5C2UB

Ferredoxin-like domain of nucleoporin nup54 bound to a nanobody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
VQLQESGGGLVQPGGSLRLSCVVSGDYYAIGWFRQAPGKEREGVAAISSRDGSTYYPDAVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADRRQRWGPYYYLSALEYVYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the metazoan Nup62Nup58Nup54 nucleoporin complex.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Transport protein
molecule keywords Nanobody
total genus 33
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c2uB00
1MOEA 2PW1B 3P0VL 3WIFA 1SJHA 1JNLL 5E6IA 4MA7L 5KOMC 4WHYG 4RMSA 5EC2A 1WT5C 2NY6D 5E2VH 2BNRD 1DANU 4XC3H 3RRQA 2Z8VC 2XTLA 5BVJB 2F8XC 1B3JA 3G5YB 3DO7A 1MLCB 3SGKC 1DQJA 4XCEA 2GK0A 2F5AL 1B0RA 5JOPE 1CDUA 3INUL 3ZKMD 5I9QB 4R4NC 3FB5A 3S36X 2QHRH 4ELME 1HQ4B 1OPGL 1A7RL 5D2NA 3P11H 2NTFB 5J3HC 2BSSA 1RU9L 5EN2B 4FQPA 4IRSA 4YHNA 3B2UD 3BZFA 4JM4H 3TP4A 4D0DA 3I02B 4EUPB 4YHOL 3TH3T 1HKLH 1J05A 4IDLA 3EZ8A 4HW6A 3JWNC 4QF1A 3MLTB 1FFRA 5BS0E 1UYWL 5JW4N 4NO5A 5DA0B 4GKZB 3LKSA 4Z9KB 4JAMA 5CJQL 3DVIA 4A6YB 2DLTA 5CD5C 5EUOF 1I1FA 1JF5A 2YPVH 3QDJD 5E6IC 4OCYH 3CFCL 2YBRB 5F88B 1G7MB 4Z7NF 1H3VA 1JCKA 3FQWA 4FP8H 1JYNA 2XWBA 1GC1C 3GSQB 4LARH 5D71H 3W39B 3ARPA 5E9DE 4TNWF 4PJCA 1FFPB 2V7NB 3EDFA 3HE6B 3D3VA 2X4PA 5HI4C 4APQB 4OZIB 3D1MC 4Q6IC 3E6FA 1FSKB 1KEMH 4PJEB 1U95B 2AJVH 2ZUWA 3T0XA 3C09B 3VWJC 4YX2H 1U8LB 2D0HA 3HRZA 5DMJB 4L4JA 3ZDZF 1RUMH 3O6KL 4MQTB 3LH2H 4YZFE 4G8GD 1DUZA 1KCRH 1Y6NR 1LK3L 3KVQA 5D6DA 1EJOL 3EDEA 2V7HA 5C0DA 4JVPA 3RWHA 3MNZB 2WIIB 2AXJA 2VZUA 3PG2A 1BJ1J 2ZG3A 1ITBB 4PJ9D 5C0AD 3DGGB 5D7JA 4HEPG 4HWBH 5J6GB 1UH2A 4LSTH 2BSTB 5EBLA 4KMTL 5DJ6A 1GXEA 3FOLB 5D5ME 5IJVB 1P4LB 2ZWLT 3EYFB 1PKQB 4UV4L 4N90D 2X41A 4LSPH 2J3SA 4XP4H 3I75A 2XFXB 4R3SB 3TIDB 2DWDA 4F80A 1CDBA 5CD5D 1MWAL 4YXHH 3NN8B 4M1CD 4JM2F 5IESH 3DX6B 1FVCB 4CN4A 3QDMB 4MX7A 3SQOH 2QV2A 4YUEL 1QFWL 1RZ7H 4YDIL 4ZFZA 3EUUA 4WFHD 4JN2B 4JG1H 1ZLVH 4KKLC 3UTSE 1T1XA 1UQSB 2YWZA 4I18B 2C1OA 1KJMA 1YMMA 1F4AA 4O2FB 5IVXE 3VXNA 3RVWC 2R0ZL 2FECI 4PJBF 2CDEA 2YMXL 3HC3H 4N1EA 2PTUA 3BSZL 1Z2KA 2IPTL 3VFNB 4NJ9H 5LGJB 4XPAH 1A6AA 1OGAE 1GRWA 3BXNB 5FYJL 5ID1B 2F53E 4PV8A 3OGCA 5DO2C 1W8NA 1RUKH 5FOBB 4HWZB 4WIQA 3NCJH 1HEZA 3A6CL 1CFNA 1ZE3C 4HC1L 3NAAL 4UUJB 5MHSE 4HV8A 1TPXC 3TC9A 5FYLD 5EU3A 3MV9E 5DZOA 3ZL4H 1FZMB 1MCRA 3STBA 1MCHA 1FL5A 2AEIT 1GSMA 3PL6A 2QQQA 5E2UL 3HTLX 5DDHA 1HNFA 4RAHA 3ZLQC 2P8LA 1NMCC 4OLYL 1NLDL 2CK0L 4ZQKA 5C0BA 1DLHB 4OI8A 4A6YL 3ARBD 4XT1C 1G9NC 3WD5L 1EMTH 4ONOA 2A83A 1QOKA 4I48B 4RX4A 3KYAA 4I4WB 2YWYA 1MNUH 2ED8A 5EZIH 3EOAA 1XGQB 2HJLA 4BZ2L 3QFJD 4KAQH 2O5ZH 3NA4A 4OGYH 2AK4B 2AGJL 4G6ML 1HN1A 5ACZB 5BQ7A 4X6DA 2SEBA 3F65A 1AGBA 4PJAE 4KROC 4H25A 3IKKA 3EIFA 1G7JA 4P5MA 1BFOB 2OJZL 3GSRA 2H1PL 1FV1B 3X3GL 1Z9MA 3CFBA 4JDVA 1T2XA 3PV6B 5H35B 2D7TL 1QUNA 2AV1B 1BOGA 3P2TA 5D7SH 4HSQA 4V1DE 4EQ3A 4MWFA 2BRRL 4E5XB 4E41A 3CVHL 3TA3B 3QQ9D 3QWRA 3U1SH 1YEIL 4NM8L 4HK0B 4PJFF 1B2WL 4DKEH 4LCWA 1BFVL 1NCCH 2IH3A 3T2NL 3W9EB 5FEBA 1I4FA 2WWMC 4Y16D 4FXKB 5IBTL 3LS4L 2X70B 4P2OC 3MLUH 5JXED 3B5HA 1HINL 3FO2B 5C0CA 1KTDB 4EDXB 4M7KH 5TDPB 1RJYA 1KOAA 5J89A 1OAZH 1PG7X 2F74A 1U8PB 3IFLL 5AD0B 4HJGA 1ZHLB 1QLFA 4XB7A 2MJWA 3FT2A 1ZVSA 5DURB 2NY3B 3BO8B 5IROC 3SCMD 4RISL 2NW2A 4PLKD 5LVEA 4X6CA 3RVWD 4GKOA 1NFIA 3AGVA 5KANG 3JTTB 3WXWL 1CD1B 4DGIH 3AB0C 3RGHA 4HKXB 5IFJA 1TZGH 4YHMH 1H3UA 1IGJB 4ACPA 1OCWL 3QI9D 3ZDZE 4GAGH 1UXWA 4NZUH 3P73A 4DK6A 5GS1A 4PRIE 4QTHB 2PCPB 2FYYB 3B5TA 1D5IH 1QLRB 2F19L 2WANA 4PG9B 5TF0A 3WYRA 4XPGH 5E5MA 3PWJA 3RWFB 3EHBC 4J6RH 1XGYH 2CGRH 4JFXA 4PR5A 1FZKB 4U7MA 4L4TD 4NO3B 2X10A 4JR9L 3LQAL 3NCMA 4C58B 3T0EA 1VFBA 3MXVL 1PDKA 2R29H 2AV7B 4FNLL 4JFDE 3N0PB 1LP9A 1U91A 5JOFA 3B3IB 4X6DE 1I7TA 1AXTH 3KPSD 4C4KO 4C56B 1DBKH 4G8FA 4JPVL 3SO3C 1XEDA 1ZS8A 4NQDD 4XPTL 4LASL 1T03H 3GRWH 3VMPA 4JG0H 4J1UB 4HFUL 3WXVH 4TNVF 2X4UA 3S88L 5CJXC 4JFPA 1FAKT 2ZUTA 1CFBA 3SGJC 4JFPB 4XP4L 1T83A 2X1OA 5FYLE 1QA9A 1U9KA 1G9MH 3MV7A 3MV9D 1IKNC 5IBUG 4Z77B 5C0AB 5F7DA 1QNZL 2IGFL 1A7QH 1YZZA 4XP9L 3D6GA 1MI5D 1IC1A 2VZVA 4X7SH 4JDTL 2ENSA 3VGEA 2ZSWB 5EB9A 3HPJA 4FQ2H 4KJYA 4XPBL 4OBSA 1JHKL 4MJ6A 2YA0A 4ORGA 1L6ZA 4YHKH 4M7KL 4MD0A 5DUMH 3BN9D 2BVQB 2YUVA 1BVZA 3KPOA 1ORSA 2R2EB 4Q58C 2BJMH 3GSWA 5LXGH 2B1HL 3VXME 1AGDA 4M5YH 4N1HB 4S10A 3SDDA 1CE6B 1NLBL 1Q0YH 2ADIA 2ILLA 3PQYB 4EEEA 3VXUD 2DAVA 3D0VA 1P7QA 5CEYA 1JNHB 1AGEB 1O7SA 2XWTB 3SDAD 1HXYA 1IAIH 4TUKL 2KQMA 2VE6B 5E8OB 3DMMC 3WFHA 1Q1JH 3H42H 1AHWA 3BO8A 1QFUL 2IBZX 4PREB 5AD0A 3ARZA 2VZTA 1IGTA 3MCLL 1QFOA 1W72H 4LRNH 5IEHB 5DTFB 3F6IA 5IM7B 3ZTJG 1UB5B 4CMMA 3QUYC 2FEDD 4PRBA 5FB8B 1NGYB 4JHZA 4XTRC 3P11L 5I1KH 1OARL 1ZWIA 5CJOL 1CI5A 3VWKB 4MLSA 5LBSH 4IS6A 2OTWA 4XCCH 1EAJA 2PW2A 1S78D 2W65B 2VITA 2IMNA 2IFFL 4JO2L 3E8UL 4YBLB 4ZXBA 4P9HH 3TF7C 4KK6D 4QWWC 4PGBA 3VFPB 1YYMH 2EYTA 5IR1A 2YD3A 2P42B 5H35A 2EXWC 5JPMA 3DECA 1X7QB 4ORGB 1IM9B 3QUMH 5I75B 1MCPL 4K3JH 2CXGA 4M5ZH 1LEKB 2WK2A 5C86A 2FIKB 3UAJC 3P0VH 3PWPB 