGAA 4OUUB 2B0SL 3ROLB 1SBSL 1CT8B 2YD6A 2VE6A 4PGDB 4ZS7L 3BQUB 4HGMA 3RPIB 1JZ3A 1ND0B 4XB7A 5L0QB 4RZCA 4EEEA 4JGUA 3HI6L 5JMRA 1R5VA 2FJGB 1Z9MA 5C6TH 4NRXA 3IGAA 4N5ED 5D70L 2IAMB 5CZXC 3MXVL 3NAAL 4PJHF 1P53A 3JTSA 1IGIH 1YDPA 4FZ8L 5C70A 5D7KD 3R8QA 3U4BH 3PUCA 4MCZB 3F7PC 5DJ8A 5DJXB 3CFJB 4LCYB 4PJXB 1G6RB 4WUKL 3OJ2C 3AMLA 4NRYA 2GFBA 2ZOKA 4UQ2B 3HUJA 5DUPH 1JNHB 5EO1B 5I15H 1W72L 4JZOA 4Y16A 4MA7H 3MA9L 1IZKA 3ARVA 5C0CB 3BQUC 3DSFH 4I0KA 4LVHC 3OR7B 4M5ZH 2DQTH 3QI9D 4LSPH 4MNGA 1MSPA 4GRMA 2IH3A 3SPVA 4L8SA 1M4KA 1U3JA 1DQTA 3DNKA 5F89B 1YMHA 3GJEA 2C3XA 3I6LD 4K55A 2VAAA 1JUFA 5SX5H 2HFGL 3UZVB 3S8WA 3P73B 2DYPA 2A83B 2F58L 3HZKA 4X7DC 2JJTA 4LKXA 1BM3L 2R0LL 3PDOB 4KMQA 3TV3L 1J0HA 4FXLA 3IJSB 3RZWA 4FABH 4WFGD 2J88H 3P4MB 3MLWL 4XMPH 3HPLB 3SQBA 5EU4B 1LNUA 4U1HA 4JHAL 1ZGLP 1RQ5A 1QD0A 1HZHL 2R0KH 2R69L 2YOCA 4JQXC 5IVZB 1BREA 4PP1D 2Y9RT 2X1WL 3C60C 3VXOB 5ERWA 1UGNA 1MNUH 1EA9C 4HJGB 1B4JL 1X5GA 3UTTE 3QEHA 1VADB 1KACB 5HPOA 4ODSL 1NEZB 4MAYB 5EC1B 4LLYB 4NQUA 4MMXC 4WO4A 3LS5L 5CLWA 8CGTA 4MJ5B 5IM7A 3S37L 5GS0H 2VNCA 3RWDB 5GZOC 5EZOL 5HHOD 3B9KD 4F2MB 4CU8A 4K3EL 5D7JB 5F9JB 4E41A 3MNWA 4WWKA 5EU6A 3BRDA 2PYEB 2RB8A 3HE6D 5DK2B 2YPLB 2OBGA 4ONGH 5DRWB 1HSBA 1N8ZA 3LB6C 3H9HA 5IT2L 5EFIA 2ZP0T 1I8IA 4PJCF 3P9MB 5C07E 4Y4KC 4ZFZA 1H8NA 3VFMA 5C0BE 1RJLB 5TPWL 4IOFD 1ES0A 2CDGB 3VGAB 1ODAA 4P2QE 2OMNA 4ZPVA 2P5WE 4FFZH 3UXFA 3RIFF 2VXTL 3ULVH 4NN5C 4ZSOA 4XBPB 5DFTA 2IEPA 4P5KA 5EC2B 4AH2A 3VFTB 1C1EH 2BJML 2JJUA 2PN5A 5E9DB 3EJZD 4UNTA 4G6KH 3UTQB 3VFUB 3MUGB 2CPCA 4K3GA 2WIMA 3EHBD 4GXUM 3TH4T 5FYJH 2OR8A 3E6FA 3HNSH 1BPVA 3RX8A 4Y1AD 1I8LC 4XPTH 1M6OB 1UQSB 4B7LA 5GSVA 5HHPA 3V4UH 1P69B 2JCCA 3LN4B 1Y0LA 1R3IH 4MNQA 2W60B 3B3IA 2Y06L 3TJEH 1NEZA 4MAYA 3X12A 4HWBH 5I66B 4QEGA 1T5XA 1NDGA 3RDTC 4ZO9A 2PTVA 3IJYA 1SBSH 3KVQA 2V5MA 1P7HL 1JMXA 4WFFE 5JQHC 3DIFA 5ANMA 5BZDA 2IANE 4M6AA 4MCYB 3EO0A 1MRCL 4M48L 1KPRB 1T0NB 5C09D 3NCYP 4RAVB 1Q9KA 2YKLL 1D6VL 4U4BA 5CBAA 1MCNA 3STLB 4WCYL 3NFPB 4ESKA 5FYKD 2X9WA 4I4WB 5EN2B 1X5AA 2ESVE 1DR9A 3N9GL 1VPOH 3MFFB 3CUPA 1JBJA 1DN2A 3T8XB 2A6KA 5AWNL 1DL7H 5GRJH 4H1LG 4XP9L 2NMSA 3HZKB 5CHNB 4H20L 1FNHA 2NCMA 3MRMA 3T08A 2CLZA 1E27B 3L9RA 4PRNA 3VRJB 3X12B 4RQQA 4L3CB 4MA1C 4ERSH 5IV2A 4DOHE 2EH7L 5JDSA 1M7XA 1CGTA 2LU4A 3U4EB 5I2IB 5JW4M 3EJYC 3UTSA 4Z5RA 1ULVA 1MJJA 1Q8MA 3WXVH 4CDGC 4JPVL 2FECL 4HIJB 3EYUL 3UJJH 2ZKHH 4G8IB 2EDJA 2F58H 5DRZA 5BRZA 1N2RB 5C2BH 1LO5A 2GCYA 2PO6A 3N0PB 3QCTL 5JHLL 1BM3H 1HH6B 5IMOA 1K4DA 1DN0B 2ED8A 4U6VL 4HK3J 1RJLA 2FGWH 4F3FB 2Y5TA 1GGBH 4MCZA 4YDKL 5E1HB 1MEXL 5CJQH 5I9QC 2EKJA 1PFCA 3MJGX 4HFUL 4WO4C 5DJXA 1MFDL 4DN4L 1DBMH 3RY4A 5IROA 4DQOH 4AQ1B 5DMIL 2E7LA 3UYOD 2AJYH 1GXEA 2FWOA 1NL0L 3BMWA 3RVTC 3DX7A 4HBCH 3RJDA 2P8PB 5DD0H 3U7YL 3WUWG 4G8GB 4F7MA 2B20A 1VFOA 1NCTA 1U8MA 1YEIL 5CUSL 5BXFB 1JF6A 5IGXH 5E70A 5GS0D 5L7XL 5D1XB 1SM3H 1PSKL 2YRLA 3RU8H 1FZKB 2VZVA 1WSST 3H9SB 3C60B 1J8HA 4L29B 1YEJL 2IALB 3F7YA 2EEDA 2A9NH 3DTXA 4K3DH 1YMMB 1K85A 1MCQA 4BQ8A 1I1AD 3GSUB 4KMLB 2YXMA 5EOTB 3QFJD 1F11B 2VWEC 4FZEH 4JLRB 3CXHJ 4QTHB 3U0WH 1MHEB 1A7QL 3QUXB 3MLUL 2VKXA 3CFIC 3O3BA 4G6MH 1IC5H 2PYED 3VWJD 4GRLD 2XKUA 2R0ZH 3KPNA 4U6XA 1KCRL 3ZL4H 3NIDF 2FL5A 4RNRA 1NCAH 5KSAA 1NKRA 1XZ0A 3AS1A 5E08H 3S3PA 5JA8B 2VXUL 4KY1H 5CJBA 2NXZB 1A3RL 3QXDA 4QY8B 1XGPB 1D5BB 3OAUH 5LBSH 4PS4H 5CEZL 4UQ3B 2ZUVA 5HHXL 4PJIF 1K2DB 4MD5A 1KENH 4LSTH 4P23B 5ISZA 2FO1A 3Q6GH 4FTVB 4IDJL 3QUKB 2GAZB 2DQHH 4ONFL 4JDTH 5I9QB 4RMUA 5F6HJ 4X4MA 5D1QD 1HQRA 4O5LL 1UKQA 4MGXA 5SWSD 4LU5H 3FB7A 4L4TE 3L3OB 4UQ2A 