5C2UB

Ferredoxin-like domain of nucleoporin nup54 bound to a nanobody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
VQLQESGGGLVQPGGSLRLSCVVSGDYYAIGWFRQAPGKEREGVAAISSRDGSTYYPDAVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADRRQRWGPYYYLSALEYVYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title Crystal structure of the metazoan Nup62Nup58Nup54 nucleoporin complex.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Transport protein
total genus 33
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c2uB00
3PF2A 3OAUL 4CUCA 1J87A 1G9NL 3L7FA 3T2PA 4AK1A 1EJOL 3MLSL 1N0XH 2V5RA 1UH3A 2R4RL 5FB8B 3EYOA 4HC1A 5DVKA 3DURA 3SDCA 4AEIH 1MHEA 3H6JA 3MNVA 2P8LA 3PGFL 1OGAD 1MJUH 1BBDH 1SYSB 1OAZH 4WI2A 4XI5C 5KSAD 2LAAA 2ZCLL 2ZUWA 2YKLH 4MYWB 5IB5A 4HGWB 2VERN 3CX5J 2DS4A 4MVBC 3KR3H 2X4RB 1KXTB 2XT1B 4BFIA 3SKUD 1EAPA 3HC4H 4JPWH 2GHWB 4YIQB 4U1HB 3O11A 4Y4FA 1F58L 1RJZB 2FHFA 2WBJB 3DETD 1R5IB 3RVWD 4WW1B 2OR8A 3O3BB 2BSSB 1MY5A 4HHAA 2JJSA 3WUWA 43CAB 3QIWC 4KJPD 5IB2B 1RIVH 1BBJB 1QFUL 2A74B 2IQAB 5C0FB 3IDYC 3JV6A 3U4AA 5JQ6H 4P2RB 4RRPA 4S1RL 1QYGH 1DL7L 3L7EA 1DVFA 3LB6C 4BFEA 1UWXH 1QG3A 4Z9KB 2ZKHH 4PJ7E 2DL9A 3RWGA 3ULVL 1Q9WA 2BY0A 2VDOL 5I8EB 4RAVB 4NZRL 3WCYA 1P6AB 3MV7D 3VXUD 1CXEA 4JG0L 1AC0A 1ZE3C 2R29L 1IM9D 3X13B 3IFPB 3HNSL 4JKWA 1MPAL 2H2PD 3AY4A 2OR9L 4LKCB 4LF3A 3CZFA 3EYFA 3QDJA 1IZJA 4M03A 1A6WL 3G5XB 4HMEA 3DMMB 4OFYA 3IRPX 5INCB 4U0RC 4NQTA 4LIQE 1T66D 4OI9A 1QNZL 2AGJH 2X4PA 3J7HA 6FABH 1AGCA 1FO0A 1U6AH 1WF5A 1WITA 4G3YH 1OD7A 4RWYH 3S35H 3TO4D 4YEFA 2IPKB 3DVFA 3BZ4A 3WFHA 4M62H 3JTTB 4YAQB 1WWBX 1PSKH 3H2WA 1MCDA 4EI5D 5IWLC 5ISZE 2K9UA 1RK0A 2HG5B 2W0LA 3QNYB 1ITCA 5I76A 2I27N 3DECA 4R6UA 2YEZA 1A9EB 3V4PH 1WCBB 1VERA 3PWUB 2YMXH 1B4RA 4ZUVB 4WO4D 5EIQA 3OJ2C 4LSVL 1YMHB 3CMOL 3NPSC 1CGTA 5EUOA 2XTJE 5DWUH 1KXQE 1F11A 3IAPA 4FG6C 3DGGA 1N3NA 2JIXB 1RZ8B 2FR4B 4MX7A 4FFWD 4OI7A 3U2SA 3BSZL 4Z7WF 4MA3A 3DI3B 4WJ5A 1R0AH 2L7UA 1DEEB 1BZ7A 1KIRB 2VR9A 3UZVB 4N8PA 2RFXB 4Y5YC 4PJ8A 1NDMA 4JHAL 3RX5A 2AKRA 3FONA 5E7BA 2XRAL 5E70A 1W0VA 2X2YA 3NIFF 4JRXB 1M7IB 4XMLH 3ZSTA 2Q76A 1A1OB 1M7DB 4HT1L 5C0BD 2Z35B 5D1ZB 5DHVH 4PGDB 4EEEA 