5C2BL

Anti-cxcl13 parental scfv - 3b4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
SALTQPASVSASPGQSITISCTGTSSDVGAYDWVSWYQQHPGKAPKLLIFDVNNRPSGVSHRFSGSKSGNTASLTISGLQAEDEADYYCSSYTRRDTYVFGTGTKVTVLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords scFv 3B4 heavy chain
publication title Optimization of a scFv-based biotherapeutic by CDR side-chain clash repair
rcsb
source organism Homo sapiens
total genus 25
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2015-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c2bL00
3L3HA 1BBDH 2EYRB 3MNVA 2YD9A 4M62L 5IFJA 4PR5B 4G8EB 3C6SA 1OGAA 3OG4B 1BQSA 3AXLB 4K23L 1JN6B 3MBEA 1E4XI 1CFSB 2F54A 1OP3K 4DCQA 5IB3A 1NC2A 4YUEL 1ONQA 2E27L 4H26B 4J1UB 5FYJE 4ETQA 3QIUA 4PRHB 2GK2A 3PV6A 2CJUH 2ZPKL 3MO1A 4GAYA 1NLDH 5EZOH 1Q94A 2CDFB 1HQRB 3U9UA 4P4KB 4Z7VA 3DHJA 4HCRA 1K8IB 5I73B 1RPQA 5K9KA 1ADQH 1DCLA 3IJSA 3QB7C 1G0XA 1ZA6A 2DD8L 1N2RA 4H1LG 3HNTH 3SDCB 1BOYA 4MJ5A 3BKJH 4GAGL 4X6DA 3JV5A 4K3JL 2HJLB 3OF6A 5HPMA 5KG9A 2AQ3A 1F90H 3QXAB 5D2LB 1CTNA 1GIGH 4C56B 1OARH 4XRCA 5JW4M 4R3SB 3FN0H 1A0QH 3IDNB 3T0VA 3IFOB 3AS3A 5MI0C 1BD2A 1IKNA 4ODWB 3HC3H 1BJMA 1O5DT 3P11L 3UYPA 4J23A 5FYKD 2DL2A 4X6CB 2XRAL 5DJXA 1JPST 2DTSA 2O5ZH 3S4SA 1NGZA 3CDFA 2ARJA 2FSEA 2J12B 4Z0BH 5ITBL 4NHUA 4XCYA 3QO1A 3NA4A 1EEZB 1YECL 1FZKA 1Q9KA 1LEKA 2C7UA 5ANME 3EOBA 5IP4A 2Y6SC 3ELAT 5C0AD 5E8PA 5ADOH 4LHUG 4GW5A 5C8JB 4QRRB 1AHWC 4X6EA 4NHCL 3T77A 5FECA 4LIQE 4YXLL 5DD0H 4WY7H 2R2HB 5IIEB 5DRZA 1DQDH 5I1JH 1I7UA 1S7WA 1WWAX 4UT9H 5KVMC 3MRCA 4NKOA 5L7XL 2NW3A 4YHPA 5TDPA 4UT6L 1YMMD 4YHOH 1X6LA 2PCPB 1AR2A 1QBAA 3DMMD 4HW6A 1Z5LB 4N0YL 1RJZA 2Q87A 3THML 1RU9H 4WWKD 5E6YA 1BBJB 1KEML 4TUOB 3QQ9C 3W0WB 2DYPB 1QA9B 1A22B 4WI4A 5DD3H 5MEOB 3WLBB 4QHNA 4K3GA 4PRAB 1IZKA 4GQ9L 2BJMH 5B38B 5IEHA 4F33A 4RFOH 1GL4B 1WITA 3VFSB 1OSZB 5FA3B 5ESVA 4YHIA 4OIAA 3UTSB 3SCMD 5JXED 2VZOA 1Q0XL 5L0QB 2WBJB 2WNGA 4NQVB 4NQCE 4LOUD 1HSAA 3HRZB 1AGBA 2J8UB 4HS6B 4KFZC 3SKMA 1L0QA 4JCMA 3S88L 1BECA 1R24B 4U1HB 3MREB 4U6XA 1U8OA 3DX6B 1P4BH 4NM8L 4FFVC 3TN0C 2DQHL 1AIFA 5I66B 4XMLH 3QEGH 2YK1L 1EA9C 4NQXA 2MCPL 3VG0H 4U31A 3TPKA 1FFPA 1NANI 5EBWA 1RUPH 4F9LA 3GKZA 5IW1A 3IKKA 2YHGA 4YDLC 4L8BA 2JF1A 3UTPD 4A6YB 5IK3B 1MFDL 3AROA 4RFEB 3BIKB 3QUXA 3S3PA 2JJVA 5BRZE 5KAQF 1ZXQA 3QI9D 5IHZB 2V9QA 4UOW1 4LLVA 1OAQL 2AK4A 4OD2B 1X7QA 4LF3A 4ZS7L 4G8FB 2ICWJ 4Z7UF 1IL1A 1FN4B 4BQ9A 4A6YL 2Z31B 4PJXE 1OLZA 4RQQB 5J1TC 3QEHB 5CFHA 5DVOA 5E8EA 3MCG1 1ZLWH 2IFFH 5HGHA 4DN4L 5ID0A 3UJIH 4XPTL 4D0BA 1V7NH 2OJEB 4EKXA 3DGCR 3WE6B 4K71C 5I19L 3MZGB 1UM6H 4QT5B 1OSPL 4PJXF 2P5WB 1R5VA 3VFRB 3QA3A 5J4MA 3ME0A 2GK0A 4HFWA 3B9AA 3FMGL 3F8UB 5KSBA 2AXJA 4WO4C 1PKQB 1WSST 3T0WA 2UZYB 4WUKH 4JPIB 5C0DA 4KVCH 1X5KA 5IVXE 4EBQL 2L7UA 1ZHLA 4PTTB 1OAXL 1AKJA 5FFLA 1S7QB 3KPNB 5C9JB 2GY7B 1DUYA 1I1AC 4JY5H 4PP1C 2HLFC 3FO1B 1WEJL 5J06A 4QRPA 1KLGA 1AGEB 1QRKA 1EH9A 4V2BA 3VXME 4Z7WE 1H8SA 5GRZA 4PGCB 1CN4A 4NM4L 3T0DA 4PJ7B 4UQ2B 2FD6L 3B9KC 1INQA 3DVGB 5I75B 3O2WL 1ES0A 2R56L 3QEQE 2NY6B 3O3EB 4OSUH 4Z7WF 2GAZA 4JN1L 3GO1H 1HH9A 1YJDL 4TUJB 1T4KA 5A3IC 2M2DA 5I1EL 3KDMB 2EYRA 4X4ME 2YC1A 4U3CA 2W91A 1XGPA 3GJEA 4GRLC 3FB8A 1QRNA 3S36H 5INDB 4G8EA 1JRHL 3U1SH 1JGEB 3AXLA 4ALAH 5DURD 1CFSA 5IUSA 3MLXH 1QFWM 4PLKD 3O6LL 2OI9C 5DXWA 1JPGB 5K33A 4CKVX 1QPXA 5C86A 5DD1L 2CDFA 2ZCKL 1RZ7L 2DLIA 3MGOB 4Y19D 1DEDA 4QRTB 2EO1A 1J8HB 4TSAL 4Q9CA 1D6VH 4KHTH 4R0LA 1T66C 3SDCA 4NRZB 2CLRB 1T6VN 2YPVH 2IF7A 5FK9A 2QHRL 4X98B 4GKNB 4PRBB 5F9WC 3FJTA 3SGDH 3HMWL 3WXVH 1JGLH 3TJHD 4HWNA 3U0TA 1YEDB 1H15A 4C56A 5A43C 3DBXB 1UJTA 3HE6B 2BMKA 2NTFB 4GOSA 4R3SA 2BVOB 4L3EE 3S5LG 3IFOA 4DTGL 3SHSA 5DJ6B 4NCC2 2W07A 3BIAX 1OTSD 1I8IB 5GS0H 2QQLL 3EJZD 1I9RL 5T3ZL 3VXQA 3Q0HA 1J1XH 2XY1A 3WN5B 4YDJA 1EEZA 2HN7B 4XX1E 1D9KD 5T5NF 3IDMB 1WF5A 1UYWH 4O2EA 5C8JA 4HUMB 1MFCL 4QRRA 3WD5H 4PRPE 4P9HL 3VXRD 5EULV 1UWXH 2HJFB 5HVWA 3TYFB 2X7LB 2QSTA 3X12B 5IIEA 4UV7H 4PGBB 1ZEAL 3SDAD 5F96H 2IALB 3WDHA 1N5AB 1V7ML 4PB9H 2PCPA 2RAMA 1Z5LA 4NRXB 4ZUTB 4JFED 1BBJA 1PY9A 4IDJL 1C08B 1UB6B 3IVKB 3I6LD 3W0WA 4LSSH 3MV9E 2DYPA 4WV1A 5EUKB 5A2FA 3AY4A 3BJ91 5I0ZA 5I15L 2VZVA 1QA9A 4HSQA 1TMCB 2DJ4A 5FM5O 3BMVA 5CJ5A 2FH8A 2EKSB 2AJXL 4BZ1H 4PRAA 4HCRH 3IETA 3U7AA 5B38A 5F9DC 3VFSA 1MCRA 5ALCL 1I3GL 4HJ0C 1OSZA 1SBBA 1TZIB 5FA3A 1M1SA 2VLJB 5CZXC 1QVOB 3LEXB 4RX4A 3F7VB 4JFDB 2WBJA 4I9WD 4PJBE 3HRZA 2FEDD 2J8UA 4GAJL 4HS6A 3K46A 2WP3T 2C1OB 4E41D 2WIIA 3WUWG 3VFNB 4N5ED 1R24A 3VRJB 5KVDL 1E0OB 3O4OC 2XG4A 1QACA 1KPUA 1LHZA 4IRZL 1T2JA 1U0QA 4YE4L 1CXLA 1KC5L 5AEAA 2XIDA 4JR9L 5I66A 5CEYB 3WFHA 2IFGA 3CMGA 5FF6B 1QKZH 2FX7L 3VI3E 1J5OH 1T1ZA 2BXZA 3VWKD 3HC0B 5T1MB 1Y6MR 3LV3B 1P9MA 1IC7L 1NFDB 4A6YA 4WFEE 5IK3A 3HE7C 3BIKA 3EDKA 1AE6L 1MEXH 4Z7NF 2YR3A 4YDVB 1GHFH 3QJFA 3ZKND 2OYPA 1DVFA 5IHZA 4OLVL 3KPTA 1E6JL 1HEZB 4OD2A 4JHWH 4XT1C 4JPKH 1F5WA 3M17B 3W2DH 5EN2B 4AENB 4G8GD 3PHSA 3HC4L 4MVBD 4CVWA 4P2QB 5C9KA 1K5NB 4LPXA 4RQQA 3QEHA 1AY1L 1AHWB 3N1MC 2YA2A 3HUJA 1FV1B 4I0CC 4IJ3C 