4X4XB 3TM6A 3WJJA 5FKPA 1P9MA 3ZKMC 4K8RL 2XN9A 3E8UL 4PJBB 4WU5A 2C3WA 1MFAL 5EUKB 1CYGA 4ZTOL 4XH2A 2D31A 5CGTA 5DEFA 3TESA 1KPUB 4KK8D 1I3RA 2WSKA 4UU9B 3VRIA 1MCFA 3D85D 1H3VA 2V7NA 1XCTA 3TFKD 2YN3A 5J13B 2AQ1A 5F70A 1IKFH 2OYPA 3GSXB 3OKNB 4C54A 3L3GA 1MJ8H 3SKNB 2IANB 5A16B 1P84J 4YXKL 4N9OB 2DAVA 2IH1A 2WIIA 5HVWA 5SX4H 2UZYB 1N0XL 5TQ2H 4KGLA 3INUH 3TH2T 4YBLC 3QIBD 3G9VA 4LLQB 1CICD 1OLLA 3OQ3B 4HWEL 5CZXD 5D7IE 3WNPA 1JTOA 3VXRB 3JSSA 4JRYD 4B50A 2Q3ZA 2OJZL 4IJ3C 1F4YL 4YFLF 4X9IA 2AJSH 1G9ML 1FNEA 2IPTL 5KVEL 4X7EC 2MPAL 4NFBA 1R3HB 3DX6B 2ARWA 5A3IC 3J7HA 2CSPA 2RHEA 3AY4C 4V1DE 1EXUA 2IAMD 4FQHB 1SMOA 1BZ9B 5MENB 3LKQB 3BVNA 5IG7B 5AYUH 1CDGA 4O2EA 2Q86B 1PG7X 3R1GL 5IMKB 1FSKC 3MLTB 4KKAC 3GB7B 4TNWF 3O3UN 3WE6B 5DD6A 4OF6A 5HGBB 3Q5TA 2VL5B 1LD9B 4I3SL 3W11C 3AM8C 4MSWA 5CILH 4YHIB 4DGYH 3VJ6A 2YD9A 3EZJB 1PEWA 1HHHB 1UB6B 5T1KB 2FO4B 1JNJA 2PETA 3A6BL 3FN3A 4Y5VC 2CO6B 4HBCL 4QOKA 1MFNA 1I9JH 4WGWB 3CK0H 4U3XA 4PJIE 3WFEH 1OT2A 1YJDL 3Q0HA 3H9SE 2ID5A 3OJDB 3O41B 1NUGA 1ZE3C 3F7YB 3VFOB 1CF8H 1QA9A 2R4SH 4Z7QF 3TA3B 1BQHA 3QJHB 3WLWD 3OMZA 1IMHC 1MH5A 4YHOH 3CLEH 4DFIA 5GRWA 3LKSB 3QQ9D 1JHKH 1UT9A 4P2CG 3OKMB 5FGBC 3ZTNL 1YEJH 2FX9H 2YR3A 2F53A 3RWJB 3ZKND 2UVEA 4Y88A 5TFSL 2P47B 2CDEB 3QQ3B 4Y5YA 5AD0A 3U4EA 2WAHA 3F58L 4X4YA 4M9OA 3RL1B 3SKJL 3MQIA 3PP3H 4EOWL 1FNAA 5FKAA 1BGXH 5I16A 4KI1A 2FECI 4OCWH 3O4OB 4DJMA 2A1WL 5A2JH 4PGEA 4IRJC 9CGTA 4ZUTA 3G6DH 1CLOH 1HYSD 2D2OA 5MI0B 1NKOA 4JG1L 4UDUA 1XIWB 1ACZA 4RISL 4YHKL 3U46A 3UROR 4PREA 2GKIA 5C09E 3UPAA 3OJMB 1HOCB 2VDNH 3O2VL 2CLRA 4CVXB 2D0GA 3QDJA 1U58B 2W07A 5DZOA 3MLPA 2VQ1B 1RU9L 2VUYA 5ELIA 5GRVK 4JQIH 1RK0A 3PQYE 1J5OL 1NAMA 4L9LB 2NQCA 4NQXA 4P57A 1N8ZB 5IB2B 3UAJC 1X4XA 4HHAB 2KDGA 4FQPA 1FV1A 4PJBE 5MEND 3TT1H 1L7TL 1WFOA 5GGSB 4IJ3B 3RWFA 4BFGA 5DJ6A 1QFPA 2CXGA 2EIDA 4BSWA 5E00A 4NJ9L 4X0KA 3LQZB 1D5ZB 4HS6B 2E7MA 4PUBL 3S5LG 2R4RL 4K2UH 3GGWB 4U7MA 1S9KC 4JO3H 4MB4A 2XOTA 2R1XB 3LKNA 3TGXA 1FNFA 2YD4A 4XAKD 1R24B 3SOBH 1KB5A 1FV1B 1IFHL 1K6QL 2A77H 3GRWA 4I9WE 1ZGLB 4W70A 2AI0L 3U9PH 5IOPB 4CBPA 2I60H 4XMLL 1G7QA 1CDBA 3H9YA 4XC3L 3T3ME 1RI8A 1MQKH 3K80A 4G80B 4J23A 5D1ZA 7FABH 2C1OB 5JPNB 1IQDB 3T2NL 1NGPL 3U7WH 1HHIB 1T3FB 2WWKT 4R6UA 3ZKNC 5H8DA 4Z77A 1W0WA 4DEPC 3SDAA 4URTB 4DW2L 3MBEC 1MFEL 4RA0C 3I50L 4Y4HC 4MZ2A 5JZ7D 1M1SA 3HNTL 4C59B 1F6AA 4TULL 2J8HA 3LD8B 4EIZC 1OQXA 2J8UB 4WW1A 1K3ZA 4Y2DD 5E0QA 1ZHBA 4S1RL 1I75A 5GGSY 1P5UA 3G6JB 3TO4A 3F7VB 2CRIA 3ALPA 5D96C 4FQLL 1JL8A 5DJ2A 2C4XA 3V6OA 3ZO0A 1P4IL 1HWGB 1YUHB 2VDLH 4NC1E 2C4FU 5E6ID 1G9MC 3MV7B 2X4RA 1GPOH 4EN3B 1BD2A 2FLRT 4YUEL 2QADC 3R8BB 4NO5B 3BIKB 5AZ2L 5L8JB 5L88H 2DJ4A 4Y1AE 4KVNH 2YMXH 3B9EA 1IGFL 4U7SA 1HHIA 4H88L 2F54E 3EJYD 4U1HB 4LGRB 4ONHB 3NBNA 4KK9D 4NYLB 1J9CT 3AAZB 5DS8B 3ARWA 5IHBA 5DRWA 1MJ7H 1CF8L 2R4SL 3WO3B 1GGCH 2E3VA 3DHMA 5BMFH 1L4IA 3EZ8A 4UNVA 4OIIH 4UBDC 3QUXD 5DJYA 2ZOLA 4EN3D 1S9VA 4YDLC 2APXA 4P2OD 2PW2A 4X80L 2G9HB 3QNZB 5IW1A 4LHUG 3QWOB 4ZUSA 1YN6B 4WEBL 5FA4B 3ARBC 3G5XA 4XCNB 3LSOA 1AE6H 3V8OA 4PJDF 4NNYB 3TLRA 3BZFA 2R39A 4J3TA 4S2SB 2R23B 4NZUH 4LCCA 5I8CA 3DV6B 1OP5H 4GRWH 4WTZA 5ACLA 4XCEA 1Z5LA 4G8EB 3FN9A 1A9EA 1Z6JT 1VFAA 5L8KB 2DQJL 4NYLA 2EEBA 1A4JB 4LLDB 4HKBA 1GZPB 1I9EA 4WHCA 5KS9A 3D69B 1KIPA 4CU6A 5A2IH 2A6JA 4M6MH 1MJUH 4RISH 4YHKH 3MV9D 5D7IA 3U30B 3EIFA 1UWGL 1GHFH 3MV8E 3CFKA 2DM4A 4JHAH 3P9LB 3WFBH 1JHTA 1IT9H 1SEBB 2X1XR 1FGNH 4G6KL 2DQIL 3WIFA 5D7JA 5F9JA 1I3RB 4UU9A 5BO1L 3BYYA 5EORH 3SDAC 1ZLVH 3QAZC 1QBBA 3HA0A 3ZT5A 5E4EB 3RZCB 3VDAA 3QQNA 1E0OB 1OTSC 1OHQA 1JN6A 1PG7H 