2OM5A 1X44A 2BSRB 1TCRA 1AHWA 5HGAB 4P3CH 1IEBA 4B7IA 4AT6B 3QXVA 2X9XA 3U79A 3D0VB 1CDUA 1KN4L 5FUCE 4X98A 3M8OL 5BV7C 3ZL4H 2E8ZA 4GMSL 1RZKC 3EJYC 3U4BL 4LU5H 4X4YA 4WHTB 3MBEA 4BQCA 5CWSB 1I9IL 4J8RB 4LRIA 2EYTA 4U1IA 5IGXL 3R8BB 1FAIL 3IJSB 7FABH 2VDKH 2GTZA 3TVMB 1BFSA 4HK0B 3IJHB 2FL5B 5BZDB 3HE6B 4OZGB 4JZNA 3DGCR 4M43L 1NGPL 1HQ4A 3MRRB 4NFCA 4NJ9H 1OAKL 3TZVB 4KK8C 1KLUA 3LDBB 4POUB 3NA9H 1U8OA 4XC3H 2XIDA 1U3HB 3JWOL 2BX5A 5DC9B 2W0FA 3NTCL 4P5MB 1KTLB 1AXTL 4WFGD 1HH6A 3TPUB 5A43C 3MROA 2CRYA 4ZSOB 3WJLA 3SCMA 4UT6L 3EYSL 3UP1A 1OTUC 3F5WB 3IFLL 5IB1A 1CDBA 4XRCA 4OSUH 4DN3L 4LHUB 2DWDA 2NY2B 5GJSL 3NFNA 2Q20A 4I18B 3ARSA 1Z3GL 1PG7L 5I8KL 5SX5H 4PJEF 1OP5K 5D9SA 4CAGA 3V6OC 3CZJA 5HTSA 4LMQI 4YR6B 2IAMC 5HHPA 3KJ4B 3GMMA 1DSFH 3H9SB 2FSEA 4X6CF 4UT7H 1NC4D 1U41A 4JO3L 2VNCA 1IKFH 4JFFB 4QTHA 2N7AA 4MXVE 1EX0A 5B38G 1YDPA 3DX8B 3MLVH 1OSZB 2Z8RA 2A9MH 5SWQA 1S7XB 2HJFA 3RWFA 4ZYKB 1MNUH 5I1HH 3FN0L 2EYRA 1YMMB 2DYPA 4HFUL 4P9ML 3RGVD 4D8PB 1QSEB 1XZ0A 3GKWH 1A4KB 3MRDA 4GAYB 4CMHC 2Q8AH 4Y19D 3QEUB 4NM8H 4U1NB 1UJ3A 4OLYH 2EXWC 4RA0C 2YD9A 3WNOA 2GITB 4PJBF 3KXFE 1S5IL 1INQA 3QNXB 4XBEH 3RTQB 1PKQE 1HHHA 2ORBL 1I8MB 4Q58C 1T04A 1N6QL 5F97E 2JB6A 4U1MB 1A3RH 4ELMA 3MXVH 4JFDA 3QDAA 4JFEA 4NYLA 4XPGL 1BFOA 3X3GL 4EOWL 4MA7L 2VLLA 3IGAB 4RFEA 3V8OA 1UKQA 4M3JA 3UEZA 5GQBA 1S7WA 3O3DB 1ZS8A 2W9EH 3FB8A 4D94A 2HT3D 2FX8H 5IM7A 3A6CH 4BA8A 5T3XL 4G42B 1WVZA 4YE4H 4BFBD 3GSXA 1HH9A 2ADFL 3JVGA 3VFUA 4XCNB 3K81A 5D2LE 2J5LB 1FG2B 4Y4HB 3W39B 2BSED 4X9HA 2C26A 3LKOA 1ES0A 5IQ9A 4O51A 3TN0D 1KIPA 2VXUH 5BVPL 4O2FB 4KZDL 5F1NB 2LTQC 3ILPB 2Y25A 4P5TC 3FFCB 4C56B 6CGTA 4YLQT 4N0YH 1BEYL 3K2UH 4OLZL 4Z7OF 2GUOB 3P9WB 5FCUH 3P0VH 1F3JA 9CGTA 5I66B 1NMCC 1JRHH 2PXYB 1EFXD 1PEWA 3VA2C 2A6JB 1NCDH 2GAZB 4DVRL 1Z5LB 4IRZH 3DMMC 4YK4B 1SY6A 4URTB 5DDHA 1E6OH 3S35X 1ZT4A 5SWZB 2AABH 2VZSA 3W9DA 2FJHA 4KMLB 4G9FB 5B38B 4DUWA 3L9RA 1BWMA 4E41A 1T1XB 3O9WC 4QHLB 1IC7L 3G6JB 5FO9A 1R5WA 5K59F 2O93L 2BVOB 1J8HD 3CVHL 1P7QB 3OXRB 4PTTB 4YBLC 3PWNB 4LLWB 3PHOB 4AIZA 1NMAH 3VXMD 3RY6A 5IUSA 3GRWH 3ULUL 2JJWA 1J1XH 1RY7B 3KG5A 4WI5A 4EXKA 1YEJH 2ICWI 3FKUS 3UROR 3UO1H 4HKJB 2RQ8A 