5DYOA 3LEVH 4UOW0 3WE6A 5HVFB 4EUPG 1K2DB 4NNXA 4KUCF 1QLFB 4YQXL 4QT5A 4G6AC 1NAKL 1YEHH 4OLXH 3VFRA 4QWWC 3PWNB 1FZMB 1MCDA 5IT2H 1DLFL 3BSZL 3BZFB 1T0NB 4MWFA 5I74C 3PNWA 3VWJC 1JHTB 2YUXA 1X5YA 5T1LD 1PKQA 4HMEA 1BM3H 4JPIA 5BV7H 2WUCH 2AJZB 4JFQB 4PV9B 4UNTA 4PTTA 5KSAD 3O4LD 3HPLB 5ETUB 5TFSH 2Q8AH 3A67L 3K4AA 1IAIL 3D25B 3GMLB 4ZQKB 5AYQA 2DIJA 4JFZH 4P5MB 4WGVB 1AGEA 3ULVC 5DHVA 3BD4A 3CXDH 4KI5F 2AP2A 4GRWE 3CFCH 2A9ML 1CBVH 3Q5OA 4KQ3L 5DJ2B 4PJ7A 1G7MA 1NGPH 1INEH 2VDQL 4UQ2A 3VE0B 4M48H 5CUSL 3GBNL 3DVGA 3NZ8B 1F11B 3V6BR 1ZVHA 4LSVL 3O3EA 1YQ2A 4U1GB 4N0UB 4TUJA 4GRWF 4KK8C 1KCVH 3CSGA 3KDMA 2NY5L 1FYHB 1M71B 1IAII 5C0NC 1B90A 4KU1A 5E8NB 5INDA 3TA3B 1JGEA 4LDOB 5HYJE 4CDHA 1OLLA 3MR9B 1YNLL 3JWOC 4KAQL 1CGWA 3L5JA 4LBEB 1JZ6A 2DI9A 5KN5A 3ETBF 3S35X 3RUGB 3A6OA 3OKEB 5BXFB 3QYCA 1FDLH 1MCSA 4ZD3H 2BVYA 5EU3B 3BGFC 3KAAA 4MQSB 3MGOA 2WINB 1U91B 3D39E 3FQTB 3SN6N 4QRTA 2JJSC 4G43B 1J8HA 4QY8A 3IT8D 3Q2CA 5TF0A 3MRRB 3OX8A 1KACB 5GGUB 2ZUQC 1S7RB 1X5HA 3QIWB 5CKAA 4CL7A 2BNQE 4QLRA 3LZFH 4X98A 4GKNA 1G7HB 2VXUH 2EDOA 4PRBA 4UAOB 4ZODA 4CADB 1A6ZB 2R2EA 3CAFA 5MP6L 1WCQA 3DBXA 3HE6A 3OAUH 3ARXA 4MZ2A 1B0GB 4DVRL 3E2HB 4PUBH 3C5ZB 1I8IA 3S34L 1MAMH 1D5ZA 2J8HA 3ESVF 3QUZC 1RZKL 4FFYH 2P5EA 5F7KC 1NKOA 2K7QA 4X83A 5EO1B 4CMHB 1U8MB 1T89C 2HN7A 3KJ6L 2OZ4L 3K80A 2FECI 3MOBL 4M62H 4JGJA 5E2TL 2VR9A 5T3XH 5I16A 2W9DL 4K23H 4FFVD 4NO0D 1JGDB 3VH8A 4WFGD 4HS8L 2X7LA 3X12A 4PGBA 4GLRI 1VGKA 2IALA 1MRFL 3C8HA 2W92A 1IAKB 3ZYZA 4GG6E 2WWKO 2ZUWA 5DWUL 1FNFA 4JM4L 4NP4L 2XQBL 2VR4A 2VLLB 1U3JA 1FAKT 3ARGD 1MCOL 5IMOB 5C1MB 5FXCH 4UV4H 1C08A 2DD8H 1UB6A 3MGAA 4FOMA 4JG0H 5DZLA 1IE5A 3CUPB 1OD7A 1AXTL 2QKIA 2D2OA 4HF5L 4MJID 4GAGH 2XZQL 2X42A 1A6AA 3MV7D 4YHYC 3V6FB 4XNQB 4GG6F 1SM3L 1M7DB 1IGIL 2V5SA 2VL4A 4H8WL 2G75B 1AGCB 2CKBL 1IZJA 2R29L 1CVRA 3CSYB 4Q9RL 2R0ZL 1MH5B 2VAAB 1MJ7L 4OI7A 3V0AC 1VFOA 3VMNA 2X41A 3P11H 1CE6B 1TZIA 3ZYOA 2VLJA 1N4XL 4LCIH 5D1QB 1QVOA 4YHZL 3KPLB 3F7VA 4Y4KD 2OI9B 2XRAH 4JFDA 1YEIL 4C54A 2J6EL 4KJWD 5ITBH 9CGTA 3JXAA 1W8OA 1YECH 5F6IC 2ZOLA 3VFNA 1I8KA 2V2XB 5F8RC 5E99H 5AUMB 4X7SH 5AZEL 1QHOA 1U93B 3I02B 1UM4L 3VXUD 1JNJA 4NHCH 2P7TA 4YXLH 3C6LB 3OPZL 1MPAL 1DLHA 5CEYA 3V5HB 3S97C 5KANI 4U3HA 4TTGA 3P0VL 4MNGB 1KYOK 1IEBB 3GMRB 3HC0A 5T1MA 3HPJA 5T33L 2BCKB 4EIGB 2BRRL 3LV3A 4N0YH 5J9PB 3E6FA 2OBGA 1NFDA 3THMH 1NL0L 3WS6C 1KEMH 4YGAB 4JRXD 4YK4C 4OZHB 2HJKB 1BZ7B 2ESVB 1EFQA 4YDVA 3AREC 4BQ8A 5MHSE 2W0FB 2N56A 1LE9A 1QFWH 2VLRD 1HEZA 4LPYA 3BUYB 4S0TD 2E7HA 1NUFA 3SGJC 4AENA 4EQ2A 4GQ9H 2EDRA 2EIZA 3FQUB 4P2QA 3JBG7 1UWGL 5T1KB 1AHWA 4Y1AE 1UWXK 2XTJB 2EDXA 1R3HB 3PL6B 3EAKA 4QHKJ 3WNKA 1M7IB 3MOQA 2AKRB 1LO5B 3QZWG 1FV1A 5E56A 4M4RA 1Q0XH 1K2DA 1JGUL 2FO4A 2P24B 1F58L 3RY5A 3NCJH 4UNUA 3PWNA 4PYGA 2ED7A 5E1HB 4XNXL 3TBSB 3TM6A 3S88H 3BZFA 1T0NA 5GGSY 4BSWB 4XVTL 2BHUA 3B5HA 4AIOA 5L9DL 1SMAA 4NM8H 2KKQA 5ISZB 5JW4Q 4JFHD 4XBEL 2DQHH 3WEXB 3AGVA 3QR2A 2AJZA 4PV9A 2YK1H 4J8RB 1JF1B 2X40A 4NYLB 2MCPH 4HGMA 3B8YA 5F72S 2OXGA 1T66D 3HPLA 3TIEA 5ETUA 1SVZA 4OFDA 5HVHB 1DBKH 2E8YA 5KVGL 4UT7L 1U41A 3D25A 5GS1C 3MRGB 4ZQKA 1CS6A 3KYAA 4NQDA 4UTAL 1MFDH 5IGXL 5D96C 1EZVX 2AJ3B 4HKZA 4X5WA 1UZ8B 3TZVB 4YLQT 3NFPA 3KLDA 3IS1X 1M4KA 3VFTB 1KELH 4ZS7H 4KHXL 4ISVB 1T7VA 3NZ8A 4A6YH 4HFUH 5HTSA 3TN0A 3DUSA 1ACZA 2VQ1B 4LCWD 5J1AB 4DN4H 1S9YB 1AP2B 4N1HB 3LH2H 1SEBB 4XPTH 1M71A 5GS0D 2F74B 3RDTC 1FAIH 1JZ5A 2W65B 3MLZL 5E8NA 3VW3L 3TA3A 4JVUA 5I19H 5DEFA 3BI9X 1OSPH 5I71B 4I0PB 1I7TB 1FYTD 5EU6B 2CIIA 1U2HA 3D85D 4LBEA 3ARRA 3IXTB 1MLCA 2EDKA 2BNRE 3FMGH 3RUGA 4LLAA 4H1LB 3GSUB 2E7BA 3GSWB 1U91A 1PDKA 3PF2A 4EBQH 4G43A 1CTOA 2Q20A 1CXFA 3CX5K 1J18A 1OAXH 5K9JH 3FT2A 3MRRA 1NJ9B 5DQJB 5CJOL 4N90D 2HTLC 1S7RA 5C0JB 4LFHD 3QIWA 4EVNB 1QSZA 3HG1B 1G7HA 4RAVB 1OGAD 1A6ZA 5GQBA 3I9GL 4GKSB 3Q48A 4LSUL 2F54D 3DXAB 4LLYB 5JHDB 2OZ4A 1HCFX 1B0GA 5GGTL 4NM4H 1QFUL 1ORQB 3L3JB 4JFXB 1F4AA 2FD6H 3WS3B 3CSBA 4NKIL 4XNYL 5HGGS 3V52H 1NDGB 3T4AB 4Q6IC 5HGAB 2R56H 1MI5E 2GJ6B 3HZYB 2D7OA 4WO4A 2AW2A 2VDML 1HWHB 4LHUB 5DHVH 4BSVA 4JN1H 4OV6F 5EO1A 1FNEB 1YJDH 1NMAL 5HGDB 5I1EH 1YEKL 3MODL 1YYLL 2HA1A 5F1KC 2PO6B 5C07B 2Y23A 1A3LL 1JRHH 3GMMB 3W5NA 5ICXB 5ACMA 4OCRL 1M7XA 4XVJL 4TSCL 3O6LH 3NTCL 4QOKE 1MFEL 5SV4A 1IAKA 2F53B 2QSCL 3MV8B 3GBML 5DD1H 2CKBA 3M07A 1KPRB 4NN6B 1RZ7H 3ZE0E 4W6YB 3F7PC 4X4XB 2VLLA 4TSAH 5IMOA 4L9LB 2ZUUA 3IJHA 5E9DD 3UBXA 2IAND 3V6FA 1U8PA 2QHRH 4XNQA 3V6OE 2A77L 3CFKA 1JTTA 3HMWH 4HPOL 1GH7A 3ZE0F 3PGDA 3EIFA 3RX7A 4GRLA 3CSYA 1M6OB 4UBDC 1AQKL 3IGAB 4S10A 3KLHC 2DQGL 3BN3B 4P23C 2VAAA 4DTGH 2BXYA 3VGAC 5L88H 1VFUA 1CE6A 3AM8C 1TNNA 2V2WB 5I1IL 5JW4N 1QSFB 2QQLH 1T03H 1PD6A 1I9RH 4K8RL 2VR5A 4WNQB 1G0YR 2C3GA 5C6TL 1A4JB 5FYLL 2FL5A 5EH1A 2AQ1A 3WLWC 1JNNL 3FT4B 5AUMA 2XA3A 3BYYA 2VXQL 2YD1A 3I02A 5B22A 3MUHL 4ZO9A 1MFCH 2XKNA 4N8PA 4P9HH 1UKTA 1XIWC 3C6LA 3V5HA 4U6TA 1KJMB 5D1ZB 1ZEAH 4NQUA 3HNSL 2DRUA 5A16B 3GMRA 5DHXB 1FSKB 1TVBB 1V7MH 5E2VL 4PGEB 2V7NB 3O6FB 5IEKB 5J9PA 4MAYD 5JPMB 3GIVB 3MLYL 3MXWL 4IDJH 