3WD5H 1MAMH 3D2UB 4HS8H 2HG5A 5DFVC 1X5ZA 3TJHD 2WLYA 3BKYH 5F96L 4PRPB 3EDEA 1BVKA 3GBNL 3GMOB 4NRYB 2AI0H 1MWAL 3C8KA 2ITDA 3T65B 1KFAL 35C8H 4NQDE 5IK3A 3MPCA 3R0MA 4QHUA 4OZHB 2UV3A 2BSRB 2AV7B 3E0GA 4G9FD 4P5MA 1T1ZA 4EXKA 1I7RB 4U1KA 4PGBA 3WCYA 4IRSC 4U1MA 3HKFA 3HMXA 2ZNXA 1YYMH 3IRPX 1E4KC 3TNNB 4RNRB 5I1JH 3QDJD 2P8LB 4ODTL 5DT1H 3P4LA 5FB8A 4X6EA 3G5VB 1ORQA 1I3VA 5C2BL 1DVFA 1BZ9A 4YBQD 4JAMB 4CMMB 7CGTA 3N1MC 1E28A 4KDWA 2Q86A 1FZMB 4PRHA 3OGOE 5ADPH 1CQYA 2AP2A 3ARXA 1I85C 2DBLH 1ACYH 4PJ8B 5GGUA 2DWEA 2X41A 1AKJD 3MX0A 1OCWL 2IPKB 2OXHA 2UUDK 2BVQA 4P2OB 3I6KB 4CKVX 2X70A 1KEGH 5A1AA 4ODHH 4ZODA 1X5FA 4ZXBA 3O8XD 1NC4A 4E5XA 3UMTA 4QNPE 3DX9A 1FPTH 5M7QA 3UC0H 3MBED 3QIWD 4OT1H 4AMKH 4XRCB 3C5JA 3EDJA 5B3NA 2Q7NA 5A2LH 3F12A 3RVXD 1G6RA 5MEPA 5D1XC 4XCNA 4PJ9A 1N7MH 2EIEA 2WM0A 4JO1L 3S36L 4PG9B 1IAKB 3LEXA 5E9DE 3W5NA 2HKHH 2P5EB 3NH7H 1KTRL 4JAMA 5J1AA 4LIQH 1B88A 1LILA 6FABH 5A43C 4QRPE 1DBML 3MLYH 4R0LB 4YDJA 32C2A 3EHBC 3QRGL 4PJDB 4YHNB 1YEGL 2YEZB 4DGIL 3SDYH 4KK5D 4B7IA 2XWBB 2YRPA 3KLAB 3L7EA 4YX2L 4CVUA 2GY5A 4ETQB 2FX8H 4U0RB 4LSSL 1NANH 3MXWL 3LS4L 3BKML 3EYOB 4K9EL 1CE6B 5D96B 3VXME 5I74C 1QSFE 2CK0L 3VRLF 5JXED 1VFBB 5IBTL 3V7AG 1PSKH 3HE6B 3QQ9C 3DUHA 4X98A 1WBYA 5FIEA 5I6XC 5M94B 4JFOB 4NZUL 3D3VB 3PGDB 4Y1AA 1MPAL 4JY6A 4P2OA 3PHQA 4WU7A 3B2VH 5JOFB 3MRFA 3QCTH 3KJ6H 5J12C 5CEZH 4P5TD 5C0RL 2BVYA 3JBG7 2QLVB 5HDBE 3X3FH 2ADGA 1GGBL 1KJMB 4G5ZL 5BZWA 4PJDA 1QVOB 1A4KA 2ENSA 2VL5A 5EDXA 1DBJH 1B2WH 4ZAKA 2P44B 3MZTA 4WFHD 1BP3B 4PIRF 3KPTA 2C1PA 1P1ZB 1XFPA 3X13B 2Z35B 4G43A 5DTFB 2F8XC 2JIXB 4FA8A 4F58H 3QQ4A 1Q72H 5BRZD 3DVFA 3Q5OA 4OFPA 1A6AB 1MFAH 5F3BB 4OI7A 4YH6A 4M6NL 3JV4A 3C2SA 3NZ8A 5E8PB 1A4JA 1T0NA 4ZG1A 3PGDA 1T20A 3CVHB 4C56B 2A74B 3IDMA 3CFDA 1RUAH 3WKNA 2WANA 5IQ7H 4R2GB 1NLBH 5FCSH 4MX7A 2IG2H 3B8SA 3TN0D 1FZKA 4LCCB 1T2QL 2FR4A 2F54A 3L95A 1YZZA 1CFVL 4QCIA 1ZT4A 4JREC 4N1HB 4RDQG 2A9NL 2I9LA 5CLTA 3O4LB 2IH1B 1U8MB 4M62L 3CX2A 1HXMB 5E7FA 4F8QA 2YZ1A 4NKQB 2Q1EA 1FL5B 1G9NL 3GNMH 2PYEE 1F58L 3UEZA 1BEYL 1AGCA 1W0VA 1J1XH 1JK8B 3KLHD 1CGYA 4IOIA 1P9MC 3ZYOA 3BDXA 1J86A 4F7CB 5BVPH 4OD2B 2AJZA 2X6MA 2H1PL 5E03A 3VWKD 4QHMB 4ELKB 1IL1A 3RL2B 3MGOA 5IFHL 4ZFFB 4MYWB 1F97A 4BQBA 3MLXL 2VXUH 5CZVH 1PZ5A 1T03L 1H5BB 4LPCA 1A5FH 1H0DA 4WEMB 1H3TA 3LCYA 1KPVB 4HGWA 2DMCA 3R1GH 4P0DA 3WXWL 4FFVC 2D7OA 1UM4L 3BPOC 3CDGB 1WUNT 3C60D 2VSCA 1MJJB 4JRXB 4C56E 3C6LA 4O00A 1BWWA 3KDMB 2HVKB 1IEHA 3SGJC 4ZFGH 4Z7UE 1CK0L 5CP7B 2UWEA 1DVFD 2J3SA 1NLDH 5I19L 2W9DH 5LGJB 2D0FA 3TWCH 1NEZG 3WIIL 1J8HD 5FHBH 4Y5YB 5AD0B 5I18H 1RZ7L 2VMFA 2EYSA 5DRXA 4F7EA 3QWOA 2ZSWA 5IBLD 2YBRA 1IGTB 4MA7L 1AGEB 5K9OA 2Q8AL 5TF0A 2VLLA 2XKNA 3QR2A 4WWID 3O11B 2BSSB 2P46B 4PJAA 3MRDB 4HQQL 1EEYB 4L1DA 4ZPTA 1I3GL 3MFFA 1DQLL 2DLIA 1AQDB 4DUVA 3NVQA 2EDRA 3EGSB 2X4TB 4FZ8H 1JZ5A 4PJ9D 3S34L 1T83C 3UJIH 1GGYA 3GIVB 2F19L 2GJ6E 1NDMA 2GY7B 5C0EA 4K23L 3B5HA 2ICWJ 1AKJA 1NMCB 2SEBB 1KTDA 1G7HA 4U1NB 3U0PB 4L8CA 2QR0B 5CSZB 5IB1B 2OCFD 3ZT6A 4P46D 2X2YA 3BZFB 4LMQI 4FNLH 1NC4D 1HCVA 3MRDA 2GT9A 2HWZH 3C5SB 1PKQB 5KVFH 5MI0C 3KLHC 2VWEE 4PJHA 2CQVA 5DFVD 4DKFL 2EYSB 3ZTNH 1WWAX 5C08E 5D72H 4DAGL 4PV8A 4PY8I 2Z31A 5HY9B 3NCYS 1OTUC 3MV7A 2ZSWB 2VKWA 3OX8B 1E4WH 2PXYD 3QIUC 2AGJL 4LSVH 4BSWB 2IH3B 5FYLH 5DMGD 4Z7WF 2R69H 5ADOL 3O6LH 5JORA 1YNKL 3MBEA 4RGNE 4EDWH 4Q6IC 1WFUA 5C0CA 4ZS6D 2I9TB 3LH2L 1XCQB 2IQAB 2VXQL 1HK6A 3KPQA 1FVCB 4I3SH 3W39B 2ZUWA 3FT4A 1FHGA 4C4KO 3S37H 3KYNB 2F5BL 4WW2F 5E8EB 3RGVA 4HIEB 1G6RH 1M05B 4NUJA 4XPAH 4XGZB 4YIQB 4LMQE 4HUVA 1LK3H 3KWWB 1U8JA 4XCFH 4KPHH 