1FC2D 3EOTH 1AQKL 1YEKH 5T33H 4FP8L 1XH3A 1TVDA 4D9QD 32C2B 2R69L 2AAVA 4HLZG 3I9GH 1KN2L 5CS7A 5L9DH 4YJZL 2G5RA 2Z91A 3C08L 3INUL 4JPIA 5GGVH 3T09A 4H1LA 1BD2A 4YDLB 5GS2H 5IKCA 4F57L 1ZLUK 4TNVF 3D25A 3WHE0 2FD6H 1SJEB 4MHHG 2IPTL 5I0DA 4HFWA 4WRLA 2AEQH 3QO1A 4WIQA 5ESVA 4KTDH 2N56A 4HDIA 3OAYK 1S9XA 4P9HL 4IRJD 4OFDA 2WUBH 1MELA 4IRSA 2H8PA 5DK0B 3QQ9D 1KCUL 4F7TB 5D1ZC 1JN6B 1Y18A 5E6ID 4XNYL 2DJUA 1KELH 2DWEA 4AIXA 2X9YA 4RQQA 5IIEB 2ZSWB 3L3KA 4WI9A 5I8CA 4FQHA 4PJAA 5E5MB 1WAAA 4L4JA 2AJUL 4LAJH 5GGQL 3FHAA 1QO3B 3DUUB 3E2HB 4OQTL 4ESKA 4PJXF 2GJJA 5F1OB 3PV6B 1E4WH 5EUKB 3QIUD 2VXQL 2VC2L 3P9MB 3BDYL 3MYJA 3AU1A 4WUUD 5E2VH 2I25N 3V4VL 3QCVL 2OTUB 3SDXA 2VZTA 3QEQB 1HNGA 3L5WA 1UA6L 2Z31B 2BY2A 3ES6B 3WEXB 1ZHKA 2R2HA 1LO2H 4JPKL 1C16B 3X12B 5EIIA 1J0JA 1OGTB 5M94B 1SQ2N 2H32A 3RZCC 3O4LD 4I13B 5JHDD 5IOPB 1N5YH 5DMKB 4NO3B 5JOFB 1FV1A 3MO1B 5JR1L 4Z8FH 1N8ZB 3QR2A 4P3DA 3TGXA 1BFVL 1RZJC 1S3KL 2GQHA 3L6FA 4JFOA 2MTPA 4HKXB 4FN0A 3RPKA 2A73B 5ESAA 1JPST 5HHOB 1ACZA 2BOCA 1MCSA 3L95B 4N0FB 1MCNA 1RFDH 5FA4B 3I6GA 3ME0A 1JHKH 2E7LA 3IVKA 1I4FB 5EOCL 3VXQB 2JCCF 5HHVH 4CVXB 1QR1A 1EO7A 2C3VB 1D5MA 3VD3A 3OKNB 4IJ3B 3LS4H 4Q6IA 4GUPB 2N4IA 1LEKB 4P4KD 1MFDL 2DI9A 2XTLA 4ZFOL 4Q9RH 2YN3A 3HG1B 2B7DT 3G6AA 1WZMA 3T1FA 2XG4A 3O2DH 3O2WH 2UWEA 5DS8A 3VE0B 2BP3A 2X4UB 5JPMB 5I1CL 2R1YA 2PO6B 2D2OA 2IBBA 2BHZA 3V4UH 1R5VB 3D5OF 4BSVB 1M6OA 3HUJF 5E8DH 4M00A 5I1AA 2A0LD 3S4SA 5CKAA 3UDWC 3QQ4B 3TBTA 4R90L 1KYOJ 3VWJB 1MRFL 2IMNA 1I7UA 4OCNC 4JB9L 2YK1H 2NY3B 3MA7A 3DUHA 1ZEAH 5FYLH 4ZXBA 1YN7B 3VA6A 1OQXA 3QUZB 1NAMH 3OX8A 3VXPA 5I1KL 4NQSA 3IDIB 5E99H 2PW1A 1RJYA 1F8TL 3RWHB 4X6DA 1GGCL 1E4KC 3N85L 4M5YL 5GZOD 4CADB 3QT2A 2W92A 3MJ7A 3UBXI 4ETQA 4IDLA 4DN4L 1CR9H 3HE7B 2WAHA 5KSVB 5ISZD 1AGDB 1U91B 4XH2A 3ARFB 2VLKE 1T20A 1KEMH 2W91A 1I7ZA 5B3JF 1AKJA 3NCEB 4PLJC 1KPUB 3PDGA 2XZZA 3HI5H 3C2SA 4OD2B 5TQ0H 4ODVL 2ZOKB 5ESQB 1BAFL 5F9WC 2UVEA 5DMGD 1FVCA 3P4MB 1NBZB 4GS7B 2PF6A 4MJIE 1IVLA 3D3VD 2XTJD 1NFDA 2VXVL 3T0EA 1K4CA 3MGTA 1DLFL 5JW4N 2VZ1A 3TA3B 2RCSL 1HYRC 4Y16B 5DD0L 1A6AA 2QSVA 4DKFL 3UMTA 5ID1A 1M71B 2PXYC 3REWA 12E8H 1AR1D 4Y5XC 5J1SC 3TH2T 2G75A 2R0LL 