2L0DA 2BNQB 5DEZA 4L4VB 5GPRA 1KJ2L 1R3HB 3CU7A 3LZFL 5FKAB 2GFBB 2XQYK 2MKLC 4HWBL 1MFEH 3SE9H 4LLQA 3D85D 2QSVA 4UQ3B 1N59B 2J8UE 4JY4B 3C8DA 2VLKE 4OF5A 4WCYH 3O45B 1YPZF 4MJIE 2AXFB 4XPFL 1MIML 1EHLH 2LU3A 3FZUD 4F3FA 4B0MM 5MEPB 2R0ZH 1ZTXH 1YEIH 3N1MC 3CDGA 3KYMB 5F71A 3QNYA 1QYGL 4JRYA 4JG1L 1S5HB 3D9AL 3RNKB 4RAUB 1TFHA 3CXHK 3CC5A 2M26A 3SQOL 3MRKB 3TPKA 3MRDB 5HPMB 3IU4L 1LP9B 3B83A 5JORB 4KQ3L 3VXMB 5E6ID 5EORH 2HG5A 4CBPA 1R6VA 4HWZA 5CUSL 4Y88A 5C3LD 4OCWH 2MCPH 5KG9A 3QH3A 4PJ5A 3ULUE 4OT1H 3HR5B 4JREB 4BELD 4L3EA 4ZFOB 2I5YL 3W9DB 2CLRB 2AGJH 4NYLB 3IDIA 2PR4H 1BHGA 3QSKB 1A6UH 2WINB 4MA8L 1CDCA 3OHXA 2FSEB 3P9MB 2E5EA 4DUWA 5I19L 2F54A 3MRPA 4NGHL 1ZV5A 4ODSH 4PY7A 5CSZB 1KB9K 5KJRL 4Z7OE 3GIZL 4IRSD 5I1DA 5FO8A 1KJVA 5KAQG 4N9OB 2R4RH 3L6FB 2EYRB 1K2DA 1WBXB 1NBZB 5DJ2B 1G0DA 2C4XA 3QUYB 1G9NH 2NY3D 3WBDA 4XZUA 1ZK9A 5J57B 1OCWH 4PV9A 4YDKH 1P4LA 1FNAA 2ARJB 3QEUA 1YY9C 1NSNH 4OZGF 1V3LA 2A9NH 1A7PH 1G7IA 4JQVA 4L8SC 2Q3AA 4RAVB 4OD1L 5I8OL 1J88A 1A6PA 4UAOC 5EBGA 3FN0L 5GRYA 4F33B 1GZPA 3HZYB 3MLSH 3JWDC 4OUUA 2MPAL 1BF2A 4YX2L 1IGIL 2EKSB 3BP4A 2VDKH 5EOQH 4G9DB 1F4XL 2NPLX 4LLUB 5I74C 1QNZH 5HJ3A 3WFBL 4G6JH 2DQIL 2EICA 1RD6A 2ED7A 3WLBA 1U0QA 3TYFB 3OJMB 1KCSL 2AKRA 3UX9B 4NM8H 3T0BA 1CCZA 1IAOA 2EE9A 4PJCB 2HP4A 3RAJH 5ACZA 2IALA 3GSQA 1W0WB 5T1LD 1I8MB 2E27L 3C6LD 3QUMA 4X5WB 3SJVB 5HHPA 5F89B 3O6FB 2AEQH 4LKCB 5IQ9B 2HH0L 2GCYB 2MHAA 3QCVL 1U8MA 4MXWH 4UIKL 4FQIH 3WN5A 2FHBA 3HUJA 3PGFL 4HZLA 3DURA 1F11B 3FKUS 4NQCA 1BJMA 3BGMB 3A6BL 1ES0A 2E9WA 4XC1H 4Z0BH 2UZYB 2R0KH 4YHNB 2AK1L 1ZEAH 2WW8A 3MLYH 4PGEB 2NTFA 3MXWL 2AS5M 3QZWA 1HQ4A 2AW2A 1OF2B 2GTZA 4Z5RA 2H41A 4NKMA 1WIUA 3V5HA 4HV8B 4GQ9L 3PIQB 3VH8G 4M6ML 3DYMA 1KN4L 4G6KH 4D9LH 3QO1B 1IQWL 1FRGL 3Q5OA 3V6ZB 3BKCL 3HA0A 2VWEE 3RL2A 3KPSE 2B4CH 1B88A 1SM3L 5GRUL 1WC7A 2FX7H 1E4KA 4KROD 2VQUA 5KVDL 1ZHKB 1U2HA 4IIQB 2C1PB 4OLVH 3QG6B 5DUPL 2CIIA 1B6UA 1CFQB 4XXCA 1YYML 2K1MA 2PW1A 1YJDC 3TWCH 3GI8L 2ZPKL 1ETZA 1N6QH 2NY5H 4JQIL 4OCRH 1YMHB 2ZOKA 4IRZL 3E3QC 4M6OL 1WAAE 5DD6B 1XGTB 2B0SL 1R3LA 8CGTA 5E2TL 2ADFL 4P99A 1QVOB 1XH3B 2PUQT 3KAAA 4LNRA 4RMTA 3TYGH 1MFBL 3NN8A 5L8JB 3NPSB 4IHOA 3TN0D 4PV9B 3BIBX 1B2WH 1DBMH 1P6AB 3I75B 4XNYH 1CGVA 5FUZL 4ZFFB 4NP4H 2CRYA 2DLIA 3I6LD 1G9EA 2EYRA 3D85B 3SN6N 5EG6C 1UKSA 5MP6L 4YXHL 1XGTA 3H3BC 5IESL 4BZ1H 1AHWC 3OAYK 5KZCD 1E4KC 4U1LA 4EDWL 4OZFH 5FYKE 4ODHL 1UC6A 1A6ZA 3MRPB 4Y16B 4HX1B 4AH2B 5I18H 4G43A 3DYOA 1AR1D 1IL1A 1A47A 1JPFB 1NLBH 1Q0YL 2DDQL 2OI9B 2HFTA 4M48L 1CFQA 3WFBH 2HMIC 1OTUD 5T1DH 5F7HA 5IB1B 1HH6B 1JWMA 3D2UB 5HVGB 2R0WL 3IDIB 5KSBF 5HVHC 1D9KB 1V05A 2Y36H 3NPZB 1MI5A 3FOMA 1WFTA 4PRDA 2X4OB 4APQA 3D3VB 1WCBA 3Q5TA 2HG5B 5IVXB 2OS7A 2HLAB 1FFPA 1NCBL 3PP3H 1RZFL 4FQQB 4FZEL 4P2OA 4BQCA 4HD9A 1I7ZA 5IHZB 3TH4T 2D9CA 4QRUA 1A6VH 2OK0L 1HDMA 3PGDB 5EC1B 5LGHL 1ZGLB 4X6FA 5FFLA 4HLJA 3OXRA 4Y5YA 2DYPD 1YY8B 4R96B 5T33H 2RCSL 1R0AH 4K3EH 1A7NL 3AAZB 3LRGA 5IHLB 1AFVH 2AXFA 5JO5B 4CU7A 1CLCA 5IJKC 4XGZA 4P57A 3JV5A 4JY4A 2GJZB 5JLZA 1P7QD 5FAAA 3DVGA 3MUJA 4UQ3A 3N9GL 3QPQC 4JN1H 5D2NB 3QI9A 1Z5LA 4FFWC 4ERSL 5ITFB 3PHSA 2CUHA 3JWOC 1H0DA 4HUVA 4QHUA 4HIXH 1RIVL 1PKOA 3ZE1F 1J5OH 1F6FB 3HG1A 3Q6GH 5MEQB 2AKRB 1BZ9B 1MLCA 2EC9U 2IPUG 1X9QA 4Y89A 2X1WL 5GSRA 1EX0A 3UTSA 4XI5D 3RY6C 5CINH 2AXGA 3T0ED 4MQSB 5CCKL 5BMFH 4BFGA 3NH7H 2G75A 2FHCA 4EN3C 1ADQL 3L3KA 1OL0A 2VITB 3IAPA 4QHKJ 4ZS6D 4PLNC 3UTPD 4IS6B 3D69A 4GW1A 3R0MA 4LPUA 2GJ6E 2CKNA 1DUYB 2WBJA 4L29B 4Z7WA 1AO7B 5C0JB 1NGYA 4PJ7F 3RIFK 4DN3L 5ACLA 5E8DL 4OF8A 3ULVH 2Q20A 3DSFH 1MQ8A 3WHXA 1CFVL 5C07E 4W4NA 3MRMB 2Q3ZA 4F57H 4LAJH 1H3XA 1IGCH 2ENYA 5GS0C 4UV7H 3GM8A 4G7VH 2DQGL 5DEGA 4PLKC 1XR8A 1D6EB 4KUZL 3VFVA 1AHWB 5CSGA 3LKQA 1AR1C 4LL9A 5FO8B 2FR4B 5IFAL 1M71A 4OM0H 3PQYD 4FG6C 5EZOL 4BA8A 1BP3B 5A2JH 1VACB 4G9FD 1J11A 5AAMA 4J7RA 4UQ2B 4X0KA 3TT1L 1U8KB 4HXAH 2OP4L 1KJ2B 2PYEB 1Q9OA 4LSRH 2AI0H 3WFDL 1MY5A 3BH8B 4YEEA 3E3QE 4K71C 4PUBH 5BOPA 4HUXA 1BAFH 4I3SL 3R8BB 3TFKD 4UINH 2A77L 3QRGH 2FHFA 3V7AG 2V5YA 4G8GB 1BX2A 4K55A 1T04B 3KLHD 1ZEAL 5I1EL 1YEFL 3CFEA 3NIDF 2XICA 4NRXA 3GMNB 2CRZA 5SWZA 1EFXB 3VU2A 5MENA 2DM7A 3MBEB 2VWEC 2NZ9D 3BN9C 3AS3A 3QA3A 3MRDA 4QKXB 3UBXI 1FG2A 4ODUB 5CGMA 3DMMA 5I1KL 3QUKA 3EJZC 1F6LL 1AY1L 1J8HE 2JK5A 1MWAA 4R7DA 2H2SD 5B38G 3TV3L 3H9SB 2V5SA 3EKCA 1RUAL 3EO9H 3FB7B 4R97C 3QNYB 3HZMB 1A7BA 3VA6A 5IJKA 4H1LH 3TBYA 1MJJA 2X4RA 4PJGE 2Z8SA 3MCLH 1FH5L 1MCDA 1OP3K 1GYAA 3KYNA 3ZYJA 5FUZH 5KOVC 2F54D 5CP7A 1RK0A 3L3DB 1QLEH 4HPOL 2ZSVA 5JHLH 2DL9A 3QQ4A 3RWCA 2DJSA 4AENA 4YBQD 5C08D 1TCMA 1CDGA 3RA7H 4LDEB 2G9HA 4BK5A 5E1AB 4FQHA 4QRTA 2X7LB 2J1KA 3LQMA 5BCAA 3QNZB 1R3HA 1R3IL 4NRYB 4F9LC 3T1WA 3QCUL 3EGSB 1C16A 5IMMB 1FYTA 5JPMB 1X5XA 4TTDC 1RVFL 3D0LA 2A9NL 5IR1B 5D7KE 4DVBB 4DN4H 2VR4A 1I1CA 4PGBB 3B8SA 3RQ3A 1K8DA 3TVMB 4XMLL 5AZEL 1QLRA 1TVDA 1RZGB 3BUTA 5F6HJ 4WTXA 4EXKA 3OKLB 1RZJH 4GSDH 2UYLB 5DJAB 4R97B 3CFKA 4ISVA 3B4NA 4GRLB 1KENL 4Y5XC 5D7LD 4XB8A 3DGCR 4YE4L 5DRWB 5FECB 2VAJA 5IM7A 1WBZA 1UH4A 