1JE6A 1BZ7A 1Y6KR 2ESVA 1IMHC 3QUZB 2X2YA 4GXUM 1ZVYA 5I15H 2W0FA 4ZFGL 3N06B 3BUYA 3I3EA 2AJXH 4BH7B 1FNHA 1BQHB 2O5XL 3FQUA 3H8NA 4F7MB 1KUMA 5T1KA 5EZJA 1S5HB 1R3HA 3X3FL 4U6VL 3JVGC 5ALCH 4KK8D 4N1CA 3FQRB 1I3GH 2AKRA 5J3HC 2ZSVA 4K3HA 3MJ6A 3B43A 1XGRB 1CDIA 4JE4B 5SX4H 5HHOB 4B5EA 1I85A 1JNHB 4GAJH 3ZTJH 3KPRD 5HDLA 3BRDA 4O4YH 3TBSA 4OCXL 1ED3A 3SKJL 2FZ3A 4BSWA 2QBWA 4H0IA 3HN3A 2J5LC 2NY4D 2EXYC 4IRZH 1SHMA 4XI5D 3BDXA 2VNCA 2OTUA 2X4QB 4HK0B 2COQA 4JR9H 4TNVK 3FO2B 3WIHA 2KUTA 3MRMB 2FX7H 1JF1A 3T04D 1N6UA 2X1PA 1YPZE 4Z78A 3I85A 5D6DA 4YX2L 1A21A 2Z93B 3MRGA 4OCLC 1IC7H 1HWGB 5EOCL 1LK3L 4OLYL 1LDPL 1QYGL 1AE6H 4K3DL 1N5YL 3CK0L 1XGTA 2EYSA 1B0WA 1YPZF 4I2XA 4OLVH 1RIUH 3RKDC 4Y88A 2VAJA 2VLMD 1E6JH 1CLYL 1CWVA 2LE9A 3DNKA 4ISVA 4ELMB 3HC4H 2GUOB 4JHAL 2RQ8A 3B9EA 4HQQH 4XH2B 1V3JA 1AY1H 2MFNA 4C57C 5CP7B 2ZSWB 2VQ1A 1K8DB 2A0LC 1AKJD 1EJ6A 3L6FA 4XCFL 4XTRC 1OTUC 5C08B 3UYOD 1MCPH 1EVUA 1S9YA 1XGQB 2FCBA 4OZGE 1TCMA 5LVEA 2F74A 1I1FB 4CDGC 4M6ML 4XCNB 2WWMC 4QRPD 4YQXH 1BX2A 1NAKH 1KJ3L 4I0PA 1I7TA 1IBGL 1NBYA 2QSQA 4G9DA 3HE7A 3BSZH 3IXTA 4EN3C 3SBWC 4OZGF 1YEEL 2GCYB 4H1LA 4K7PY 4FFWD 2BVUA 3DRTA 5SX5H 3GSWA 5CIPB 3LSOB 3CVHB 5BS0D 4R2GC 3QIBB 4OCSL 5GGTA 1NJ9A 5DQJA 1L6ZA 5C0JA 3A67H 4MD4B 3G5ZB 3NCBB 4L4VB 2BDNL 4EVNA 3CNKA 2LU3A 1XR9B 4RAVA 1DE4B 5EOTA 5FYJU 5H2BB 3D0VB 5DK0B 3DHMA 4GKSA 4ZNEE 2EDDA 3CVHL 1CFQB 3DXAA 4LLYA 1WVZA 3BQUC 5JHDA 2A9MH 5DJYB 2V17L 2YPLB 3FFDB 4PRHD 4KQ3H 1MJ8H 4JFXA 5JQHC 2VDQH 3RWIB 1DQML 3WS3A 2QQNL 2CMRH 3GBNH 5CUSH 1NDGA 4P4KD 3VWJA 3T4AA 5IMMA 1VB9A 2GJ6A 4HS3B 3HZYA 2OTWB 4LHUA 5JZ7C 2YMXL 2GSIB 1NH6A 2NXYC 3SDCD 3SKNB 2C3WA 3MRQB 3L3OB 2VDKL 4LHJB 3RAJH 5BVPL 4KKCD 4E0RB 5HHMD 2I5YL 3OL2A 4Z76B 5C07A 2IQAB 4DGYL 1R3LB 3NPSB 2B1HL 1YNLH 5ICXA 4C56D 4KAQH 4LCCC 2P48B 4XX1G 4OBRA 1INDH 4ERSL 3EYQD 5DMIL 1H0DB 3G5YB 32C2A 2F53A 3SO5A 1LEGB 1PFCA 3QUMB 5DRNB 4ODUA 5HSFA 3GIZL 3BPLC 3QPQD 1F3JA 1KPRA 3QFJB 5J7CC 2W0LA 4B41A 5K9QI 4KQ4L 4OI9A 3KR3L 1ACYL 4LSPH 3I6GB 5L2JA 3QUML 4QRRD 3L3KA 4OUOA 1M6OA 4Y19E 3ZDXE 3IGAA 4NC2B 5C09A 3O2VH 2SEBB 4WI6A 1CU4H 1WFUA 4DVRH 3PABB 1HOCA 1NGWB 2J3SA 1QSFA 5CILL 3VXSD 3S34H 4Y5XC 1RFDL 1RZIB 3C09C 1RZKH 5CINL 4MA7H 2PN5A 4OLWH 3K2UL 4JM2C 3ZDXF 4OD1L 1YQVL 4G9FD 1A4JA 2NY3B 2R0WH 3W0WD 4ESKA 3KJ6H 2DYPD 4RMSA 2OZ4H 1KCLA 3MOBH 1G84A 3SE9L 5DS8B 3FT4A 5E2TH 1EO5A 4F15B 2W9DH 1U8HB 2E8ZA 3ZYJA 5EBLA 3ARTA 4U1LB 4AH2A 2YN5A 5D1ZA 4HKBA 3BHBB 4XBPB 1VESA 1MRFH 3FOMA 2CGRL 4EXPX 1TVHA 5DWUH 3UTSD 1ZHNB 4NP4H 1YYML 1I8LA 2XQBH 2V7NA 2WBJD 3O6FA 3KPPB 1WLHA 1LGVA 3RL2B 3TV3L 5JPMA 2BC4B 4N9GB 4G7YL 3KG5A 3VXRE 1WTGT 1AXTH 3N9GL 3QUZA 4HF5H 4FZ8H 2XZQH 5I1CL 1DQJB 4IMLB 1SM3H 2W60B 1T89A 5DD6B 1RHHB 4H8WH 3ALXA 2CKBH 3BO8B 2R29H 4BH7A 4GBXD 5GRJL 3VJ6B 4JFEE 4Q9RH 4F7MA 4OBSA 2Y1VA 1S5HA 1O0VA 5FGSA 2CR6A 1JTPA 1TNMA 3I6LE 1KXQE 3O0RH 3STLB 3B9DA 2GJZB 3LKPA 1N4XH 4YHZH 4XZUB 5TPWL 1XGRA 2HFFB 5AWNH 1YEIH 4QHUA 1T21B 5E8DL 2VB5A 3F5WB 5EO9B 4L1DA 2LU7A 1JNHA 2Y07L 4XCEB 5JHLH 3MYJB 3V4UL 3BXNB 1J10A 4NC0B 1GSMA 2FHBA 5AZEH 1JWMA 3O9WD 3SKOB 1BVKA 4HJGA 3MC0A 2A1WL 5C0BB 3TYGL 5C0CA 2X4QA 4HK0A 3OPZH 4OQTL 1MPAH 4P0DA 2Z31D 4I9WE 1CFNA 5A2LH 3BE1L 3P0VH 4ODXB 5ACLA 3GSNB 4YBLB 5FGBA 2OQJA 1GGCL 4WU5B 1C16B 1FHGA 2GTZB 3DIFA 4E41E 5T33H 1S78C 4U6YB 5JORB 4J3OC 2BRRH 1E4KC 3PUCA 4HGWB 1NL0H 2YZ1A 5H35B 3VGHA 2P5WD 3UTOA 1KCRL 15C8L 5KJRL 3MLTA 5C6PB 1HIML 4ODSL 4LRNL 3GSNL 1JI2A 2HT4C 4OFVA 2JJTC 5EC1B 3WDJA 3U4BL 1OF2B 2HH0L 4ELMA 2GUOA 4Q6YA 5CP7A 1XIWB 5C08A 1CDUA 1XGQA 2E6JA 1Q9LB 5K9QG 3BPNB 4JRWA 3BP5B 1JGUH 4OZFG 5KVFH 3MRHA 1BHGA 1MCHA 4YGVB 1F58H 2Q76B 1F4YL 3KWWB 2WZPD 4G8GE 5IVOA 4XNXH 1IILE 3MUJA 5MERB 5B3JE 1JHKL 2DWEB 2EIDA 4XVTH 4WHYH 3JZ7A 1PBYA 3BPCB 5INCB 4PJ8B 5L9DH 1DUZB 3STBA 1P84K 1HCVA 2DMCA 2X4RA 3AREA 3PXHA 5F89B 2GCYA 43CAB 3H3BC 1NPUA 1WZLA 3VGFA 1XZ0B 5EA0L 5CIPA 2NY6D 3GMNB 5FKAB 1MSPA 3CVHA 3QIBA 4MXQC 3O3BB 1B6UA 5B3JF 2P46B 4MD4A 3G5ZA 3ULUF 4L4VA 4UT7H 2BY0A 3BKML 4JEGB 3P4MB 1QSEE 1XR9A 1RD6A 3S5LA 2H2SC 4UTAH 5IGXH 1DE4A 5H2BA 5DK0A 4KROB 1T1YB 5CGYD 4OCNC 3HCVA 3LQMA 3WIHH 1CFQA 5KOVC 3KLHD 4FQIL 3ES6B 5DJYA 2YPLA 3FFDA 4KJPC 1K4DB 4JKPL 3QUYC 1WFTA 2OLDA 4KHXH 1ZT4B 3S96A 3OJDB 1H3VA 2MMXA 2XN9B 2V6HA 3TEUA 5BCAA 2OTWA 3BWAB 3TCLB 4FQLL 5J89A 1CG9A 1FCCA 1ZLSL 2GSIA 4YO0B 3SDYL 3L3OA 2BVTA 3GI9L 1S7XB 1PVHA 3D48R 2YUVA 3H3PL 1ZLUH 4Z76A 3MLZH 3MUY1 3CFBA 4CU8A 3VW3H 2IQAA 1R3LA 5T3ZD 5I1LB 5HYQB 1I8MA 3JWDL 1QTYT 2HKFL 3OQ3B 5DQ9B 4BUHA 3HE6D 2N7BA 3QQNA 3G5YA 2Y25A 1S8DB 1LEGA 1RV6X 3QUMA 1WT5C 4DFHA 3QFJA 1U3YA 3GRWL 3TWCL 3WHXB 2CK0L 5GJTL 3MMEB 1C5DA 5CJOH 3S98A 2MTPA 4JFFA 5HHNB 1FO0B 4NN7B 5CEZL 2DQTL 4MLIA 3I6GA 5KS9A 3BRFA 4H1LH 4D8PB 2NNAB 3OKLB 3I9GH 4ONOA 4LSUH 3X14B 2OSLB 2SEBA 5GGTH 3TT1L 1MFBL 1QFUH 3VDCA 1I9IH 4DGVL 3FCTB 3STZB 2A2QT 1NGWA 4NKIH 1FO0L 4OGYL 1MLBB 1RZIA 3TVMC 3RFZC 2FJFB 1GZPA 5D9SB 3WO3B 4WI7A 1RIHL 2VDMH 5D72H 4M61A 1OTTC 4UQ3B 3VGEA 1NMAH 3CDCA 3DOSA 1YEKH 5D7JB 2MWCA 2BHZA 3MODH 1A6UL 