4ZUSA 3GSWB 3V2AR 1LDSA 3QDGA 1KB5A 1JRHI 3M1BB 2X40A 5KZCB 4HUMB 3PP4H 1JYNA 2OTWA 3MJGX 1FNFA 1HOCB 2R23B 4PRBA 5FKAB 4EDWH 4Y5VC 3BEVA 4MQTB 2EKSB 3DTXB 3L5HA 2OL3H 3QJFA 4G6KH 2ZCKL 2R1WA 4W4OA 4ONOA 5K9OA 5IQ7L 2C4XA 3CC5B 4ODTH 4OZFG 4M93B 1X5KA 1UM6H 2LU4A 2X44D 3CDFA 3F7VA 3QIBA 1P84J 3G08B 4I0PC 4OFIA 3TP4A 5EZIH 4DVBB 3D87B 3EDJA 2O5XH 3MRHA 2ZUUA 4PRPB 1QBBA 1FRGL 4JHZA 3GJFB 1QBLL 4NPYB 1H15B 1UB6A 2VIRA 1EO5A 3U0TB 5KSAB 2DAVA 5D71L 4PV8A 4NM4H 2HH0L 4R0LB 3HR5A 3NIGE 1S7SA 4NDMB 4PJHF 4YBQC 4XGZB 4MD4B 1QPXA 3ILQD 5GISH 5HVFB 1T80A 2D31B 4JKKA 4NBYB 3QPXL 5C07B 2DKMA 3GJEA 3ZSSA 3ZTNL 3A67H 5D1XC 3ZE2F 1FL6B 3DV6A 2R1XB 3B6SA 3QDJE 4HK3N 5CSGA 5T1LD 2MQCA 3BISA 2GY7B 2WW8A 5JW5A 3GUTB 5DVOA 2FEDD 1FFOA 3IF1A 2BMKA 1A7QH 5DK3A 4L8BA 2QQKL 1DCLA 1KXVC 4QRRA 4LCWB 1JZ7A 4UV7L 4KROC 1S78C 5D96B 3FQXB 3TV3L 5JDJA 1DFBL 3MV7B 3VXUB 2EDDA 5IJKA 3MLRH 5HVWA 1D6VL 3L5XL 5ITFB 2YSSB 4XCFL 5IMOB 5F3HB 3VXRE 3V79C 3MUJA 1IM9B 1GHFH 1V7ML 2MQ0A 4YDVB 4H88L 4HJGB 4NZTH 2P48B 5MERB 3D69A 2ZUYA 3NACH 3IDGB 4TSAH 1JP5A 3MRQA 3ZDZF 1MHHA 3NZ8A 2FJGB 1XIWC 3T4YA 4KQ3H 3MREA 1EEQA 2SEBB 3CCHB 1LWRA 4EZMA 4GG6E 3NCFB 5DEGA 4K23L 3OAZK 2Z31C 3TM6A 1FL3A 5K9JH 4FFZH 1W0WA 1H3TA 5EUOE 4NUJA 3V6ZB 1IGTA 3TO4B 4FQXA 4OM0H 4XAWH 3GM8A 5CCKH 2FO1A 5E5RB 2CK2A 4GW5A 4F9PC 3FO1A 4ZUTB 1CDHA 4MAYD 2K7QA 2X10A 4OZFB 1J05B 1IBGH 1UM5L 1FN4B 2EEBA 2L4OA 5I1DB 3ZKMD 2Q3AA 1CGSL 2QQNL 5DUPL 3LHPL 1NQBA 1NCCH 3UYOD 2NLJA 2VXSH 4M48L 3T3PE 3DO7A 2VDLH 3MRJA 4LASL 1I1AA 5EO0B 3BUTA 4WO4B 1WICA 4X4MA 5BRZA 5ALBH 4ODWB 3ULVF 5FHAH 4PJGF 3P30H 4I9WD 2CIIB 4Y1AE 3KYAA 1NUGA 4EIZC 1EIBA 5SX4H 3ARXA 2QADB 1QD0A 5C0IB 3ARZA 3DI2B 3UJIH 1FNLA 5BZWA 2Q7NA 5E9DA 4P5KA 3V5HB 4KRNA 1L4IA 1KG0B 3TF7C 3QI9B 1D3CA 4R7DB 4PS4H 1BZ9A 5FK9B 4RGMC 4OZHA 4KJWC 5I73B 1MI5A 4U6YB 1I1YA 1KCLA 1WT5A 3P0YL 4GKZA 1WCQA 3VG0L 3B9VA 1CICA 3QXAB 2EDXA 4DW2L 1DBJH 1B4JH 3FB7B 4IOFC 1RUQH 4Y8AA 4XVSL 5C0BB 3HRZA 2V5SA 3CJJA 2X4OB 2Q3ZA 2OMNA 3RVXC 3QPQD 3VRJB 2XICA 3LEXA 2ARJB 3T0XA 1T7WA 4IMKA 4QXGH 5DJ6A 5A2LH 1TVHB 3CK0H 5MEQB 1JGEA 1GOGA 3QUZC 4A6YA 1HI6B 5C9JB 2X4TB 4MSWA 5J0BA 4ELMF 2J6EA 2H3NA 3P4NB 3EFFB 3VRIB 