5C2BL

Anti-cxcl13 parental scfv - 3b4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
b'SALTQPASVSASPGQSITISCTGTSSDVGAYDWVSWYQQHPGKAPKLLIFDVNNRPSGVSHRFSGSKSGNTASLTISGLQAEDEADYYCSSYTRRDTYVFGTGTKVTVLGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords scFv 3B4 heavy chain
publication title Optimization of a scFv-based biotherapeutic by CDR side-chain clash repair
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2015-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c2bL00
1S5HB 3GHEL 4NIKB 4PV9A 3IU4L 3V5DB 4DKEH 4QRQA 5B22A 4UT7L 1YC8A 3BVNA 3FFDA 3HLAB 4JO4H 5T1DH 3GSNH 4K7PL 2A83A 3FB7B 4QRPB 3BQUC 2A2QT 2SEBA 4QRTA 5F71A 4XNYL 4N0FA 1G7IA 4XPAH 3OKEA 4TPRL 2EE2A 3KPNA 4FQ2L 3U0TA 5JIPA 3S5LB 5ESVB 3WFBH 2X70A 4ZUTA 5T5NG 4K2UL 5EZIH 3DVFA 4R97B 4OJFH 5GISL 4CU8A 5GGSB 2BHYA 4HW6A 4YDIH 3TVMB 1QHPA 2QLVB 3TJHD 3L3GA 3ZE2E 1GL4B 2NY2D 5A2KH 3NOIA 2EH8H 1OAXH 4TSBH 1MSPA 2NXYD 43CAB 4JPKL 2O5YL 1UZ8A 4M48L 1PY4A 2WBJA 1ZLVH 1YMMA 1KLGA 2Q8BL 3VGFA 1QYGH 4M6OL 3AFLA 4LHUD 2O61A 5DMYA 4F7EA 1FSKC 5KSUB 3LRGA 4QXUL 1J8KA 2MPAH 35C8H 3WHE0 3ET9F 1SQ2N 3SE4A 3VFOB 1OAUH 4JZNB 4LSVL 3PXHA 4FMKA 4MD4B 1EZVX 2V7HB 1HHJA 5JUEL 2JF1A 4KJYB 3RTQB 5C09B 3HNVH 3K46A 3OHXB 4H26A 1ZE3C 4P9HL 3PWPB 1MIMH 4JFXB 4X8JA 5CILH 2YC1B 5I15H 4JFPA 3MLSL 3SDCB 5HHQB 3R1GL 1F3DH 3TV3L 2FEDC 3KS0J 3SDDA 1QEWA 3L6FA 4NWTL 3VXSD 4JM2D 3TO4D 1T2QH 4QRRB 1KLFA 1DBJH 3NGBC 5GGRY 3G08B 3A6BH 4BUGA 4V2CB 2PTUA 3LQAH 4FQLH 5DQJA 4AY0A 1U8OA 3IFPB 4P46C 4HUXB 3MREB 4LSUL 4M8QB 1RZIB 1F4WH 4NM4H 4KTYA 3DV6A 4QO1A 2FSEA 4GW1B 5BW7A 3QI9D 3F5WB 1R6VA 2FR4A 4Y16D 2AJYL 5L9DL 1U0QA 5T3XL 1EJOH 4J7RA 1R3LB 2DQCH 1J11A 3SGDI 5C0EA 1RMFH 3W11C 3UPRB 4NWUL 3S34H 25C8L 1UT9A 2IAMB 3V6ZB 2EH7L 3ROLB 1ADQL 2DLEA 2BZDA 3H7BB 2QHLA 5C0GB 4CMMA 4YDJB 3BRGC 3IDYC 4JDVA 4MJIB 1KCLA 4GRWF 2D7TL 5IK3A 2DLGA 3NCMA 5IW6A 1NMBH 2ARJA 1C12B 5HGGS 5DRXA 1J9CT 1KNOA 2ZOLA 2AXGB 5IEKB 3MSPA 5GGUA 4GKZA 2D31A 2CXGA 5C0BA 1J10A 4NQTA 4I0PD 5IFJA 3BJ91 3MODL 1X5JA 4POUB 5HHOB 1A14L 4G8GD 1BAFL 2C1PA 2P24B 2VR4A 4NGHL 2CH8A 3C5SB 4K7FB 2EC8A 3LRSB 3SKOA 3O8XD 2P43B 1EA9C 3BZFA 3H9SD 4FP8L 1Q38A 5SWZB 5TH2B 5AZ2L 4DW2H 43C9A 1ZANL 3V0VA 2GIYA 2XKNA 4XPTH 2GJ6D 3UO1L 5J06A 1G9ML 1RJLB 4JJ5A 3EOBA 2JIXA 3BO8A 3TPUB 5F3HB 5C6PB 2E6QA 3CXHJ 3P9LB 4PJEF 4NQDE 4ZAKB 1IEHA 5FK9A 2G9HB 3TA3B 2VSCA 3QIWC 2XKSA 1NGXA 4NQCD 4PJ8A 4NQDA 4I9WE 5L2KD 5I66A 1A6UL 2VLJD 1I4FB 4ALAL 3ARFD 1IFHL 1NPUA 3RX5A 2HMID 5BS0A 1CD0A 3IF1B 1UB5A 1VCAA 3DX6A 4OCXL 4X6CE 1CFTA 5D7LA 3P40A 2BSTA 1N3NA 1MIEL 1YDPB 1OAZL 4X6CA 3ECBB 3P11H 5EU3B 5IW3A 5TE4L 4G6JL 4M3JA 5HGDB 4AJ0A 1V05A 5JW4M 2PYFB 5EA0H 2D7OA 3AB0C 4M5YH 1K8IB 2D0GA 1QBLL 3MACL 1T7ZA 5IVZB 4ACPA 5IR1A 4L8DA 1QHOA 2DBJA 3O2WL 4I48B 4WU5B 4JANB 4QT5A 2XT1B 4LLWA 1T2JA 4EN3B 3VFGL 4HD9A 1F4HA 1C5BH 2W59A 1SHMA 4P23C 4V2BA 3S96A 5HVGB 3BW9B 2XTJE 3VGAC 1FFOB 2ZCLL 4LF3B 4PR5A 2X1QA 2EDLA 1ZHLA 5I76A 4K8RH 2V9RA 4YPGB 3I3BA 1U8LB 3W39A 5CBAA 4ONFH 5BV7C 3AS3A 4YX2L 5D1QA 2AK4A 1OGTA 4IS6B 5CD3A 5FHAH 4ZUVB 3QUKA 1GGYA 2PYED 1FZKA 1O7VA 4LEOA 1I85C 4ZUWB 3WIFA 4H0GA 5M94B 1IAIH 1IC7L 5T5FH 2YBRA 4K94H 4E5XA 3MFFB 4XMLL 4A6YL 3KYNA 4PB9H 4PJIB 4XHQA 1F4AA 3RWHA 3IJHB 1NC4D 3M1BA 4HIHA 3HFMH 4NN7C 5D6CA 3TN0D 3L3HB 2Z92B 1N6QL 4KROD 1ACZA 2OQJA 3BIBX 3BGFC 3GSUB 2D4FA 4CKVX 5INDA 3DTXA 3D87B 2ZUQB 3NACH 4YJZL 4UT9H 1UJ3B 5DFTA 4ENED 2VOTA 5IG7B 1ZHKB 1AC0A 4NHUB 2XZCH 3N85H 5HHPA 4UI2A 5D72H 3NFSH 4MHHG 5JPMB 1XCTA 2FYYA 5CCKH 4G6FB 4R8WH 4Z7NE 4MA8L 4WHYH 2M8XA 2FGWL 1S9WB 1LP9E 4TTDC 1OARL 2QEJA 2YUZA 1RZJL 4WWKC 1PQZB 3O4OC 1LP9A 2FB4L 3DUHA 4Y4HA 1I8IB 4GKNB 1FGVH 3S36L 3WSQH 3WNMA 4MX7B 1T1WB 2APVA 5DHVB 3VXUB 4A2MA 5ETUA 2ZCKH 1A3RL 4R4FL 4K71C 3BMWA 5DC0A 1QSEB 5AYUL 4YXHH 2VH5H 4R0LA 1QNZH 4G8IB 1WV7T 1NAMB 1J12A 2X4SA 4Y5YB 3PHOA 2OTPA 3OB0K 3I9GL 5C0RH 3GSNB 4GS7C 2DI8A 1EUUA 4EI6A 1IZJA 2EDBA 4HZLB 2PO6D 4DKFL 4GG6A 3DX8B 1JPFA 1ITBB 3BN9D 3MR9B 5C08A 4QY8B 1BQHG 1U9KA 1DUYA 2R56L 4NRZA 3I3DA 1DEEB 2IEPA 4WW1B 1ZLUH 2VUOA 3MBED 2GAZA 3PGDA 5E08L 5EORH 2FH8A 3JVGC 5MEQA 2X4RB 3BP7A 4M7JH 4BJLA 4N0UA 1KB5L 1YQVL 4RGOH 2FGZA 3MOAH 1IEAA 2C26A 4X9BA 2F19H 3RIFK 4JFZL 1QSFE 4O02H 2P7TA 2O5XH 3T0EC 1E6JL 2NY7L 3H0TB 3ARBD 2J8HA 3BXNA 3ZYZA 4MXVE 4PJGB 2UY7A 4CNIB 3TWCL 2QQQA 3DUUA 1WJ3A 3MA9L 1CICC 1QFPA 1WCBA 5EBGA 1ZVSA 3KJ6L 1JPTH 4GMTH 5J12C 4MDJA 3MLRL 3VWJB 4ODHL 3MRBA 4GAGH 3VFPB 4ETQB 4MB5A 1OTSC 3VWKA 3FO9B 1CWVA 1KOAA 1AQKH 3ZYOA 4OLWL 3AU1A 5C9JA 4JB9H 4OCYL 2R2EB 1JZ4A 3S97C 1S7SB 3ZT5A 4OI7A 1CFQB 1YUHB 3OKKB 1GOHA 1LO2L 5EZOL 4JPIB 3MJ8A 4YQXL 3C8DA 1L0XA 1BJ1J 4EUPG 1YPZE 1W0WB 3ABZA 5IFAH 4LPXA 1VEOA 3OQ3B 1RZJC 1HHGB 3QDGE 1TJIH 5EU7E 3T0DA 4NUJA 4WY7L 1X7QB 5B8CB 3SPVB 4N9GB 5KOMC 2X4QA 4O2EB 5CMAA 3DO3A 1Q94B 3I85A 2W60A 1NMAH 3PUCA 4MNQE 2NY0D 3DVNB 2BCKA 3RWCB 2EICA 5I0ZA 4CDHA 4MNQA 2VJXA 5BXFB 5E94B 4EI5D 5DDHB 1FAKT 1NDGB 2EDQA 3RUGA 5D96C 2CJUH 5JXAH 1R5VB 3DI3B 1TPXB 4XP1L 1EAJA 4KTDH 4P2CG 3EFFA 4NQVA 5FGCE 1YN7B 