5I0DA 2VXVL 4LEXL 5DS8A 3RVTC 1EXUB 2IADA 1U8HA 4AIZA 4U1LA 3H42L 1G9ML 4OCRH 4XVJH 4PG9B 4TSCH 3BHBA 3NTCH 1MFEH 2QSCH 1S9WA 2NQCA 2VLJD 3GSRB 3IDJB 2FO1A 4J6RL 2QADC 1WBZB 1ZHNA 3I3DA 5ILTH 1NMCC 1TIUA 3CJJA 4G7VH 3ZHLA 3KPPA 4P46C 3RL2A 1NFIB 1F13A 5IW3A 2BC4A 4N9GA 3UAJD 5FAAA 3BKYL 3VD3A 3PGCB 4WFGE 35C8L 5AAWA 3RWEB 3IU3B 3OKOB 3CFJB 5IB1B 1DQJA 2ADIB 4M02A 4YBHA 2A77H 5CMAB 5DD6A 4M5ZL 1RHHA 2DN7A 1R5IB 4HPOH 4GKOA 2VYRE 3VJ6A 1AQKH 1OT2A 3E3QE 5H94A 2R4RL 1URLA 2DQGH 5EG6C 4Y2DB 1U95B 4LCCB 4MJIE 4PJ5B 4XCCL 5AYUL 3STLA 3G5VB 4APQC 5D7IE 2NLJB 3W82A 3MV7E 4XZUA 2HFFA 4OQTA 1IQDB 1R6VA 4K8RH 3UTTE 1T3FB 1I9JL 4GJTB 3NIFE 1GOGA 5C6TH 2P8PA 4PJAE 4XCEA 1MF2L 5FYLH 4DKFL 3MYJA 4L8SB 5DI8B 3BXNA 2VRAA 4RGMB 5CLWA 4Q2ZB 1Y18B 4EN3D 3JWOH 1JNNH 1F3DH 5D7IF 2VXQH 3SKOA 1HNFA 1B4RA 2JIXA 3JTTB 3MXVL 3PWJB 5AZ2L 1D7FA 3NIFF 4PJIA 5E95B 4DK3A 3GNML 3D3VE 4PJAF 4ZSOA 5FCSH 1OQXA 4ODXA 3HNSH 4JQIL 3GSNA 1TDQA 4WU5A 1C16A 5IVNA 2B4CC 3BD3A 3L3GA 2HFEB 3U6RA 4P23A 4Z7QE 5E2VH 2EXWC 1MY5A 4NQEB 4HGWA 1F3DJ 1CVSC 3NVQA 4U7SA 1MIML 3AM8A 4KGLA 4TVSa 5ICYB 5K59E 4NFBA 3MLYH 3MXWH 5EZLB 3VXUE 5H35A 1LVEA 5D1XC 2ZJSL 3OXSB 5F7FA 2FYYB 4JM2B 3BQUD 3P0YL 2NY2C 5HDQH 4ZFGH 3SQOL 4Z7QF 5DFWH 4HH8A 2YWZA 5EC1A 1NLBL 3BDYL 5K59F 2O5XH 3VXOA 3LB6C 1CGSL 4YPJA 1X9QA 4EIZC 5B8CC 2B1AL 1VGEL 3X3FH 4U6VH 4JRXE 1FVCB 1XIWA 2UWEB 4L3CB 5SWZB 3RVUC 5JNYB 4PJDE 3DYOA 1UGNA 1RSFA 1G7IB 1Q9LA 4F7CB 5BW7A 2ITDB 4FTVA 2VLRE 4LP5A 4Y16B 5FUZL 8FABB 4CMMB 4OGAC 4YGVA 3KWWA 3P3YA 4XHJD 1FVEB 4HUKB 1UJ3C 4W4OC 4MGXA 4OCXH 4JRYE 2Q6WB 3TIDB 5MERA 4Q0XH 3SKJH 2DWEA 4PJDF 4GKZB 3LVEA 3ARFC 3O3AB 5INCA 5FOBB 5EBMB 4RA3A 4JZNB 1XF2A 2VDLL 2X4UB 4RMWA 4R4BB 4OLUL 43CAA 4MA1B 1AI1L 3LOWA 1ZK9A 3PP3H 5IMKB 5FKAA 2J88L 3L95B 4OZIB 3QHTC 3MV11 3EUUA 1T1XB 4UB0L 1NC4B 5CHNB 3ARBC 3S6CA 3OV6A 3ZKXC 5D5ME 1G9EA 4YX2H 4MQTB 3JVGA 2CXKA 4K07A 5EOCH 3TA3D 1LK3H 2DI7A 1PLGH 1LDPH 1QYGH 2DOCA 4PJ9C 4JFHE 1N5YH 3CK0H 1BFSA 5E4EB 3SDDB 4AM0B 4CU7A 3ES6A 2F15A 1RIVL 1K4DA 3FFCE 4P59L 3ZKMD 5BMFL 3M1BB 3MBXL 1CLYH 5C71A 4ZXBC 3LQZB 1ZT4A 5I17B 1KIQB 2NR6C 4JHAH 2XN9A 3LRSA 1X3DA 5EOCJ 1DBJL 4LDLB 3QDMB 3BWAA 3TCLA 3L3IB 1MQ8A 4N0RA 1LEIA 4FXLA 4YO0A 2PYEE 4DZ8B 2P42B 3QDGB 3IAGC 2MSPA 1G1YA 3QIWD 4XP9L 1EHAA 3DECA 1ZLVK 3TF7C 4JGMA 4M6MH 3MJ7B 3GRWA 3MLRL 4XNZB 5JOFB 5ANMB 5A2IH 3HFMH 2PETA 5HYQA 2AJUL 3FOLA 3D18B 3CU1A 1KJ3H 1IBGH 4ODHL 4FABL 5DQ9A 2Y72A 1OVZA 3I2CL 2GTWB 4QGTA 4M8VA 3HRPA 4NKDB 3C5ZD 1U3HD 5GXBB 1I3VA 1FG2B 2IPUG 1VFBB 3UZQA 4OCSH 3RWGA 3MMEA 3WFDL 5EPMB 5IV2B 2IMMA 1SJXA 2RIKA 4LIQL 1FO0A 4RMQA 5I1HH 3BW9B 2JB6A 4ZO7A 4D8PA 2NNAA 1R3KB 3OKLA 1FNAA 5CIPH 3CVHH 1WQVT 1Z2KA 4G80B 4HKXA 4FZEL 5JA9A 3ZHKA 4N90E 3STZA 1DQMH 3P73B 4N8CL 2QQNH 3OB0H 3ROOB 1MY7A 3SBWA 1GGTA 5IVZB 2XQYG 5ICZB 4LGRB 4C58B 1OGAE 3HAEG 4WFHD 4H25B 2Q3ZA 2WBWB 2F54E 4LPWA 2QR0A 3QCTL 5D7JA 1AO7B 1UXWB 5BVPH 1HSBB 1NFKA 1IM9A 4MNQB 4DGYH 1DEEA 1I1YB 3CC5B 4RGNB 1YY9D 2B1HH 5DZNA 3CFEB 3MLWL 3LQAC 3RL1B 1DZBA 2R1YB 3K74B 4A2LA 2I25N 4OV5B 3TO4B 4NJ9H 5EDXA 4PG9A 4ERSH 2E9IA 4OZ4B 4ZUVB 2E7MA 2F8VA 1QFHA 3GSRA 1CFBA 3IDJA 2VKXA 1MCWW 3QNYA 4X6DE 3EYOB 3LY6A 5D1QD 7CGTA 3GIZH 1WBZA 3PQYB 1T5WB 3EDFA 1ITCA 5JR1L 5C0IB 4PJFB 4PJGA 4QF1B 4J4PC 4Z7VF 1NFIA 4QNPE 4KQ4H 2JCCA 1F02I 5IBLD 4XWGL 3PGCA 2XWTB 2A74B 4UU9B 5CCKH 5L2KB 3RWEA 3IU3A 3OKOA 3KR3H 1DN0B 1RJYB 3CFJA 4RAUA 2ADIA 2Q7NA 4KDWA 2IAMB 1BD2E 3N1QC 4X6DF 5CMAA 5LBSL 3SE8L 1A1MA 3V95A 3QUMH 1KB5L 3C6LD 2NYYC 2BVPB 4QNPF 1J1OL 2HMID 3DSFL 2CIKB 1U95A 4LCCA 1P7QA 2LU4A 4PJ5A 1JUFB 4KKLC 3G5VA 4YWGH 3QFDA 1IQDA 5CINH 3IFNL 4MDIB 2BK8A 4OD1H 1YQVH 4HDIB 4L8SA 4DOHB 4Q2ZA 3SE9H 5DK3A 3BWUC 4M6AA 4LASH 3RPIB 2VLKA 1J05B 1GGUA 3KNBB 3MRFA 5GGQL 4ZOEA 1T7YA 3RA7L 1XGYH 3VXPA 2XTJD 1CICB 3PL6D 3L1OH 2VISB 4ZNCD 4PG2C 3RIAK 2CGRH 5KSVB 1A7OL 4M1GL 2HFEA 3R06B 2HFGL 2K1MA 5JW4R 5I76B 1KGCD 3F58L 4NQEA 4Q7DA 3TV3H 2H2SD 5ICYA 3PWPA 4PP2B 3WNOA 4G7YH 2A6KB 2FGWL 5EIIB 1FORH 1EV2E 4WHDA 3OXSA 3N9GH 5CZVL 4MMXC 2FYYA 4JM2A 1MCFA 1IGTB 3QDJB 3MNWB 2DM3A 3NACL 4F9PC 2IPKB 1D5BB 2B8OT 3GM0A 4M7LT 3UP1A 5ISZD 1XH3B 4IRSB 5JUEL 1HHGB 5GRJH 3HR5B 4YBQC 1HKLL 1RURL 3RBSA 3JSSA 1FVCA 2UWEA 4L3CA 5SWZA 3B8SA 5E00A 5GGSB 5BRZD 2VZTA 1FFNB 2DBLL 1MHPL 3K0WA 3OKYA 3BPOC 1G7IA 5TPWH 5BJTB 1ZSDB 4F7CA 3S3JA 4CBPA 2ITDA 4Y16A 3RI5F 4CMMA 1JTOA 1YN7A 4S1SL 4GH7B 1S7UB 2ICEB 3HNVL 2Y07H 3KJ4C 1FNGB 4HUWA 3RGHA 3TZVD 4P2OD 1FVEA 1Q9OB 4P46B 3KLAB 2IGFH 2RFXB 4FP8L 3TIDA 4OD3L 1NBVL 2JB5L 4GKZA 3KPQB 4AYFA 1EVTC 2HT2C 4JZNA 4R4BA 3TYGH 2A1WH 4GFTB 4LSRH 3T4YB 5DFVD 1EAPB 4OQTH 5ITFB 2PTUA 5KSUB 5IMKA 1IGYA 4BQ6A 3L95A 3QNXB 3BE1H 2HLAB 4D3CL 1B6DA 2JKXA 1GGCH 3KPRE 2BVQA 5HD8C 1ETZB 5DJCA 3U4AA 4U1JB 3ZL4L 2AK4E 5C0EB 2YA0A 3IDUA 4OIIL 1CFTB 3RTQB 4HWEL 3CGTA 3DX8B 1OD9A 2G9HB 15C8H 5EU6D 2DB8A 4Y5YB 5KJRH 1A02N 3ZE1E 1HIMH 3SDDA 2EH8H 4AM0A 3GSNH 3SOBL 4F7TA 5HHPA 4O2FB 3M1BA 2H9GB 3U4BH 2CO7B 5GSVB 1KIQA 2DQFA 2HH0H 3P9LA 3U83A 3TVMD 2AEWA 3C60C 3OGCB 2NY1B 5ABDE 4NUJB 4DZ8A 