2OLDA 1U8QB 3GHEL 3T0WA 2NY0D 1CGYA 4NRXA 5C6TH 1EERB 4UTBL 1AFVH 1NC2A 4JFZH 2JLLA 1G6VK 5JW4R 4LP4A 1FC1A 3GI8L 3M45A 2F53E 1E4JA 4OUOA 5JIPA 1HSBB 2FEEL 5I17B 2MCPL 3OKKB 1BFTA 1U2HA 5AYUL 3BP4A 5DRZA 5JXAH 1TZGL 4QHNA 3ARFC 4Q9QL 1MCIA 4ODHH 4WHYH 3RJDA 5DVLA 4BK5A 4KQ4L 2AJXL 1LEGB 3O45B 3QXDA 1G6RA 4RCAA 1TJIH 1VHPA 2ENSA 1INEH 4XPAH 3I02A 3VRLF 1TJHH 2A9NH 3CSYB 3EO1B 5IV2A 3NIDF 3C8KA 1XCQB 3OJDB 5DJ0B 3CSGA 1T1ZB 5CILH 1FNSL 3CAFA 1X7QA 2BK8A 5ERWA 3QDMD 3WNMA 3KYNB 5TDNB 1F4WH 3HMXH 1UXSB 5F71A 2X41A 4NO0D 4CMMA 3ZDXE 3F12B 1ORSB 3WO4B 4OGAD 4JDVB 1FIEA 4JFDE 4JFEE 3DROB 1X5JA 5FDWA 3UTTD 4FZ8L 5J9PB 5A3IC 1ZWIB 3UC0H 3RGVB 4N0UA 4HIJA 4XPTH 2QHLA 5IR1B 4Y19B 1LVEA 5M95B 5C08A 4M93C 1OD9A 2ENYA 4XWOC 1NUDA 2FBOJ 4Q97A 3RBSA 1ZLSL 2YWYA 5HYFA 3I50H 3C8HA 3GSNH 3TT1H 4OLUH 1JPTH 4M7LL 1J12A 4BQBA 4K9EC 2XZAL 2EE2A 1G9NH 3CXDL 1HWGB 2UV3A 2VZVA 1EJOH 2P44B 3MLSH 3Q3GA 4IS6B 3HZKA 1S9VA 1SM3L 2R4RH 1OQOA 1RVFL 2YZ1A 1KJ2B 1ZAGA 4K3JL 1EMTH 1K8IB 4M7LT 3TH4T 3WV0A 3WSQL 1V7NH 1T5WB 2E5EA 2CGRL 1YNTA 3EGSA 3O0RL 5JQHC 4TSCL 1U8MA 2ZCLH 1ROWA 3AGVA 3GMQB 3DETC 2ADJA 4LVHB 3RVWC 2BVEA 1MRDH 4KK5D 4BUHA 3FHQA 4KJPC 1TJGL 4GAGL 3PL6D 3S5LA 3T2QA 3DLQR 1EV2E 2OTPA 3QUML 4J23A 2X6MA 1FNEB 5FB8A 1F58H 1KCRL 4YZFE 5TE6L 4FQ1H 3FT3A 4R26L 4LGSB 4M6ML 4XHJC 5IVNA 8FABB 4AENB 1JGUL 4W68A 4CN6A 4E41E 2RAMA 3MV01 1QFUH 3BKYL 1R6VA 1WAAF 4M9PA 3HNTL 4MD0A 3PNWB 4S1RH 1DL7H 2X4RA 3MGOB 1LO0L 4HIHA 2HFEB 5HHNA 3GBML 4L4VA 4YIQA 2H2PC 3MGAA 1EFXB 5EWIL 3QFJA 4ZO8A 4GRWF 2HVJB 2VDOH 4XWGL 4NZRH 5IJVA 3N1MC 3MRIA 43CAA 2PYFB 4JG0H 3B8SA 5FUZL 1ND0A 3SDXF 2R29H 1MQKL 2A74A 5F72S 3BKCH 3TBWA 1GJIA 1T66C 3HNSH 4ZAKB 1FPTL 3O8XB 1JPFA 2ARWA 1AIFB 1QUNA 1CFNB 5F9DC 4NIKB 4UBDC 3B43A 4FXKA 2VDML 1U0QA 1A5FL 3PGCA 1MVUA 3TO4C 2IBZX 2FH6A 4RAVA 1J8HB 4LLUA 4AEFA 1QNZH 2YD3A 3ECBB 2J7LA 1QRKA 4NQEA 4FOMA 4EI5C 5CEZE 1BD2E 3KS0J 2E9IA 1U42A 2PUQT 2FZ3B 4L3CB 2YOCA 3VXMB 3X13A 1R24B 3WIFB 3C87A 4K8RL 3AROA 1U8NB 2VOTA 1G9EA 3G5XA 3CXHK 4OGZA 3SJVE 2BXZA 1C5DB 1H3GA 1WFUA 4PYGA 2FECI 1S8DA 1T2JA 1BX2A 1RUPL 2CO7B 3BESR 4O2CA 3CDGB 3DX6A 4HWBL 4IIQB 4PJAE 3WE6A 4HWEL 4XTRC 4OKVB 2IPKA 2BVPB 5CFHA 