2GIYA 5JXEA 1QLRB 3JTSB 4UINH 5D1QA 3IDYC 4PJFE 3VXPA 3W9DB 1EHXA 5SWSB 1Q9LA 1BFVL 3P11L 1PYWA 1UXSA 3WBDA 1IAIL 2DIJA 2ZUXA 1CGWA 2MCPH 4GBXA 1I85A 4NHUB 3QQ3A 1T2XA 1JMZA 2NXZD 1A02N 1OAKH 4OZFB 3WUZA 4QF1B 5JIPA 1FVDB 1GOFA 1JRHL 1PZUB 4M1GH 4XBGA 1T21A 4XMKH 4OLWL 4ZTPH 1BGXL 2ZJSH 2CRMA 4UTBL 4RBPK 3HNTH 1A21A 1NAML 1UB5A 5BVPL 5IQ9B 3BP7B 1PY9A 1QNZL 5SWZA 1YEFH 4UB0H 5INCA 1KELL 4BH7A 5HHQB 5E5MA 1ORSA 3LIZH 1K8IB 2HJKB 1AD0B 3FJTA 3LEVL 5F3BA 1E4JA 2JF1A 1MQKL 7FABL 5GJSH 4JHWL 2VDNL 1EMTH 4MSWB 1TXKA 2VLLB 3WIHH 2FCBA 1UFUA 2BVPA 3EAKA 3V52L 5E5RB 43C9A 5JHDB 1NBYB 3Q1SL 4RWYL 4PRID 5KN5A 3VCLB 4JKPH 3W0WE 3DOSA 5E8DH 3LKQA 1JPGA 1S3KL 2J4WL 1C7TA 4OLYH 4O9HH 4KK6C 4H26A 3CMOH 3TT3H 5C0NC 2XZZA 4FTVE 4QLRA 5DJ6B 3N9GH 1VPOL 4QRTB 3ZDXF 3MV01 1OAUL 2GTWA 5DMIH 3IETA 3SGEI 3T65A 3PWPE 3C8KB 5EOQH 5C9JA 5IJVA 5AZ2H 5FCUL 2A77L 2XN9E 2E7BA 3GMQB 2BHYA 5KSUA 3MLRH 4L29A 1W0WB 5HVHB 3O8XB 4YZFE 4ZUUB 3CD4A 3ZDZE 4L4TD 4TQEL 5ESQA 2YMXL 4XMLH 3NIGF 3VH8G 4P2QA 4NO0A 1RURH 3VMOA 3TIEA 2WIIB 1B0GA 1VESA 1S7XA 3IJHA 2VDQH 1IL1B 1W8OA 5D1XA 1MCSA 1F3DJ 4WCYH 5D1ZC 1ZS8A 4WGVB 4YHYB 3IGAB 1A1MB 3EYQD 3I75A 1ZGLA 1QHPA 2B1AL 4AIZA 4R4NC 4PJAF 2GK0A 2VLMD 1Q0XH 3RL1A 4WHTB 2IF7A 4QWWD 2ERJB 1D5IL 4C83B 2A6DA 4U0RC 2WP3O 2J5LB 1T04A 1URLA 5GS0C 1NFDF 1FH5H 1IAKA 5HI4D 4HUNB 3TO4C 5T3ZL 1T0MB 3QI9B 1JGEA 4DN4H 2LQRA 2VITB 3UDWC 2Q76B 4LSDA 2EICA 4NM8L 1K4DB 4XPGL 1T22B 4K7PY 2GSIA 5C7XH 1JPSL 4I1NB 5E8OB 3RWGB 3B43A 1C5CH 3A0OA 3VE0B 4W4NA 1YQVL 3K4ZA 2IPKA 1N6QH 2A74A 5GQBA 5DMGC 1BBDH 4LLQA 3ZKQD 4APQA 5GSRA 1PKQE 3L3IB 5F9DC 4HWZB 3RPKA 3QQ4B 2LAGB 3ZKXC 3R06B 1TZGL 2MJWA 1KN2L 3S3JA 5JMOC 3PE9A 5IBUG 2Q8BL 2P7TB 5KOMC 3LZFL 3DMMB 1LVEA 1MHHA 1MOEA 2BMKB 3BGMA 3OKLA 3QEGL 4DVBA 1NGWB 2BSTB 5HPMA 2YPKA 1RZFL 2AJYL 2PCPA 3QUYC 4N9GB 4FQHA 1CD1B 1KJVA 1WAAA 1EBPA 3KPMB 5JR1L 1RZIA 2VLRD 2I5YH 4X80H 2V5SA 4PJHE 3U7YH 2Y07L 3QFJE 5EBLA 3LKRB 5MP6H 1U36A 4ZSOE 5HBBA 2VLME 4KC3B 2WUCL 4RAVA 5GGVL 3EJJX 4Y1AB 3S9DB 1LWRA 3DO7B 1YQ2A 4BFBD 5HYQB 3LN9A 3CGTA 1REIA 1A9BA 3IDNB 3ZDYE 4MQXC 4OLWH 4ZTPL 1V3MA 4KJPC 2ZWLT 5B38B 1I7UA 4N0UE 2DI8A 2O5YH 4D0CB 3OXSB 2B2XL 1MJ8L 3MRQA 4BYHA 4KUZL 2DQJH 4FG6D 4EN3A 4OQTA 1P84K 1HYRC 4JFDE 4BFEA 1V7NH 4FQ2L 3TBWA 1FIGL 1WGOA 1FORH 1CD1A 1NCCL 2Y36H 4UOW1 5TDPB 3FQXA 4UBDD 5F3HB 3V0VA 4P9HL 1KC5L 3GRWH 5IMKA 1U95A 1IT9L 4LDEB 3GM0A 1OD9A 4KKBD 1SEBA 2DL9A 4IMKC 4S0TD 1TCRA 4Q9RL 4KWUA 5KAQF 4NFDA 3F12B 2VL4A 3OPZH 1HKLH 2R8SH 3G6JF 3HC4H 4M1CD 3ARPA 3ILPB 4ETYA 4NC0B 1BX2B 3PWJA 4OD3H 3HAEH 3TBVA 1HH6A 5IMOB 1DEEA 2EC9U 5GISH 3MGTB 4LVNC 4MAYD 4IDJH 5E2TL 3BP5B 4N0FA 4NWTL 1HH9A 4QXUL 1P6AB 1SVCP 3FQUA 4YX2H 1QZ1A 2VAJA 3RNQA 4WFHE 2BZDA 1C5DA 3RWCB 4JVWA 1OP9A 3S98A 3ZYZA 4QGTA 2R56L 5C8JB 3REWA 4DFHA 4JY4A 3X11B 4DZ8B 1I1FA 3FO9B 4MJ5A 5IM7B 4ENED 2Z31B 1XGTA 4S1SH 4ZUSB 3ZSSA 2BNQE 5F7FA 2XFXA 2J1KA 4TUKL 3QG6B 1NPUA 5I1HL 4AEFA 3SGDH 2DRUA 1CI5A 2Y6SD 4XVSH 4LLMB 1RZGB 3N85L 3FONA 3FFCB 4MD0B 5GRXG 2APBA 4OLZL 5ILTL 3AY4A 3BEWB 3KS0J 3B5TA 5DDHA 1SJHA 1CL7H 1H15B 4BZ1L 1MIEL 2OTUA 4JFEE 4NKDB 1ACYL 3FZUD 4Z78B 3C08L 1INEL 3BX7C 2EE3A 3BPLB 5EUOE 4QWWC 4NM8H 3U2SA 2GJZA 2BSSA 4GW4B 3VD4A 4UILH 1R0AH 3G5YA 5CILL 4DGYL 4NQCD 5JIIA 4K7PL 3PWPD 2DQCL 5C07A 4FABL 5I17B 2NTFA 5CIPH 2R0WL 3RDTA 4IRSD 4YK4B 3WFHB 2AJXL 3WIFB 3GK8L 1PYWB 1UXSB 2MQCA 4S1DC 4DVRL 1N0LA 4LLUA 2DJUA 4NRZA 3O2DH 1H3WM 2ADIB 3H6JA 3K2UH 3MUGA 3S88H 3V95A 5CCKL 1N26A 2RQ8A 5C07B 3P9LA 2CKNA 3VFGH 2IFGA 1D7FA 1PW3A 1CR9L 3GSQB 1C8PA 2ZG3A 3WDJA 3THMH 1G0YR 4N0CC 1YNTA 2NY3D 3RBGA 5D2LB 