3CMOL 4QCIA 3HG1D 3IDYC 2VLME 1KB9J 3MJ7A 1CFVL 2OCFD 5KSBE 5ANMA 4EI6A 1FE8L 5TQ0L 1LILA 4OUUB 1F4YH 1L9MA 3CZFB 2Y06L 1E4KA 1X5LA 2QHLA 4U33A 2WM0A 1DP0A 3DXAD 2BVEA 2UY6A 5JHDD 3IRPX 3MRKA 5J57B 2GTWA 1JHKH 5DUPL 1JMXA 4M43H 5T1DL 3C5JB 4GUPA 4NKDA 3EHBD 2APVA 1BPVA 5KSBF 5C0GB 1EX0A 3JUYA 4D9LH 5EA0H 2GJ6D 5D4QA 2B4CL 2JJTA 3F6IA 1FBIL 1FG2A 4QRPE 1VFBA 4M7KL 1N64L 4HV8A 2R4SL 2X9WA 4FQCL 5AAMA 5EPMA 3WNNA 4FG6D 5IV2A 3T2PA 2LV4A 3BKMH 2PO6D 3RBGA 1TZHB 4LPUA 5EU4B 5C07D 2WK2A 4FQXC 3BZDA 4M00A 2ENYA 1TPXC 1R3KA 5CBEA 3L5WB 4NBXB 4G80A 5BS0E 4FQIH 5I2IB 2C4XA 1J87A 3TO2B 4JKPH 3I84A 5HI4D 4RWYL 2F53D 3MV8D 3BEVA 3P73A 4UDTB 1UWEL 1ZGLB 1QPPA 5HBBA 5IVZA 4B7IA 1KPVA 4S2SB 1NLDL 4FQLH 5CD3B 1KF9B 4H25A 4NQCA 3DARA 3T0EB 3GI9H 1AO7A 5D8JH 3RNKB 1JHLL 2AJSH 4PRHE 3H3PH 4MNQA 3BKJL 4EDWL 4K8RD 3QWRA 4K2UL 3CC5A 5DO2C 2EDTA 1UXSB 3CFEA 3QUKB 3JWDH 3RL1A 2R1YA 2HKFH 2CPCA 5HJ3A 1D6EA 1T20A 4H88H 4OZ4A 1GIGL 4ZUVA 2EC9U 4FQQB 1KB5A 1QSFD 3PQYA 3W9EA 1T5WA 2EXWD 3GRWH 3QUYA 5C0IA 5HYSB 3SJVB 4QF1A 4PRPD 4JHZA 4XP5L 2MQCA 3PWUB 5GJTH 3IDIB 3CDGB 5D2LE 1KBGH 2C3HA 4C56E 2A74A 4U0RB 4PY7A 4N68A 5L2KA 5FYKU 1G1CA 4EI5B 4Z0BL 1P2CB 2NY2D 5CEZH 2DQTH 2IAMA 2X4OB 2ZG3A 3VXNB 3UCRA 4X6CE 3ARYA 3TBYB 2BVPA 2XWJB 2CIKA 1UKQA 1GXEA 3TT1H 3RVUD 1MFBH 5FKPB 4DGVH 1JUFA 5TDOB 3G6DL 4F58H 1FO0H 4OGYH 1BGXL 4UT9L 1NCNA 4O5LL 1CI5A 1RIHH 4QRRE 4MDIA 4YHOL 1EPFA 1WT5A 4W4NA 2R1WB 5HDBE 1A6UH 4LEXH 1SYSB 2H26B 5GZOC 3SDXB 5CJXA 3GSXB 4X5XA 2YKLL 3RPIA 2N7AA 3K1KC 5KBNC 1RMFH 4FQ2L 1J05A 3H42H 3HLAB 1CICA 4IOFC 2VISA 5HYFA 5IVXA 4OKDA 4QXTB 2MJWA 3DVNB 3W0WE 2X4TA 3SEPA 3R06A 4J6RH 5I76A 2R23B 1CD8A 4O00A 3H9SB 1C5CL 2YA1A 3WJJC 3PDDA 4PP2A 5HHOD 2DLTA 1LO0L 2A6KA 5EIIA 4GG8B 4DUXA 1ZT1B 4G5ZL 1ND0B 35C8H 2W38A 1BLNB 1IGTA 3EDJA 3QDJA 1CLCA 3MNWA 3VXMA 3LDBC 2NY0B 4M5ZH 1D5BA 1XH3A 4ZXBD 1G7LB 3UTSE 1MIEL 1HHGA 1P4LB 3HR5A 4V2CB 3EOAB 4ODVL 1PX3A 1FJ1A 2CUMA 2O5YL 1DDHB 2J8UE 1CDGA 2DQCL 5GGSA 1QBLH 3QEGL 1A14L 2E6PA 4XCCH 5AYUH 4RRPG 3GJFK 3V6OC 5IJKC 4YJZL 3GSQA 2XZCL 3W39B 3AS2A 1EBPA 2X1OA 5E70A 4FQHB 1I9JH 4X4MA 2E9WA 3CCHB 3BKCH 2ICEA 2EC9T 1MF2H 1FNGA 1AGFA 1Q9OA 4P46A 4QHMB 2J8UF 3KLAA 3DPBA 2RFXA 1UFUA 4JZJC 3LQAL 3MRBB 3OKNB 3REWA 1RJCA 5D7SL 4U1IA 4W6WB 4JGUA 3FB6B 3MXVH 3O3DA 3T4YA 5KSUA 1EAPA 3U36B 1PG7L 2XOTA 5AZ2H 3GNMH 3QNXA 1CGUA 25C8H 1MELA 3VCLB 1U92B 3NZHL 4HHAB 2YOCA 4FHBD 2XNAB 4XHQA 3BP7B 3EYFB 3CFDA 3BH9A 4U1JA 1B3JA 2Y9RT 1MIMH 1SBSL 5C0EA 1KNOA 1CFTA 3RTQA 4TVPH 4QO1A 3KVQA 3UJIL 4U3XA 4APQA 3INUH 2G9HA 2ILLA 2ZJSH 4Y5YA 4KI5D 1UM6L 3P0YH 2FH6A 3SQOH 4J2XA 1ZGLM 2H3NB 4L3EA 3NIGE 3F7YB 1NLBH 5GSVA 1CGSH 3FB5B 1R3IL 3BYTA 2IG2L 5DEGB 2B1AH 1VGEH 3QIBD 4QGYA 2P5WE 4KVCL 4XB7A 1V3KA 1EZVY 3BVNA 3H9HB 1DJSA 3NIGF 3HUJF 3BOVA 3QHFL 1LE5B 1Z9SA 1PKQE 4OUUA 2ADFL 2WAHA 3CZFA 1BWMA 3DMMC 5BQ7B 4WWKC 1WBYA 2IBZY 2IPTL 5I8EB 3HI6L 1OP5K 3EYUL 4RFNB 2VDLH 4RBPH 3GSOB 4HKJB 1I1CA 3DETC 5BOPA 2G60L 4OLUH 3WJLC 1I1RA 5CEXB 3R4DA 4KK5D 5IG7B 5C0GA 1AC6A 4K7PL 1PYWB 1CIUA 4I1NB 4CW1B 2J88H 2X70B 4J4PD 1D5MB 3ARUA 3DROB 3ZKSD 5D2NB 4ZPTB 4UB0H 4DQOL 4JZOB 5B8CA 4NRYA 4TSBH 4LKXB 2DQUH 4AMKH 4PJ7E 1VCAA 2DJSA 5KZCB 3IXAB 3SCMC 5JXEC 2D9CA 2PUQT 5LWYL 2DM4A 3VG9C 3PHQB 3L5WA 4Y4HD 3ARSA 4LOUC 3U1SL 4NBYB 2VXTL 1RIVH 4ALAL 5I2IA 1ZHBA 4P59H 5BMFH 1GC1L 1A6TB 3MBXH 4LGPB 2R2BB 4NCC1 4UDTA 1G7JB 3CZJA 3F12B 1ZGLA 1L4IA 3CXHJ 4PJ7F 2XI9A 1A7NL 1DBJH 5DVKA 2G5BB 4S2SA 1UH4A 2J7LA 2GSGB 4LCYB 5I8OL 4PJBA 1Q9WA 3DUUA 3T0EA 3RNKA 4D2NA 4XP9H 1UC6A 4D9QD 3MLRH 4H20L 2AJUH 1UXSA 3QUKA 4ODHH 4NZTH 4FABH 3IB4A 2MOVA 1J8HE 4XP6H 3I2CH 1UCBH 4OT1L 5TE4L 2MHAB 3QI9C 4UIMA 3BAEL 1KIRA 5FA4B 5I18H 5JW3L 1PQZB 1WZ1H 1ZVSA 3SJVA 3BIBX 2P8MA 5T3ZE 3PWUA 4NT6B 1ZTXH 3CDGA 2E7LC 3NFSL 2NY3D 1OQOA 3MLVL 3WFDH 4F7EB 4LIQH 4EI5A 2X4PB 1P2CA 4N5UA 2X4OA 4LVNC 3L3HB 3MNVB 4P99A 3TBYA 1RULL 2OK0L 3SGDI 2CQVA 3C6SB 3EYVB 2AEQL 4OGZA 3WKNA 3DV4A 4FZEH 4ZUSB 2A9NL 3R0NA 4Z95L 2FJHB 4DCQB 1NC2B 4M6NL 5TDOA 4N8CH 3RRQA 1JYNA 4ETQB 3PV6B 3VXTA 3MO1B 1Q94B 4U6HB 4IRJD 3QCTH 2EYTB 3IJSB 2R1WA 2XXCB 5EB9A 2PNDA 3T0AA 2H26A 4RDQF 3SDXA 3GSXA 2HT2D 1A1OB 3MLWH 4Z0XA 3MROA 3ARQA 4X7FC 4JQXA 3DLQR 4BZ1L 2W0KA 4ZMAT 3H6JA 1Z9OA 4IHOB 4QXTA 3DVNA 4DEPC 1F00I 4LVHC 5I6XB 4JHBA 2R23A 5J13B 5KW9L 3H9SA 3WO4B 3Q6GL 3FQNA 3D87B 4XWGH 4GG8A 1ZT1A 3S4SB 1QP1A 2LTQB 3K3QA 1VFAB 2ARJB 2FSEB 1BLNA 3QHZH 4XWOD 3QO1B 1ITBB 5LBSH 3SE8H 1Q9KB 1T7WA 1LEKB 5EWIL 2VLJE 5C0BD 1KB5H 3EOBB 1G7LA 3P30L 5E8PB 1XGUB 4JFDE 4GW5B 1J1OH 1RZJC 1JZ4A 3J7HA 4LQ1A 3DSFH 4X6EB 4NQTA 1VEMA 4OZFA 1HXMB 4XPBL 1IAOA 4X4ZA 3OAZH 5MHSD 1J5OL 2CRMA 4IIQB 4ZAKC 2VSDA 3TCXA 3MRCB 4TQEL 2Z35B 4NKOB 3W39A 3IFNH 4FQHA 3BP6B 1C8PA 4DKAA 3CCHA 1H5BC 2P1YA 3RHWF 4XP1H 1G7PB 2B5IC 2YXMA 1BWWA 1RJZB 4ZDHB 5F7EL 4QHMA 5GGRB 1ROWA 1CDHA 3OKNA 1MEXL 1FLTX 4WEBL 1IC1A 3U36A 2NXZB 4K9EC 4CJ0A 5GGQH 2X05A 3TJEL 3RA7H 1NFDE 3DVFA 4QHNB 5J12B 3TJHC 5I1KL 1U92A 3QNZA 3D39A 2P47B 3W5MA 2NCMA 1A7OH 2XNAA 4M1GH 2X4NB 5FHBL 3OGOE 3BP7A 3EYFA 3F58H 1A1NB 