1FE8L 1NGPL 5DFVC 2I60H 5GSRA 3JWDH 4WUUB 3B83A 1CG9A 1CLYH 1UADC 4F33A 2BDNH 3MLTB 4M7ZB 1CFNB 2HFEB 4PJHE 3FT2A 4YGVA 2J8UF 4RGND 2VLRB 3EYUH 2A77L 2G5BA 2WWKO 3I6GA 3KPQA 3LDBB 4FQJH 3G5XB 1IGIL 4AEFA 4LMQE 5KVMC 1JF6A 4M7KL 3QFJE 5I73B 5F7UA 5ALBL 5FF6A 4HUUA 3WNPA 1VFAA 5J3HD 1AO7B 2YPKB 4HK3J 4PJ9A 4N8VG 2ATPA 3OKYA 5ESQB 1BX2A 3TFKC 1EHLL 2DIJA 5K59E 1BJMA 2FIRT 4HLZG 5KJRL 1RIVL 4NQXB 1S9VA 2ZCHL 3U2SA 1U3HB 3JSSA 1ZHBB 1IKNC 5DD3L 3GUTA 1IC1A 2BHUA 5C0AE 5DD1H 5JIHA 4ODVH 3BIKA 3QO0A 1MRCL 3HMWH 2UZYB 2EE3A 5IB4A 4Z76B 4Y5VA 3NABL 4QRUB 1KIPA 1PGRB 3HKFA 1I1AA 4GAJH 4MXWL 5DTFB 4MGXA 5LGJA 5DRWB 4HV8A 3REVB 3AREC 2OJEB 5FYJE 3UYOD 3TZVB 2XA8L 1G7MB 5BQ7A 4YXKL 2NY1B 1J1OL 2BY2A 1RZFH 2YD7A 3Q3GB 3MXWH 3TO2B 3T2PA 1J0IA 1A0QL 3DX9A 5EOQH 1DFBH 2EDKA 3U6RA 4Z18A 3FQRA 1L7IH 2BOCB 4NCC1 3B2UD 5D7JD 3EJYD 2Y6SC 4MVBD 4IRSB 4E42B 4TUJA 1AGDB 3P73B 1CDJA 5D2NE 2KZWA 5J6HA 2FX7H 5IEHA 3IDMA 4BH8B 5IQ7L 4MNGA 2JB5H 3CIQA 5IMKA 2I9LA 3EGSB 4EDWH 4MAYB 4HEME 4ZFGL 5E00B 2B0SL 4G6MH 2DDQH 3SKMA 4HKXB 1KT2B 4RMUA 4U3CA 1DBBH 3HCVA 5IVXA 3QEQD 1NBZA 3D0LA 4WO4D 1HKFA 3OJ2C 1REIA 4BSVB 5HYSA 3O3EB 3V7AE 4HFUH 4X0KB 3MRCA 3DMMC 2NLJB 2W07A 3QDJE 4OUUB 2VXSL 3BKJL 4X5WB 2KH2B 1GGCH 1MJJB 5EC1A 5IWLA 3V6BR 1TJHH 3WNLA 4M43L 2DMCA 4QXWA 1ETZA 5F7MC 4XNZB 5D1XA 3GMRB 4Y19B 5C2BH 3BPOB 4QOKE 4RDQF 2YSSB 4S2SB 1UH3A 4AIZB 4HLZH 4UBDD 1U8JA 3NH7L 4KAQL 4XXCA 3RIAK 1EV2E 1SM3H 3VRLE 4JVPA 5IW1A 4LEXL 3ZLQC 3CFDB 5IOPB 3WLBA 1EMTL 3MRKA 1BJ1H 1A7RH 2XRAH 3MRQB 5I1AA 3OR7A 5C0IA 4P5MB 2OL3L 1JL8A 3ULSA 3X3GH 4NN5B 4AENB 5MI0C 5BZWB 1Z9LA 4OZIB 1AFVH 3EYOB 4TSCH 1DBML 2LQRA 3O9WD 1OSZB 1AY1H 2HKFL 4XMKH 4NT6B 5GPRA 3MLUL 4AQOA 2HKHH 4ZNEA 3SDXE 3RQ3A 1A22B 4HPYH 4X5LA 1B0GB 1DL7H 2QQLH 4UINH 1KFAL 2I24N 4H20H 4NC0B 4TNWF 5EBLA 3RX8A 5E2JA 4L8BA 2P8PB 4L4TE 1BFVH 3CX5K 3QEGL 5J1AA 3CFEA 4KMTL 4JN1H 1GAFL 4XP9H 1IM9A 5T1KB 1AXSB 3MQIA 4MJ6B 4L5FH 2I5YH 3RBSA 5EU6D 3IXTB 1DP0A 4RISL 3EZJB 4YEFA 1EEYB 3J8F7 3RWJA 4ODSH 1HILA 4U0QB 5TQ0L 4N0YL 4JFEE 4YO0A 1HHIB 1HDMB 3FN9A 1A1MA 3MRRA 3T65A 5EZLB 4NC2B 3IFOA 3GSWA 3MV9B 3G6DL 1QZ1A 3WO4C 3U0PA 4OZHF 3BPLB 5HGAB 1WFUA 1HHKB 4Z8FH 4F37K 5EBWA 1YECL 4I18C 1ED3B 5A16A 2GT9B 4WFFD 1R0AL 2AJXL 1KYOK 2UZXB 3ARPA 4RMSA 2PTVA 3ZTNL 4ORGB 2EIZA 3QWOA 1J5OH 3O45A 2V7NA 4XI5D 2GI7A 4BQ9A 3HE7C 3OAYK 3BKYH 2ICWJ 4YHNA 4HK3N 3BVNB 1YYLL 2R69L 1UWGH 4Z7OF 4U1LA 4PJCF 5JOPD 2DJUA 4FN0A 5M7QA 4Z7QF 4Z6AT 5IVOA 1T1YA 2CR3A 1L9MA 3OAUL 4KKBC 4N0FB 1A6WH 4P5KA 1P5VA 3OKEB 1F3RB 1OGAA 3KPNB 1ZS8B 3U0TB 1HI6A 2X70B 4G42B 3TBYA 2AXHA 4N0RA 1MEXH 3M45A 4ZUTB 2ARJQ 2LV4A 1CBVH 3V4PH 1QFHA 4P2OA 4OZGF 1PZUB 3C60C 4LCWA 1HNGA 4LNRB 5JOFA 3PL6C 1G9NH 1GHFL 1RULH 3K8KA 1J1PL 3L3GB 4WW2F 3WS6A 4RFEB 4G6AD 4W4NA 4ZS7H 3P0GB 1YMMB 1KLGB 3U46A 2H1PL 3HI6L 4F7EB 4GXUM 4P3CL 4C56D 4BZ2L 4O00A 3PGFL 1EAPA 3JBG7 1CVRA 1RVFL 4TQEH 5CSZA 3O3AA 3V52L 3MLZL 5ADPL 3RHWF 5J4MA 1YEEL 2UWEE 1Q1JL 5JQ6H 4H26B 4NNPL 1E28B 1OP9A 1PAMA 3MNZA 5L8JB 4X8JB 2H2PC 3D3VE 1Q9WA 3GMQA 4LCUA 3T1FB 4OLXH 4DK3A 1QSZA 4JFDD 2PF6A 1KPUA 4JM4H 5FA4B 4OF7A 5DT1H 5DMIH 3V4UH 2WM0A 2FD6H 3T2NH 4I3RL 2B5IC 1U92A 1SBSL 3OKDA 2E5EA 3ILPA 3L9RB 4HBCH 4XPFH 5DQJB 1U8OB 1KLUA 2AV7A 3PHQA 4DFIA 2VDKH 1R3JA 4XH2A 1MCOL 5FYKE 3CFBA 3I6LE 3DV6B 2EYTB 2FSEB 4L4JA 2OMBA 3I02A 1QG3A 2FR4B 1PG7H 4LHUA 2V2TA 3VFUA 1LEIA 4XVUD 4PRBA 4Z7UA 1OAKL 1SJHB 2F54D 3NZHH 5F9OH 5ILTH 4WWID 2EEAA 1S9YA 3PWNA 5DURB 1FLTX 3ARXA 4EOWH 1BFOA 5C0EB 2KQNA 1MFCH 2BXYA 5HI3C 1JE6A 4XCCL 3PP3K 5KBNC 5F89A 4OUOA 4UU9A 1TDQA 2IGFH 3RY5A 4CMMB 5F93C 1T6WA 4JDVB 4KZEL 2N7AA 3SKJH 4R90H 3GBNH 3U7AA 3FONA 5ITBH 5IW6B 1HINH 3VXSA 1VHPA 4JM2A 3TO4A 1SJEA 4PRNA 1KNOB 5I6XC 1JPGA 1I1FA 2ZOLB 3KVQA 5GGUB 1B4JL 2D31B 2BSED 1GYAA 3W0WE 3QULA 1RJYB 4M7LH 1R3KB 4QNPF 3WD5L 1NFIA 4XTRD 3M8OH 4U1KA 1L4IA 5I71B 3S3PA 3L1OL 5DK0A 2C1PB 4HT1L 2FLBT 4FQXC 4R7NB 3QUXB 3SKOB 1RFDH 1RSFA 1BQLH 1FC2D 2A9ML 3I6KB 4XAKD 4Y16A 43C9B 3V0VB 4S11A 4FQ1L 3ZT6A 1QFWM 2UUDH 4QTHA 3TBVA 2VLKD 4JJ5B 1CI5A 3EOBB 3MC0A 2F8OA 5FCUL 1A3LH 4HKBA 4YHOL 5HD8C 3TH2T 3MRPB 4IJ3B 4OIBA 1T03H 2BNRE 4TRPL 2CGRH 3C5ZC 1MCQA 4CMHB 1NGXB 4HX1A 4NQDB 4LSTL 4HZAA 4OSUH 3MZGB 2EEBA 2YKLL 5KSBE 4YHPA 1ZT4A 2QSQA 2VXVH 5AG8A 2HT4C 3QQ9C 5JO5B 1KJ2A 4XWGH 3PWVB 2R9HC 5E2WH 5EOCJ 2E9WA 5GGVL 1RZ8A 3Q1SL 5BO1L 2Y5TA 2OP4H 2XZAL 1MHEA 5HPOA 1CFTB 1FVCA 3K1DA 3RWGA 1N3NB 4G8GE 4OAWA 4I0PA 1X5IA 5IB3A 4OFDA 4X6CB 4WNQB 2MCG1 2X7LA 3D25A 4G8GA 1CIDA 3ARGD 3O2DL 1NBVH 5C1MB 4X99A 1D6VH 2FHFA 1NBYA 3MV7D 1ZLWK 3E8UL 4N5EC 3L3JA 5FV1L 3O8XA 2FNBA 4XNQA 2BVPB 3H9SA 4G3YL 1YY9C 2GJ6E 4GXVH 1WT5C 3BAEL 1TITA 5K9JH 1Q9LB 5I1HH 2GJ6A 1JF1A 5JW3L 1J1XL 2HA1A 4L8DB 5F7LB 2V5SA 1NUGA 4PJDA 3BRFA 4NQCE 5DO2D 2DLFH 4PG9B 3CK0H 4QT5B 2HTLD 3MROA 4LLWB 1ZV5A 1WSST 2G75A 3GO1H 5GZOD 4G8EB 3TGXA 1XZ0A 5L2KA 1JGLH 2VLJA 3RDTC 3S96B 2QKIA 5E2VL 4XBEL 2VZ1A 3ARFA 1HNFA 5I76B 5TE6L 3W39B 5CBAB 5ISZE 4P2QD 4DGVH 1A6ZA 1OGTB 4JQIL 2IC2A 2OR9L 3WJLC 4YBQC 1EFQA 3QUKB 3SQOL 1A6AB 