5EA0L 1FG9C 1G9NH 1FVEA 1XR9A 1KIQA 2R4RH 2Q7YB 3RVWC 1KB5H 1U0QA 2B1HL 5I75C 4NN6C 4KHXH 5FECB 3FFCE 4NN7C 4JM2A 1ORSB 3FFCA 4MD0A 4I0PD 3OJVC 2R2CA 4LARH 1AP2B 4X7TB 1DEDA 4ODUA 2ZUUA 4GRWB 4ONGL 3FQRB 1Z5LB 2NY2B 1WQVT 3DIFB 4JFEB 1OT1A 4I48A 3HC3H 4H0GA 4JHZA 4XXCC 3PDGA 2EIZA 2MKLC 1JFQH 2V7HA 5FDWB 4F2MA 2WBJC 1PGRB 1CFVH 1F42A 4JG1H 3GGWA 1A7NL 5T3XH 1T03H 2IC2A 1KXTB 3FQTB 4L1HA 5DRNA 3VRJA 5DC0A 3T2NH 4KUZH 3U7WL 4JM2C 4M62H 2VZUA 5TH2A 3REWB 2VLRA 4PJHB 4NZTH 3JWDC 1IEBA 1ZVYA 3W11D 4GG6B 1V8HA 5E8NA 4EOWH 1I8MA 4E0RA 3BPCB 3I50H 1FORL 1IE5A 1KNOA 3S7GA 4BQ9A 1QFWH 1G7IB 3NGBC 3RWCA 4GRLA 5FYJL 4YJZL 3P40A 4JFQA 5D1QC 1B0RB 4PJGA 4U7KA 3CFDB 3NFPA 5FECA 4P4RA 3VFTA 1RJYA 2W92A 4X6CF 3EYQC 5DJZA 4YIQA 5C0JA 5C0BA 1XT5A 4WI4A 1OGTA 4FRWA 1VGEL 1XIWA 3SCMD 1KEMH 1KSRA 3ARSA 4PREB 4JJ5B 4EUPA 1LDPH 3P0VH 4LKXB 5IMMB 2L7UA 4RGOH 3B2UD 4M00A 5CMAA 4KAQL 2C1PB 1RUAL 3EOBA 1HSBB 3GMMA 4HQQH 3VMNA 4RX4A 1UWEL 3SE9L 1BMGA 1UM6L 4KTDH 1R5WA 2VDML 1TZIB 3QJFA 2QSVA 2J2ZA 3HI1B 2HH0H 4PJDE 4DOHB 1U8PA 3CSYB 2GUOB 3GEWB 5I8OL 5L2JB 3TWCL 1KCVL 1JPFB 2DTMH 3MBXH 4O2CA 4JO3L 4JY6B 5I73C 4GW4A 2UWEE 5EU5B 2RCSL 2YD5A 3BKJL 4JRYB 4XNMA 1TJGH 3CXDL 5DJCA 3VXUD 4KQ4H 5I1KL 4AZ8A 1BFOB 4NPYB 2CUMA 1QSFA 4XVJH 3ULVC 2E6PA 3QDAA 5IVZA 2GAZA 4RFNC 3QIBB 2LFGA 2ICEB 4WEBH 4CN6A 4Z7VE 2BNRA 4HLJA 4XVUC 5T5FH 1Q9KB 4ZFFA 2NY7L 3OF6A 1B0WA 3FAWA 4QXGH 4U1SA 4PJ7E 4P9MH 4MS8C 1BLNB 4R97B 1YNKH 4AT6A 1SYVB 2IAND 2IAMA 3NPZB 5D5MA 1J0KA 1TZHA 3MCG1 4PYGA 2P49B 1VFUA 1FNSH 4M43L 2H6PA 3OKOA 4D8PA 4JFFD 1JPST 1M7IB 4LHUD 1ITCA 4DK6A 1YC8A 4DVBB 1NC2B 2VDOL 3ARZA 3ZKSD 1YEHL 5E2WL 3LRSA 3MLVL 4N1CA 5F1NA 1G6RL 5IEHA 3ULVE 4LLYA 4QTHA 1RUPH 5B8CA 3FL7A 3M8OL 2FX7H 2BOCA 3CX5K 1D5MB 2HTLD 1P4IH 3PWUA 5GRUL 4NBXB 4Q97A 5F9OL 3T0EC 3SDXA 4I48B 2NY4B 3REVB 3WNOA 1XF4B 3VH8B 2BVTA 1T20B 1CGSL 4P5KB 3D39E 2XY2A 3V8CA 1RK0B 4Y8AA 1FE8H 2V5RA 1H8OA 4NO3B 3JWDL 3LH2H 1MI5A 3S96B 4LCWD 5CEZE 2EDOA 5C0IB 5MEOA 3H0TA 2BOCB 2RBLA 3GHEL 4NZDA 4UDUB 2P4AB 2WQ8A 4GQ9L 4YHPB 5E4IA 1CXIA 1T1XA 1F90L 2PO6C 4G8GA 1C7SA 2EO9A 4XT1C 3HLAB 5AZEH 4P99A 4DTGH 2A0LC 4ETQA 4LARL 2DKMA 4XP6L 1P7QD 3QUZB 2WUBL 3LKOB 4C4KT 5AYQA 5GS2D 4AEHH 3I2CH 4WI9A 3AGVA 5CD5C 4I18B 2VSDA 3QEQB 4OJFH 5EUKA 1FFOA 3M1BB 1T1ZB 4M7KH 5MHSE 5IVXE 3GHBL 3NABH 1Q0YL 3LKSA 1RVFH 1X5JA 3VFNA 1YY9C 2C5DC 1AE6L 3I02A 2Y1VA 2ZUTA 3V4PL 1J88A 1TVHB 2FZ3A 4YGVA 4HX1A 4JN1H 3VFSA 4O4YH 3ARYA 5IJVB 3RDTD 5BO1H 4U3HA 3GMQA 4EXPX 3TPUA 2H45A 4MDIB 1TETL 1WT5A 4RMTA 3LIZL 2DD8L 3ARBB 1OWRM 5SWQA 5IHLB 4X83A 5L6YH 1XZ0B 4ZD3H 4JY5H 2EDDA 1DBKH 2DQEH 1OGAD 3F6LA 5MHSD 3KPMA 1JPGB 3O3EB 4ODBD 2EECA 1DLHB 1INQB 5F88A 2MHAB 3MLRL 2WQRA 3SO3B 3WFBL 5BS0E 1OSPL 5C08B 3BE1L 2OM5A 5KTEL 2W65B 4ODXB 1R3HA 4PJ9B 1E4KA 1IGIL 2G5BA 5GGTL 2VIRB 1EFQA 2ATKB 3KXFD 3WN5A 6CGTA 1SY6L 3FRPG 3K4DA 4OGXH 4JKMA 4MLSA 4WW2C 1K8IA 4PJFF 3DRQA 3RUGE 3DX9B 5JIKA 4ODTH 5DGQA 1OAUH 3U36B 4KKBC 3L5JA 5ANMB 3SDYL 4YHZH 3OTTA 2YC1B 3B2UC 3VI3E 5D71H 2ARJA 1IKFL 1KNOB 1I8KA 1MCJA 5SWZB 4JB9L 3L3KB 4XHJD 4D9QE 4YR6B 5TQ0H 5D7LB 1CIUA 3IFLH 1AHWA 4ALAH 3O6FB 4GS7B 1CE6A 1MLBB 4HCRL 3QWQB 2NPLX 2VLRB 1E28B 2YD8A 5TQ2L 4IOSD 2D7TL 3BD4A 1X44A 3AUVA 3OKNA 2G9HA 3QNZA 2BY0A 4QHKI 5DGRA 4YHYC 5E24E 1SHMA 2FATL 2R2BA 3WJJC 1HN1A 1EMTL 1FYTB 2FEDD 5JDJA 3MRGA 4GH7B 4PG2A 1I1RA 5D6DC 1PLGL 2R15A 4F7TB 2OQJB 4OF7A 1TNNA 4TSAL 3CJJA 3O3DA 2C3VA 2CMRL 5E99H 5IJKA 3QUMH 2F8OA 3P4OA 2OR9H 2AV1B 1U3YA 5T5NG 1FJ1B 4GKZA 3W39A 2VXVH 2ARJB 5D5MF 5FUZL 2Z9TA 4OGAD 3IU4L 4KGJA 5EH1A 1JI2A 3NIFF 2QQNH 4P46C 3QT2A 5ESAB 