1OTSC 3V7AE 2D3VA 4FQXD 2BNQA 4YHIB 1CK0L 1NFDF 4OAWA 5DMGD 2FGWH 3LEVL 3EJZC 3LRHA 5BV7B 4F8QA 4P2QE 4U2ZA 5CZVH 5JOPE 1GYAA 2J4WL 3DO7A 4X9GA 1AGBB 3NACH 4PJ8D 1ZA3A 2FDBP 1D9KC 4TUKL 5J8OA 3WFCH 3T65B 3F7YA 3K8MA 3QWOA 5JUEH 4U6XB 1U8OB 2A6JA 8CGTA 3NCYS 2H2PD 3FB5A 4XXCC 1RURH 2QEJA 4BZ2L 5DEGA 2HRLA 5BV7L 2DJUA 2WUCL 4YFLF 1FRGH 1MHPH 2H32B 4HUXB 3SDAC 3H9HA 4KRPB 4WDIB 4PG2A 1FFPB 3WIFB 5IW1B 4S1SH 1E4JA 4KROD 3HNVH 2R0KL 4NPYB 4L8BB 2L0DA 4FP8H 5JQ6L 4OD3H 3OAYK 3QUXB 1X5IA 3E1F1 4HWBL 1MJJB 4HKJA 4HIXL 1CBVL 5CEXA 5D93C 5IG7A 2XN9D 4LF3B 4CW1A 2YPKA 1J12A 3I6KB 2Q7YA 2BOBB 3NGBC 1D5MA 3TP4A 4D3CH 4NC1E 1S9KC 2XQYK 4JZOA 4MB5A 1F6FB 5J6HA 3ZL4H 4BA8A 3V5DB 5ID0B 3SKUD 4HWEH 5E5UB 2YD7A 1U8NB 1B4JH 3OZ9H 3PHQA 2FEDC 1VENA 4N0UE 1A6TA 1IFHL 3LD8B 2R2BA 2VDRL 2GKIA 5SV3A 1CXEA 1G7JA 3OR7B 4JKLA 1U8QB 1DQTA 1HINL 3DTXB 4M93B 2G5BA 1FDLL 4LSQL 4XGZA 1TQBB 1T6WA 5JDJA 4PTUA 3CMOH 1ZHLB 3BH8B 2GITB 3VA6A 3QULA 2R69H 3VWKC 5GZOD 4GSDL 3RUGE 2DQJH 1CFVH 3L7EA 1FE8H 2ATKA 5TQ0H 3LPFA 1E6OL 3VD5A 1KLGB 3OHXB 2C5DC 5T1DH 4IOFD 4LDEB 3PIQB 2MHAA 5FV1L 3ZKNC 3OAUL 2YZ8A 3RUGF 3B2UD 1NUGA 2B4CH 4LAQL 4FXGB 5FHAL 1FBIH 4Z18A 4HUVB 4M7KH 1N64H 4NT6A 1WIUA 5C0AB 2GYSA 4FQCH 5FYKL 1DBML 1VADB 4F7EA 4X4YA 2FIKB 2FJGA 4ONGL 4WW1A 4X7CC 4ELKA 1HH9B 2C3VA 1T4KB 1JK8B 3LS4L 3JV0A 3EBAA 4LNRA 1FCGA 2YC1B 3VFOA 4WW2B 1XGPB 3GJEB 3FB8B 4MNHB 5JPNA 1AGDB 1NCCL 1G9NC 1QRNB 5T3XL 5FCUH 3EYVA 1YMMB 1H9VA 5F7WC 4YH6A 4ZUSA 3DMMB 3G5XA 2KDGA 4RWYH 5E6IB 2FJHA 3GDBA 5HI3D 3WYRA 1QSVA 4Y1AA 4KI1A 1UWEH 3FAXA 2Z8VC 3W11D 3EO1B 1LK2B 2ENSA 2AAVA 5GRWA 3O45B 3DGGA 5I9QB 4U6HA 1N0XH 2EYTA 1JHLH 3IS0X 5KSAC 2L7JA 3ISWA 4UV4L 4R0LB 4JG0L 3P77B 2CLZB 4JDVA 2H6PB 4EDWH 5BZWB 4K2UH 5FK9B 1T1WB 1A1OA 4IS6A 3LHPL 3EO0B 3AB0C 4Y2DD 3U0TB 5I8CB 1H15B 5IOPA 1UT9A 4WTZG 4IHOA 4WFHE 4PJ5D 2BMKB 3FB7A 5DD5L 5EO0B 4KK6D 1AH1A 1DQQB 3MOAL 3IAQA 1NAMA 1F4HA 4XP5H 5IFAL 4LCIL 4PRNB 2UUDK 2EZ0C 3DUHA 3FAWA 1LD9A 2O26U 3V9FA 2HTKC 1T04B 3VXQB 1VFAA 1J0IA 1FVDB 3RZCC 2HG5B 3RQ3A 4TTDD 4YDJB 2FBOJ 4POYA 3FTGB 1UM5L 5E99L 4X7SL 1XGUA 1YN6B 3ARZA 2VDOL 1X5GA 4O2EB 1PAMA 1QZ1A 1BAFL 1HXMA 4YDKL 2DAVA 1NGYB 3G6DH 1A5FL 2HAZA 4IIQA 1BGXH 3MZTA 2ICCA 3FRPG 1X4YA 5DMKB 2Z35A 1Q38A 4O5LH 3BP6A 4YC2C 5CP3A 4Z9KB 3LN5B 1G7PA 3TGXA 3ILPB 1RVFL 5EU7E 4ZDHA 2ID5A 5GGRA 5GS3A 1W8NA 1QG3A 1MNUL 2F58L 4MNGE 2X89A 2YSSA 4V1DB 2YKLH 4WV1B 3DETD 2BNRA 4FQ2H 5DJAB 3C8KB 5IROC 4U7MA 5A1AA 3GB7A 1QFWL 1C12B 4KKAD 1X5XA 5JLZB 3S37X 1T80A 1NCDL 2X5PA 2NX5D 3MCKA 3IETB 4OZHE 2ESVE 1N59B 5GZND 1UEMA 4KRNA 2X4NA 3KS0H 1C5CH 4KTDL 4LSDA 2VTFA 1A1NA 2W9EH 1WISA 3LKRB 3WL9B 1LO0H 2DDQH 3Q5YA 5TQ2L 4G5ZH 4JREC 1A9EB 1XCQB 5EIQA 4OZHF 4QHKI 2XTJE 1KJ2B 1ZS8B 3NCJL 4M7JH 2WIIB 3T65A 3KS0J 5I1GL 1MIEH 2AJYL 3VFWA 1KGCE 1KPUB 1QFWI 1TFHA 3O8XD 4OF8A 3LPWA 4X9BA 4FMKA 4ODVH 4S1QL 2O5YH 2XTLA 5L8LB 1JMZA 2DQCH 1NC4D 4YAQB 1JYVA 3WFHB 1A14H 1FQ9C 4HWBA 5HPOA 1YNKL 4MQXD 5J11B 2H32A 1KJ2L 1A8JH 4HUXA 1T1ZB 3T8XA 2I60L 4WDIA 3ARPA 4JFOB 2XZCH 3RGVC 4DEPB 3WIFA 1DBKL 5ISZE 4NZDA 1NGXB 4Z7UE 4OFKA 4NPYA 3E3QC 1CE1L 4MAUL 3ARGC 3WJJA 1CT8B 4OZFH 3LQAH 5F1NB 1EO8H 1BIIB 2BSRB 1MJJA 3QJFB 3WKMH 5D7SH 1DVFB 4QOKA 2V5RA 1KELL 1PG7H 4Y4FB 3QDMD 3I6KA 4F37F 2BOBA 3NZHH 4PJHB 1JWUA 2XKSA 4Z7OF 1FZOA 3QDGD 3BRGC 4HFUL 4O58L 2UZIL 5DURB 3CSPA 2FHCA 4ZO8A 1DANU 1SBSH 4NZJA 4WEUD 3HUJB 3V5DA 3LH2L 1SQ2N 1S7VB 1U8NA 4Y4KC 5DYOB 1FAIL 3F65A 4P5TD 1H3WM 4NNXB 1HZHL 3RVWD 4KJWC 3QXWA 3V4PL 1VACA 1QR1B 3EW3B 5J6GB 3DX7B 4LMQE 1MAJA 5IBTL 1RZJL 3HAEA 4MWFB 4P48A 4KZDL 3PNWB 3OR7A 1U8QA 5MEND 4JJ5A 3Q5TA 3DTXA 3WNLA 1R3IH 1FC2D 2IG2H 5JIHA 5EC2A 1IEAB 4MJ6B 3KPMB 4JPVL 2KZ1B 5EU6E 6FABL 4XPHL 3BH8A 5CBAB 4WI5A 2GITA 5K9JL 1YMHB 3QHFH 2D7TH 1J0ZA 2ADFH 2EDNA 4P4RB 2IPTH 3OHXA 5DHVB 3HI6H 4RWHA 1E4WL 3PIQA 7FABL 3EYUH 4KKNA 4XVUD 4IBLT 4CNIA 2G60H 4K7PH 3HG1E 1G7MB 2C4FU 2DL9A 4FXGA 4HUVA 3V52L 2E5EA 5D7KE 3VFGL 5C0AA 2R8SL 3RIAF 3MRNB 1GGIL 4DQOH 1VADA 1AO7D 1H8OA 3DXAE 4MZ3A 5JHDE 3GHEL 4O9HL 2FIKA 4ZS6D 2EO9A 1JK8A 3QWRD 2GT9A 3ILQD 4UOJA 4WW2A 2I24N 4MNHA 1AGDA 1ZT7B 5LWYH 2GJ6E 3TO4D 1HN1A 2DLFL 5DUMH 1YMMA 2VXTH 3SO3C 3DMMA 5F1SA 1GC1H 1K6QL 5E6IA 4WWKA 4HK3N 4ZAKD 3EO1A 1LK2A 5KN5B 3FO0L 1A7NH 1CQKA 1X5AA 5C07E 3O45A 2ZCLL 2WANA 4HMCA 4LVOC 5I8OH 4JKKA 2D7NA 4QY8B 3QQ4B 3LN9A 4G6ML 1MHEB 1TTUA 2X9XA 2CLZA 3OX8B 3P77A 5IJVB 2H6PA 2R9HD 3BZ4B 1NCBL 4H20H 2F53E 2W9LA 3MV8E 5BZWA 3QEUA 3ZLQC 1UQSA 1TQCC 1T1WA 1ORSA 3QXVA 2VIRB 4UZGA 5IBUB 1GOFA 1QBBA 3EO0A 1JRHI 5CD5D 5JXEA 4OT1H 1DANT 2R2EB 5I8CA 4XMKL 5TE4H 5EO0A 4LRIC 3BAEH 3RY6C 1DQQA 1YPZA 5F1IB 2CRYA 2Z91A 5JW3H 5L88L 3SGEH 2ZUTA 2IH1A 4ZYKB 3MRDB 4PV8B 4Q97A 4PRNA 1T03L 3NFSH 3MLVH 1D5ZB 5FYLE 4E5XB 2P5EB 1T04A 4BK5A 1FVDA 1IGCL 2HG5A 1FFOB 5IFHL 2AEPH 3FTGA 3WIIL 4NFCA 3PGFL 1RULH 5GS0C 1QSFE 1JZ7A 3W9DA 1YN6A 2OK0H 3PE9A 4JO4L 4KVNL 5I16B 1OL0A 2AEQH 3QAZC 3VH8B 5B38G 4ZFZB 2A9NH 4Z95H 1NGYA 3GSVA 3NMEA 4M6NH 1J1PL 3P4OB 4XNMB 2VZ3A 4DK6A 1VGKB 4XMPL 3NH7H 5DMKA 5H37G 1MVFA 3LN5A 