3CMOH 5EU7C 5B39B 3CU1A 4ZS6D 2HG5A 1J10A 5SX4I 2VLKD 4RFOL 3KLAB 3T0DA 5JXED 1U8HB 1P2CA 5LG1A 1JGVH 2VLJD 3S96B 3OHXB 3NN8B 1GH7A 1WCBA 4IRJB 1PY4A 4ZUVA 4WU7A 4WWKC 3WFEL 3BSZH 3FOLB 5C2BL 4ZPTB 2I9LB 3WMSA 3FZUC 3Q2CA 1YMHA 3TBSB 3VI4E 4MJID 2V7NB 3U30B 1PKOA 4LOUC 3LIZL 2WMPA 4JHAH 4F8QA 2XRAH 3WFCL 4HT1H 5T5NF 3MZGB 1FNAA 2JIXA 3N9GL 5EU6A 4HEPG 3ULUF 3QIUB 4HG4J 1D6EA 1DANU 3SGDH 2OBGA 1ZA3B 3RWJB 1DEEA 1JF6A 3SDCD 1OP5H 4XB7A 1A6TB 1KN4H 2RFXA 1CLYL 5IW6A 1FIGL 1D5ZB 3U4BH 4MAUH 3OB8A 3OR7B 4U7SA 5JZ7D 1I9IH 3V9FA 3VWKA 4PGDA 2XWJB 3LVEA 2FATH 3O4LB 3QP3A 5JHDB 4UMGA 4HMDA 4W6XB 5HGAA 5JIHA 2Y06H 5IGXH 1G9NC 1FAIH 4Y4FD 2BHUA 5TQ2L 4AT6A 1MQ8A 3T77B 2V2TB 3CFBB 5FV1L 1ONQA 5GS0L 2BRQA 3MLZL 3TNNB 2UWEE 1KT2B 1QSVA 4WHTA 4F3FA 4JFPA 1NGPH 1LP9A 1VFAB 1DVFD 4J8RA 4ZD3L 2W38A 1OAKH 2QKIA 3BH9B 3IJSA 4CN4A 1WC7B 1KLGA 2J4WL 3WDJA 1NFDF 5J57B 1RUAL 5FGRA 4HUWB 3JWOH 3UBXG 1AXTH 2XQBL 4XPFL 2FL5A 3HE6A 3VFMB 1FH5L 4OZGA 4UUJB 4U6TA 4UT6H 3EYSH 3GSUB 5GS1B 3MRRA 3IFLH 3QDJD 2DTML 3TZVA 4DN3H 3RVTC 1MFCL 4PRHE 4OFYD 4YC2B 5GJSH 3ZO0A 1RZ7H 4PGCB 1U3HA 4X6DE 1PG7H 4LNRB 5I8KH 4G6FD 3MNZA 1KTLA 4PJFF 3O3AA 3TPUA 4OZIA 1SHMA 2F8OA 1F97A 5D7IA 4X83A 4LPCA 4U1KA 2A83A 2KPNA 3LAFA 5BS0E 5J11C 1A4JA 4JO3H 4ODUA 5D4QA 1CGXA 3SO5A 4LSTH 5KS9B 1PYWA 4OI8A 3I75B 3T3ME 5KSBE 1GRWA 3K4ZA 5JIKA 3KVQA 3FN0H 4HFUH 3CMGA 3R06A 1KFAL 3DYPA 2GK0B 1AXIB 5IFJB 4YHLH 1HE7A 4X6FB 3H9SA 1XF3B 2P8MA 3RL1B 1H3PL 4HUNB 4JFXB 5IESL 5I74B 1KIQA 3QSKB 2ZUSA 1MCHA 3MOBL 3DX8A 2ORBH 1IEAB 1KGCE 1OSZA 2P8PB 4GRWH 5F1IB 4R4BB 1NFDE 1YYLL 3MRBB 3T0EE 2ZNWA 25C8L 1PZ5A 1FVDA 1SJVA 3CGTA 4CU7A 4XPGH 2O5ZH 4GAYA 1A4KA 5IVXA 4KVNH 3MV11 4U1NA 4GSDL 5DD6B 3UJTL 4EOWH 5HDQL 5F7KC 2A6KB 1OWWA 5AUMB 2GITA 3RTQA 2A6IA 4L29B 1I8MA 4PJ8D 2R56L 3QDGE 3RWDA 5T3XH 4GAJL 3TN0C 4JO2L 1SJHB 2PTTB 2HJKA 3CUPA 3GMPA 2ADFH 3SBWA 5CIPB 4IDJL 3MCG1 1CDYA 1E27A 4G7VH 3D3VB 3HC0B 5I1EL 2KUTA 4TUKL 4LQ1A 2M26A 1GZPA 4M8VA 4LSSL 4XNQB 1N2RB 3ZHLA 4LDOB 4EUPG 5EU4B 3K8KA 4G42A 1BEYH 3QJHA 5GGVY 4OLZH 2EDEA 3C60C 1DDHB 4WEUD 3MBED 4LVEA 2BZDA 4ISVB 1IGML 5F93C 1FG2A 1ZVSB 3LKSB 1NKOA 1ZLUH 4PJDA 5GZND 5AG8A 3SKMB 2JJUA 3PHSA 