2XKNA 4IJ3B 2RFXB 5IEHA 3JBG7 3RWIB 1DL7L 1BMGA 3FT2B 4PS4L 4N5ED 3BIAX 5C6TH 3BDBA 2XA3A 4X4ME 4WJ5B 1KGCD 4NZRL 3LS5L 2PN5A 2R1XB 2ICES 1OP9A 2AJYH 1HIML 1OGAA 3GKWH 1VFAA 1QZ1A 3MLXL 1JNHA 2CJUH 3W9EA 2GSGB 5AUMB 3FL7A 2IPKA 1Q94B 2IJ0C 4XHJC 3CH8A 2IH3B 4LP5A 3HE7D 1MAMH 1FC1A 2YA1A 1C1EL 1JL8A 3RPIB 3F58H 2LVEA 1KTLB 5FGRA 2UWEB 3T77B 5IB2B 3PP3K 4GMSL 3LMJH 3FTGB 5DFWH 3SY0B 2W1NA 2G5BA 4OLXL 5I8KL 1BOGB 4HS6B 3ARGB 4IEFB 1GGBL 4WUUD 2LAGB 4WI6A 3ALWA 2UZIH 2Z0BA 3MQIA 4URTB 3FB6B 4YBHA 1QACA 5GZOC 4G3YL 1H15B 5KTEH 2X05A 4M6AA 1IT9H 1MEXL 2Z4QB 2YN3A 4MXVF 3MUHL 2P5WA 4HS8L 3LIZH 4WV1B 4K7PH 1UWXH 4WFGE 1E4JA 2ADFH 2AK4A 2HKFL 4RWYL 15C8H 3U0PA 5DD0H 1VEPA 2CSPA 1Y6MR 3DSFL 2HJLB 1HSAB 2P7TB 4PTUB 4PB0L 4MAYB 5HGDB 4F58H 1N6QL 4P9ML 1YEKH 3MV7B 1WZKA 1AXSB 4XBPB 2EDNA 4HUWA 5DJXA 3MA7B 3WUWA 1BWWA 2D7OA 2FO1A 2PETA 1F58H 2YD7A 4NC2B 4OLUH 4PJ8D 4ZQKB 1PG7H 4LRIC 4NM4H 2FLRT 4U1HB 1NEZA 1XIWA 2OR8A 4MGXA 4RA0C 5TQ0L 2VDOH 3ULSB 4G8FB 3CMOL 4PJFB 1ZT4B 3NIFE 3INUH 3WCYA 3W5NA 5DGQA 2NXZC 5FDYA 5IMLB 2DBLL 3MUGB 3QUXA 4FQCL 1V7ML 1GVIA 4NQCE 4PYGA 1P84J 5EH1A 2Q87A 3VDBA 2HFEB 1QFHA 1T5WB 1ZLWH 5BS0A 5HHNB 5JHDE 2VOTA 5K9KB 4J23A 1Q9WB 1SEQH 2PYED 4U1IA 4LRNL 2OM5A 4HGWB 1EEQA 3X11A 3GSXB 5F9WC 4I18A 4PJBE 4V2BA 3WNPA 4U1KB 1UJ3B 2PYFB 3RWGA 2CLZA 1PFCA 2CD0A 1T5WA 3QDMA 4MX7B 4NKIH 5EBWB 4I3SH 4JZJC 5D2NE 2A77H 3QRGL 3WS3A 2A74B 1S8DA 3TBTA 2EH7H 3VWKD 4RDQF 4W4OA 1A4JA 3QXTA 4IRJD 1QLFB 4ZUVA 5HHOE 2ICWI 2A6JA 4R0LA 3KPMB 1KLUA 4JO4H 3TNNB 4OZ4A 5FM4A 3OPZL 1VB9A 1D9KC 4JQXA 4OM1L 4OFDA 1DQDH 3FONA 2FBJH 4R90H 3FO2A 2BSTA 5EBLB 2DMKA 4KDWA 4DZBA 1XF3B 3OKKA 1CICA 4OCRL 3G6DL 2QTEA 4HJ0C 3CX2A 5FGBA 3L9RA 4KKCD 4Q6IA 3VXPA 3MA7A 1ZT1B 2NY1B 3WUWB 3B9KC 2AP2A 4YXKH 3C8KB 1DUZB 5C09D 1VPOH 2P7TA 4PTUA 2FX7L 3RJDA 3HRZB 4BZ1L 5CFHA 3X14A 3ZKQD 4LIQL 3U0PB 3DTXB 1KCUL 4JDVB 4I0PA 2XZAH 4XBGB 1EFXD 5DVOA 4HUNB 4QO1A 3AMKA 5J0BA 1J0KA 4Y5VB 4PG2C 3RJQB 1T1WA 4YBQC 3L5XH 4HIIB 1H5BA 5A1AA 2XKUA 3W11D 2JJSC 5FDWA 5D70H 5KSAC 1CLOH 4YHPB 2DKSA 4YUEH 5DJ0B 3HUJF 4WU7A 3UTSD 2D03L 1GZQB 5D70L 4P2RA 5FM8A 2X4NB 4M61B 4PRPA 5D5MB 5I1JH 1ZA6B 2A83B 4I48A 1KTLA 4L8SA 4GT7A 1QG3A 5SWQB 4P3DA 4P4KD 4KRPB 5EUOE 1ROWA 3BJLA 3L7FA 5C0BB 4K23H 5DA4A 1MCJA 4KH2A 4JRXE 4P23B 5B3JF 1OGAB 1KTKE 3C6SA 5DJDA 1G6RA 3DUSB 1WCQA 4BSVA 4O4YH 4UT9H 3CH1A 4GRLC 3QUXC 4OFYD 4NHUA 1CQKA 4HWNA 5DJ8A 4PJXA 5E2JA 2Y6SD 5DQDL 2BVUA 3KPNB 1T83C 1MIEL 1IKNA 2HMID 1KN4H 4G6KL 4LBEB 3DO7B 3G5YA 1QPPA 5F7MC 3T4AA 3QXAB 4O2CB 4UOW1 2ICWA 3J8F7 4NKDB 5LGHH 4OTXH 1FO0L 4ZO6A 1GGBH 4APQD 1A6WH 2ZP0T 4KTEL 3LMJL 3CNKA 4M7JL 2LABA 3NA9H 4P2OD 4NN7B 4TUJB 1IQDB 4YDVB 5D71L 4FFVC 3U36B 4QXUL 2I9TB 1C1EH 1KLGA 2GITB 3V4VL 4K94H 4L3CA 4JJHA 3AM8A 3HC0B 2Y5TA 3B43A 3L3OB 4KDTA 4WI3A 3FQTA 4OCXH 3NFNB 3RWEB 3DUUB 4P46C 4XP9H 3HE7C 1HIMH 1XGRA 1CG9A 1TZIA 1X4XA 4W6WB 1C16B 4M4PA 3ROLA 3O9WC 1DTUA 3QO0B 5MEND 1TCRA 5I9QC 3LN9A 3STZB 1NUGA 3WKMH 2X7LA 3MRGA 3L95B 3ULSA 5GRVK 3TBVB 3G5XA 1WIPA 3LKPA 1AGCB 4U1HA 3BP6A 3MBEC 3OGOE 1IBGL 4K8RH 1JPGB 5FA3B 5FUOH 2EDYA 3S3SA 2JJTC 3NFPA 2WP3T 4RCAA 4BZYA 1GH7A 2W9DH 3RDTD 1FGNL 1HSAA 3BD3A 4MJ5B 3FB7A 3UJIL 2I9LB 1KCVL 2Y23A 1QRNE 4I9WD 2FZ3B 1MWAB 1H5BC 2VIRA 4NM4L 3BPOB 5EUKB 2FLBT 1YPZB 3RY5A 3TBSB 3QUKB 5DD3H 4P2YA 1WAAA 4AMKH 3RL1A 3AY4C 1AIFB 5F7WC 2OL3A 5I73C 2FNBA 2NXYC 5BOZG 4JHAL 5E4EB 5GQBA 5I2IA 4MNHA 2KZWA 3VJ6A 2ICWJ 1N7ML 2VJXA 5F88A 3V8OA 3KNBA 3CVHB 3ARGA 5TGBA 1YUHB 3NCFB 3V5KB 5J56B 4G9FB 2FBJL 4H88L 4KKCC 3H6JA 4PP1C 4WFED 2J88L 1PYWB 3O3EA 3GUTB 4JAMB 1HI6A 1MFCL 3L5WA 5JZ7D 1KN2L 4QF1B 1OAZL 2IFFH 2NR6C 5SWSD 3TJHC 3X13A 3MO1A 5FHBL 4H1LG 2EO9A 3ZDXE 5D4QA 5LCVL 1CR9H 2FR4A 1IVLA 4X80L 3MOBH 2C7UB 1D7FA 3T0AA 4FQXB 3EYOA 3P4MA 5IMOB 5J1SC 5ETUB 1M7IB 3FT3B 3X12A 1YN6B 3BE1H 1I1AD 4WWKD 2WUCH 4LPYA 3TN0B 1ZHBB 3AY4A 1QBMH 1CLZL 3MCG1 1Z3GL 4JFFD 3IU3A 4ZOCA 4JFZL 3MA9H 1OGTB 1CGSH 3A6OA 2YD6A 4HKBA 5HHVH 2HT4C 1RI8A 4U1NB 1OGAD 43C9A 5EU4A 1YQVL 5E6IB 3RZCC 4BK4A 3LEXB 4Q9BA 2VB5A 3PWVB 3DXAA 3V5DA 5KW9H 3BP7A 4LCYB 1UADC 3HE7A 4B7LA 3DV6B 2AERT 3DXAB 1RZKH 2APWA 5C8JA 3GMPA 3LEVL 4N0FB 3RUGE 1K8DB 1CFSA 5L9DH 1GHFH 5ENWA 2DI7A 1Q38A 2EE3A 1RZIA 3VRLF 1JGLL 1U8HA 4P49A 5CGYD 2P46B 5GGUB 3ILPB 3RX8A 5D9SB 3SE9L 4OV5B 4M00A 1T7ZA 1JGDA 4LLWB 1YEKL 3MNVB 1HE7A 5FHAL 3RBSA 3VXRD 3BGFC 4FQ2L 1UWGL 3MUZ1 3UCRA 4BH8B 1MJ8L 4NO0A 4S0TD 1Y18B 2ZNXA 3FB8B 3I50H 4KFZC 5DHVB 4FQHB 3PHQB 3QI9B 3MV7E 5FM5M 3VFTA 5LG1A 2G9HB 2CK2A 3AVEA 2ARWA 3DVGB 3P30L 5DGRA 4OJFH 2FECL 3JWDH 1NH6A 5C9KA 3TBWB 2EDHA 3K81A 3X13B 2XZQL 4YDLC 3SKJL 5C0NC 2B1HH 1KELH 2ZCHH 4PY8I 1V7NH 5AWNL 2DYPB 4UDTA 3KYNB 2DD8L 3VH8B 5HVHB 3UBXA 5HHQB 4PJ8A 5IG7B 1HYRC 2D4FA 4UTBL 4X4MA 5A43C 5DK3A 2O5XL 3DUHA 1S7XA 3S96B 3TPUA 3RTQC 3WUWG 5KJRH 3VJ6B 2DQDL 2E9JA 3F6LA 3UYPA 3PDDA 1GGCH 2VXUL 3ARGC 2OTPA 4P46D 4PJ7A 5AYUH 3WSQH 3HPLB 2OL3B 4P5KA 1BD2A 4WW2B 5D7LA 5F3HA 3IYLW 3VE0B 2NNAA 4G8GA 5ESVB 3BKYL 2ESVA 4QGTA 2I5YH 4AIZB 3MGOA 3EFDL 5DURD 4RFEA 3E6HB 4R9HA 