2VLJE 2UUDH 1C08A 1MNUL 2K3TA 4M4RA 5F7EH 5KSBE 1YQVH 4I3RL 1UH2A 4UV4H 3T0EA 1BD2E 3X3GH 2GUOA 4M02A 1DSFH 3NTCH 3OF6D 3Q2CA 4QO1A 2WBKA 1UZ6E 2EDNA 5E7BA 5B22A 3UJTL 4LCIH 5F93C 4EUPH 5DWUL 1DFBL 1QSFD 2HKHL 2ESVD 2H3NB 1JWSB 4K3EH 3QUXA 4OFYD 4L4VE 5D9SB 2W0PA 4ODWA 2EXYD 5TDNB 4ZUWB 1TVBB 4TRPH 5ITFB 5MERB 2PO6D 3CMGA 1V3LA 2QR0A 5CSZA 3L3DB 1KTDB 4L8CB 3E2HB 5FYJU 1XGUA 3LS4H 2XQBL 1F4XL 3ARGA 4JFZH 1U3HC 3SJVE 4UTAL 1BQSA 1I8LA 4LKCA 4X8JA 4P5TC 2LU7A 1WT5C 4BKLA 5T3ZH 1BIHA 2E6JA 4HKZA 1JHLL 3MRKB 1HQ4A 5GGVH 5JW4R 4OZ4B 3SDXB 4EBQH 5IOPA 1XR8A 1F3RB 2AK4E 1U3ZA 5DURB 3RWGA 4U3CA 5HDBF 5IMLB 4MJIB 5GGVY 2A0LD 3QNYB 4IEFB 2WBJB 1WTLA 5C0FA 5IEHB 3ZYIA 1BVLB 3CVHH 3QZWB 4KI5C 4GG8B 2CKBL 3ARFB 5H2BA 1LE9A 3WNKA 4JY4B 4CMHC 2COQA 4CVZB 1AY1H 4XC1H 2OL3H 3BSZL 3HI1A 2I25N 3OKDB 5L6YL 4BFIA 3GMNA 1CDUA 4ZD3L 3HHRB 3RDTB 3HFMH 2BERA 4RRPG 3RKDC 5AUMB 1MVFA 4ZNEA 1NCWL 1P7QA 1QBLL 3BN3B 3IDYB 1NGXB 4P9HH 2O61A 5DURD 2V17H 4PJ5E 4XGZA 1JNHA 5EO1A 1TENA 2KH2B 1NLDL 3HUJB 1UEYA 4I18C 4XWOD 4PV9B 4KTYA 4NM4H 5ENWB 1BIIB 3BGFC 4YPGA 1SVZA 4HKXA 5FHBL 4HC1L 2QQLL 1D6VH 4H8WL 5B38G 2Y07H 5FYKH 5ESQB 3ESVF 3ARFC 1YPZA 2Z93A 5B39B 3MC0A 4OCNC 5CKAA 5EO9B 3IDIA 3QPQC 1IFHH 1K6QH 3FOMB 4QRSA 1P7QB 3MLZL 5JNYB 1WTGT 1RZ8A 4JFQB 2IPUG 5KVDL 4Z7NF 5GS2H 5D6CA 4OCSH 4H20H 3G6JE 5TDPA 4PJXF 1GGTA 2AJZB 4XNZC 5LWYL 4JM4H 3ET9F 1IM3B 3MV11 4A2MA 2DMBA 3LEYL 1PG7W 3GMRB 1N64H 4OCYH 2EH7H 1LK2A 1MHPL 4WI5A 2FATH 1EGJA 2NY4D 3LKPB 2BVEA 1T6VN 4IIQC 1DQJA 4TULH 4WENB 2DQCH 3T8XA 3SO5A 5E1AA 5CFHA 3GKZA 1CCZA 1RV6X 2OTUB 2Z91A 5J9PA 5IIEB 3QEUA 3MYZA 5IKCA 2XQYG 2X10A 1KPRA 5ALCL 4UUJA 1NMBL 5CBAB 1LHZA 3MLXH 3MJ9H 5DVKA 1KIQB 4QOKB 3RWHB 3VXSD 5CZVL 2DKSA 5EZIH 2PR4L 3NFNB 5T1DH 3V5DB 4LAQH 4XTRD 2XA8H 4R97C 1GOHA 3G5ZA 2JIXA 2F5AL 2VXVL 4Z0BL 3KYMA 3FRUA 2K9UA 4OFIA 5TDNA 4NKMA 1CR9H 1VEMA 2QQNL 2DQGL 4D3CL 1U8IA 1AGEA 3VXNA 1FYTD 2GW5A 5LXGH 5DVNA 5F7EL 4MQ7B 1CDIA 5KOVC 1P4LA 4YC2B 4QRUA 4K3HA 4HWNA 4YZFF 3NPSC 5CP7A 5C8JA 3F7VA 1T7YA 3W82A 5E2UH 3O9WA 1LK3L 2EXWC 3WMSA 1F4AA 3HUJF 4AL8H 3KPSD 2YA0A 5SWSA 4P46B 1FDLH 3KHOA 4I3GA 2FEEI 2IJ0C 1A6UH 1LEGA 2YD1A 5EC2A 4JZNB 4XVSL 5T1MA 5JW4N 3QDHA 4PV9A 4WV1A 3VFMB 2QHLA 5HDQL 5J6GA 4OF8A 1L0YA 2DB8A 3AVEA 3UX9B 1CL7L 3O3DB 5EZLB 1J1PL 2K7PA 4DKEH 4XMKL 4JKLA 4PB9L 3QCVL 2XWBA 3KLAA 1C16A 3EOYG 3SDCD 4AG4L 4LLMA 1CFNB 1YEFL 4UB0L 1ZVHA 3DYOA 2V7NB 1JK8A 4PJEA 2UVFA 1T89A 3MO1B 2HWZL 1KG0A 1E4XH 3QDGE 4CDHA 1NCAL 3CH8A 3QISA 3DBXB 3KPSB 4Z0XA 2NXZC 3EW3B 3ARUA 3GSWB 1A3RH 3BRGC 2VZ1A 1INDH 2JJTC 3BDYL 2ORBL 2AJXH 1CICA 1RHHA 4JDVA 4OTXH 2FHCA 4U6TA 4KKNA 2OR7A 4X4XA 5J3HC 5K9KB 5D7LA 4P3DA 1LMKA 1WWWX 4LHQB 3HI6H 1FLRL 4ISVB 3RUGA 2OXGA 4L3EA 2ESVA 3QUXC 1UM6H 1NBVL 4KTDL 3HPJB 4D9QD 4YC2C 2V5YA 5I1CL 5H37G 4OZHE 3B4NA 4IHOB 4XP1L 3JV4B 5IB5A 5ICXB 5I1GL 1HHGA 1HOCA 2DICA 4K8RH 5D2LA 3E8UH 3L3DA 1GRWA 4QOKD 5H35B 3VXSB 5EU6E 1HWHB 2DTML 1BJ1H 1CXHA 1XF2B 5I0DA 1YY8A 3N1FC 4L5FL 4H0HB 5FO8B 3X13A 1XEDA 4OLXH 1WICA 3BKYL 5F96H 4CMMA 5IEKB 4NQSB 3FTGB 1IM9B 5DUMH 5D9SA 3VGGA 4QGYA 1QNZH 1UZ8A 1XGTB 2E27H 2J5LC 2FB4H 5DI8B 3OKOB 4DWHA 1QVOA 4M5ZL 2Y23A 4D0BB 3UTPE 5FKAB 3IDJA 4QT5A 5D70H 2BNQA 5FF6B 1IKNA 3UTZB 1U8HA 1F45A 2XWTB 4RGNB 4M7LH 5IJKC 3CC5A 5EPMB 4YLQT 2BFVL 4H0IA 5I8OH 2DL2A 4RAHA 1LO2L 5I1JL 3V7AE 3EOTL 4M93C 4OIBA 5C07D 4MDIA 2AXJA 4Z7UF 3ULVF 1EK3A 3L3JA 1NJ9B 3IXAA 5B3JE 4O9HL 4WUUB 4FP8H 3SJVA 4XNZB 4KROD 1BF8A 2BRRL 1MY7A 2C7UB 4H1LB 3L5WB 1KULA 5I74B 1RZJL 2OQJA 4RFEA 2V2XA 4GS7C 3GSNA 4PJ5D 1FNLA 2QSQA 4JFXB 1WBZA 2DLFH 4GSDL 5DEGB 2P8PA 