3PWPB 4I48B 4O2FA 1SBSL 3ILPA 3DARA 1ADQL 5D2NA 4HH9A 1IRAY 1LEIB 3OAYH 1P5UA 4MXQD 1FZKB 2GUOA 4TRPL 5DJDA 1KV3A 3P4OB 4WFHD 5C0EB 1EZVY 4ZS7L 4RDQF 4LIQH 4FQLL 2WWMC 3MTRA 5I66A 1IC7H 2DL2A 4X5WA 5I18L 1MREL 1R3JA 2GAZA 3OPZL 3CVHH 4JR9L 2APBA 2OP4L 5I1GL 4QHKJ 2FGWL 2WQRA 2ZUQC 4CW1B 3AAZA 3PIQB 1PAMA 5SWZA 4QRRE 3SCMD 1A0QL 5ILTL 5E00B 1TCMA 2B4CH 5B38A 3CSBA 3ULUH 5HYJB 2CUIA 4H8WL 3EDKA 2Y7QB 4IIQC 3G6JA 5L88L 3GNML 5A40E 2DICA 1AQKH 3ETBF 4JVUA 5J89A 2QSCL 4PP2B 3OXRA 4FP8H 3BHBB 2V17L 4LLWA 4QCIA 4OZHF 1WQVT 2ED7A 1GSMA 1QP1A 2BFVH 5J6HA 5T1LB 4M5ZL 2R69H 3ARUA 4Z7WB 1KN2H 2F5AL 1P69B 3C08H 3INUH 1PVHA 2HT2D 5IVZA 4HKJA 2IPTH 2W1NA 2CRIA 5E6IC 2DYPD 3HKFA 32C2A 2VXTL 4P9HH 2E7CA 4MQ7A 4XVUD 1I85C 4N8CL 2ICEA 4GW1B 1T83C 4E42B 1KCUH 1PW3A 2Y5EA 4EUPB 4HULB 1JYVA 3QIUC 3LN4A 5T1MB 4LFHG 5J1AA 4XP9L 2AJUH 1IM3B 2AJVH 4JFDD 1UH4A 4JFED 5BRZE 1F3DJ 5INDA 4OQTH 1S5HA 1II4E 4HBQA 2Z8VC 3SGDI 1OTSD 5I71B 2A2QT 5JW3H 5DK0A 5DTFA 3V4VH 3VD9A 4EKXA 3QCVH 4Y2DC 5IIEA 3F7RA 4JANB 4RNRA 1FFPA 4P0DA 3W2DL 3BVNA 3MLYL 2ZZUT 1UG9A 5HPMA 1UA6H 3DUUA 5IMLB 3G5ZA 4JFYB 4ZNEA 1NCBL 4JPKH 3VI3E 1MI5E 4OZ4A 1AGEB 3AREB 4PRNB 4P2OC 5LXGL 1XGQB 1TETL 3QYCA 4N68A 4UQ2B 2NR6D 4LGRB 1BFVH 2X70A 3BE1L 2YA0A 4YHPB 3ES6A 3WEXA 4Z5RB 2Y5TB 4NSKB 3X12A 1C16A 1OGTA 3FO9A 1VEPA 4LAQL 3MRLA 1A14L 1QLFB 1YPZF 5E8NB 1PG7X 5JOFA 3MO1A 1N8ZA 4NHCL 4P4KC 5EOCH 3SKOA 4JREB 2V2WA 3BPOB 4C59B 4P4RB 1UQSB 4HKXA 4X6CB 3OF6A 4Z77B 1ZA6A 4DGYL 5HI3D 2W65B 1X5HA 3F58L 1FZJB 4E41D 1MCJA 1MFDH 1IGJA 5EZJB 1LO5A 4GBXA 2V7HA 4FFVD 4HLJA 3RWEB 1DQQA 4JJHA 4K3HA 3QG7L 1XF1A 4WTZG 4CVXA 1U8IB 4PRAB 4JJ5B 3M07A 4PP1C 2JK5A 3LMJL 3ZKND 3OKNA 1EXUA 2ZOLA 1I3RA 4GUPA 4R90H 4J3XA 4PJBB 5BO1L 1MRFH 2X1QA 3VFSB 5JIIA 3DBXA 2YS4A 4JB9H 2Y72A 2NY0B 3HG1A 4YO0A 3O2VL 3FQNB 3SGEH 1UB5B 3SPVA 5GZOC 1M05B 2P5WA 3C9NB 4LCCB 1P1ZB 2PO6A 4GG8B 4WI6A 4Y2OA 1R5VA 4BSVA 5H35A 5DT1L 3Q5YA 4F9LC 4PG2A 4R96A 2VDPL 1F8TH 2V5TA 1GGCH 3O6MH 3VWJA 3N85H 4AIOA 4M5YH 2D3VA 1BD2D 4WY7L 1T21B 1JFQL 2B4CC 2YUVA 4RFNB 2AI0L 1DBAH 1EA9C 5DJXA 5FUOL 4HPOL 4DN4H 3UTPE 3UPAA 4LLDA 4F7EB 4QHMB 1N5AA 3NOIA 4D2NA 4IRSD 4R7NB 3X11B 1FFQA 1UZ6F 2JJVA 