5T1MA 1BBDL 2I07B 3VH8A 4JRXA 1FP5A 2PYEA 5CZVL 5DQJB 4KJPD 4ZO7A 1GGUA 4HX1A 3FQXB 3L3HB 3DXAE 1EFQA 3TCLB 4MAUH 2P5WE 3C08H 5T33L 2N4IA 1JYVA 3R1GH 1WWWX 1UEYA 2NY0D 1I85C 1C5DA 3G5XB 3LKOA 2E6PA 3GB7B 1Y18A 4H8WC 4LOUD 4IRJB 4TVPH 3V7MA 1TJGL 4Y2DB 4LRIA 1MIMH 4PGDB 3UZVB 2NX5D 1NGXA 3T4YA 3QJHA 4B50A 3K2MC 3ILPA 1TZIB 4WUUA 3ABZA 4HBQA 1QSFE 3NACH 2BY0A 5ACMA 4LVOC 3HC0A 1YMMD 5ISZD 3EYUL 4PJXE 1A7QL 3UYRH 4MJID 1FHGA 3A67L 1U8NA 3QCUH 2NY5L 1D6VH 1J1PL 3GBLA 1S7UA 4W6YB 3QQ3A 4JZOA 1IQDA 4YDVA 4PJHF 3V79C 3IFPA 2FGWH 4LF3B 3PWVA 3ARDA 3IFOA 3NMEA 2G75B 2YD8A 4KJPC 1JNNL 2ORBH 3MV11 3OG6B 4NFBA 1NC4A 3H3KA 4KK5D 4NC0B 1S9YA 4MDIB 2WWKO 1U3ZA 1KB5H 3G04B 4Y8AA 4PLJD 1JK8A 1H0DB 3NABL 5FYJH 4PYHA 1XIWD 5FGCE 3EYOB 3R06A 3GSNH 1I8KB 4Y2DD 4OZHE 5DHYB 2EDEA 1FNSL 2DLHA 4KDTC 4HH9B 1HYSD 3NIFF 4AEHL 4PGEA 1EUUA 1GJIA 1CVRA 2GJZA 4LPVA 1N5YL 3TO4D 3OKNA 3QDGA 3KGRA 5JO5A 4XNUH 1OAKL 2VQ1B 1HI6B 1PBYA 5GGSA 1MFCH 3H2WA 2MHAB 3V0WH 3WNNA 3HMWL 5BV7B 4TUKH 1Q1JL 3H42L 4UTAL 3QUMB 4E0RB 5IMKA 3VD7A 5I1LA 4LCCA 4DVRL 1J12A 3ZKNC 3WFDH 1T6WA 5F7EH 1W0YT 5IK3A 5J3HD 2RCSH 3BQUB 1R0AL 1WIOA 5C1MB 5KSUB 1OP5H 4GQ9H 3U0TA 1T5XB 4WEBL 4WTWA 4HFWA 2OJEB 1UWXK 4EUPG 1C5BL 3JUZA 5I6XC 3QWRD 4L9LB 1EHAA 4OQTA 1T2QL 2HKFH 4RWYH 1C5CH 4X7CC 4Y4KA 4CMHB 4APQC 1GL4B 4HCRL 2WLZA 4M93B 2PXYD 5DMGC 4Y16A 3HZVB 4JJ5B 3L9RB 4F57L 4DK3A 5C2UB 4NDMB 5FCSH 2AJXL 3C2AL 4PJIF 1AGCA 3B9DA 4H0HB 3QIBC 1X5GA 1FVEB 1EDQA 1NCWL 3MRJB 1WZ1H 2IGFH 2ARJA 3QEUB 2JE8A 1X5YA 4QY8B 2VDQH 1JPST 4XCNA 1MWAH 1T22A 5CKGA 4XAWH 3K8MA 3HFMH 3GSOB 5GSVB 5C09A 1NBZA 3RAJL 4ODHH 2HJFA 3ZT5A 3ROLB 4Y19A 3HAEB 4MCYB 3ROOA 3EO0B 1P7HL 4UV4H 3ZYOA 4KWUA 5TF1H 3L6FA 4KC3B 1R3JA 2F8VA 3DUUA 5SX4H 2DQIH 4G6JL 4N5EC 4I0PD 2AEPL 1EBAA 1ZA3B 2Y5TB 3L3OA 4UB0H 3GZKA 4U1KA 3QI9C 4Y1AA 1OSPL 4PLOB 5F7FA 2BNQE 4YHOH 5HGHB 5ILTL 1GGTA 4M8QB 5ICYB 2FO4B 1I7RB 3L5HA 2YEZA 1F45A 5HHNA 4I77L 4OLYH 3V2AR 1OPGH 4NQEA 3VFWB 2H6PB 3DX8B 4YNYA 4G80B 4Q0XH 1Z9SA 2XG5A 4U1SA 2DKMA 4OFIA 1RZJL 1MCWW 3CFJA 3OKEA 1KELL 1YY9D 2COQA 4NQDA 4LFHG 2WWMD 3T3ME 1V5JA 5DJ8B 3WNLA 5F6IC 1RJZA 3DOSA 3V6BR 5EOCL 3I6GB 1MAKA 3MRKA 4NHUB 1KIQB 1RMFH 2A6IB 3KDMA 4DVRH 2PTVA 4BSVB 4OFYA 5DJDB 1EK3A 2Y9RT 3FFCE 43CAA 3ARGD 4YPGA 1X3DA 5EIIB 4A2MA 3HNTH 4J2XA 3ZDYF 4LLDB 3V4PH 4X8JA 4J3OC 1F11A 4HZAA 5FK9A 4P3DB 3HNVH 4Q9QH 5DJXB 1J1PH 1QD0A 3DRTA 1EA9C 3KPRB 5HYSA 1OW0C 1ZA6A 4NN7C 2CDGA 2VDRL 3F7RA 4O02L 5I66B 1QP1A 2K7PA 2EIEA 1N59A 3ORJA 5C0RH 1N4XH 3DVNA 2JJTA 2O61A 5IQ7H 4KK9C 1XGPB 4ONHA 4L4TB 2IH1B 2NY0B 4Z7VA 2VR5A 3QDAA 4X4XB 2GFBA 3WO4B 3D48R 1NCCL 1PZ5B 3MMEB 1LO0H 3PWNB 3T2NH 3C6LB 1FL6A 4JLRA 1MCPH 4FXLA 4OZFB 2FJHA 4ELKB 4UOJA 4GOSA 4LSPL 1P2CB 2WSKA 2WUBL 4OGAC 3ZE0F 4CMHC 3IDJA 4FXGA 4JFED 4LSUL 1M05B 2R15A 3VFPA 3EOBA 4XPHH 5IT2L 5LWYH 5D8JH 2JJVA 4HT1H 4ZXBB 5D72H 4XVSH 4S2SA 3GMRB 1S7VB 2OL3H 3DXAD 1HH9B 2HYMA 5EZLB 4XVTH 4KI1A 4U6XA 4U3HA 4HWEH 3BOVA 3SDAA 1I8IB 1XF3A 4KVCL 2NCMA 1AQKL 1FSKC 5GZND 1JTOA 4X5XA 5FYKD 1XF1A 4TTGA 2JCCA 4R0LB 2E6JA 2EDQA 3RDTA 1Z0MA 1U3HA 4UT6H 5H8DA 3VXRA 1HKFA 3WS3B 1LP9E 1WV7T 3KS0J 3IKCB 4KZEL 1HXYB 1N3NA 4FTVA 5CMAB 1CZ8L 1KXQE 4HGWA 2DQCL 2P45B 25C8H 3SDDB 3MYJA 5AG8A 1HZHL 3VXSE 4HBCH 3TJEL 5L88H 2WZPD 3M07A 5D1ZB 4JM2A 3SKUD 4WY7L 3RZCA 5E08L 4XP1H 3IDMA 4PJIA 2HFEA 2VUYA 4L3EB 1ZLWK 4AEHH 3MGTA 5GZOD 4WI4A 3QH3B 4PJ5B 2NY4C 1NDMA 4MS8C 5KVEL 2H2PC 5SWSA 4GS7C 4LAQL 4WW1B 3RX5A 2VQTA 1QSZA 2ZSWA 4UDUA 3PWLB 5HHOA 3TGXA 2J5LB 2QKIB 3S7GA 1LD9B 4KHXL 5DR5L 3ZE1E 1R5WB 4Y5XA 5CINL 3CSYB 5TF1L 1MH5A 3T1FB 4NN5B 1AGFB 1QTYT 1IC5H 1QKZL 1MCCA 2A0LD 1YEJH 4M03A 3EYSL 4Z77A 3QFDB 4K94C 2PXYB 1BQLH 4OFVA 4MB4A 4F3FB 3TO2A 2D31B 4UNVA 3M8OL 3OTTA 4LEXH 4OB5L 1RIVH 2YZ8A 4JG0L 3WXVL 4KZDL 1Q9LA 1ZT7B 2VLKA 2Z93B 2VSDA 3ZE2F 5LXGL 1OAUL 3U83A 1S5IH 2RBLA 5DLMH 4Z0XB 5E8EA 1TTFA 4JM2C 5A3IC 5E5UB 1DBKL 3V0VA 1BVKB 1S9XB 1MJUH 2X9WA 2QSQA 5DUML 3PL6C 4U0RB 5D1ZC 2ADJB 3G6AB 1OD7A 4HS8H 4JRYE 4R7NA 3LKNA 5DEFB 4F7TB 3GJEB 3MLVL 2OP4H 1G9MC 5C0FA 4MQ7B 3BZDA 2FIKA 3RVXC 1B9ZA 1C5CL 2BFVL 4NRXB 1XGUB 1H9VA 1T0NA 3N1QC 2Q8AH 2R8SL 4JFXB 5C0IA 32C2B 4LDOB 3D25A 4QXWA 8FABB 2GI7A 1IM9D 3KPPB 4GAJL 4HK3N 3K2UH 3RX7A 3SEPA 4BKLA 3FQRA 3QHZL 4D3CL 1HHKB 4OCSH 3O81A 1DN0A 4G7VL 1MY7A 4PTTB 3BW9A 4N0YL 4X83A 2J88H 2OX5A 2OTWB 3V6OA 5E9DA 3OZ9L 1BZ7A 4ODWA 5IVOA 5D2LB 4Z7UE 5CIPA 1VFAB 4K71B 2LFGA 5IW1B 3LQZB 1N3NB 5CMAA 4O4YL 2GJ6D 4UT9L 1DSFH 1P1ZB 2R1XA 4QRQA 4CMMB 1T03L 1F6AA 5DC0A 1NDGB 3RTQB 4O5LL 1JRHL 2EYSB 3E8UH 4JGMA 3NCBB 4FG6D 1VGEH 2KUTA 5I19H 3BISA 2BXZA 5I17B 5LJYH 1I85A 4PB9H 3RWIA 1FDLL 3RHWK 3MXVH 5F1OB 3RTQA 1OARH 4Z7UF 2L7JA 1DL7H 5C0AE 4L9LC 4WEMB 3WHXB 1IAMA 5C2BL 1LDSA 3K1KC 5KN5B 3GMMA 4UT7H 3KYOA 3LSOA 1WTGT 1U93B 3BHBB 3OKLA 3QDGD 4HK0A 5ADOH 1JNJA 3ARVA 4NQEE 3HI6L 1TQCC 1YYLH 4U2YA 1SY6H 3KPOB 4YDJA 2ESVD 1KCUH 4XP5L 1M05A 1L9MA 2DS4A 3EO1A 3TYGL 2JB6A 2C3WA 5F8RC 2BERA 3EDKA 5E2TH 5FM5O 1ZLUK 1X5ZA 3SE3A 1UM5L 1VADA 1WGOA 2V5RA 3VFGL 3B9EA 3IJYA 3GJEA 3C6LA 4X6DB 