3V7MA 1QBMH 4RMVA 2YEZA 4NKOA 1I7TA 3QWRA 3KS0H 3FO1B 5TE4L 1NC2D 2HKFL 4LSRL 4OUUA 3ROLA 5IF0B 5D7SL 4V1DA 2APTA 3SDDB 3BQUA 2R1WB 3RPIA 2X4SB 3TZVB 2VE6B 4PGDA 2FWOB 4OGAC 3A6CL 5GZNC 3FO2A 4NQSA 4S1QH 4JM2D 4RFEB 2VDQL 4ENEC 3X11A 4WU5B 1N7ML 1ZA6A 5EU3A 2VDMH 3CMOL 3TT3L 2IADB 3AS0A 3CU1A 5I1AB 5IB3B 3DECA 4U31A 3MMEA 4HAFA 1GOGA 4I8DA 1GZPA 4J1UB 3L3JB 4R7DB 4LLDA 4TVPL 1A6PA 5D7JC 5JXAH 5HD8D 1I8KB 1KIPB 3CVIL 1F6LL 2KKQA 1T7WA 3EJZC 1HHJA 3DARA 2BVQB 2GEEA 1NC4B 2EDYA 4BH8B 4XCEB 2Z31D 1A6UL 5ID1A 5F7WC 5GHWL 2LE9A 3ULUD 3VFPB 4PJ8A 3IT8D 5I30L 2FIRT 3T0DA 3RY5A 4YQXH 5DMKB 3W2DH 5BW7C 2VZOA 2CK0H 2D9QB 4JM2F 5EU6D 5GGRA 1TVDA 1ADQA 4Y5VA 3L9RB 3EBAA 3W0WB 4OLVH 1N5AB 3SKJH 2DM7A 3IAGC 5DSCA 4LSUH 3CFCH 2GQHA 3QBTB 1BZ7B 5IEKA 3FQXB 2EXYC 4UAOC 2O5ZL 4WJ5B 1OM3H 1GCFA 2H6PB 4RWHA 1E6OL 4RFNB 1AQKH 4IRJB 3W5MA 2FD6H 5HHNA 1Q94A 3ARBA 4A6YH 3UTTD 4U1MB 5BV7H 4PJXE 4FFWC 5KW9L 1U6AH 4XCYA 2EEAA 4ZOEA 2Q8BH 5EUOB 1G0XA 4KTEL 5KANI 3PHQB 3QIWB 4M8QB 3S4SA 1FIGH 5F97E 1L0QA 1QO3A 3ARDA 4OTXL 3B8YA 4JG0L 2WP3T 3HE6A 5C86A 3QH3A 2HVJB 3SDCA 4GLRH 4IRZL 4G6AD 2IMMA 1I1CA 5JW4Q 1VKXB 1DUZB 4X6CA 1BBDL 1I9IH 2L4OA 2V6HA 1LO0H 3RI5F 1R5IB 1T80A 5GISL 1R5WB 4AY0A 5E2VL 3D87B 1XGYH 1U8PB 5IQ7L 4X7CC 1FCCA 4W4OA 3FB5A 4D0BA 4OV6F 5EOCJ 3KPPB 1IGCH 2OSLB 1C16B 3NA9L 1NGWA 5I8KL 1T7XA 5EU7E 4O58L 4UIKL 1LQSR 1S8DA 4PTTB 3KJ4C 4R7NB 4JCMA 4AENB 4MQXD 4M5YL 4GQPH 4KRPD 4ALAL 2NW3A 1D3CA 1OW0C 2G5RA 3CUPB 5EIIA 5JXEC 3NIDE 4RAUA 3LQAH 2J6EH 3NCBB 1G9NC 4X6DF 2Q3AA 5C71A 4ZUUA 2CDGA 5DDHB 3KPQB 4YE4L 1NDMB 4HKBB 5IKCB 1S7RB 3VXSE 5J9PB 2VUOA 3WXVL 3WLWC 4MVBC 4JFYA 2LVEA 3D39B 1MLCB 4XXCA 3BP6B 5FGCE 4HXBL 4U6YB 4QNPF 4J3OC 4PRAB 1CD9B 2BDNH 2WINA 4OZFA 1B90A 1Q1JH 3ILQD 5TQ0L 3RZCD 2FJHB 4O02L 1MEXH 3BHBB 4HZAA 5CJQL 2HFEB 3VXNB 4HCRH 2DIAA 4C83A 2JCCB 2XTJD 4P4KC 4JKWA 4ERSL 1R3IL 3U83A 5BS0D 4DQOL 43CAB 4PJEE 43C9B 1L6ZA 1EFXB 4Z7UA 4NWTH 3C5ZB 2DQEL 2GT9B 4NN6B 3PV7A 4HIHA 5HI3D 5D6CB 3L95B 3I75B 5DQJB 4OLUH 4PRAA 2R1YA 5L88L 4GRLC 3QXTA 1RK1B 2ED9A 2X9XA 1CL7I 3TCLB 4KRMB 1JWUB 3B6SB 4G8FB 5IVXB 4LOUD 3F6IA 4CJ1A 4J6RL 5CIPB 1TJIH 5HHQA 3BDBA 3DV4A 2Q7YA 3BI9X 1QG3A 3BD3A 2GITB 3QNXB 4CNIB 4TUKH 5EIIB 5CBEB 5HHME 1Q9WB 2X1QA 3CVIH 1N59A 2I9TA 1MJ7L 4ZFOB 3BMVA 4HK0B 4OQTL 5CD3B 4WI7A 1BJMA 4OLZH 3H8NA 4M03A 4MS8D 3UYRL 2H32B 2D4FA 3U7AA 1F3JA 5F6HI 2CDEA 4Q7DA 3QEQE 1S7WB 5DYOB 3PWLB 3VXPB 5T1LA 3OR7A 5D1QB 1N59B 2YD7A 4EUPG 4KK8C 4Y4HB 4AEIH 2R9HC 3DX8B 2O5ZH 4Y4FB 1QR4A 4FQXD 3DV4B 4NUJB 2GFBB 3QHFL 5F44A 3NFNA 5D2NC 2I24N 5LAXB 3QIWA 3S4SB 1LP9F 2FD6L 2X4UA 3ORJA 2O5XL 3OJDA 3UZEA 2HJKA 3RIFK 1RHFA 2A2QT 3WFZA 5K9QG 1K9TA 3TCLA 1SJHB 5E5UB 1I4FB 2EE6A 3Q6GL 4LLWB 4Y4FD 2Z8RA 4P59L 3SE4C 1CU4H 1GC1H 1UG9A 4HFUH 3BPCA 4PY7A 4YHIA 3D3VE 5AUMA 1A7BA 1IGMH 4GRLB 4Q9BA 1WJ3A 2XXMB 3S36X 3MA7B 1XF5A 4NQED 5HI5C 2NY4C 3MNVB 3PXJA 5DSCB 1ZANL 1NDGB 1KCRH 5ETUB 2VR9A 1LO4H 1VGKB 3MRJB 4OUOA 2VLKE 4XPAL 5EBMB 4AYFA 5FYKL 2MFNA 5IW1B 1I1AB 3L1OL 2B7DT 2ICCA 5GSVB 3RVXC 3AM8A 3I6GA 3C6LC 4KROC 3KNBB 3MLSH 3LHPL 3BP6A 1U42A 3NN8B 3WLBA 1TMCB 1S7SB 1BHGA 3HB3D 1DQQB 3ARDD 1SJEA 2XN9D 2HTLC 3L3HA 1I4FA 4LLWA 5LWYH 1BQLH 1IGJB 1UXWA 3WN5C 2OZ4A 3FT3A 3ZHLA 4XNXH 5GGUB 4XBEH 5MERA 1SJVA 1F4XH 5FGCB 4JFZL 1JRHH 1DZBA 3VXUE 1MHPH 5FO7A 5EFIB 1W72H 2WW8A 4ZUTB 4OF5A 1ZEAH 1YEEH 5DRXB 4GMTH 2CDFA 3K8MA 1BD2B 2X4RB 1FYTE 1JFQL 3ZLQC 3GI9H 4LQFH 3ES6A 3SPVB 2VZTA 2HYMA 3BW9B 4J7RA 5TE6L 5HHOE 4LPUA 5E08L 2QHRL 2YUXA 4JDZB 2CKBH 3TO2B 1ZVSA 3KG5A 5IHUH 1AFVL 4GLRI 1TTFA 4PJBA 2WMPA 3OXSA 4MWFB 3BKCH 2YZ8A 3BZ4B 