4RA0C 1I8MA 3NIFF 2KUTA 2HJLB 3SGKC 4MZ3A 1FZKB 2W9DL 1QBAA 3RZCC 4J3WA 2G5RA 3H8NA 3CSBA 3UTTE 2DTSA 1IGYB 1YEGL 4L4VD 1JBJA 1WFTA 2NY4B 2RBLA 3KYNB 1ZTXH 1RHHA 2BK8A 2GFBA 1D5ZA 3M1BB 4ZFZA 1ULVA 5D6CB 4DFHA 4KJWC 4NN6B 4YHLL 3RRQA 3HUJA 1RIHH 2OQJB 4WFHD 3CU7A 4KDWA 3ES6A 5INDB 1FN4A 3DTXB 4Z95L 2DTML 4KDTA 4PJAE 3K2UH 5SX4H 4LFHG 1A5FL 2W0KA 1V3LA 2YPVL 1DQLH 4HUNB 1Q9OB 1XCTB 5E4IA 3CVHA 3UBXI 3ZO0A 1WAAA 3HG1D 1U8MA 3AY4C 1LP9B 3GBML 4S1RH 4XRCA 4IOIA 4LHQB 1BMGA 1VFBB 3VG0L 2O93L 5EUOF 2PYEA 1J0KA 4RWHA 1IMHC 1MRFL 5CZXD 1D9KC 2VDLH 5B3JF 1EO7A 3VRIB 2C5DC 4APQC 1J0ZA 2JE8A 7FABH 1MFAH 2X4SB 1G0XA 1BZ7B 3PHOB 3JTTA 1ORSA 1KEML 4NFCA 1NC4A 4EI6B 3X14A 2WP3O 3KPLA 3CMOH 3D1MC 5IHUH 5I1LA 4GRMA 1C1EH 4AL8H 5C08B 5CUSH 5GRWA 4GMSL 3IETA 1LGVA 2LVEA 4RAUA 5GS3A 1PJ9A 4KXZI 3C9NB 3FQNA 1KTDA 4J3XA 4DKAA 5DYOA 4YXLL 2HFTA 4CBPA 3RI5F 1I1CA 5FGBC 5CD5C 4NPYA 3NIDE 2GAZB 3PGDB 3S88L 1CD1B 4HXAL 1KXVC 5HVFB 4N1EA 5MEQB 3MOBH 3BP7B 3SDYH 1XGTA 1FG9C 5DD5L 4KKLD 1IEAB 4TUOA 2DYPD 3N9GH 5EOCH 5F6IB 3UTSD 1A6VL 3KXFE 5TGBA 2FO4A 4FG6C 4KRPB 4H25A 1QSFB 1KN4H 1UKQA 2NY6C 3BXNB 2V17H 4Z7WF 1I7TA 1FYTE 3PJSA 3DUUB 3VFMA 4WU7B 4LARL 5BVJB 1ZVSB 4HQQL 4NQEE 2JCCF 3EIFA 4MDJB 2V5TA 3ZMRA 1VEMA 4R96A 5TE7L 2ED9A 2PO6A 1MRDL 1BLNB 2DD8L 4XNXL 1F97A 3OMZA 3BPNB 5C9JB 3EYQD 3CFJA 3DGGA 5B4MD 4PB0H 3WUWA 1GZQA 3AAZA 3LEYL 2BSRA 2OI9B 1NGQH 4R97C 1WCQA 2HT3D 3SE8H 3TVMC 3MJ8B 3ULUL 4FQIL 5KSAC 3B9AA 1B6DA 2J6EL 2P44B 1NANI 4M6ML 1EEZB 5C71A 3G5ZA 1IQDA 4QWWD 4NUJB 4Y4KD 3L3DA 1YPZB 5DI8A 3RVTC 3ARDD 1A6PA 2X4QB 1RUML 3QDGB 1TETL 3LKNA 4N5UA 5CMAB 3SQBA 3ZKXB 4NJ9H 5IB1A 4JQXC 3V8CA 1NC2B 3ARBA 2BCKB 2R29H 2W0LA 2DAVA 3NN8A 4J3TA 4G7VL 1CFSA 5DMKB 2XFXA 4MNQB 3RTQC 4OQ1A 3X17A 3OPZH 4OLUH 5I8KH 1NCDH 3LVEA 5F1NB 4CN4A 5LGKA 3VDBA 1OW0A 1CL7L 2F58H 3QUZB 3MO1A 3RUGB 3TC9A 2B1AL 5LQBH 3IFLL 3SDCC 2V9TA 1D5IH 3KPOA 5CWSA 3RY4A 3K2MC 1TNMA 4JRXD 1VDGA 2E6PA 3VI4E 5I19H 3EFFB 1EHXA 2JB6A 4NQVB 4NKMA 3IDJB 1OCWH 1XF4B 1AKJD 3T0BA 5D8JH 5D1ZB 5FGCB 4YNYA 4F33B 2C1OB 3WJJC 2ADJB 4ZOAA 3FT2B 1FL3B 4YGVB 2W1NA 5TDOA 1WTLA 2HYMA 1Z0MA 3I6GB 4UNVA 3KPQB 4DUWA 4RZCB 1LK3L 1CE1H 4PJHB 1T0PB 4XWOC 1A9BA 1YYML 3CGTA 4OFVA 4L3AA 2R23B 4PV8A 3OXRA 4ZPTA 4LLYB 5FF6B 3TT1H 3QFJB 5CZKA 3T0EA 1WWBX 1VFAB 5GRZA 2CKNA 3ZHLA 4PJ9B 2ZUXA 4XC1L 3CMGA 3V8OA 1S9VB 1XF1A 1K6QL 5MERA 1HHHA 3IAQA 4A6YA 3GUTB 4JR9L 1X5AA 2ZNXA 3KR3L 5CHNB 5AEAA 4WGVB 4EI5A 1GRWA 3BIKB 3QO0B 5FOBA 2P8MB 3OJDA 2VABA 4OIIL 1N26A 2IAMC 2DKSA 2N1KA 5EWIH 1HOCA 5F7YC 4AG4L 1IM3A 1I1AB 3QHZH 1DQMH 5LGJB 2R0WL 3QZWA 4S10A 5H94A 1VB9A 3LEVL 4DCQB 3VDAA 5CEXB 3LV3B 1N0XL 2OJZL 1N64H 1GGIH 3P2TA 2EIEA 3VE0B 3P4LA 5BQ7B 1WICA 1MCEA 3LS5H 2A6KA 1T5XB 4KY1L 1MCHA 1X4YA 2RCSL 2MJWA 2YK1L 3CLEH 4FZ8H 2VKXA 4X6BB 3DX9B 1KJ2H 3FQRB 3NTCH 4LPTA 3GKZA 4KPHL 3EYSL 4TUJB 3C08L 4YFEA 3OTTA 2XZQH 2J4WL 1G6RB 5J6HB 3I2CH 4PJFF 5C7XH 4K9EH 3BKMH 3ZE1F 1CFVH 5HDLA 5IMKB 3F12B 4LRIA 1KPRA 1K2DA 4ZAKC 2FZ3A 2I27N 4KJQC 3TA3C 4A2LA 2D7MA 4UT6L 1I3RA 4ZUUA 5E8EA 3T4AA 4JFQA 3MBXH 1B6UA 4HGWA 3H9ZA 5EO9A 1NBZB 4PJEA 3D0LB 1U91B 1QO3B 5HYSB 3I3EA 4YHMH 3RNQB 4XCNA 1A7QH 4U6TA 3GI9H 4DAGL 3GHEH 5D6DC 4GKOA 3IU4H 5EC1B 1QKZL 5C07E 3QDJB 4UT7H 4G80A 3ULUD 4PFEA 4K7PH 5HHOD 1PKQA 5D1XB 4DN3L 3MLXL 5MP6L 4JJHA 2VZVA 4XNYH 1U8JB 3HE6B 4TPRH 1P4BL 2NYYD 5IW1B 4P2RA 3SGDH 3WLBB 5D7JA 3MRKB 1NAML 3W9EB 4K2UH 3BE1L 1CS6A 4TSAL 5GISH 3VFSA 3RL1A 4FZEL 5FYLL 3S9DB 2Z8VC 4LOUC 1FFRA 3IS0X 4JPKH 2O5YH 3EZ8A 3G5VA 5DHXB 4M48H 2Q8BH 4M6OH 5F44A 4QXUH 1FO0B 1CCZA 5IROA 3SDXB 4ODWA 2R4SL 1RI8A 3QEQA 4LSVH 4GUPA 4WO4A 1HIML 2FECL 1RK0A 4DOHE 1H8OA 3N1MC 5JUEH 1IGFL 2VQTA 4JFOB 2I25N 3AS2A 3WNOA 4P9HH 1WWCA 5EH1A 1JZ7A 4NDMA 3MLSH 5HHMD 2AV1A 3R1GH 3RWJB 5I1IL 5L8LB 1HILB 3TV3H 4POZD 4MQSB 4YO0B 5DRZA 5DEFB 4NWTH 5F1OB 4JFEB 2H8PA 2C9AA 1IQWL 4Z9KB 1A1MB 3MRRB 3QH3A 3T65B 3SGEI 5KG9A 3GSWB 2ADGA 3S35L 3WUWG 3U0PB 3E3QE 3CC5A 4LSUH 5EULV 4X7CC 4OCMC 3J7HA 4WI8A 2BFVH 3O9WA 4EN3D 3LHPL 2ZUQC 2EIZB 3QWOB 5IM7B 2AJYH 3O45B 4H0HB 1UJ3C 2V7NB 5L9DH 4YHNB 3ARYA 5T3XH 1JFQL 3DMMA 5FDYA 3RU8L 2OM5A 2KZ1B 4KUZL 5ESAA 4TVPL 4C58B 1T1YB 3ZSSA 4X4MA 4YPJA 3WYRA 4P5KB 2QTEA 4B0MM 3U7YL 1OGAB 4NWUH 5EU6A 25C8H 1P6FA 2EH7H 1ADQH 1I7RA 3Q5YA 2EDOA 3QHTC 4KK6D 5DJ8A 1P9MC 5I2IB 4P2OB 2D7TH 5I8CB 4KVNL 4LCWB 1YEFL 5CJ5A 1BM3L 1OLZA 1OOAA 1ZSDA 5ANME 4RMVA 3KPPA 3VMPA 4Y5YC 2Y06L 2K9UA 3U46B 3QPQD 4PGDA 3MODH 4OGXL 5DR5L 5ICZB 2OX5A 1A14H 3L7FA 1BAFH 4HBQA 4GOSA 4NGHH 4UV4L 3IAPA 5IGXL 2XACC 5FFLA 2XPGB 1RZKL 2PXYD 2RQ8A 5CSZB 3O3AB 4TNWK 4ZPVB 4FP8H 3QYCA 4UUJA 5AZ2H 1CE6B 1ZANH 4RRPG 1N4XL 3LOWA 2C4XA 1JHLL 3UO1H 2UWEB 2AXJA 1G9MH 1IGJA 2Z8WC 1Q9WB 3O81A 4LCUB 1JP5A 4LCCA 3RY6C 3QUYC 2H41A 4P3DB 1RUAL 2EDXA 1KPUB 2PCPB 3CAFA 4PRHA 3BD4A 3U30B 1P7HL 2ICEA 5ITFA 1NJ9A 1AC6A 5JXEC 3C87A 2ITCA 1T89C 1OP5K 4HULB 1A6UH 3QDME 3VXUD 5J13B 1YC7A 3ILPB 3SCMD 1CDHA 4EQ2A 2IFFL 1T5WA 1KLUB 2AV7B 3PHQB 4ALAH 1ZXQA 2X09A 1R3JB 5DEZA 1CZ8L 3CFBB 3QZWG 1ZT1B 3C8KA 1I75A 2NXYB 5I9QB 