1S9VA 5ALBH 1OTUC 3QNZA 2QR0B 5T3ZL 4NN5C 3B6SB 3LCYA 1BVKA 1P4BL 1S9XA 4CVXA 5B3NA 1AJ7H 2O61B 3BAEL 2H32B 1QQDA 3DX7A 2HTLC 4GRWB 3RBGA 2APVA 1UKQA 4N8CL 1F3JA 3NVQA 2VXTH 4WRLA 5MERA 1KJ2H 2VLJA 5F8QC 3NZHL 2JCCE 3QUZC 1K4DA 2B4CC 4TQEH 4Z7QE 4QRSA 1OB1B 4ZPVB 3O2DH 3TIEA 5FK9B 2PXYA 3OJ2C 1A0QL 3QT2A 4XBEL 4OM0L 2FB4L 4PRIB 2W9EH 5EC1A 3CSYA 1IBGH 4K8RL 1ZGLA 2Y36L 2HT3D 2OQJB 3VI4F 4MS8D 2OXHA 2BNRE 3QP3A 5DSCB 4UNTA 3TN0C 5DWUL 1EZVX 4UV7L 2ZCLL 4UUJA 4FQQA 5E7FA 2DQUH 3SE3C 2DI9A 3QA3B 3ARDD 1D5MB 4BFIA 2LV4A 4NIKB 1SEQL 4NQXB 4NZJA 4W81A 5MENB 3H7BB 2VXQL 3C9NB 1O0VA 2OCFD 4G80A 4Y19D 5IWLA 5GRZA 2HH0H 2ZKHH 1RZKC 4YHIA 2XWJA 2IANA 4AIOA 5C07B 2Y5EA 4PG9A 1S7SA 1RSFA 2QADB 4ZD3H 5JNYB 1BVLB 5CILH 1H8SA 2VXUH 4Y2DC 3SE4A 5K59F 1UXWB 4ZSOB 3GHEH 1QFUH 3W2DL 5EWIL 4FQXC 3BPNB 2JJSA 1P4IH 4WUKH 5I8CB 1XGYL 4LSSH 2DQTH 4U1MB 3U0WL 1MCNA 5KVMC 2A6KB 4KV5F 3LKQB 4J4PA 3WKML 1X4YA 3IDXL 4ZTOH 4FABL 1IGIH 1N26A 4AL8H 3VGAB 1SMOA 5F1KC 4G9FE 4X9FA 3RDTB 1U8PA 3GSOA 4ENEC 5AG9A 3KXFE 5BVPH 2H3NA 3MPCA 5HI3C 3THMH 1DSFL 1K4CB 4JB9H 3FOLA 1X5AA 3WJJA 2I60L 4L8DB 2X1QA 4O2EA 1A1OA 4CU8A 4L29A 4Z7WB 15C8L 3MRHA 3BT2L 2X9YA 2VLLB 5HDLA 2Q7NA 1HWGB 2A2QT 4XWOC 5EBMB 3CDYA 4Z8FH 1D5ZB 4RMWA 1IARB 1S7VA 4POYA 3GMRA 4K8RC 5JW3H 4Y4KB 4G42A 3MRLB 4TSAH 4QT5A 3KHQA 1YEGH 3SE4C 1FORH 2VAAB 3LRHA 5EU7C 5FUOL 5GS2D 1JGLH 1F13A 3T0VA 1EGJL 2BDNL 1SYVB 1GIGL 2E8ZA 4LVNC 3SKNB 1KFAH 4FQLL 1ZLSH 1JUFB 2VZ3A 5GSRB 4Y4KD 1JFQL 3PV6A 3QR2A 3RL2B 2NY1C 5ISZE 3PHOB 3QNXB 4S1DD 3P4OA 4YGAB 2NY1D 2EC8A 4P5MB 4ZDHA 3DROA 1ZLVK 5C3TA 1T21B 4FRWA 4IDJL 5F1NB 3PIQA 3PWNA 3VD3A 2BRRH 3ULUC 2F58H 2X5PA 2FATH 3MRQB 3NTCL 1FIEA 2J4WL 4P5TC 1T20B 2CMRH 2AEPH 3ARBC 3LN4A 5L0QC 1VKXB 2DLGA 1SMAA 5JLZB 2EXYD 4XGZB 3UTTB 5DRZA 3HAEH 5MI0B 4J3SA 3VGGA 1DQML 2HFGH 3MLTA 3PV7A 3QIUD 1FYTE 1PX3A 3QDME 5DRZB 3ET9F 1ACYH 2RJMA 3QDGB 3EDJA 4NHCL 2YPKB 4KKAD 5HI3D 5I1HL 3MOBL 5EIIA 4PJEE 2NXZD 4X6DF 2HKHL 3FN9A 3H3PH 5H37G 4JVUA 4XPGL 1A9BB 1MQKL 1RURH 3R06B 5DO2D 1OW0A 1W0WA 3W0WD 5D6CA 2F5AH 3UJTL 5KVEH 1IAOB 4G8EA 3UYOD 2GK0B 1TZGL 4YHML 1U3HD 4X99A 3LEYH 4LVOB 3BXNA 1JUFA 3GBMH 2Y06L 1S7WB 3VFNA 2EDOA 1OT1A 4G42B 3KPRD 1OSZB 1HZHH 5T5NG 1G7QB 4JQXC 1EEYA 1NCNA 1KBGH 2GW5A 5CJQH 2WBJD 4OB5H 5DUPH 3QQ3B 4JZOB 4TULL 4ZTOL 1QEWA 2ATKA 4FFZH 1A1OB 2J6EH 3RNQA 4L1HA 1S78C 3O3BA 1G7PA 2XPGA 2XZZA 1R24B 4QLRA 3ZDYE 3GIZH 4WHYH 1QSEB 1YJDH 2H9GB 2APFA 3QJHB 2E7LA 3GHEL 1UCBH 2UWEF 3W2DH 1MHHA 1AH1A 1P9MA 5ITBH 4XVJL 3S4SA 3S8WA 5H94A 4QY8A 3MNWA 1QFWH 4YDIH 4GAYB 1FVEA 4AYFA 5GJTL 4PG2A 2C26A 4U33A 4WUUE 1IM3A 4WI5A 5I73B 4PY7B 1QSED 1T3FB 5EPMB 4OLUL 1ETZB 5DQJA 3EOTL 3C87A 5JNYA 4P5TD 4LU5L 1NEZG 3VRJA 2ZCLH 5FYKU 3VFOA 2CIIB 4S1QL 1S7SB 4JFEA 2C1PA 3BJ91 4RMUA 4E42A 1INEH 4L9LA 1BQHA 2YXMA 2XWJB 1HSBA 4Q7DA 2E27H 2DM4A 4M7LL 4DKFL 1AQDB 3IVKB 2W9EL 5SWZD 3MV01 1OLZA 5B8CA 1D5XA 2YHGA 3HE6A 4NQXA 4DWHA 1JN6B 1F3DH 5E1HB 2XRAH 3PXHA 1L7TH 4YO0A 3F62A 2XG4A 3ARYA 4D9LL 3MRFA 3P9LA 3LOWA 4DGVL 4NUJA 4OZIF 4JFFB 1A9BA 5EZOH 2OQJA 5CS7A 1P5VA 1CDIA 1N8ZA 3GRWA 1I1FB 1GAFL 3KYMA 3VD9A 2I27N 1ES0B 3NAAH 1R3KA 5I1HH 4JPWL 4DTGL 4TVPE 4BUGA 5FYJE 1QSFB 3RWJA 2VN4A 3GNMH 3HNSH 4AMKL 4MA1C 3S34L 4HKJA 5JDJA 4Y1AE 1TJGH 4Z7VF 2W91A 3I2CH 2Q6WB 4WO4B 4U49A 1V8HA 2X4TB 1S7TB 2FL5B 3MOAH 3BGAA 2H32A 3DX7B 4FQ1L 1RMFL 4XP5H 4C57C 3QIUB 2GJ6A 2B39A 1T4KA 1KNOA 4PY8J 4EIGB 5IEKB 4OF3A 2IALB 1LO3L 1MEXH 4PJDA 5ADPH 2PYEE 3S35H 3JVGC 4N0UA 1FYTD 3QDJA 3F8UB 4TNWK 1FNGA 3NFSH 1MHEB 2UVEA 4MXVE 4QOKB 5DFTA 1IC5L 3ARSA 2N56A 2P47B 3H7LA 2P5EE 5EC2B 5DF0A 4AM0B 2QQLL 5EWIH 3MJ9L 4X9BA 4HJ0D 4QT5B 3D3VD 1IAII 3L5XL 3S5LA 4ZPTB 3HZYA 2X40A 4LF3A 1D5BB 1UH3A 4F33A 5HHOD 3CSBA 2PW2B 4JDZA 1U93A 2Z31C 3BHBA 4P4RA 1XF5A 3LEXA 3SGEI 4WVRA 3H9YA 1DBAL 2EDLA 5HDBF 4KMTH 4LIQH 3V6FA 5KN5A 4Q9RH 4WWID 5EU6D 4U6YB 2O5XH 4L3EE 3OF6A 3IDGA 1JNLH 2BOCA 5FA4B 3WS6C 4DW2L 1DBJH 3UDWA 3QEGH 4RGMC 3GSNA 4RIRB 1DEDA 2QSCH 4LK4A 5DVKA 1RZ8A 1U41A 3DETC 2ZCHL 3VXUE 3CVIL 3W11C 2K7QA 3F7VA 2YD5A 1P1ZA 3OG4B 2A6KA 3L3GB 1EGJA 2M8XA 1EVUA 3AREC 3J7HA 5I8CA 2Q76B 4QOKE 5CEYB 5D7JC 3B9KB 2WBWB 2XRAL 4TQEL 3ULVF 5CHNB 1JGVH 1DLFH 2CIKA 4OD2B 2VLJD 5J4MA 1AGDB 5TH2B 1F90H 2I07A 1BVLA 2DJ4A 5JA9A 3ARWA 2ATPA 3RIFF 5B21A 3DHJA 4BKLB 2NW3B 2I60H 3MGOB 5INDB 2IANB 1OAYH 2MNUA 2WLYA 8FABA 3O0RL 2CLRA 1JI1A 2YPVL 2NNAB 3MLXH 3NCCB 2JJUA 2NY4D 1YEEL 2P8MA 2R23B 1OQXA 3KPSB 3VXSB 3N1FC 4BFIB 4PJ7B 3MRCA 2AK4D 5KVGH 2DOCA 2R0LL 1EV2E 3HB3C 3SDXB 4MD5A 2RQ8A 2YK1L 1L9NA 4Q2ZB 3ILQD 1DBBH 4Z7QF 3H0TA 1R5IB 4WWKC 2FD6H 2P1YA 3STLA 4S1SL 5CJ5A 1Q9LB 1UB6B 3O6ML 4HXBL 5DMKA 1BAFL 1JHTA 4XCCL 1PQZB 2FEDC 1IEAB 4I3RH 5D96B 2APBA 5JIKA 3NFPB 3O3AB 4BSWA 4M6NH 4HCRH 1IEHA 2Q1EA 2VO5A 4UILH 4ZNCD 4UU9A 4LLQB 3ARBA 3I3BA 5ESQA 1MELA 3O11A 4ODVL 5DJZB 2YUZA 4J4PD 2DIAA 3GNML 2P49B 3HNSL 4UDUB 4Y2OA 5T3ZH 1KB5L 3UTQA 1J8HA 1UZ6F 4KU1A 4HUKB 1NDMB 4OIAA 3OAYH 5IHUL 4HULB 3T8XA 1T80A 3WFEL 1NFKA 5T3ZD 3ULVL 3DYPA 1ONQA 1MHPH 5DK2B 3U2SB 4QRPE 1DQLL 