3ARTA 4Y0GA 3VGDA 4X7FC 1OAYH 2GTZB 1J18A 3CSPA 5L2KE 4CL7A 4UT6H 3VDBA 3U4BL 4HMDA 3GJFH 4KKCD 1U2HA 3EYOA 1YJDH 1OARL 3FB6A 1AQDA 1SY6A 3V9FA 5BW7A 2FBJH 3MODL 5C0ND 3SCMB 3ALXA 5BS0A 5KSVB 3KR3H 1HZHH 1XGQB 2R0KL 1FFQA 3TVMA 5EOQL 2OI9C 1B6UA 2NY5L 1U8HB 4QT5B 5FF6A 5L9DH 2AEPH 1CT8A 2R2HA 5JHDA 4Y5VB 5FK9A 3HRZA 3UPRA 3VXMB 5D93C 3T4AA 2DQFB 4NDMB 1MHEA 1IM9A 3HS0B 4JFPA 4L4VB 4DZ8A 4HKJA 4NZRL 3F5WB 3DMMA 3WDIA 4P2OC 3VFPA 1EBAA 4PD4K 5GRZA 1UM5H 3FQUB 1NGZA 4QXWA 2N4IA 3A67H 5GGQH 3ZE0E 3C6LB 2R9HD 2GYSA 2XT1B 1MCBA 3IDMB 1YC7A 1NAMB 3D48R 3L6FA 1TTGA 3C60A 3MA9H 3TF7C 4L3EB 4K3JL 1ZMYA 2J88L 3AREB 2QV2A 4LCUA 4XVJL 1ZA3A 2EXWD 3KPRB 3QHFH 1ZHLB 3D18B 1CGUA 3CFJA 2WLZA 3MRNB 1U8LA 1Q0YH 1RUMH 3DRTA 1DE4B 4TUJB 5J89A 2A6DB 4N8CH 5DUBB 4PTTA 4P9ML 3HAEG 3U0TA 4EN3C 3BN9C 3RJQB 1MREL 1LO3L 4HMCA 1EAJA 1A0QL 3DWTA 2D7NA 2HT4C 1XGQA 1H8SA 1X5XA 2DYPD 1YEDA 1GGIL 3G08A 2UYLA 3O6KL 4PTUA 2R0LH 4XH2B 1KN2H 2X4OB 4KFZC 2NY3C 1DJSA 3IS1X 1MCIA 1S9YA 1FAIL 4IRSA 4F37K 5L8LB 2XA3A 1OW0A 2QQKL 4UV7H 2XIDA 2X4UB 4Z7WA 3HTLX 5MEOB 2AABL 2H2PD 3I6LE 3AREA 4Y2DB 4DEPB 3VXRD 4AL8L 4G7VH 2G75B 1IGJA 1I7ZB 1KGCE 3BE1H 4P46A 3B9KB 1VFAB 1FLRH 1FZJB 3WL9B 1F8TL 3E3QE 4NCDA 3MRBB 5AG8A 3U1SL 1FIEA 1KIUA 4S10A 4XP4L 3VFWB 1MCOH 1IARB 2PTTA 4WW2A 3NABL 4RQQB 1F4WH 5I76A 4NJ9H 2MQ3A 4LRIC 5C0GA 1CG9B 3TBTB 1FL6A 2NNAA 3EOTH 1TZIA 3QJFB 5DI8A 1FZMA 4PRHB 3C5ZC 1G84A 1CXLA 3T0AA 5C3TA 3FFCD 1J05A 3LPFA 3BJLA 3FMGL 5DUML 4Y8DC 5I1DA 2O5YL 2AXFA 4WWKD 2WUBH 3IFLL 1TQCC 4JLRA 5HGGS 3LV3A 3MOQA 4G6FD 3HAEA 5TPWH 5TE7H 5HGDB 4U1JA 4PRDA 3K3QA 4FQQA 2JIXD 5IB5B 1J7VR 1JWUA 1FZJA 1QRNA 3B6SA 3BO8A 4P4KB 2ICWA 3WFCH 1YA5A 4QXTB 4F9PC 1OSPH 4QRRB 2JJSA 1QSVA 3O2WL 2XACC 4R2GC 3A6CH 3T0XA 1A6TB 1DQJB 4P23D 2B5IB 2NYYD 3OPZL 2R8SL 2VITA 3HC4L 4Y19B 4KI5E 2EYRB 4LEXL 3IKCA 2O93L 2GSGB 1J12A 1YN6A 4GBXD 5HHPB 4WHTA 4EI5D 4X0KB 4Y2DC 1Y0LB 1J11A 4JY5L 2H32A 5BMFL 5DA4A 5CD5D 5DC9B 2OP4H 1NL0H 4NQTA 3VXUA 4AM0B 5D7KE 3NCJL 5KSBA 3GIZH 1JV5A 2AEPL 1K8DA 3IF1B 4HDIB 1I7RA 4QRQA 4ZFOA 2AV7A 3UYPA 1MRCH 1YPZB 2Z93B 4Z7OE 3WJLC 1T1WB 5EO9A 2BVOA 3DUSB 4FN0A 3V6ZA 4JR9L 4KI5D 3SN6N 3UJTH 2A6JB 1PZ5B 1YMMD 5F7NC 1EVUA 5K9JH 1QFWM 4I0PA 1IQDA 1KJ3L 5HSFA 4D2NA 5C9JB 1MFBH 4XNMB 4TVPH 3V0WL 2AAVA 1JGUL 3PHOB 1UWXK 5DVLA 3MV9A 4X6BB 3EYUH 3UJJL 1A9EB 4XVTL 2KZ1B 1OM3L 4DW2H 4HD9A 1S7QA 3GSOB 4Q74A 4K3DL 2BP3A 5JHLH 1FZOB 5L2JA 3SQOL 5IESL 4K3JH 2Q6WB 4QRTA 4POZC 1ONQB 1EFXA 4S1RH 2QL1A 2PYFB 3U0WL 1MFDH 5J57B 1GH7A 4Q0XH 2P24B 4PJFA 2EYRA 4JFHE 2K1MA 4N8CL 3EFDL 1H3XA 3FRUB 3GMLA 3TBSA 4MJIA 4XAWL 1T66D 3SDCB 5IMLA 5CHNA 1MREH 1V7ML 3OGCA 4HAGA 5ID0B 3GDBA 5JW5B 2ZUQB 2SEBA 1P7KB 3QO0B 4NKIH 3RWHA 1HEZB 5IB1A 3CVHL 1E6OH 3C2AH 3P2TA 3PJSA 3MCLH 3V5DA 2LTQB 3WNMA 5C0JB 4JQVC 1RMFH 3MV9E 2OZ4L 2IBZX 1UCTA 3DMMD 4MQSB 1J8HE 1U6AL 1LNUB 3GBLA 4X9GA 5E1AB 1DUYB 3O0RL 1UVQA 5ACZB 5CP3H 3VJ6B 5I8EA 3AROA 3QHZH 3P4MA 1PY4A 3SDDC 1QBLH 4LU5L 4E42A 4YNYA 3CLFL 2R1XA 3LKNB 5FFLA 4XP5L 1ZVSB 4ZO7A 1JNNL 1CFQA 2BY1A 5DYOA 5HGAB 2QQLH 1TIUA 5CINH 1M6OA 1I9IL 3MJ6A 4PLJC 5IR1B 4KQ3L 5IGXL 3DSNA 3HNVL 2J12B 3DHJA 3OXRB 4G6ML 5KJRH 2BOBA 1Y18A 1C5DB 2XICA 1CFNA 1RZ8B 3GMMB 3RU8L 1IGCL 3HB3C 4HSQA 1DBBH 4OI8A 4Y16B 1A6WL 3FMGH 3F7RA 3MGTA 1WAAF 3MOAL 5DHXB 3TBYB 3TA3A 3ULUH 1CTNA 1EJ6A 4LCYA 5KW9H 4NZTL 4OCYL 3V6ZB 1AR1C 1NAKH 1H5BA 2D4DA 4MA3A 4HFWB 5JPMA 1S7SA 5GXBB 5KSBB 1A7QH 3QDGB 3MV8B 4Y19E 4OAWA 4ACPA 2R1YB 1JV5B 4BSVB 4W4OC 3V2AR 2R2BB 3FO1A 3I6GB 1EAPA 1OTTD 3QG6A 1X4ZA 5DMJB 1VACA 1XF3A 1H5BC 2PR4H 3ARFA 2XN9B 1MCEA 5HYSA 1X5YA 3UTSD