4OCXH 1H15A 5F88A 2X4NB 3EUUA 4F9PC 5GHWL 1MIEH 3K1KC 4PUBL 4GRLB 4U6HB 1OAZH 3WFDL 4LHUB 3KLAA 1LEIB 2W65B 1IEBA 3AXLB 1UCTA 4G6JH 4PRBB 2H6PB 5TE4H 4C56A 1FNEA 3O11A 3UAJD 5DS8B 4N1HB 2HTKC 1S9YB 3FO2B 3HE7A 1QBLH 1D5XA 2XIDA 4OZ4A 3PWNB 3MACH 1CT8B 4JRYD 1JUFB 2JJVA 5SX5K 3LQAC 5IUSA 1G7QB 1CU4L 1T20A 3A6CL 3K74B 4UU9B 4WHTA 4QHNA 3O2WH 4JFDA 1UQSA 4JAMA 2A38A 1IC4L 4K3JL 4M00A 4IRZL 1UFUA 3VXSB 4JM2B 3TO4B 5B8CC 4NQSA 4PRNB 1JPGB 3VFGH 1I1FB 3QEUA 3ZE2F 5CEZL 3OKMA 2DMBA 3C60A 1MCFA 2NY3C 3DLQR 4ISVA 2ZCLH 4U1KB 1A3QA 3TYFA 1AXTL 2Y07L 1JNHB 3VWJD 2NTSP 2OL3A 4HWZA 2IALB 3QI9B 4PLKC 1YJDL 3RHWK 4Y16B 4B7LA 4I3SL 5I1KL 5BRZE 2F54A 2WUCL 5TPWL 4QTHB 1IC7H 3TBVB 4JO2L 2B4CL 3HAEA 8FABB 3UJTL 4HKBB 3RJQB 2Q20A 2ZSVA 2BC4B 3SJVA 4XMLH 4A6YH 4OM0L 1A1NA 1I7ZB 4AK1A 4M7ZC 4TVPD 1ZMYA 1I8LC 3Q0HA 1N0LA 2A6JA 4GJTB 2VC2L 1U8NA 1NUFA 4YHPB 1N6QH 3I75A 2J88L 2E9JA 2J8UE 1KJ2B 1H3GA 5I73C 3LB6D 1XF5B 5KSBB 4RBPK 4Y5XA 1T3FB 1LDPL 2J8UA 4KU1A 1U3ZA 1RZ8B 1PD6A 2HT2C 1K4CA 4U4BA 1MHEB 2CK0L 1FVCB 3NCEB 4HWUA 1T7XA 5T33L 1W8OA 3RWGB 4GRWH 4MA8H 4OAWB 4I0PB 2YMXL 2AJ3B 2FGWH 4HS8L 5IB3B 1OARH 2YD9A 1RZJH 1URLA 3DYOA 2X7LB 4G8GB 5CKAA 2MMXA 2FB4H 2BSSA 5A3IC 2XWJB 1NBYB 4KK9D 4XAKE 3VJ6A 4BFIA 2XV6B 3L3JB 3O8XB 3BGMA 4GAYA 4LLUA 3S36H 3EO9L 3QNXA 2IADA 2AK1L 2LE9A 3P0YL 1A3RH 2GJ6B 3OG4B 1JF1B 4R4FH 4RFNC 1TCRA 2VLKA 5AYUH 3QR2A 4PJDB 1A7PL 4YHYC 2B8OT 3JWOL 3WEXB 2VLRD 1TVBA 3TZVC 2G75B 3OXSA 1S9XA 4NQCB 1U8QA 2NY1C 2DWEA 5J89A 4DKFH 4QHUA 4WV1B 4CADA 5L2KB 5HI5D 2VLJB 4J4PC 2XWTA 3DVIA 4OD2A 4XP5H 3RZWA 4G7YL 1DE4A 4UOJA 2R56H 2WBKA 2E9BA 4IRSC 1A6ZB 1U3HD 1QLFA 2C7UA 3Q2CA 5E08H 1I8MB 3LKRA 3F7YB 4WI9A 3MV7E 4NNXA 5F7DA 1KB5H 1YQVH 3ARGA 3V79C 1X6LA 2A9NL 4P0DA 4MAYC 3MV7A 4JFZH 3GMMA 4LQ1A 4JGMA 2A6DB 3BP5A 3V6OC 1E6JH 2NY7H 4MWFA 5JQHC 3UTTB 4OF3A 4JLRB 1RHHB 2DQJL 2GFBB 3HC3L 4OZFA 4ZFZB 4YH6A 3TWCH 3MA9H 2B4CC 2MKWA 4K8RC 2PTTA 3IJYB 5H8DA 3KJ6H 1I3UA 1QLEL 3MLRH 3ES6B 1FN4B 2AABL 4ODHH 2OTUB 2VWEE 4FHBD 5IP4A 4JFYB 1MUJA 4CN6A 2DQGL 3BPOC 1WBXA 5E56A 4OLWH 4PJAB 1KJVB 4LCYB 3CVHB 3BJLA 4OCYH 4LNVA 3UDWC 5CEZD 1NKOA 4M03A 2P1YA 1V5JA 2P5EE 1VACA 1D6EA 1JMZA 2FJFA 4F3FA 1DQTA 2EYRB 1U8MB 4P2QA 1LO2H 5EZOH 1JWMA 3GB7B 4OF0A 4XRCB 4YDLB 4IOIB 4Z5RA 2XYCA 4NN5C 4YQXH 1J0YA 3OKLA 3T04D 4ZSOE 1ZGLA 2NQCA 3GJFK 4X9IA 4WY7H 3S4SA 5LAXA 3UPCA 4EXKA 4L4VA 3C6SA 5E5MB 1MFDL 2XY2A 3JTTB 1JV5A 1KUMA 1ORSB 3A6OA 5L0QB 1NC4B 3MV8E 3X14B 2OYPA 2DQTL 1BVKA 1RK1A 1WZMA 3TN0B 2JJTA 2ZZUT 4U6YA 1R5IA 4KROB 3JWOC 3OKOA 2APTA 3O6FC 3FQNB 1KTDB 2IQ9L 3FN3A 5DYOB 3ULVE 1B0RA 4XP1H 5C0NC 4NPYB 4MD0A 4PREA 1S7WB 3MTRA 1FE8H 1NGPH 3HG1E 1NL0L 4U1MA 1GIGL 2H32A 4D9RE 5T3ZE 4WVRA 2ZSWA 1XGTB 3HG1A 5CJ8A 1XIWD 1BIIA 2F53D 4TUOB 4FFVD 2A77H 1KCVL 2FLRT 5I1DA 4ZYKB 5LXGL 1IGIH 4M62L 4M7KH 5TGBB 2FO4B 2QSVA 2YXMA 4OZHE 1NCTA 3RGVD 1LEKA 5JW5A 3KPSD 5ALBH 5F3BB 3G6JF 4YBLC 3PJSB 5IF0A 3VFMB 1D5BB 2HN7B 1VKXA 3T0XA 4C83A 1EHLH 4PLOB 5KJRH 3NFNA 1RIVH 4ODUA 4S0SD 2ZCHH 2VDQL 2NNAB 4P49A 5DLML 1FNFA 1EUTA 4NQEB 4R96B 5I30L 5DD3H 5T1KD 3DWTA 5FDWB 5GS2H 4PJCE 4BA8A 3LEXB 1DDHB 1U8IB 2MTPA 3ZHKA 3DGGB 1X5LA 4OI8A 5EIVA 4N90E 1MRCH 1KC5L 4KQ4L 4ZMAT 1GZQB 5CP3H 2BSRB 2BVEA 4MXWH 2BX5A 2E7HA 3MBEB 2J5LB 3RVVD 4PRDB 4X7TA 2FEEI 1CD9B 4HH9A 1LNUA 1YN6B 2X9XA 3HAEG 3HZYA 4OZGE 5FM5M 1W72A 2L7JA 1PEWA 4U33A 1IQDB 2XA8H 1AGFA 4X4YA 1UZ6E 4YXKH 1J1OH 2WBJC 2DYPA 2FBOJ 5DK2A 3H2WA 3WLWC 5JLZB 5GRUL 3UTSA 4HSQA 4S1DC 3UBXA 3O2DA 1MI5E 1ZA3A 3GIVB 5IB1B 5EUKA 1MVFA 3FQUB 4PBXA 3SE4C 1A0QH 3ARBB 3RP1A 4JG1L 3MMEA 1T22A 1DN0A 3NN8B 2XFXB 4FXGB 4F2MA 3VMNA 2PW1A 5F1SA 5L7XL 4MQXD 3VCLA 5JTWA 3NZ8B 3MO1B 5FXCH 5IQ7H 5I18L 4FXKB 4DGYL 2FJGA 2ZG1A 3KPOB 3KLHC 2VERN 4K07A 2NZ9D 5D7IE 3CDCA 3RI5K 3TYGL 4ZFGH 3FFCE 2JB6B 4LSSL 3SDDC 2B0SH 4LBEB 3VMOA 3MRJA 4PG2A 1EBAA 4YNYB 3C8HA 2A73A 5HYQA 3D69A 2AJUL 1KCSL 2VXSH 3BKJH 3HI1A 5MEPA 4L3CB 3U82B 4ZPTB 3OXRB 5I1JL 4M43H 3GHBL 4WEBL 4Y4KA 5GGTA 4YE4L 2F74B 2JELL 3ARDA 4IOFC 3FL7A 5JZ7C 1VGEL 1OT1A 2HLFC 4KZDL 4FFWC 3NH7H 4KAQH 3GGWA 1T80A 4GG8A 2NY0B 1YEDB 1KTKE 4LEXH 5MERB 1S3KL 1A7NL 3UTOA 1EMTH 4A6YB 3JWDC 5JIKA 1OF2A 3V5KA 3HLAA 2OL3H 1S7TA 2ZUVA 3FB7A 5FOBB 4NZTL 1AR1C 3VXNB 2YD1A 2APFA 1DBMH 2X6MA 4JRXA 2HKFH 1IM3B 5ESVA 3MLUH 1HXMA 3B9KB 1LO0H 5H94B 1NUDA 1MCPL 3MUHL 3HAEH 4OD1L 1AKJA 1U58A 2Q8AL 2ADFH 3REWA 3VXMD 1KFAH 4GRWB 1E4XL 4RGNB 5IFHL 5D2LF 3QEGH 5I71C 43CAA 4KMTH 1GAFH 4MXQC 4QNPE 1K85A 3CUPA 4RISH 4OTXL 2IAND 4L9LB 2VL5A 5L2JA 5TQ0H 1LE5A 4N0YH 3V5HA 1KG0A 1QFWI 1NMCB 4Y89A 4U31A 4XP4L 4KJYA 4DUXA 5C09A 4OM1L 5TFSL 3WFCL 4L8SB 4N8VB 1A7OL 3OWEA 3PWPA 4XHJC 4IJ3C 1MF2L 2YC1A 3G6DH 3T77B 1KJMA 3U7WL 2FZ3B 3MJ9L 4CMHC 3E1F1 5HHQA 4PJ8C 1I3RB 2MSPA 5J11B 3RAJL 3T4AB 4PJBE 4JFQB 1YECH 4HGWB 2VYRE 2HLAB 3QO1B 5EO9B 1R0AH 1ZAGA 4P4RA 2AJXH 4PJHF 3X3FL 2XWBA 3ZTNH 4XCNB 1INDL 3S4SG 4LKXA 1WVZA 3IFPA 3QPXL 4N5ED 3MREA 1ZHNA 1YYLH 2R69H 4M8QA 1X5GA 1SJVA 1RZIA 4LP5A 2VZOA 4GW1A 1NGYA 3JZ7A 3IVKB 3QUXD 5D93B 3F5WA 3K81A 3VD5A 2WANA 