4Q97A 5DYOB 2D7MA 5TQ2L 4OLZH 4XWGL 2PCPA 1IGFH 4H1LB 5GGRA 2ZUVA 4CVZB 3BP7B 4LCYA 3V5DB 5GS1B 1G7LB 3IXTB 3WS6A 1OAKH 2ADGA 3NCJL 3WJLC 3O2DA 1TZHA 4LGRB 5E94B 5H2BB 3SDCC 3JTSB 2E7BA 4LQFH 1EVTC 1I8LC 2JCCF 5ICZB 1RUAH 1FNSH 3DX9B 4S1DC 4XH2B 1NCBH 1KPVA 1FCCA 4Y4KC 4HWEL 1FYHB 1KXVC 2J5LC 1W72L 1JTTA 3GIVB 2EYSA 5TDPA 2HVJA 2CJUL 4KRPD 1V3KA 2YPLB 3N1GC 4WWKB 4PRAB 4RFOH 3WKNA 1WITA 5T3XL 1MRDH 2XN9A 5HDQL 7CGTA 3PXJA 1I4FB 4MLIA 4IOIB 1K85A 5D7IB 5IB5B 2ED9A 3GJFH 1SY6A 4JY6B 2OI9C 2XNAB 5L6YH 1LHZA 3N85H 4FZ8L 3AFLA 4I2XA 5D5MA 4KMLB 1BBJB 2AJ3B 3KXFA 3BKYH 3MFGB 3V7AE 5IVNA 4FXGB 2J6EL 2BVQA 3RHWF 3LVEA 4GXVL 2HRPH 3EJJX 5HVFB 4OI9A 1NCWH 4XCFH 2RB8A 3BZEB 1ED3A 2AJXH 4J3UA 1TNNA 2R29L 1J5OL 3O3DA 3MLPA 1T1WB 4M7ZC 5E0QA 3LKNB 4P3CL 1FL6B 4MB5A 4IOFC 2HWZL 1LO2L 4OGAD 4DCQB 1PZ5A 3WD5H 4D8PB 4FQXD 4CUCA 1FQ9C 1FZOB 4L4TA 2HVKA 4JFQB 4ONHB 5EUKA 1A7PL 1P53A 4MNGA 3SKOA 4WTZG 3X14B 5F1IB 3CJJA 1NSNL 4MJ5A 1I7UA 4WEBH 1IGYB 4BUHA 3BRFA 4P4KA 4LCWE 2J8UF 4AIXA 3KPRA 4PJCE 2IG2H 2P8PB 3UZEA 1NPUA 3CPLB 4XCYA 4RGMB 4D9RD 3KWWB 3O2VL 1BIIA 3QBTB 4QWWD 3LKRA 2LVCA 3G5ZB 2ID5A 4OQTL 1UCTA 1CU4H 4NUGH 1KC5H 4I77H 4XWOD 3SE8L 3CFDA 4GUPA 3CX5J 4ZODA 1KIQA 5GISL 3MV9A 1PG7W 3F12A 1HOCA 3OKEB 1A4JB 4ZUVB 1F02I 2YUWA 2JB5H 4NO3A 4S11A 1A1NA 3MGTB 3ZKMC 2H6PA 3VFWA 5E4IA 5DK0B 4XX1E 1A6AB 5JDSB 1NUDA 2PR4L 5F9JA 4ZUSA 4YHYC 1J8KA 1J1OH 4OCNC 3RZCB 3ULVE 1I7RA 2GITA 4R8WL 1KLGB 5HGHA 3PJSB 2FYYA 2XN9E 4OCWL 4YIQB 5DVLA 5KS9B 4PS4H 4MHHI 4DAGL 4U1IB 4TSCL 4EOWH 1F4YH 2EDKA 3RWDB 1JZ2A 3W5MA 1XCTB 5SV4A 2D7QA 5JPNB 1CZ8H 4JN2A 3V6OE 1ZA3A 1PZUB 3FFDA 4JY5L 3D9AH 4CW1A 3ZTNL 1IZKA 4LKXB 3T0EE 5J06A 3KJ6H 4QRPD 4RNRA 2X1PA 3VXUA 3EO0A 3QUXB 4JFOB 1JVKA 3VXOA 1Z0NA 2WUCL 1FG9C 1U3HB 4GG8B 4HUUB 4R3SA 1LO0L 5EFIA 2L4OA 2H8PB 3HE6D 3I6LE 4PJXB 4F2MA 4JPWH 4PJFA 4MD4A 3MV9B 4KK6C 4GS7B 3QAZB 3GMQA 5J12C 3ZYZA 5JHDB 1A14L 3QQNA 5DJ6B 5IUSA 4RDQG 1WEJH 1UVQB 4O02H 2VZ1A 3JUYA 3KLDA 5EOTB 3AB0B 4Z7WE 2XIDA 3MLYL 1RIUH 1VA9A 3ETBF 5BVPL 3L7FB 1OY3B 3FN0H 3V4PL 3WLWD 5TQ2H 5TJWK 1NAMA 4E5XA 3AS1A 4K3JL 1FGVH 4YJZL 2X4NA 4I0KA 1GZQA 1F42A 5GS2H 4PGCA 1PLGL 3BKML 4UILL 4MYWB 3RU8H 3D39D 5I1CH 3OX8B 2VC2L 4P59L 1G9NL 1UM4L 1FV1A 1FJ1B 2P5WB 4J4PC 4OZIA 2VZSA 4P9HL 2FJHB 4ELKA 3T0WA 3L3JB 1G7JB 4N8VG 3D18A 5BRZA 5I6XB 3U4AA 3D18B 3GBNH 3L3JA 5CCKH 1FJ1A 4D9QE 1ED3B 4Z6AT 1BGXL 1N0LA 2CKBH 3T65B 5E8PA 4HS6A 2W0FA 1RUPL 4HMEA 4M6NL 2VR9A 5IB2A 1MJ7H 5HDOA 5HD8C 4I4WA 1CL7I 2BCKA 4OIIL 3PGFH 4AG4H 3GEWB 3LKSB 3VI4E 2X89A 3O4OC 3RPIA 4NO5B 1OAXH 4K3GA 1INQA 4NNYA 1T89A 1J0YA 4XPHL 5D7IA 5IT2H 3FO1B 1Q0XH 5JW4Q 25C8L 2O5YH 1CF8L 1CXIA 2B7DT 2Z31D 4NZTL 4PIRF 4MMZC 1WUNT 1DJSA 1VERA 4UINL 5DMIL 4KI5E 1FC2D 7FABH 4WWKA 1FL5B 4KZEH 3GMQB 1YEHL 3FB5B 2HVJB 4MD4B 4C4KT 2Z31B 2AI0L 3BKCH 3HN3A 2QEJA 4M8VA 2A6JB 3CFJB 4K3EL 4HUUA 4GG8A 3BPCA 5FOBA 1S8DB 3TBTB 4KROB 1KG0A 4MDIA 3VXUB 5BVJA 2Q8BH 4LKXA 2G60H 2IAMB 3WIHA 4K94L 3LV3B 3LHPH 5HHME 5DJAA 3HNVL 1TITA 4XC1L 1DFBL 4Z0BL 4U7KA 3PF2A 3IDNA 4JZJB 1LGVA 4OD1H 2A73B 4KTEH 3PJSA 4L4VD 1TVBB 1MRCL 1Q9WA 4WI9A 5GJSL 1UJTA 5HTSA 3REWB 1T1XB 5JOEA 5HI4D 4DGYL 3BKJH 5MEOA 4ZFZB 2FH6A 5DLML 5BS0B 5EULV 3WLWC 3NCEB 3NIGE 3C08L 2DWEB 1FYTB 3ZKND 4UMGA 4J3TA 4MCYA 1L7IH 1I1AB 3VFMA 1P7KA 2BMKB 3TM6A 3T4YB 1U8QB 5D96C 1MFDH 1W0VA 2VERN 4G7YH 4KVNH 4EZMA 2C9AA 4OZIE 1F4HA 2VDML 4QRPB 4U31A 1PX4A 3EYFA 4W70A 3O4LE 4H0GA 5C6PB 3ARBB 5ESQB 5L0QB 1J9CT 3Q1SH 3F7QA 3SBWA 2R69L 5SX5K 2IQ9L 3RWCB 5IQ7L 4NDMA 4KDVA 4H8WH 2VDKL 5EOQL 4BSWB 1AO7E 2F58L 1SEBB 3KWWA 3RWHB 3MLSL 3AXLA 5JIIA 1IEAA 4HUWB 4XI5C 3M1BB 4JFDA 5I1JL 4YBLC 4LVNB 4KUCF 1G84A 3BN3B 4YLQT 3H9SA 4X6CF 1T5XA 3MRRA 1GPOL 4N90E 3ME0A 3TJEH 5J9PA 1UACL 4RBPH 4KRMB 4NZUL 4F8TA 4MXQC 5GRWA 1ACZA 1J8HD 5DQDH 3IF1B 1W2KT 4JCMA 4HG4K 5EU6A 4R2GB 2BVTA 3QRFM 4E0RA 1HHIB 1A3LH 1S7XB 3S96A 3TPUB 4LHUG 2Q7YB 2DQFA 2NXYB 4I2XB 3LD8C 3W0WB 4FFYL 2O5YL 3WIIH 2JJWA 5TE7H 5J1AB 4GKZA 2R4SH 5L2JB 1KJ2A 5ILTH 2UUDK 3C6LC 4OZHF 1SBBA 1YNTB 2VYRE 4PGJA 1QRNB 1VACA 4D0DB 1W72B 2Q76A 4DQOH 3L3GA 3WHE1 3UO1H 2X4SA 4U2ZA 4R6UA 1YPZE 3O41B 5DHYA 5I16A 2EE2A 1I1AC 1I8KA 1NL0L 2BVOB 2NX5A 1EPFA 1RZKL 2OTUB 3LDBB 1VEMA 3LEVH 4LLWA 1B0RB 2FEEI 4IIQC 4JO1H 3C5SB 5D9SA 1ZSDB 4OV5A 3DX9A 1FBIH 1S9YB 2GT9A 2BOCB 1WBZB 4IMLA 3RKDC 5C0GA 3UJJL 5C08E 4H20H 1PLGH 5EDXA 2D7TH 4EOWL 2XN9D 4JFZH 2UYLA 3WFZA 3WIFB 4ZAKA 4Z7WF 1I3VA 3HE7B 4X7DC 3I85A 3CUPA 3MROB 5J6HB 5E6YA 2FBOJ 4ZPTA 4F15B 4OZFG 2ICEA 4MJ2A 1ONQB 1NC4D 2XI9A 2AXGB 4X7EC 1D6VL 3P0GB 5DD5L 4P5TB 3U48A 5C6WH 4N68A 3EYUH 5C0GB 5JHDD 1OGTA 4WUUB 4IRZH 5JA8B 4KTDL 5MEQA 1AP2A 3CMOH 4IRSC 3OB0K 4Y2DA 4PJDB 3X12B 3B2VH 3WNOA 3KLSA 1RIHL 5IMOA 2JKXA 2VDOL 4FQXA 4X6BB 2A1WL 5HHMB 3UPAA 1N7MH 1AJ7L 4WI7A 5DMIH 3TH2T 3S98A 4D94A 2JIXB 2ZSVB 2VMFA 3AM8C 1BF8A 2FGWL 4HKJB 5CP7B 5I75C 3A6CH 4WENB 3FQXA 4EKXA 4Y4FA 3L5WB 3BIKB 1PYWA 3EJZD 3OJVC 1UB6A 4TRPL 3CD4A 3SCMC 3N06B 1GPOH 3P30H 4JZNA 4CNIB 3HZMA 2Q7YA 4Y4HC 5T1LB 5TDOB 3D39E 1YUHA 4BYHA 2AK1H 3O9WD 