3N1FC 1EAJA 1YY8A 2C1PB 4JJHA 4KRLB 4LLWB 3ILPA 2Z92B 1T2XA 3ARDD 2C4FT 4LK4A 4LLMB 4GS7B 1SJHB 2QKIB 4V1DA 3QDHA 4IRSD 4LSTL 1A6AB 3Q6FA 5DJAA 3C8KA 4HLZG 1C12A 5JLZA 4DJMA 1KLUA 2ARWA 2OP4L 4WHTB 1N59A 3G6JB 4I5BB 3VD4A 3QIUC 1UADC 2PXYD 3BMWA 5KW9H 3NCYP 3EYSL 3D6GA 4OM0L 3Q6GH 3MJGX 3LKRA 3L5XH 3WL9A 3DYMA 1A9EA 1XCQA 1OT1A 5E5MB 1KJ2A 1ZS8A 4ZNEA 5TE6L 4TULH 5CWSA 3RWDB 2H1PL 3LN4B 2ZOLB 4O4YL 4WGWB 5EWIH 5L6YL 3V6ZB 1I8KB 3O4LB 5FEBA 4WRLA 3P30H 4OFYD 2Y4SA 1NAMH 4XXDB 4AIXA 5HHOE 2P7TB 3QRGL 2K9UA 2A6DA 4XPBH 4L4TD 1DLHB 4YAQA 1AXSB 4Z7NE 1GGBL 1IKNC 4JFOA 4OTXL 4TQEH 3SY0B 4POZD 2OX5A 3HPJB 5ACZB 1NGXA 5MI0B 3TC9A 3E6FB 1KCKA 5F7EH 5SX4I 1CT8A 3QH3A 4I0KA 2ZCHH 4M5YL 3VFUB 5F1NA 1BIIA 4FMFA 2BSRA 4WEBH 1RIUL 5TH2B 1LE9B 4O51B 3TJEH 4GO6B 3NN8B 4Y4FA 1V5JA 4MXVE 5CP3H 5DVLA 5I1KH 1EHLL 4PJHA 1DBAL 2V9RA 2EIZB 2EDQA 4HQQL 1E28B 3AS1A 5FHBH 3O6MH 3ULUD 3HMXL 3BISA 2E9JA 1MCPL 3OKMA 3U7YL 3KXFD 4RCAA 3VMPA 1PZUB 1CK0H 4Q9QL 1S7VA 1HH6B 2RGSA 4MXVF 4ELME 4TN9A 4YHKL 5ERWA 2J4WH 2FO4B 3NCFB 1QR1A 2G2RB 4NJAL 4Y19A 5C08E 5J6GA 3ZSTA 3DX7A 4GXVL 4TUKH 1MCEA 1JPSL 5LJYH 4C55A 2ZUSA 5M7QA 1QSED 2RR3A 4BFGA 3FO9B 4ELMF 4BZ2H 1IEAA 4MJ6A 3KPMA 4I18C 2VH5L 5CBAA 3CPLB 4ZPVB 1I3UA 4KI5E 3Q3GB 1ZKAA 1YMHA 3TIEB 1IGFL 3G08A 2R0KH 1HKFA 4BSJA 4MAYC 4P4RA 2PKDA 4NQDB 5JQ6H 1KXVC 4PJEB 5GISL 5C2BL 4HKZB 5FDYA 4X5WB 3R8BB 4HWBH 5L8JB 3NFPB 2H32H 4HIXH 4YFLI 3QXTA 4K94C 1MJ8L 1D9KA 3VFPB 3RVXD 2CMRL 4Q9BA 2EZ0D 3MRNA 4XXCA 2HTKD 4NO0B 1X4XA 1RI8A 1HNGA 3JUZA 3TN0B 3RZCD 3DUSB 4I13B 3H9ZA 4R97C 1U8KB 2WP3O 4UI2A 3F62A 3RAJL 3ALPA 1XR8B 4F9LC 1KV3A 4YFDB 2MNUA 4CAGA 3S35L 2DLGA 1P69B 1ZT7A 3IKCB 5IW6B 5DEFB 1TCRA 5K9OA 1EBAA 4GT7A 2EIBA 2NZ9D 4YDLB 1IFHH 1WCBA 2CIIB 3VMOA 2VDRH 1E27B 1INDL 1MLCB 2EDBA 4WTWA 2NY4C 4AG4H 5B4MD 4XI5C 1HINH 3SJVD 2ICWB 4Z77B 4LSQH 4AEHH 4ORZC 4KZEL 3QQ4A 4RDQG 1MHEA 4KV5E 3FT2B 4PYHA 5IJVA 1QFOA 4GSDH 4J3VA 1OCWL 3BZ4A 2KPNA 3D2UB 3PDOB 3HAEH 4EDXB 1U2CA 1ZLWK 3GMPA 4JB9L 1E6OH 1VHPA 3QFJE 2VIRA 4LSPL 2FGZA 2WV3A 3VRIB 1A47A 4AY0A 5C7XL 4K71B 4KV5F 3O2VL 1YEGH 4OF6A 5F1IA 3TH3T 1CU4L 4CJ1A 4D9QE 4JY4B 1I3RA 2BNUB 5BOZG 5IHUL 4LAQH 5FHAH 4ZYKA 3MRDA 4PV8A 3TPUB 3DVIA 4HWUA 2ZG2A 4E5XA 5FYKH 4MA7L 1DBMH 4OLWL 4WO4B 1MFAH 4KPHL 4BSVB 4YPGB 4ONGH 3GM8A 5E4IA 2R0WL 1FFOA 3LS4H 1UEYA 4YIQA 4OGXL 1HILA 5DTFA 5FUCE 3NCCB 1PG7X 1NCCH 1NUNB 3VWKA 4ZFFA 4RRPA 2X44D 3ZTJG 4NO5B 3M8OL 1I1AB 3JWNC 5DC0A 4ZFZA 4TYUA 3P4OA 4XNMA 3QQ3B 3H9SD 3CX2A 4ZUWA 3RGVD 4FFWC 2CKBB 1G6RB 4HGKC 2C1PA 1JZ3A 4LLWA 1RK1A 2Z92A 1HQ4A 3D0LA 3B9KB 5F7DB 4G8GA 4LEOA 4LLMA 1SJHA 5DT1L 2NY0D 1FC1A 2PW1A 3IJHB 4FZ8L 3UBXB 5B39G 3TNNB 3HR6A 4H0GA 3U79A 1U8PB 2XA8L 3CFKB 3LHPH 3UTTD 3VGGA 2AS5M 3GZKA 3GK8L 2V5TA 3PGDB 1G6RL 4WHTA 5KVEL 4GRLB 3JTSB 3G6JA 4I5BA 4PJCB 1DSFL 3WFEL 5DD5H 2ORBL 1OP3H 4R9HA 3H7BB 3MOAH 3KYOB 3ZT6A 4LAJH 5E94B 3O0RL 4QYOB 4ETYA 5M95B 5IFAH 2B7DT 4P4KC 5AWNL 3D3VD 4P57A 2CUIA 1TTGA 5E5MA 4WFFD 3SDCC 5JHLL 4ZFOA 1A2YB 2FL5B 1XAUA 3RWDA 3LN4A 4KKCC 3V6ZA 3IDXL 5KSAA 1S5IL 1UM5H 3O4LA 4R4ND 5F6HJ 1VERA 2VDOH 4BK4A 4RZCA 4XXDA 2XKNB 4X8XA 3VA2C 1BAFH 4YDKH 2DICA 5GRVK 5F9WB 4BQBA 1AXSA 1A5FH 3NA9H 3EYQC 1RUKL 3UBXI 4WUUB 4QRUB 4MHHI 3SY0A 5C0BE 3G9VA 5FGCB 5ACZA 3QPQC 3S36X 4X99B 1RVFH 3UTQB 1MNUH 2F58H 3VFUA 1TJGH 2GI7A 3HMXA 2FRGP 1BFOB 1QHPA 5GSRB 5F71A 1YNTB 5TH2A 2XZAL 5LQBL 4O51A 4LCWB 3NN8A 4WI9A 1QO3B 1NCDH 4PJIF 3S8WA 1II4E 1RUML 1E28A 4JRYD 2EDWA 5EZJB 5HI5D 2VKWA 3MJ9L 3TFKD 1FYTB 4KTDH 1KULA 1CR9L 1PZ5B 2ZSVB 1RZ8B 3ULSA 1HH6A 1B2WL 5TQ2H 3QG6B 5KVFL 4WJ5A 4YR6B 3DJ9A 4AJ0A 1TJHL 2G2RA 5FGRA 1BIHA 1T83C 3MYZA 3ZHDA 4NUGL 3UDWC 1ED3B 5HVGB 1MWAL 2FZ3B 5I1GH 2AJYH 1KN4H 4DAGL 3FO9A 3REVA 5BVJB 4KXZH 4S1QH 5IROA 2OTUB 2Z4QB 2MKWA 3U0PA 1YNKH 3CPLA 4ZPVA 1KJ2H 1BOGB 4OB5L 5LGJB 2I60H 3FFCD 3Q3GA 4Z78B 5DK2A 3T3PE 5KZCD 1UKSA 5L0QC 2WBJC 1CE1H 3H0TA 4MAUH 3F7QA 5LKNA 4PJEA 1WUNT 4S1DD 5AG8A 1KTDB 4YHNA 2PYED 1XGTB 1XF5B 2UYLB 2EYSB 4I3SL 3WIHL 2HRPL 4I2XB 4C83A 4X9HA 1V3LA 3T3PF 4X9IA 3VFPA 4J3UA 4JKWA 4GBXC 5JOEA 4R4FL 3O4OB 1FH5L 1D5XB 1CGXA 4NO0A 4O58H 4B0MM 2YRZA 1NCWL 2UZIH 3L6FB 3HZKB 5DA4A 4KTYA 1W0VA 1U8KA 3E6HA 1XR8A 5CSZB 1T0MA 1P9MC 3IKCA 2XN9E 5IW6A 4G6FB 1HZHH 3V4PH 1BX2B 2YUWA 1IQWL 4NNYA 3ARWA 1V3MA 1NBYB 4X80L 5IBTH 4G9DB 1RZJH 1E27A 3HE7B 5TDNA 2M1KA 3UPRB 4KZDH 1BMGA 3O9WC 3UJTL 1HXYB 2ICWA 5E9DB 5D7IA 3AMLA 4Z77A 2IANB 3T1WA 3DRTB 4JVWA 2PF6A 2AV1B 2Z31C 4JPVH 6FABH 2MQ0A 4XPHH 2VABB 5GIRB 3IFLL 4PJAA 3PDOA 3D2UA 3R8QA 4EDXA 4NZRH 5IESL 5IB5A 1AQDB 2QL1A 3VRIA 3MBED 5EOTB 1H3UA 4IJ3B 4K9EH 4YEEA 2O93L 1E4WH 4Y4KA 1EDQA 3CFIC 7FABH 1NC2D 3P9MB 2FX8L 3N1PC 3QIUD 3P9WB 4Q74A 1F4WL 4JY4A 4LMQI 2BNUA 1I9IL 1JCKA 3TPUA 5KANG 5D6CB 5I74B 1A6PA 1CD9B 5SWSB 3VFGH 3RJDA 3VWJB 5IMMB 2R8SH 1EIBA 1GGIH 3EJYD 3RI5K 3G9AB 4P2RB 3VXUA 4CVZB 5D72L 3GHEH 4O9HH 4YPGA 4MHHG 3VD9A 4MXWH 4FS0A 4HIJB 3CH8A 3OF6D 4TNWK 2ADJB 1FZJB 5HY9B 3ABZA 2DLFH 4NO5A 1I1AA 4PBXA 1U58B 1YJDC 2P4AB 3HZMA 1VKXB 1K6QH 1GZQB 1TVDA 4JG1L 3C2AH 4JRXA 