5D7JB 3DOSA 4EJ1C 2AQ3A 4XCFL 4U1HA 1ITCA 5EDXA 1M7DB 3ZDYE 1R3LA 5HSFA 1GHFH 3QJFA 1J1PH 1Q0YL 4JFFD 5D71L 1I9RL 3ARZA 2YRZA 5DJAB 3UPRA 5E99L 3GJFA 1KEGL 2CK2A 2H1PH 3UTPE 3HI6H 4P3CH 1ND0A 4I9WD 4BZ2H 3DRQA 3C5JA 3PGFH 4ODWB 1SVCP 4O2CB 1JNLL 3U9PL 3EJZC 3ZT7A 1RVFH 3QEQB 4GUPB 4WO4B 3V52H 3MLZH 5ADPH 3VA2C 1YEEH 4OZFH 4HC1L 5IEKA 3BH8B 4DZBB 1Q1JH 1QVOB 2C3GA 4NNPH 4WGWB 2OBGA 2FBJL 4NM8L 2AV1B 5HHOA 2J6EA 4MCZB 4R4BB 3K7UA 4PP1D 3C5SA 3JV6B 1TVHA 3MRHB 3CSGA 2IMNA 3LRSA 3WE6A 5SV4A 1TZIA 4I0CC 5SWZA 4I3RH 5IJKA 4J3SA 1SBSH 3L3KA 2MHAB 4F8TA 5GS0L 2I07A 2ADGB 3VXTA 1N59A 3TPUA 1MCOH 5HXMA 4F15C 3ELAT 5ERWB 1JF5A 4LIQE 1MQKL 3O9WB 3V2AR 4OKVA 4LLVA 1P1ZA 4POYA 2XXCB 3ZE0E 2FDBP 3BDXA 3IB4A 1OAKH 1E6OL 3UBXG 5EU5B 4CU7A 2XTJD 1VFUA 3STZB 3IF1A 3O3UN 5I75C 1I3VA 3P3YA 4XCCH 3QIUB 3KYOB 5EU6B 3ECBA 4Y4HC 3VRLF 1TJGL 5FO9B 4QTIL 5CS7A 1I7RB 5EU3A 5DGRA 4D9QD 5HGDA 5DJ8B 4KZEH 5CIPA 3GZKA 1NCBL 2X1XR 4LVOB 4NO5A 5EUOE 3DBXB 4R0LC 5IVZA 1B4JH 3KPPB 4KV5F 5EU4A 5EUOA 3WD5H 4E41E 5ANMB 3N0PB 3SDXF 4P59L 4HDIB 3L1OH 3L7FB 1ZEAL 4I48A 4WU5A 4HT1H 1WWWX 3AUVA 3IRPX 4M4RA 4EN3A 5E5RB 2A9MH 4WFGD 3BW9A 4JVUA 4Y4FB 4FQ1H 1FFOA 4G9DB 3CJJA 4XAWL 1IGJB 4LF3A 2DJSA 5FO8A 3ILQC 1YNKL 4LCCB 1G9NC 1OAYL 5FCUH 4EIZC 4YHOH 1S78D 3KDMA 4TRPH 1CQKA 3R0MA 1DEDA 5DZOA 5IHZA 5IJVA 1BF8A 4IS6A 4OT1L 2GITB 1ZLSL 3IYLW 3UC0L 5ITFB 3QJHB 5A2JH 4HIEA 4NBXB 1NJ9B 2EDWA 5I17A 3NPZB 1JWSA 1GZPA 2ITCB 5F6IC 4JHAL 2YKLH 4O2FB 3U4BL 1T5WB 4KRPC 3QDMB 1YNTA 3S5LG 4MA1C 5GGVH 3Q1SH 5IIEA 4PJIA 3C8KB 2QADB 3EW3B 5BO1H 2XZAH 4Z7WE 5F88B 4FA8A 2WW8A 1TFHA 5IESL 4Z7WA 3L3HA 1IEBB 4C56B 4QHKJ 2YS4A 2CUMA 2AEQL 3HPLA 1FNEB 3O2DH 3VWKC 4DVBB 4P5TB 3SE3A 5FAAA 2JCCA 3E8UH 2PXYA 1ZHKA 4OZ4B 4G3YH 3V6FA 3FZUC 3BAEH 1HKLL 1P7KB 5JPMA 1TZHA 5MENE 3RNKB 4HGKC 5FYJL 5L6YL 3DXAE 1T20B 1TZGL 5JW3H 1J1XH 4KK5D 4RQQB 4N0CD 4QHNB 3N1QC 1PQZA 3OZ9L 3QDAA 4PRID 4YR6B 9CGTA 1F90L 4JAMB 4LPVA 3ZKND 3PV6B 1AE6L 1QD0A 4GKNA 1U93A 4NQSB 2OK0L 1L7TL 3QEUB 4YHKL 1LO4L 5EU7C 3OKMB 1QSFD 5DHVA 3VXUA 5B39B 1FL5B 5E2VH 3ZKXC 1G6RL 1HCVA 1U95B 1CXFA 1OT2A 5DUBB 1RUQL 4G8IA 1G0DA 5GS0D 1NAMA 1QFOA 4FQHB 5TE6H 4EBQL 1MFEL 2DN7A 4KXZH 3QRGL 2OL3B 4HWZB 2KL6A 3PIQA 4JQIH 2OR9H 3WMSA 3QUZC 2DKUA 4HZLA 3K4AA 5D5ME 4HHAB 3SQOH 4GLRI 5EO1B 3JV4A 1UXWB 2W9DH 3MR9A 4JN2B 1KF9B 4QY8A 2D2OA 4EKXA 3VRJA 4JRYE 4LMQI 1YEGH 2ZSVB 4BM7A 3PABB 1DEEA 1JNNL 1V3JA 4NHCL 4YHZL 4JRYA 4QRSA 1A1NB 3H3KA 2BP3A 5C70A 2BVUA 4CU6A 2X4RA 4FFZL 1U8NB 4YHLH 5GGVY 1L9NA 4I13B 3I75B 4HJ0C 1VSCA 2D7PA 3MJ7B 5T5NF 2YPLD 3QDGD 1K3IA 1U3JA 4Z95H 2DTMH 1FORL 2K1MA 3VI3E 1JRHL 2J8UB 4MSWB 4PJ7F 5ICYA 1A5FH 2D9QB 4PJ9C 2YPVH 3B2VL 2AKRA 3IKKA 3KHOA 5C8JA 3SBWA 5KAQG 1XH3A 2MOVA 5A43C 1V7NL 2BSSB 3VWJA 3GBMH 3MRNA 3GSOA 4TYUA 4BKLB 3VU2A 4GAYB 4LLUB 4Z78B 3VG0H 4ETQA 1FO0L 3QNXB 2IADB 3FO9A 4HJJL 1MRFH 1LHZA 1NFDE 1U42A 4PGJA 4WEMB 2VKWA 4Y5VC 2HWZL 3TESA 1NANH 1SMOA 1I1AC 2R2EA 4G9FE 5D1ZD 4FQQB 2UV3A 1JZ2A 4MAUL 1CFQA 3HRZA 1MQ8A 5FB8A 4IOSD 4JPIA 1KEMH 1UG9A 5HY9B 1U8QB 15C8L 2DWEB 4QHUB 4CADB 1QRKA 2IF7A 4RAVB 4P4KB 3B5HA 4NKOA 1X7QA 2XWTB 4JZJA 5F9JA 5B8CA 3SPVA 4GMSH 4N9GA 5DQ9A 4M3KB 1EGJL 4O2EA 1IAMA 4ZXBD 2F8VA 4OIAA 5LGHL 3LPGA 2LU7A 1RJZA 2J1KA 4H1LA 4YXLH 4AQ1B 3DVNA 3RWCA 3ZKMC 5EIIB 5E6ID 3S88H 4HXAH 1UJTA 2L0DA 3S7GA 4KRLB 4NNXB 3ME0A 3O6ML 3KPRD 5F7DB 3ARGB 5DD5H 5C0AD 4PJFE 3EYVB 4L29A 3MV7B 3DIFA 3EHBC 3ZE1E 2CD0A 1A6VH 4PJFA 3X13A 3DUSB 4MWFB 2AEWA 1YN7A 4JDTL 4OZFB 1JI2A 4LRNL 4WJ5A 5DJYA 3MLTA 4LARH 1FZOB 1D5MA 5KSBF 1CFNA 4HQQH 1JRHI 5DD0L 3MLYL 5FHBH 5IWLC 3CSPA 5GGSY 2VLRA 3B8YA 4M6AA 1BREA 1PLGL 3LN5B 4F7MB 5TE7H 5DQDL 1DQJB 1BVZA 5D1XC 1MUJB 1MRDH 4WTZG 1VADA 4XNXH 3X12A 1WBXB 5FECB 2Q1EA 4YUEL 1TVDA 5F9AC 4MLIA 3B3IA 4EIGB 1AO7A 2YPKA 4CAGA 1VACB 5F7HA 2IBZY 3LEYH 5DJCB 1OTTD 4F9LA 2P5EB 1U3HA 1BEYL 1DBKL 3E2HB 3HZVB 4Z5RB 2DQFB 3ULUH 4FQIH 3OKLB 1MLCB 2J6EH 4M6MH 4YDKL 1II4E 3L5XL 1BD2D 1U2HA 3L5IA 3HS0A 4PYHA 3SE9L 5EOTA 4YC2B 4ZSOB 1RUMH 5LAXB 1TETH 5IBLD 4DN4L 4L4VB 3C6SB 2V2XB 4Z76A 3U79A 5MHSD 4ONHB 3BSZL 3K80A 1JV5B 5DRWA 1T66C 2WP3T 3REVA 3BD3A 4HWNA 4G7VH 4HAFA 3PWJA 4XB7A 1RK1B 3B6SB 3QDJD 4U6YB 1R5IB 3EDKA 2Y72A 4RX4D 1CL7H 1I9IL 1UXSB 3OKOB 1XGYL 3HPJA 3KJ4C 2B1AH 3IFLH 3Q3GA 2NW3B 3HE6D 1B0RB 4QOKD 4PREB 2BOCA 5J56B 2Q3AA 4W4OA 5A2LH 4J6RL 2H32B 2BRQA 2ZSWB 5FYKL 4JZOB 3HG1B 4OI9A 5I0DA 4RAHA 1BIIB 1NBQA 1UM6L 5I1DB 1LK3H 4MA7L 3EGSA 1YYMH 5IT2H 4PTTA 5E00A 5CIPH 1LEKB 5JW5B 4LSPH 4Y2DB 5IF0B 1F3DJ 4HKXA 4OZHB 1EEUA 2W38A 5DVKA 4C83B 3HNSL 1E27B 4XC1H 2WWMD 3S37X 4BSVA 3O3EA 4ODUB 5B3NA 3MYJA 4JY4B 4X0KA 2IPUK 1K6QH 1OTUC 4X5WA 5GRJL 4PJAF 4L4TD 5E4EB 4JR9H 4UNTA 3KR3H 5TJWK 5F7EL 1MPAL 3AS1A 2JK5A 2VE6A 3O41A 3GMRA 4OIIH 4Y19A 3MRLB 5CKGA 1YEKL 4K23L 4PJCB 4PJXE 1CGTA 4IMKA 4GQPH 4AG4H 4QXGL 3UDWA 5JW4N 3CDGB 3FOMA 4P2OC 1NDMB 2R0WH 3I50L 1AD9B 1KPVA 5EFIB 5IOPA 5CBEA 4X7TB 3LEVH 4G43B 3F6IA 3MRQA 1LNUB 5D4QA 1N0XH 2F53E 1W72B 1NLDL 4NP4L 3WS6C 2OJZH 4P5MA 4AENA 1XIWA 4OZGB 4QGYA 1B9ZA 4LPUA 5DK2B 