3C5ZA 1MJ8H 3IT8D 1X5LA 4WU5A 3OAZH 4LPCA 3GMLA 4Z18A 3P9LB 1KYOK 3DMMB 1N2RB 4M43L 1HQRB 2HLFD 3MBEA 2EDRA 3UDWC 5DD1H 4BH7B 3F7YB 4E41E 5ADOL 5IVXA 3PDOA 4UI2A 2NLJB 2FX8L 1QBLL 4D0CA 3K7UA 1T04A 3FFCB 1NFDB 1Q8MA 3EZJB 1RUQL 2EDBA 4NHCH 5J13C 3VFOB 4E42B 4HUXB 3F58L 4JO1L 4YC2C 3BH8A 1K5NB 5FO7A 1OAQH 1U8KA 1C12B 1CT8A 1A6ZB 1I1YA 3QAZC 5DC4B 1MCKA 4GBXD 1IJ9A 4YFEA 3LPGA 3A67H 1CGXA 3T3PE 1NGWB 4L4TE 3U82B 1CLZH 1WEJL 5JMOC 4QRPA 3SCMB 3STZA 4QCIB 2ZUQC 3REVB 4CJ0A 3QEHA 2R56H 4P2QD 1LK3H 3MX0A 2Y7QA 4NCC1 5FA4A 1XT5A 1R24A 3MBXH 2E8YA 5CZXC 4WI2A 1OD9A 3AS0A 3NFNA 3WEXB 4JANA 1CFSB 2ATKB 5JXAH 3MBXL 1DP0A 4OLXH 3O2VH 5I8KH 4N8VB 5EO9B 5L9DL 1XF5B 4P4RB 3MJ6A 4NSKA 3VI3F 3QXWA 3DV6A 1HWHB 2NY0C 3S9DB 1JPTH 3FO9B 1IILE 3L3KB 4M5ZL 2C3VB 2FWOA 1DBJL 4Z76B 5DI8B 2F5BH 1KJ3L 1A3RH 2J8UA 1MJUL 4P46B 1MCWM 4ENED 4PJCF 4U1JB 4LASH 2FJFA 2X4QB 1DR9A 1ZANL 1JIBA 1OAXL 2QQNL 2H1PH 3P9WB 4NPYA 4HIJA 4OIIH 5JR1L 3VMNA 1HINH 2XTJE 1RU9H 2BVOA 1T4KB 1JI2A 3VG9C 1HILA 2X4SB 3DUSA 5F6IB 2VLMD 5I1AA 1TMCB 2A9MH 4NQDE 2YMXH 3U9PH 1LVEA 5K9QG 3EBAA 4OT1L 1QBLH 2NYYC 3RI5F 2E7MA 3SGKA 3HFML 4HDIB 4B7IA 1INQB 4NNYB 5HHMD 5DS8B 4RZCB 3ILQC 4L8SB 12E8H 2EDJA 1QPXA 3O3EB 3GUTA 5KVFL 2UZXB 1LO3H 5LAXA 4P2RB 4PJFE 4X6FB 2W0FB 4G9FA 4MZ2A 1CTOA 4WU7B 5IBUB 4QRUB 3U9UB 5ALCH 2MTPA 3DRQA 3M17A 1I8LA 4MMXC 3S37X 1INDH 2N7AA 5L8KB 4YO0B 4MNHB 2DLEA 1ZGLM 5F1NA 4TRPH 1JP5A 1IGMH 2DTML 2R2BA 4G6MH 2VDLL 1KB5B 3BFOA 4YHZH 3GK8L 3P77B 3C8HA 4PB0H 5C09E 2M1KA 3QHTC 4GG6B 4Y19E 3FZUC 1HSBB 3QUZD 4G9DA 1BIHA 1MPAH 3ZT6A 4JFEB 4QHLB 3SKMB 4CAGA 5K9JL 4Q6YA 4OQ1A 4OGZA 4ETQA 2BK8A 3DMMD 1JPFA 3ARED 5JXEC 2V2WB 35C8L 3QISA 3LH2L 3PABA 1OP5K 3SJVE 2VLLA 5EO0A 3CVHH 1VEOA 4YR6B 4X7SL 2UZIL 1A3LL 3BP6B 4QYOB 1QBAA 1LO4H 3B9KD 4GAYA 5JW4R 4NNXA 2CR6A 4H20L 3QXVA 1G9ML 5E24E 5TDNB 3NZ8B 4DUXA 3TNNA 1ACYL 3ECBA 2QADC 3MV8D 4QHMB 4E9LA 4KI5F 5CBEB 1MCOL 5C08A 3PGCA 2UY7A 1WBXA 2F9BT 1P7KB 4JFOA 3P4NA 1NANI 1WAAF 4FTVD 1T1ZA 4OKVB 4QXGL 5GGVY 1XGRB 4LPWA 2N1KA 1NC2B 3L5IA 3D39A 1E28A 1SVZA 1T0MA 4J3WA 5E6ZA 3FQTB 3RWGB 4ALAH 3GSNL 2CMRL 5JPNA 4MCZA 1QEWB 4LHUB 4BQ8A 2XKSA 3S3JA 4CVUA 5KSBB 4JM2D 5A3ID 1EEYB 3PWPE 5EZJB 4JFDD 1LP9F 5E5RB 1OSZA 3SPVB 4OCLC 4PRPE 1XIWC 5LKNA 3S35X 3ALXA 5GRJH 1MHPL 4NYLA 4QHNB 1NC2D 4C83A 2ICWB 2NY2C 3H9SD 4Y5YC 1XCQA 4AEIL 3QXAA 5JIHA 4ZYKB 3IJSA 1FFOA 4B53A 4DKAA 5CGYC 2VXVL 1SJEB 1I75A 1XZ0B 4ZOEA 1K8IA 5JORA 1WT5A 2AQ2A 2Z31A 3K0WA 5DSCA 2APXA 4KHTL 3HNTL 4L1DA 1MHCB 3CFDB 3V0AC 4LLVB 3C6SB 4P23A 5J1TC 4OKDA 2YPKA 3CDGB 1UKTA 1F90L 4PRHE 3E0GA 3DO3A 5EO1B 3O3UN 1OB1A 1WF5A 3CPLA 4ZPVA 4WO4D 4ESKA 4XMPL 1C08B 4I18C 2E7CA 5CLWA 1RUML 1GAFH 5DHVH 4GFTB 4MAYA 2BNRB 3U4BL 1GCFA 5FYJU 5HHPB 4JM4L 3SJVA 4HS3A 2W07A 4F37K 1H3GA 3MUY1 3U4EA 4AZ8A 4LOUC 4RMRA 4WGVB 2QR0A 3MLVH 3MRQA 3MREA 1T7XA 1UXSB 5F7NC 5FKAA 4EI5B 3MJ7A 2BC4A 4WNQB 4IMKC 5JQHC 4L4VA 3BDYH 5L2KD 3LPWA 3UTPE 1G0YR 3DROB 3BZ4B 1DDHA 5F7KC 4WHDA 3FB6A 1AC0A 1IM9A 3WLBB 4DKFH 1FE8H 5ID0A 5ERWA 2AJSL 4JQVC 4LVEA 4PGCB 5T1DL 1UT9A 1EEZA 1CBVL 5JUEH 1Y0LB 2IF7A 4PJ5E 4JVWA 3MRLA 1YEDB 3NTCH 2AEWA 1VPOL 2QSTA 4AK1A 4LAQH 5DHXB 3OR6A 1ZT1A 4FMFA 1NGZA 3VFUB 5CBAA 2P44B 1RUPH 2IPKB 2NMSA 5ANMB 1NMAH 3GDBA 1G7IB 2E9BA 4KQ4H 3QHZH 4D3CH 3WFCL 4HWUA 4QTIL 1JFQH 3I6KB 5HGGS 5IW6A 1RZJC 2R1YA 5IB3A 5JHDA 1QSEE 3NIDE 3O6LH 4HIEB 1NCDL 2VDPH 5DJCA 3RTQD 5KS9E 1FFQA 1EBPA 4XH2A 4Z7OF 4RNRB 1KPUB 5FCUH 4H88H 3RGVB 3OAUL 1UFUA 2W0KA 4OD3H 1C8PA 4U1MA 2G2RB 1P7QB 4EQ2A 4POZC 3GSXA 1WWAX 3QUXD 4LLMA 3VD5A 5DT1L 3BW9B 1JYXA 2F54B 1DQTA 2H26A 2IQAA 4QNPF 4K2UH 4QRRB 1IGML 5C7XL 1DN0B 4Y4FD 1UZ8B 3VXTA 1M6OA 4JGJA 2HJKA 2GQHA 1LNUA 3TVMA 1T89C 2DQHH 4XP6H 2R2HB 1G6RL 3KPPA 3BX7C 1QKZH 3R8QA 3CCHA 4DGVH 1U8JA 1U8OB 5JW5B 5DK0A 3U0WH 32C2A 1YC8A 3C9NA 4BFEA 5KG9B 1G6VK 3UPRA 3MJ8A 2YRZA 3KLAB 1X5FA 1HOCB 3KPQA 2V2XA 5C9JA 3O6MH 4HXBH 2XTJD 5HPMA 3QDMD 1VSCA 2BY3A 4X9HA 1MRDL 3JV6A 4Z7UA 4GUPB 5F7LB 3O11B 4PLJC 5CD3A 3V0VB 1S5HA 4KVCH 2X44D 5GS3A 1XIWB 2YSSA 1EO8H 4AENB 3JVGA 1CL7L 4QHKI 5E08H 3L3DA 4GW4A 1IAKB 4LPXA 2I24N 3TIEB 2HTLD 4TULH 5D72L 5T5FL 3ZDXF 5BXFA 3LDBC 1CICD 1AGFA 1LMKA 3ULUD 3T2QA 4F15C 5E8NA 1QQDB 3BRGC 3AMLA 5F9DC 4FQCH 5D1XA 1A8JH 4ZAKD 3DNKA 5DD0L 2QKIA 3V8CA 1FG2B 4ZOAA 2VLRB 2FB4H 1EMTL 4DCQA 3OZ9H 1M7XA 4NBXB 3VXSA 5HY9B 4OZGA 3NCYS 4OLZL 4KRLB 3Q2CA 3T0EB 1LEKA 2JLLA 5BV7H 3O6KH 5F93C 2VDPL 4P2QA 1KLFA 1X7QA 3GSUA 3VGHA 3QCTH 3RWFA 3MXWH 5E5MB 1MFNA 5INDA 3SY0A 1FNFA 2X1XR 1B4JH 4LCUB 2NYYD 4CGTA 2BHUA 4Q74A 1CN4A 1F4YL 3D3VE 1Q9OB 1J18A 4L8BB 5B4MC 3QEGL 1KEGL 4O58H 2HFGL 4PJ9C 1SVCP 5K9OB 4IOIA 2D7NA 1ODAA 3TZVD 2ZJSH 1ZWIB 2Y25A 5J11B 2OSLA 4X6CB 1FIGL 2NW2B 4BQBA 1G7HB 1J0ZA 1ZVSB 2GEEA 2JB5L 3SGEH 2F74B 4X6EB 4XNMB 1JHLH 3BESR 4I0CC 5IV2A 1G7HA 3MRMA 1NDGA 3CXDH 1YECL 1WJ3A 1ZOXA 1PW3A 1J86A 1DBBL 4QRQB 4XRCB 5FECA 4KK8D 5JHLL 5IVXF 1AO7A 1Y6KR 3UAJD 3TNMB 1UWEH 1F4XH 2DN7A 4ODWB 4KXZI 3MBED 5IROA 2GJJA 1AXTL 4EI5C 3U7WL 1FH5H 2X6MA 1HH9A 1F3DJ 4HIXL 2D0FA 1CGUA 4HJJH 4LEOA 