1BD2D 3QQ3A 3FO0H 5JW5A 2YD8A 1VA9A 32C2B 4PJDA 2IQ9H 5AD0A 2ZCLH 4ODUB 5I75C 3ARVA 5ILTL 1G6RA 1F3JB 4G7VL 5KTEL 2NY6C 5HDOA 3IF1B 2RB8A 3B9KA 4WI2A 3X13B 4G6MH 5F7DA 4L8DA 1NCBH 1J88A 4UMGA 3ULVL 3TNNA 1LO4L 1FIEA 4Y2OA 5L2JB 2ITCB 4NBZB 1CL7H 3L3KB 4U2YA 4XMKH 5CGYC 3JTSA 4PJCA 1GAFL 5C09B 1W72B 3G04B 3T0BA 3MQIA 3H7BA 4PRIB 3KYOA 1HOCB 5E94A 4QYOA 1QLRA 5D5MA 4J3SA 2AVGA 4PJGF 1A6WL 2ZOKA 3BGFB 1EUUA 1IGCH 4PB0H 4P49A 2X89D 1A2YA 5IFHH 1W72L 3MNZB 4PJ5E 3WIIH 3L9RB 3PGFH 3QXDA 2NXZD 3JWOL 1WIOA 4JO4H 4KVNH 2ZUQB 3UPCA 2EC8A 5DVMA 4O02L 1ZE3C 5EBLB 4AH2B 3MFGB 1X5JA 2K3TA 1C5BL 3HE6C 4WHYG 1KCSL 1J1PH 4HKBB 4XMPH 1A7RL 1MCQA 5DR5L 3FOMB 3MRIA 4WUUA 4QRUA 1TVHB 3NFNB 5F8QC 5E24E 4OF3A 1L7TL 4X99A 3UTQA 4EQ3A 3I75B 1EFXB 2QV2A 2Y36L 2A83B 2RJMA 5GRYA 3G6AB 3MJ9A 3WN5C 4BM7A 5KAQG 3FONB 3GHBL 3UROR 1BFOA 4LSTH 5GSRA 5HDQL 1YNTA 3HTLX 3MJ8A 2A6IB 4LCWA 4NQEE 1A6VL 1RUQL 1QO3A 4M03A 2OP4H 4JANB 3GUTB 4MS8D 5GS2H 1NGQL 2GW5A 3F6LA 1FG9C 4S1RL 1MWAA 4KMQA 1E4XL 4KRPD 1FYTA 3EYSH 3D85A 3DURA 1QNZH 1PZ5A 4OM0H 5C92A 1IJ9A 3LKPB 1RZ8A 1BFTA 4ZUUB 4QHUB 1MHCA 3QG6A 1ZHKB 4YR6A 4ODTL 5TE6H 2NX5E 3QUXD 2UWEE 4JM2F 2H1PH 1K85A 5L6YH 1FL6A 4Q0XL 3WHE1 1QUNA 2PR4H 5DJ8A 2AK4D 5C2UB 1JWMB 4LQFL 3TLRA 1RUAL 3OKKB 5BVJA 4OF0A 1BVKB 4HJGB 1XCTB 4YHYB 1I7RB 1WBXB 5C0CB 3QRGH 1HHHA 5DC4B 2Z4QA 4HIEB 1CFNB 4K3EL 2I9LB 5CJBA 2UWEF 3B5TA 1BOGA 3ZSSA 1GGBH 5LGJA 2OQJB 4OTXH 3PV7A 1TLKA 3DIFB 3T1FA 1P7KB 4OZIE 4M5YH 1PLGL 3UAJC 4R90L 3N85L 1KTDA 5L8KB 1NEZG 1XF5A 2UYLA 3MLTB 1PGRB 4LCUB 4F8TA 1N7ML 1SVCP 4XC1L 2BP3A 5F6IB 1EHLH 2OR8A 5HHMB 3V0WL 1DBAH 3V2AR 4OZIF 1D5XA 2CKNA 3EO9H 1JVKA 5C70A 1VEPA 1P4IL 3HMXH 3HZKA 3DYPA 3U7YH 3L5HA 2IBGA 5CSZA 3EZ8A 4RISL 4Q9QH 4B7LA 2AEIT 3EFDL 4YHKH 4HBCL 3MRHB 2FB4L 3LEYL 3HFML 3QDME 1J86A 4NJAH 4Z8FL 3HA0A 2EE9A 4GXVH 3QDGE 1JPSH 1GPOL 3UPRA 4YK4B 4AEEA 2DTML 5T3XD 1HXYA 3LKSB 3AREB 2X4RB 5E9DA 1XEDA 5I30H 2IANA 5FO9A 2AV1A 1T7XA 2VH5H 2VABA 5GIRA 4QXWA 1RJLB 1L9NA 4HUUB 5ALBL 2VERN 1IGFH 4WTZA 4Z6AT 1QRND 4P9MH 5GRUL 1AQDA 5I1HL 5MENE 3S5LB 4UILH 5HHQB 5GISH 3U46A 4GQPH 5C2BH 3VXSB 4XNUL 2YD3A 2CDEB 2XFXA 3HCVB 5E6ID 3UJJL 3P9MA 2F8XC 4MA3A 4G9FB 1U3ZA 2WIMA 1TETL 3S96B 5D6CA 4BH8B 5SWSA 2JK5A 2YWYA 4P2RA 4CVZA 3D69A 2DM7A 1CG9B 3E0GA 1WV7T 5T5NG 4I18A 5GPRA 1P6FA 2EDHA 4HIJA 3ZE2E 1EJOL 2ADJA 3S35H 1XF3B 1FZJA 3CFBB 5HY9A 1X6NA 3EOTL 3FRPA 3PP4L 4DWHA 4XHJC 4NC1C 1U58A 1I8MB 5GS1B 1VKXA 4FQ1H 1GZQA 4MAYA 4XBGA 2NY5C 1TITA 4P3DA 2Y5TB 1AO7E 4NJ9L 5D96B 1CXIA 4MNQE 3ZE2F 3FN3A 4RGNE 2IC2A 1DBBL 4EOWL 1S3KL 2C3XA 2I9TA 3IF1A 4KZEH 5EOQL 3X13A 4GBXB 4U1GC 5TF1L 5IHBA 1C5DB 1OCWH 5CCKL 4B50A 4JFFB 1UZ6E 1BF2A 3MRLA 4JB9H 3C9NB 3PQYE 1MQKL 3K81A 5KS9B 2ITCA 3TA3C 4PJFE 3RP1A 2Z8RA 2PTTA 3RDTB 5C7XH 3ZTNL 1W72A 5L2KE 3G04A 2W0PA 1UZ6F 3KPRA 4PRIA 5IHUH 3ZKMC 2Q8BH 2BZDA 4PJFF 3WUWB 4YWGL 5E08L 3O9WB 3U48A 1GZPB 3KYNB 4KPHH 4M61B 1ZV5A 4QHLA 3V7MA 2QQKL 2O61A 1FL5B 2C26A 4OGXH 2JJSA 4V1DD 1L7IL 3MNZA 3QIWC 3L9RA 5GRXG 3RU8H 1DTUA 4QRQB 5DC9B 4OF5A 4UAOC 1BQHG 1RZKC 2IADB 4LLQB 1PX4A 4LASL 3M8OH 5GGVL 4AIZB 2R2CA 1W0WA 4DOHE 3KYMA 1XGYL 3U9PL 1T5XB 3L1OL 4O2CA 1JFQL 2H41A 5A40E 4D0DB 1IVLA 1S9WB 2YRPA 2WUBL 3E2HC 4JO3L 3C5ZC 3NFNA 2BSTB 1U3HC 4RX4D 3P2TA 1AR1D 1N3NA 3I75A 1EFXA 3EDEA 2A83A 4U0QB 4CMHC 5T5FH 3G6AA 1FORL 4Q6IB 2JE8A 5DT1H 3FONA 1I9EA 1R3JB 5I1AB 4RA0C 4PRDB 2AV7B 4R96B 1IT9L 2FWOA 2XA8H 2A6IA 2DKMA 5DLMH 3GK8H 1G6RH 5KVEH 2J1KA 4JANA 5H94B 3WFEH 3GUTA 1DSFH 1SJEA 2ORBH 4HT1L 3WXWL 5IVXF 3QXUA 4EUPB 1LP9B 3QDJE 3R1GL 5JA8B 4FNLL 4H8WC 3WUZA 2EIEA 4HXBL 4ZUUA 1MCKA 4KKBD 3VD7A 1RY7B 1ZHKA 3MA7A 1UB5B 2P8PB 2E9BA 5BS0A 2EH7L 3QCVL 2IGFL 1DVFD 3IDXH 1S5IH 1U8IA 3UC0L 1HYRC 4Y4FD 3OKKA 2FBJL 3KYKL 1YY9C 4I3RH 1XCTA 2JIXB 1I7RA 1WBXA 4LSRL 4PR5A 4HIEA 4PJIB 3FRUB 2I9LA 4LP4A 1JN6A 4ZSOB 2AK1L 1RUKH 5GGRY 3KPSB 3L3GB 4H26A 4JO2L 4J1UA 5D1QC 4P23B 3U6RB 4PRHA 3VGAB 12E8L 2QLVB 3WHE0 3CVIL 1P7KA 1HQRA 1BQUA 4P4KA 5IBLC 5D71H 1K8IA 5DMYA 4L4TE 1O7VA 2EH8L 4LCUA 5EUOB 2V5MA 4R7NB 2XZAH 3B2VL 4EZMA 5LQBH 1WWWX 4EXKA 1MHHB 2HJLA 3A6CL 3C6LC 2DMKA 3VXOB 4N0CD 5EU7C 4ENED 1RUMH 3QXAA 2HMIC 4EEEA 2ZNWA 5D2LA 4OM1L 3MJ9H 3BZEB 4MD5B 1CR9H 4QEGA 3IDNA 3S9DB 3FHQA 3X3GL 3BP4B 1B2WH 4ODWA 4FTVB 4X6CA 4HIHB 1TJHH 2LAGB 3TH2T 3D1MC 4G42B 1I7ZB 1IAMA 5F7NC 4NUGH 4N0FB 1T0PB 5JIKA 1MWAH 3WS6A 4Y89A 4M43L 4HPYL 4DAGH 3ULUE 3OR6B 1KYOJ 1R0AH 1XF2B 3LKSA 1TZGL 4MLSA 1SY6L 1IM3B 3KXFE 1GOHA 2V5YA 4D9LL 4CRPA 5DHYB 3B6SB 1EEUA 2XTJC 3PL6C 4OB5H 1EEYB 3SGJA 1RJLA 4HUUA 1WAAA 2F5BL 5C3TA 1NBQA 4IOSD 1CGTA 2R2HA 1EK3A 5C0RL 5HHQA 5F21B 1I85C 3BD5A 3VXSA 5D7LB 1OP9A 2CDEA 5B21A 4I3SH 3RJQB 2HRPH 4PS4L 3AUVA 4TUOA 4G9FA 2D7MA 2ZUXA 1T83A 3UDWA 4M1CD 1J0KA 5MEQB 4BFIB 4BH8A 2J5LB 4R4FH 2FR4B 3LRSB 5KOMC 1F45A 1FH5H 5MEOA 1J8HD 1QEWB 3WLBA 2BHYA 5F9OL 1NCWH 3RHWK 2YD5A 2DS4A 1LEIB 5HVHC 5D6DC 5D8JL 5F88B 5IM7B 5IR1B 2AJSL 1XF3A 1Z9MA 1EMTL 4DW2L 3UTSA 1IQWH 3FOLB 5GS1A 3TZVC 4P2OC 4NQVA 4X80H 1IGMH 3T0EE 4H88L 2Y5TA 1U9KA 3WNPA 3UJTH 1UH2A 4U1HA