4KY1H 3EYOA 3RVUC 1OSZA 3IDIA 4WW2B 2RCSH 5EUKB 2YK1H 1UM4L 3EDJA 3RGVA 1P2CB 5GZNC 3MMEB 3KPSA 1T22B 1B0GA 1DN0B 3Q6GL 2HFFB 4M5ZL 4KPHH 3EYSH 3SKNB 2ORBL 2PW1B 3C08H 3GSRA 3LD8B 2G60L 6CGTA 3VCLB 2J4WH 1MAKA 5CJXA 2FJGB 4LSDA 2LU4A 5T1KA 4KH2A 4AIXA 3SGEH 1EEYA 5ALCL 3U30C 3VFNA 5D7IB 4UT6H 2MCPL 5IV2B 3FFCB 5FUCC 4V1DD 1JGEA 5J13C 2X05A 5LVEA 1HHIA 2ERJB 2A73B 5HYQB 3D69B 1HDMA 2EE6A 3S6CA 5JHDD 3D2UB 4DAGH 5K9OA 3VXPA 3TJHC 3T3PE 2NY2C 3O2VL 1QKZH 2N56A 2NXYC 2VIRA 1E4WL 5I9QC 3O0RL 4KKAC 4Y4KB 5HGAA 2IFGA 3ARDB 4DN3H 3WIIL 4Z7VE 3MLXH 1ED3A 2LABA 2GT9A 5DHVH 5MP6H 3RKDD 3QAZB 1HQ4B 1S7QA 4OLVL 2JJWA 3UP1A 3GGWB 1P4BH 1L0YA 1HK6A 2D3VA 4PLJC 4JDZA 1A2YA 1NUNB 1NAMH 3BT2L 2C3VA 3BE1H 4FQCL 4TSAH 2ESVD 3I84A 1OF2B 3V5KB 4CL7A 2EXWD 4FZEH 3PGCB 1S7TB 3DARA 5FYLH 2N7BA 1M7XA 1XEDA 3D3VD 1MAML 1BZ9B 2IQAB 2NY3D 4PJ5D 1NEUA 4RA3A 4P46B 4XVSL 2D0FA 4JRXB 1ZS8A 3ORJA 2BY3A 4G42A 1HXMB 1G0YR 3N06B 3T08A 4JM2C 3TO4C 1AKJB 1T7YA 1FDLL 1U58B 2BXZA 4M1GL 3REWB 2FATL 2R4SH 3MRMA 4LNRA 3HMXL 1HIMH 2XQYK 1IGFH 3FMGL 1ZT7A 4RFEA 5CGYD 5FKAA 5FYKD 5FEBA 3I6LD 3NIGE 1HZHL 4H8WL 4MQ7B 4I2XE 1B4RA 4ZOBA 3NCJL 3BHBA 4GRLD 3CUPB 2CUHA 1T7WA 3QI9C 5IBUB 2XG4A 3TCLA 5I1IH 2VL5B 1CLZL 4X4XA 5L2JB 1LE5B 5DEGA 4Y16C 3V5HB 2UZIL 3B9DA 1R5WA 1KG0B 3WS3A 4UQ3A 1TNNA 2DRUA 3GM8A 4Q9QL 4IRJD 1IQWH 3IDYB 1IT9L 1E28A 3FB5B 1L0QA 4UV7L 1A4KA 3S35H 1KJMB 4XX1G 1KTRL 3HZKB 5FM4A 4I3GA 5AUMA 3T1FA 1H0DB 3VI4F 3MCLL 5LG1A 3HZMA 4HFWB 1U8KA 5FA4A 3PQYD 2A1WL 4P4RB 2B2XL 1WF5A 3CVHL 2XWBB 3AC0A 2DBLL 3LHPH 3VXME 5EZJB 4LKXB 3L9RA 3VXMA 1N7ML 1ZHNB 1JFQH 3W0WD 3RU8H 1SBBA 2CLZB 3W2DL 4KUZH 2YN5A 4TVPH 1JPSL 4I0PC 5F6HJ 2R0LL 4K9EC 2EYTA 1NGYB 4Y1AE 2IANE 3U7YH 4MD5B 3CPLA 2VQUA 3LPWA 3EOTL 5E6ZA 2L4OA 3DROB 3O8XC 3GK8L 1FFQA 1SJHA 1QRND 4JHWL 3QIWB 4X83A 3N1FC 4KK8D 4KVNH 1YZZA 4U1HB 3O3BB 1VERA 1YEFH 3UJJL 5C0CD 1FV1A 4KVCL 3QJFB 2Q7NA 2Z4QA 1BM3H 1BOGA 2R2HA 5JW4Q 2BNRD 2P8LB 3GJFB 1DBAL 2Y06H 2AAVA 2GEEA 1P53A 1ND0B 4OGXH 5DR5H 4FXLA 3DRQB 3C5JB 4UV4H 5IGXH 2OTWB 2H26A 1RZKH 1J88A 2BMKB 1A64A 3U4AA 1F11B 3ARFC 1CDBA 1TLKA 3A67L 3TBTA 3L5WB 3IDUA 4C57C 2HMIC 1N4XH 1RJYA 3AB0B 1JHLH 1R3KA 4XPHL 1Z9MA 4XGZA 2NCMA 1RUAH 5ABDE 3OR6B 4R7NA 2RAMA 4NFBA 1TVHB 2EKSB 3QUXA 2VUYA 2ZUTA 4XCYB 3WE6B 5T1LD 1TZIB 3BI9X 2UYLA 5FO7A 3I6KA 4LL9A 3L3KB 1CLOL 4JO3L 3ZDXE 5HYFA 5C2UB 2I07B 2IFFH 3VXTB 1N59B 1EFXD 4JFFE 5E5UB 3MRPA 1CZ8H 3DECA 3BWAA 4JFFA 4P9HC 4O58L 4OCRL 2HFGL 3VGAB 2A6IA 4Q7DA 4LHJB 4OKVB 3V7MA 4LLVB 3RWIA 5GHWH 1P1ZB 4PUBH 3WFDH 2ZUUA 4KDTC 5BV7B 3FQXA 5JO5A 1AI1L 4BELD 3PWVA 3H9HA 2NY5L 4F7CA 1FFNB 2BVQA 1BQSA 1L6ZA 5ISZD 4P99A 3R4DA 5T1MA 2DMKA 1CU4H 4YZFE 4YDLC 4WHYG 3BEVA 5HHMB 3A6CH 2I60L 4WNQA 3RWEA 3F7RA 1J0JA 4F7PB 1KCRL 5F7KC 5CIPB 1IC4H 1PX3A 4K3JH 4IRZH 4KI5C 2BVPA 4NO5B 5CEZH 5K9QG 4NNYA 3UTTD 5IB5A 1CXLA 1F42A 1GC1L 1Q9LA 5EU4B 2RB8A 3F62A 5EUOB 4J3UA 1V7ML 1ZK9A 4U49A 4LVHC 1XGQA 1AXTH 1XGPA 2Y07H 2DI9A 3FAWA 4PG9A 3TN0C 2Z93A 4KROC 4G8EA 4MHHI 1FIEA 1YJDH 1PZ5B 2F5AL 4I0KA 5HDBE 5I16A 1Q72L 4I3SH 5I1KH 4ENEC 5DHYA 5ACZB 4ODVL 2WUCH 2OLDA 5TPWH 3RJDA 3QCUL 3BYTA 4JO2H 5D7KD 2B4CH 5E8OA 5FO8B 3UJTH 3LKOA 3IU3B 3KDMB 4UOW1 2I9TA 1PW3A 5IJVB 5IHZB 3STLB 1A6TB 4OM0H 3PDOA 4NRXA 4D9QE 4HIEB 1CR9L 2OZ4H 2NX5E 1A6AA 3C6LD 5I17B 1J8HE 1JWSB 1GZPB 4TVSa 2HJLA 2VC2H 1IAKA 2AJZB 2J88H 1FG2B 3H7LA 4GS7B 1DCLA 1YNTB 1RIUL 3K4DA 1IGYA 4RIRA 1LDPH 3QUMB 4KHTL 5IIEB 4X6FA 3VXRD 4F7TA 1DR9A 1NGZA 2CK0H 3G6JE 5T33H 1EO5A 5CINL 1G9MC 2CRIA 2YMXH 4HS8H 5E9DD 5JW4R 3NMEA 4Z7WB 2PO6C 3HPLB 4WDIB 5FUZL 3MJ9A 1RURL 2JCCB 2PXYB 3BN9C 3TP4A 4WFGE 2AGJL 3EO9H 3V6FB 3QQ4B 2AK1H 4WCYL 1Q9OA 1TZHB 4DJMA 3P0YH 1M6OA 2Q76A 4MJ5B 2NY5C 3JTSA 1A7PH 3DXAB 3JWOH 3RKPA 1FZMA 4PD4J 1CYGA 3INUL 4HWBL 5GRVK 1AHWB 1VFBA 1CGYA 4WENB 1U93B 1NEZB 2G2RB 5CJQH 3WKNA 4C55A 1IZKA 3KXFD 3SCMB 2WQ8A 3VRIA 2QQKL 4DUVA 3ARBC 1AGBB 4G7YH 5HGBB 2EO1A 1FYTD 4ELKA 1HSAB 4S1SL 1FPTL 1E4KA 5JA9A 1BZ7A 5HHXH 3MX0A 1FJ1B 1N5YL 3V0AC 1A47A 3ALXA 3PIQB 1MLBA 4NQED 2XY1A 1OW0C 4HUWA 1PX4A 1CXEA 3JV4B 2VN4A 4MNHB 5D5MB 3H42L 2CQVA 1QBML 1KIRB 2D9CA 3BEWB 2A9NH 3D39E 3C9NA 3VRJB 3IDNB 2ZUSA 5HI4D 4FRWA 4ORZC 1JHTA 3BPCB 4F80A 2EXYD 4JRYB 4QRSB 2DQJH 5JPNB 4NKQB 3HC3H 1CD1A 4HC1A 2BHZA 4PRIE 1N8ZB 3FRPA 4PRIA 1QLEH 2C3XA 2AABH 4D2NA 4KMQA 5JOEA 5E8NB 1VENA 5ICYB 2DQGH 1QSFA 2OR8A 1H3PL 1LD9A 2AKRB 5E2UL 5D96B 5C8JB 4WU7A 2NY0C 5DJZB 2DJ4A 1XH3B 5BVJA 4QRRE 1ZLVK 1UWEL 5KS9F 2HVJB 4LASL 3MRNB 3GSOB 2Z0BA 4EI5C 3DYMA 4RWYL 4XB8A 4L1DA 4PY8J 1JTPA 1ORQB 2CLVB 1BLNA 5AD0B 3EO1B 4OCWL 1Q9KA 4AM0B 4OGAD 1ZVHA 2J8OA 5C86A 1NFDB 5FYJU 4NZJA 4JY5L 3RL2A 1CXHA 4IEFB 1MFDH 3HRZB 5FB8B 1GCFA 2VRAA 2DQTH 1SVZA 4RGNC 2AJVL 1T6VN 4U7SA 1EEZA 2YPLE 5BOZG 4NKOB 4JZJB 4LSRL 1YPZA 5F9JB 1DUZA 3ROOB 4ERSL 1J7VR 5D2LE 5DQ9B 2YPLA 3QDGA 1MCBA 2IQ9H 1RJZB 4H1LB 5D2LA 5J3HC 1RUPL 1DVFD 2BJML 1NC2A 3CFIC 3WKML 4KRNA 1NMCC 4MJIE 5DMKA 1C16A 1NL0H 4LQFL 4TN9A 3WFEL 1GIGH 5F1NA 2QBWA 4J12A 1RD6A 3QUZA 4LRIC 1MHPL 3LMJL 4L29B 3DIFB 3KNBB 