1WVZA 1D5BA 4DOHB 4X4ZA 1HHKA 4XMKH 1PEZA 1VGEL 3GSWB 4IBLT 2V5TA 2GYSA 5HXMA 4LHJB 1FL3A 5FKPB 2Z9TA 1II4E 2AV1A 3FHAA 4K7PY 4WI8A 3C2AH 2QADD 3UTSB 5ERWB 4EI5D 5ID0B 5FYKH 4KGLA 1JWUA 5IBLC 1KT2A 4P2QB 3CFBB 2IFGA 3WIHL 4K07A 5C0FB 3THML 4JLRB 3UTQB 3WHE0 4F7PB 5L7XL 5ELIA 3MC0A 4KMQA 1UM6H 5TE6H 4YQXH 5AYQA 1E27B 3M45A 2BDNH 4LGPB 3U30C 2GJ6B 5D1XB 5DXWA 1PKQE 1IC4H 3U4BH 1LK2B 3DVNB 4X9IA 4XNZC 2NQCA 2OR9H 4NN6C 3QWOB 1XGQA 2BSED 2A1WH 5F7DB 3RA7L 2Q6WA 5I66A 4FZEH 3WFCH 2CO6B 2YRLA 5GS0H 3S4SG 4AT6A 3GM0A 1C08A 1QSFA 3RWJB 4RWHA 1F4WL 2Y72A 1JHTB 5EO1A 2ZUYA 1IAKA 1CFTA 4M6MH 5HYJE 2YN5A 5CILL 3TBYB 5IFAH 7FABL 4Y5YB 3GMOB 1Z6JT 4G8IB 3IS0X 4M7LH 4ZD3L 3QIUC 1IRAY 2KQNA 1INEL 3CZFA 1AQKH 3SGJA 1MHCA 5IBTH 1S5IL 2ZUUA 2DDQH 3FN3A 3OB8A 3PWLA 3B3IA 5IBLD 3B5GA 5I18L 3MRCB 2FATL 4WW1A 3V4UL 4NNPH 5TPWH 1HEZB 3LB6D 3NOIA 3R0NA 5AZ2L 5B3JE 5C6TL 3UPRB 4MB3A 4I13B 3DIFB 2BNUB 2CR3A 3OGCB 4KQ3H 4ZYKA 4PRDB 1RQ5A 4YNYB 5GRJL 5CWSB 4F9PA 5KSVA 1EHXA 5JW5A 3DARA 5I1EH 1U8JB 4UAOB 4KJWC 3G6JA 2R2HA 1U8IA 3QB7C 1CGSL 5IB1A 1FVDB 3WUZA 2AJUL 2F15A 1HYSC 1U36A 4QTHA 3BH9B 2CIKB 1KSRA 3IAGC 1SJVA 2EEBA 5HYQB 1IGJA 3TT1H 4QRRD 2F53B 5E4EC 2AVGA 5CEZE 1EO5A 1A7OH 3KJ4B 3EW3B 6FABL 1FVCA 1NC2A 5TFSL 5C0RL 1G6RH 4UIMB 3S4SB 1D6EA 3Q6GL 3HAEA 4MHHG 4LGSB 5KSAB 1YNKH 5DJCB 1LEIB 4P9HC 1YNKL 3KPLA 1IAIL 3T3MF 1NKOA 5IB3B 5GRVL 1P84K 4RGNB 4AJ0A 4LNRB 4FABH 3AREB 1KULA 5IW6B 1Z9LA 2OMBA 5D7JB 3DGGA 4D0BA 4MA3B 3LIZL 1FZJB 4UTAH 1KXTB 3D69B 4GW1B 5SX5H 2ZOKB 5IHUH 2WIIA 1CWVA 2EIBA 1T1YB 4OZGE 2VXTL 1G7QA 1MVFA 4ETQB 2QQKH 3RVTC 3HCVA 4Y4HB 3IRZA 4QHLA 3QG6A 3SKMA 4Q9CA 5BMFL 2B2XH 1EEZB 3R1GL 1U8LA 3U7AA 1ZKAA 2JELL 4QTIH 1A21A 3BGFB 1KCVH 2BXYA 4MNGE 1KCLA 5TE6L 3SO5A 1VFOA 1MHEA 4LU5H 4POZD 1ZGLP 4PD4J 4KPHH 1BZ9A 3O9WB 1BFOA 3GSRB 4KGJA 5DRNB 3ULUL 3EOTH 1E6JH 3VCLB 2DIJA 3HG1B 4S1RH 3EDDA 4M1CC 5L2KA 2BC4B 4WNQA 4NQTA 3P0YH 2AEQL 4HGMA 3DRQB 3M17B 2IH1A 5D7KD 3UTZA 1QO3B 1G7MA 5IMKB 4LHUD 3LS5H 2RGSA 2X4TA 4HF5H 1G0XA 4GLRH 4GKNA 2GK2A 2XQBL 3MZGB 4PUBL 4G6AD 1FFNA 3WN5B 2ZUXA 3UTTA 5JOPD 1DLHA 3EFDH 4DFIA 3I02A 4EUPA 2P8LB 3FRPG 1A7NH 1NUNB 1K6QL 1MI5E 4Y7MA 4YPGB 1N8ZB 4O00A 3FQNB 4QNPE 1HDMB 3PGDA 2CDFB 5I1AB 4X5WA 1F5WA 4RGOH 1QO3A 1OAYL 2A6IA 1FZMA 4DGYH 3DBXB 2W9LA 1VCAA 4NN6B 5B39G 1F3RB 2HLAA 1I9JL 2DQDH 2OMNA 4M1GH 4MNQE 4XCEB 5HYJD 1WCBB 1DFBH 2X4OA 4KRPC 3BMVA 2FX9H 3FOMB 3C5JB 3HZKB 4OD3L 4U1JA 3SKNA 4TNVK 1C5BH 3BVNB 3WNMA 4C83B 2EDTA 4P46A 4JB9L 4X9GA 1MFEL 4GQPH 3SGDH 1A4KB 1UGNA 1NBYB 4MAUL 3QEQE 2XXCB 1BD2D 2C3VA 2MKWA 1DZBA 2JTDA 4GAGL 4NWUL 1YYLL 3BEVB 4N5UA 3BQUD 4WV1C 5KSBA 4JKMA 1KIPA 1YMMB 4O2FA 4N0RA 2YKLL 1ADQH 4MCZB 4D0BB 1I9EA 1TJHH 1TQBC 3FRUA 4M1DL 4L8DA 1OWWA 1GHFL 3MJ9H 3WEXA 4K3DH 4JFEE 3B2VL 2IEPA 1EAPB 1KCKA 1BREA 2W38A 4GKSA 4XZUB 3QEHB 4V1DA 1LEIA 3TIDA 1XMWA 5BO1L 4ZFFA 3NFSL 5C08B 1MHHB 4UZGA 3JV0A 5DJ2A 2H9GA 1K2DB 5H37H 2WQ8A 5EA0H 5TDNA 4HPYL 1MRFH 3SJVD 3MLUL 3LKOB 3K4ZA 4X98A 4K7PX 4ZS7L 3O8XC 4UB0L 1QVOA 1XH3A 5IF0A 5J6GA 1JF6A 3P0YL 5E00B 1WZLA 4YR6A 1BFVH 2F53A 1PAMA 4X4YB 4JJ5A 3U1SL 3HZVA 3C09C 3VWJB 1KIPB 4EDWH 4JREC 5CKAA 3Q0HA 5DRXA 3TZVC 4U6VH 5ISZA 4ZO8A 1UG9A 5GJTH 5GGRY 4FTVE 5C07A 1ZHKA 4ZOBA 3G6JB 3VG0H 1S7WA 4DGIL 2WUBH 1MVUB 2Y6SC 3HS0A 5IB4A 5KSVB 4WFEE 5D1XD 3E6FB 3PDOB 1MREL 5DD1L 3DIFA 1YN7B 2GIYA 3IETA 1RULH 2J8HA 3MLRL 1KB5A 2VKXA 4GRLD 3BEWB 3E2HC 1D5MA 5IK3B 2VABA 2ARJQ 3VXSD 3V5HB 4OAWA 2XWBB 3FQWB 1OF2A 2GTZB 4BFBD 3GMLB 5I1LB 2YBRA 3RKPA 4JRYB 4EN3B 2DF3A 1H3WM 3WO3B 3ESUF 3IGAB 4KHTH 5FHBH 2EDXA 3MFFA 2DLFL 2G60L 3SHSA 4PJ8B 5IG7A 3L1OH 4U0QB 1NCUA 3SQBA 4NQSA 4YHZL 1L7TL 2VQ1A 2DQCH 2GAZA 1FFNB 4FFYH 3KR3H 4RZCA 1K4DB 5FYLL 3HUJB 4AEEA 4AT6B 1A9EB 2O93L 4YGVA 3OKNB 2VZOA 1BQHG 3JV4A 3QWOA 2BSRB 3TZVA 2LAAA 5ALCL 4F9LA 4LSSL 1HILB 3VFTB 4PJGF 2VL5A 5J7CC 3UJJH 4NO0B 1HHGB 5GHWH 1JK8B 4I3RL 3MNVA 1N5AA 5MI0C 3FQUA 3TYFA 1J10A 5GGTL 1DBML 2FJFB 4GH7B 3IB4A 1SHMA 3SDYL 3GRWL 2EYTB 1IFHH 1K9TA 3HMXA 1S9KC 4ODSL 5DI8A 1G1CA 1K3ZA 1AO7D 4XP1L 5K93A 1F2QA 1SJHB 4N0FA 5J6HA 3MJGX 4U6HA 1D5ZA 4NRZA 4TSBL 4MXWL 4H8WL 2H2SC 4Y4HD 1NJ9A 5FXCH 5EO9A 5JUEL 4OV6F 5F7YC 5HYJB 3B9AA 2IPUK 3TNMA 5HGBA 3Q1SL 5A2LH 3V52H 3V95A 4U1NA 2MQCA 4F9PC 1V3MA 4BJLA 3RU8L 4O2EB 5I1CL 3SE8H 1FE8L 4JANB 1EO7A 3H9HA 3IAQA 1ZSDA 4Z95H 2V17L 3IFNL 2IANE 4NC1E 2H3NB 1VDGA 2ZZUT 3O2DL 3VFSA 2AXHA 3QUYA 1T0PB 1BEYH 1LDPH 4OCSL 1PSKH 2FGZA 3NGBB 5KSAA 4X7TB 2FH8A 2OTUA 5ETUA 4GBXC 1OM3L 1F6AB 3T2PA 4GG6E 4OTXL 3F5WA 5JXAL 3O41A 2OSLB 3WDHA 4R2GC 1WICA 4HUMB 4J12A 1UENA 4LSVH 5DD5H 3TCLA 4OUOA 4C56E 2R4SL 3L3HA 4PTTA 1K5NA 3KXFD 4JPIA 1E4WL 3SDAC 4JRXB 4WGWB 2KL6A 1FVDA 3UMTA 4G3YH 5T1MB 3FQRB 4KKAC 3ZSTA 4HQQL 1MREH 4LCUA 2EDDA 4JRWA 3OAZK 4KUCD 1L0QA 4M9OA 4YHIB 2P5EA 3D25B 3FFCA 5E99H 2H2PD 2UWEE 3IJHB 1NMBH 3GI9H 3HR5A 3MJ9A 5D7LB 3IF1A 1BQUA 4P2CG 3QEQA 2GTWA 4NKQB 4P2RE 4OZGB 3LN5B 2V2TA 5DEFA 4Q0XL 3HPJB 4L9DA 4NQED 5F21B 1N2RA 1ZVHA 4RAUA 2LU7A 2FZ3A 2VIRB 3CZFB 3NPSC 4Z0XA 6CGTA 5INCB 4JO2H 5C0AA 1A02N