1KCVH 2VDPL 3FB8A 5LXGH 4M62H 3P0VL 3GI8L 4PJFB 2NXZD 5J11C 3X13B 5D7LD 3B9KD 3IDJA 3VD7A 4CVXB 1XF4A 1JYNA 3R06A 5D1ZA 5GJSL 5DJYB 4WJ5B 1TIUA 1D5MB 2C1OA 3MLVL 1KCUL 2ADJA 1FL3A 1O5DT 2R8SL 4C4KO 3VH8A 2BERA 4RZCA 2VDQH 4PJHA 5DLMH 3MRFB 3F7QA 5CJOL 5I30H 1Q0XL 5FIEA 1VADB 5BZDA 1XF2B 2R23A 3X12B 4J3VA 4LLYA 4X6DE 1LVEA 5D93C 3QFJA 1HXYA 3B3IB 1UCBL 3H9YA 1U2CA 4ZXBA 5ACLA 6FABL 1KC5H 4KQ4H 3B2UC 5D7JC 3EJYC 4MVBC 4ELMF 4IDJL 1NKRA 5E6IA 3KPRE 5DGQA 1IL1A 1YEHL 1F5WA 1Z3GL 5CHNA 2QQNL 1DLHA 3D5OF 3KPRA 5C0AA 2P8MA 3F65A 3HS0B 5EOTB 3VA6A 1OLLA 4WI7A 5GRUH 2VXQL 5D1QD 4EVNA 5KTEL 3WFZA 5IROC 4HG4K 5JDSA 4CUCA 2A74B 4JG1H 4WO4C 4DCQA 5CEXA 3LV3A 2BY0A 2FX8L 3PWJB 3NAAL 2PETA 3FN0L 1DLFL 5ENWB 3VE0A 4NZUL 1Z5LA 5EN2B 5L7XH 2P45B 2R1WB 1C08A 3GMLB 4UDTA 2D03L 4KHXL 5C07D 1T5XA 3HPJB 5I18H 4DGYH 3TNNA 5DVLA 1OHQA 4X6BA 1JNJA 3TYGH 4OFYD 4LSSH 5GXBB 4UBDC 3U0WL 1Y6MR 3U36B 1D3CA 3S3SA 2Q86A 1J05B 2DQUL 3WFHB 3QFDA 1FH5L 5F97E 4R2GD 1G6RA 1UKTA 5D2NA 4MLSA 1C7TA 5DMGD 3RVXD 2AJUH 1BD2E 5IMMB 1KCSH 2HRPL 3F12A 4HMEA 3RA7L 4PTTB 3A0OA 5I1JH 5B38B 3TJEL 3GHBH 3D85D 3BP4A 3P30L 4WEBH 3O9WC 4YE4H 5CEYA 2JELH 5GGQL 3QA3B 4B7IA 5MHSE 2OSLB 4QF1A 2H2SD 3MUY1 1VGEH 4KZDH 1U91A 3DV4B 1QO3A 3EAKA 3UJIL 1H5BA 3RNQA 3MYJB 4M93C 5E2TL 3O4LD 1NFKA 1S3KH 1A7NH 1J86A 1WIUA 1Z2KA 2V6HA 1M71A 4XNUH 3WXVL 3QDJA 1VEPA 4NO0B 2FIKA 3STBA 1GPOL 2JK5B 2VE6B 3MJGX 3O41B 4G8FA 1Y6KR 4NZTH 4X9FA 5EPMA 1FGNL 3HE6A 3FOMB 4PJXB 4QOKA 4FQPA 1KPVB 3X11A 5CBEB 1MCPH 4MCYA 4OD1H 3W9EA 2Q8AH 2X1PA 4LVOC 4XWGL 5L8KB 1XIWB 1E4XH 2F53B 5DA4A 5IFHH 1LEGB 5HYIA 4UTAL 3ESUF 4KV5E 1PYWB 2YOCA 3IDIB 4HUVA 2CMRH 4OB5L 1EIBA 4ZD3L 3RGVB 2RFXA 1WISA 5F7WC 3LQMA 3KPSB 2EIDA 4OTXH 2EDEA 1FO0A 4ZS6D 3SDXA 3GSRB 4XI5C 2QSTA 4NC1E 4XP4H 5E1AA 4JFOA 4OM1H 5TFSH 1KV3A 3WFCH 3OGOE 4LCCC 1A7OH 3ULVF 1MF2H 1QSEE 4L4TA 4Y0GA 2EIBA 1SY6L 3U7WH 3QIUD 3MJ9H 3VFNB 4QCIA 1KB9J 1ZKAA 4HJGB 4M1CD 4PTUA 3RAJH 1JGEB 2X10A 5DEFA 5LKNA 3X3FH 1EGJA 4JFEA 4PGZA 1INDH 1PFCA 5K9OB 3VXPB 2R0ZL 3QPXH 1H3WM 2VIRB 2X42A 1KSRA 4G6AC 1R3HA 4G5ZL 2RIKA 1W8NA 2GSIA 5DWUL 2F9BT 2W92A 1P4IL 4MA3B 1CK0L 2PN5A 1HEZB 1E4JA 3PHSA 1S7QB 4WUKL 2A0LD 4Y7MA 5IM7A 4JDZB 1A2YB 4Y4FD 2C3VB 5FM5O 4UTBL 4XCFH 4B5EA 1UA6L 3FQWB 1QR1A 2ILLA 4HK0A 4IM8A 1Q0YH 5ELIA 4N1CA 5D71H 1I9RH 1RV6X 3IXAB 4BSWA 4U0RB 4R4ND 4M61A 5E99H 3KPMA 1KEGH 1U8HA 4V1DE 2ICWI 4XVJL 3T0VA 4Z7UF 3CXHK 4GQ9L 5E7BA 2Z31D 5I2IA 1ZLUK 4V1DA 1GGBL 3QDMD 5I8CA 3U9PH 1JNLH 1TTGA 2FL5A 3MRMB 3CFCL 4L3EE 4J23A 3OGCA 1F02I 3P9MA 1UZ6F 5JHDE 1SYSA 4RFOL 2FRGP 4H0IA 4HC1H 2QADD 1K5NB 1ZT7B 5FKAB 4ONOA 1F6FB 2DQEL 4UB0L 5I1CL 5JMRA 3BHBB 2FBJH 2XQBH 1NCWL 4NM8H 3TCLB 1KN2L 5ICZA 4I2XB 4HCRL 4X4XB 5DEGB 4P5TD 2XPGA 1R5WB 1AGEA 1RPQA 4QGTA 4OD3L 1S8DA 4XVUC 3WS3B 1SMAA 4UQ3B 1KXTB 3RFZC 4ZPVA 2GY7B 3IFNH 2GSGA 3VXOB 1CE6A 2ESVE 5SWQB 5GS0H 5KSVA 5HVHC 2UWEA 1A4KB 5D7IF 5AUMB 2ESVA 5HYJE 3HZMB 3KYAA 3LN4A 4PJ5E 4P3DA 4U05A 1U8KB 3D3VA 2PCPA 1YNLL 3B9VA 3WUZA 1FLRL 4CVWA 4J8RB 4PJ5A 1KXQE 5ADOL 4TULL 5H35A 3JUYA 1JTOA 4LDEB 2EDFA 3EBAA 4Y5XC 1JZ8A 1VGKB 2X4TB 2C3WA 3LPFA 3VXMB 2X4PA 4YHIB 1E6OH 1HWHB 5A40E 3LKSB 4PJ7E 4XTRC 1ZT1A 4E9LA 3OAZK 1F13A 4C54A 3VFWA 2X4NA 4WUUE 3CPLB 1FVDB 4GRLA 4U6HA 1TJGH 4LGRB 4QTIH 2IANB 2W65A 3AXLA 2H6PA 3R8QA 4X6EA 3C5ZB 3GMNA 2AI0L 1FVEA 1NCBH 5DS8A 5BRZD 1FV1B 4KQ3L 3FO2A 3RPIA 1Z9SA 4ZODA 4IRJA 1CT8A 2Z4QB 1JUFA 1BOGB 7CGTA 2R2HB 1G7QA 3ZL4L 3DRTB 3Q5TA 3PQYE 4P59H 2C4FU 2R0KL 4NO3A 4QHMB 1ZEAH 2H26B 3PQYA 3CFKB 1WIPA 4U7MA 1GJIA 3T1WA 3ULVL 5HHNB 3WN5A 5AWNL 2YEZB 3ZZ1A 1B88A 3TBTB 3CNKA 3QXTA 3BP6A 3GSVB 2CRZA 5E24E 4XAWH 5T3ZL 3W0WA 5HYSG 1YNKH 1OAYH 3QIBD 4XGZB 1X5FA 1JNHA 1TTFA 1MCDA 1YEJL 3HN3A 4H88L 3V7AG 4LLAA 2IALA 4OT1H 4NKDA 4QLRA 3QI9A 1ZLSH 3UC0H 3ARGC 2UYLB 5FO7B 2IBZX 1QRNE 5EG6C 2ZNWA 2YD2A 3GSXA 4JHAH 1QSVA 5C0CE 1BWMA 1QRNA 3ARWA 3U4BH 1RU9H 1NLBL 8FABA 4F57L 4JPVL 4O51B 4GSDL 5FKPA 2BC4A 3DSNA 4NBZB 4HPOL 3BWAB 4JFFB 4PJBF 5INCB 1I7ZA 5J9PB 2BNRA 2A6IB 1FIGL 2DKMA 5DO2C 1MCCA 4LGSB 2HTLC 3RWIB 5L88L 5IESH 4P4KD 1K8DA 5GZOC 1FBIL 3FQXB 2AEQH 4PGEA 2VWEC 4EQ3A 1XF5A 3H9HB 5KSBA 1T3FA 4F7CB 2YD5A 2BVQB 1M7IA 2AS5M 4YFDB 1W72L 2GUOA 1HKLH 4U2ZA 3OL2A 4TUKL 3V6OE 5ACMA 3DHMA 3L3OB 5FYJH 5T1MB 5L6YH 4M9PA 2AJ3A 1TZGH 4MJ4A 3BEVB 4JKPL 3W9DA 4JKKA 2HJKB 3HUJF 3RWEB 4HEPG 4AMKL 1IJ9A 1RUKL 3OZ9H 1TQBC 3RVWD 1F90H 1KIQB 2XWJA 2LAGB 3C2SA 4RCAA 1AE6H 2E8YA 4X9GA 5T1LA 3ZDYF 1C8PA 3B5GA 3WIHL 1UEMA 2EZ0D 2OK0H 4YC2C 1L7TH 4YHKH 4NNYB 1RAMA 1LO4H 5IB5B 2PUQT 2P5WD 4NSKB 1JGUL 3C09C 1G6RH 1EFXA 4XBGB 3R8BB 1HYSD 1V8HA 1WAAF 1RUQH 1XGQB 3EOAB 1XGPB 1JGVL 2VZTA 4NOFA 4NO2A 3WEXA 4EBQH 1MFEH 2JJTC 2Z93B 4OF8A 3QRGH 4NQCA 1U36A 4X5XA 1QPXA 3SGJC 4WV1A 5I16B 4EDXA 4KI5F 5DHYB 3VGHA 4LLDB 4OZIE 2FJHA 1F3JB 5E8OB 2XTJB 3LKOB 4YBHA 5BJTA 1JNNH 2CKBB 1JN6A 2I9TB 2P5ED 2D4DA 4YHZH 3O6LL 2EC9U 3HMXA 1EO8L 3PDOB 4NRXB 5ISZA 1F58L 5GGTL 4APQB 4AZ8A 5DJ2A 5SWSE 3F7YA 3S98A 4FFZH 2GY5A 3KWWA 1M4KA 3DETD 1UYWL 1IAKB 2B1HL 2DLIA 1HWGB 1J8HB 2K7PA 2ARWA 2YXFA 3G9AB 2WLZA 1ZA6B 1FORH 5AG9A 5CZXC 4RIRB 1MCRA 1JRHH 2A6DA 5ID0A 1BVLB 4MS8D 3UTTA 1CTOA 4JLRA 4JQVA 4X6FB 2LVCA 4F7TB 5J7CC 4XMPL 3B2VH 1NGZB 4XCEA 4H5SB 3LZFL 5I8OL 3FTGA 2EEDA 3QISA 3IJYA 3G6JB 3MV8D 3DX7A 2CDEB 3K4ZA 3ZE0F 1PBYA 3QBTB 3ARSA 1QLRA 1V7NH 5DC4B 1TCMA 5J6GB 2OTUA 3HA0A 4S1QL 1N5AA 1RHFA 3HB3D 4LSQH 4JFYA 4YAQA 1FO0H 1OWWA 2HJFB 1ZGLP 3G04A 5D7KE 3ULVD 4PJAA 1KJVA 4LCYA 4XP6L 3OB0H 5HPMB 1M6OB 2HWZH 4LPYA 1K4DA 4LFHD 1A9EB 2Q76B 5C3LD 3JTSB 2EYRA 4ONGL 5JDJA 4KJPD 3PE9A 3GB7A 1FZMB 1DQQB 1T0MB 4D9RD 5T3ZD 1QACA 4OFPA 2CDGA 3CDYA 3QNYA 5BVPL 5LBSL 1UC6A 15C8H 3GJEB 3SDAD 3C6LA 4IBLT 2IMMA 1H8NA 4Y2DD 4ZNCD 1R3IL 4GBXD 4WW2C 3FHQA 2IPKA 4PS4L 1EGJH 1IGCL 5F8RC 3VXRE 5LGHH 4ELKB 1NCCL 3MOQA 4PP2A 5E5MA 5FGSA 1HH6A 1F4XL 1F6AB 3VXRA 3LD8C 5E9DE 1MLBB 1MVUA 1QR4A 3S8WA 4HUWB 1IC5L 5CJBA 2VDML 3B4NA 3TN0A 5E9DA 5BMFL 2FX9L 1OSPL 4DGIL 2FHBA 3L5JA 3O6MH 5DJDA 3GIZH 2XNAA 5KSAB 3C2AL 3EYQC 4U6XA 4OCLC 4LHUG 4N90D 1YMME 4PG2C 1JHTB 3LY6A 3D39B 5B4MC 3BZ4B 4KKAD 3OSKA 1S7WA 1LO5A 5D70H 4JDTH 2ERJC 2LU3A 1LK2B 2HT3C 3TIDB 4LRNH 3ARUA 4HKZB 4ODXB 4PRIB 5DD0H 3MLYH 4PLJD 2O26U 3S37L 4QWWC 4ZYKA 4Y4KC 1PLGH 1XMWA 5DQDH 3ARDC 5IQ9A 4D0BB 5KVDL 2ZP0T 2EDYA 1LD9B 3KXFA 4YUEH 1MI5D 3BQUD 3QAZC 5F3BA 3CSYA 1D5BA 2HN7A 1RZGA 3QCTL 1PEZA 4FABL 1FYTA 5KN5B 4OCSL 2NNAA 2YZ1A 1BEYH 1DBKH 2Y7QA 4NQEA 4YDKH 3NCCB 5FDWA 5M95B 3L5XH 3LEXA 1DDHA 1U8IA 3VGDA 2CIIB 4X8XA 4ZTOL 1Q9KB 3SE9H 3FFCD 2KBGA 3THML 4DN4H 3NCBB 4F8QA 3EDFA 3RL2B 1BQHA 2ADIA 2BFVL 2X1OA 3N50A 1MHCB 3BSZH 3MBEA 4PRDA 2NPLX 3H6JA 3CU1A 3D2UD 4XBPA 1MCSA 1BFTA 1YN6A 3CX5J 1YMHB 1AP2B 4P9MH 4RMTA 3QWRD 1XGUA 4RNRB 1DUZB 1I9IH 1XGYH 2YPLB 2GYSA 1T4KB 5JLZA 2D0HA 5D2LB 3GIVA 3GNML 3FQUA 4JPWH 3QG7L 1JZ5A 4X98B 3HC0A 3WNKA 2FEDD 1C16B 4FXGA 1XFPA 2DQHL 5D5MF 4UOW0 5MEOA 4J6RH 3DYPA 4K55A 3T3MF 5FYKH 4HS6B 3NZ8A 1G7HB 4Q6IA 5I8EB 4LIQL 4FXKA 1UM6H 3FB8B 5C0BE 1H3TA 2ZOKB 4P46D 5BV7L 4MA7H 4XZUB 5IKCB 1P4LB 1KYOJ 3OV6A 4LBEA 2BNUB 5F9WB 3M17B 5IMOA 1BZQK 3R06B 2ENSA 1P7QB 2QR0B 4DVRL 2W9LA 3HNSH 3VH8B 2X44D 4LLQA 2JTDA 3VI3F 5GRJH 2Q3ZA 2DICA 1JWUB 2J12B 4L3CA 5BZDB 1PDKA 4UAOB 5F7EH 1MPAH 3HR6A 4O9HL 3WL9B 2F74A 1HXYB 5KW9L 1EDQA 1S7XB 4LAJH 4ZXBB 3WBDA 4EUPA 1CF8L 3W11D 5DVNA 1YEKH 4K23H 4X6DB 2CR6A 4QXGH 1DVFA 1YEDA 4K3EL 3I50H 1KB9K 4YDVB 5E6IB 1IL1B 1NLDH 4NP4H 3S35X 1DLHB 5BS0E 1D7FA 1NFDF 3KPRB 1F45A 5C0AB 8CGTA 1Y18B 3T0AA 3VXNA 5D7LE 2UUDK 3FHAA 4EVNB 1H9VA 2NR6C 2LTQB 1UM4H 4WFEE 5JDSB 3B9KA 4EEEA 1CXIA 3Q6GH 3UZEA 4M5ZH 3T4YA 2R4RL 4ZFOL 4I4WA 4W81A 2ORBH 4JKWA 1Z5LB 4ZTPL 1C08B 1F2QA 4LLMB 4UDTB 1IGML 2G60H 4Z0XB 5HBBA 1ZWIB 3F7VA 3ULUC 2VLLA 3TNNB 3GEWB 4HWBA 5ALCH 4L9LA 2Q86B 2NYYC 3QUML 2MCPH 5DC9B 5IJKC 3IDGA 1S7UB 3QIWD 3QFDB 1WZLA 3WHXB 1CGSL 4U1NB 4LPCA 4HIJA 5D2NB 1M05B 4L8SA 1OP3K 3AM8A 2XZZA 4N8VA 2HH0L 4LAQL 4XVTL 1I1RA 1CIUA 3T77A 3O2VH 1UWXK 1BD2B 4D3CL 1E4WH 3M07A 3O0RH 3BP4B 4NJAL 3TM6A 5CEYB 1F4YL 5GS1A 2AK4E 3O3DB 1OM3L 3UTPD 4QF1B 3WIIH 2HLAA 3QO1A 2V9QA 3R0NA 3KS0H 4OLVH 1H5BB 4NUGL 3MGOB 4HIIA 5DJ0A 1M71B 3BT2H 2JJSA 2R2BB 4FQCH 5A2IH 2FIKB 3QSKB 4KI5D 3E6FA 4G8FB 5C07A 5EPMB 1NAKL 1BECA 4HUMB 1MAMH 3LQZA 3IVKA 2X89D 2VZSA 5T3XD 4XVSH 4FQ2H 4D0CA 4NKIL 4QOKB 4POZC 5KVFL 4OQTL 3RWDA 4OFYA 3X11B 3WCYA 4MCYB 2OR7A 1FDLH 1SEBA 4M1GH 1MOEA 2FATH 1NCAL 1M7DA 2W9EL 3HMXH 4HKJB 4P23D 3QEHA 2YD4A 3CVIL 3FMGH 5DJAA 1HZHH 4H8WH 2XI9A 4DK6A 4HUVB 2HP4A 3IJSA 3NCJH 2QJDA 2RFXB 3D85A 4RMWA 4BK4A 4EN3C 1A02N 2XOTA 2ZPKL 3VGGA 1NQBA 2EECA 1CLZH 4O5LL 4OV6F 4O2CA 2UZIH 1CGXA 2L7UA 3O4LE 4S0TD 5GGRB 1MJ8L 5E1AB 4Q9QH 3BH8A 4DZBA 3RWFA 3O4LA 4AEIL 5E8PA 1QVOA 2GJZB 1IT9H 4XNMA 4L4TB 4UV7H 3EJJX 5F7NC 3MCLH 5IHLB 3GSQA 4QCIB 4MCZA 2X2YA 3Q5OA 4R4BA 5H37G 4PTUB 2R2CA 3JV6A 5HDQL 3MRHA 4BQ6A 4B53A 3OAYH 4K3DL 2A1WH 2B2XH 4KK6C 1N6VA 4GG6E 3CVHH 4PY7B 3ZYIA 4NCC2 5HJ3B 2DBLH 1FYHB 1S7RB 2VZUA 5C08E 2MHAA 1GXEA 1WBYA 2AXFA 2GKIA 5EO0A 2DI7A 1N7MH 1R3HB 4XP5L 1HH9B 2GSIB 3W2DH 5TQ2L 3CXDL 1JPSH 4E41D 3QPQC 2R0LH 5ERWA 1HQRA 4TTDD 3SEPA 2DB8A 4QHLB 4WWKD 2OCFD 4K7PY 3EOTH 3ARRA 3QUYB 1T7VA 3SE3C 3PG2A 2PXYC 4N0UE 4OLZL 3P4NB 3GK8H 1FNLA 4W6YB 4JHWH 1A1OA 3HR5A 3FCTB 5EU5A 3SY0A 5GIRB 1QR1B 4HK0B 2YUXA 3T09A 3UJJH 2X41A 3STZA 3D18A 4KVCH 4PJXF 4BSWB 3CLFL 3SN6N 4M61B 3KPMB 2WIMA 1DBAH 4BZ1L 2VDRL 1U8HB 3KYOA 3QIUA 4P57B 5FO9A 1AGCA 3UTZB 1AHWC 2JLLA 5GRXG 4V1DB 1UH2A 3VFTB 2FL5B 4QYOB 3OGCB 3P9MB 3SCMC 1SYSB 1B2WL 4LVNB 3GRWL 1IAOB 4M7LT 4L3EB 3DBXA 3Q6FB 3A67H 4WRLA 4AT6B 5JHDB 3BZDA 1QUNA 5ANMA 4XPHH 4HDIA 2DS4A 1MCWM 5LCVL 4R7DA 1S7VA 3TT3L 1AGEB 3DGCR 4BYHA 3HHRB 1S8DB 3G9VA 3UTQB 1C5CL 3FQTA 4KTEL 2GSGB 1CLOH 4JO3H 3UAJC 3AMLA 5KSVB 4Y4FA 3TF7C 3OAZH 2BVOB 4G9DA 2ESVB 5MEND 3T0ED 5H37H 3LN4B 1QQDB 2C3HA 3DXAD 3D3VB 4GW4B 3RGHA 5HYJB 2NY3B 2GITA 4PJ5B 4O58H 4OCRH 2HFGH 5H35B 3QJHA 1CICD 1OPGL 1MH5A 2EYSB 2VSDA 4O2FA 3RUGE 2Z31A 3T3PF 1AI1H 2X4PB 4OGYL 3QDMA 5HDOA 2ZJSL 2D7NA 2NY5H 1JCKA 1IFHH 1AJ7L 1OTSD 2CRMA 3PP3H 3F6LA 3SBWC 2FWOA 3IDXL 4Z7VF 4W70A