1SJXA 1HZHL 1IJ9A 1WISA 3BIKB 4FQCH 4N0UE 2VQ1B 2A6DA 2IADA 1AR2A 2XTJC 1QQDB 1EVTC 3OKLB 1G7MA 1LDPH 2BVUA 2CSPA 3ZDYE 3QDMB 4U05A 3MUHL 5C08E 3VDBA 1BAFH 2D7QA 4L1HA 2XZQL 1AGDA 3G6DL 4NO0B 1DQML 4Z7VE 5IMMB 5ALCL 2AJ3B 2VXVH 3E3QE 4HQQL 1DLFH 3ARQA 4DGIH 2RCSH 3MJ6A 4KKLD 1MLBA 5HY9A 3UPRA 4HKBA 3JTSB 3TLRA 4KDTA 5FM8A 4YPJA 3UTTB 1KENH 4D0DA 2VL5A 4LKXB 4QNPE 4XHQA 2D03L 3P4MA 1U95B 4L4TA 4UV4L 2R0WL 4GKOA 3MRFB 2XKNB 4OLVL 2ZUTA 4Y16A 4NKMA 3U9PL 1CVSC 5FUCC 1I7TB 1NFIB 1G1CA 2DLIA 2BCKA 3G5YB 1GXEA 4KRMB 3EYQD 3ALWA 5L2KA 2D7OA 2ZCKH 3QFDB 3PUCA 1FGVL 5IQ7H 1C5BL 1U8PB 3PDDA 5CUSL 3B3IB 5CJQL 1KNOB 4LP5A 3OG4B 1CWVA 4KKCD 3M1BA 2NY6C 5KN5A 2WQ8A 4ZQKB 2B0SL 3KPOA 3GMLB 2H41A 5FKAA 1H5BB 5I6XB 2EKSA 1FRGH 4ACPA 1QBLH 5L0QB 3ILQC 3MUZ1 4OD1H 1JZ3A 4EJ1C 3BGFB 3OAZH 5AEAA 5D71H 1UXWB 5L6YL 4MNQA 3CC5A 3WKML 3NFPB 5MEPA 3PL6B 2V2XB 3G08A 2DLFL 4LLMB 2IBZY 4UQ3A 4DVBA 3AUVA 5IHLB 3QPXH 4QRPA 4P2RE 3ZTNH 3ZHKA 2PCPA 4PRPA 3RPIB 2DQJL 1FL5B 1UZ8A 1H15A 2DQHL 4AQOA 4KDVA 4CNIB 5AAMA 1GIGL 1UKSA 3H3KA 4WU5B 4X9FA 2KH2B 1FVEB 4R0LA 3UTSA 4WW2A 3ZKSD 3ZKXB 1DLHB 4MD4A 2P24A 5IHZA 4OCSL 2DQTH 1RK1B 2D31A 4UV7H 4ZXBD 5C07A 2C3WA 2CLZB 3BO8A 3MLUL 4U4BA 1FL6A 4G8IA 3TV3H 1DFBH 4HF5L 2X4NB 1GGUA 4RGOH 3G9AB 4XCFH 5ENWB 1DBBL 3NFSL 1V7MH 3EZJB 4H88H 4D9LL 2R0ZH 3JUYA 3RX8A 5E1AB 5I2IB 5KG9B 4KJYB 4KAQL 5FM5M 4OTXH 4LCWA 4G8FB 2W60B 2WP3O 1Q9KB 1TTGA 3MFFA 1IE5A 2C3XA 3GMRB 5ITFA 3MJ9L 1IGFL 3LKQB 1ZLWK 4MAYC 2WINA 4K23H 3KPQA 3WUWG 1P53A 3KPLA 2XKSA 3ARPA 1QFOA 3PP3K 3IDGA 3SE9L 1AKJD 1LP9F 5FGBA 4RRPG 1ZV5A 5K9QI 5L2JA 4I0KA 3X3FH 5DO2D 1R3LA 2VH5L 3DUSA 1ORQB 1OCWL 4WV1B 1UM5H 5I75B 3GMNB 2JJTA 4RIRA 3EDEA 3FN9A 1CGSH 2PTVA 1PX4A 5DUPH 1WBZB 3LHPH 4L8SB 5GGTA 1KGCD 2IG2L 4PLOB 4BM7A 1P9MC 4KHTL 3T0ED 4PV9B 4TVPD 4PUBL 1IILE 3V5KB 5TFSL 3HFML 2EE9A 3LKPB 1S9WB 5EU6E 1HXMA 4KHXL 2ITDB 2VLKB 3QUXB 3SGKC 3WHXA 5I1DA 2VLJB 2XN9A 4J3OC 3BPOC 5LGJB 1IKNC 3QDGD 5I0ZA 2Q86A 3RIFF 2VR5A 3ARBA 5EO0A 5D7IF 2G9HB 1IC5L 4JRXE 3ROOB 1HDMB 3BOVA 5IROC 1C7SA 4M9OA 3HUJB 5IBLC 2CIIA 3QPQC 3P0YH 5A16A 5D7SL 4HSQA 4KH2A 1U92B 3VG0H 1JGDB 1OWRM 4DW2H 3K3QA 4XVSH 4EXPX 3DNKA 3L7FB 1J88A 3QIBD 4MNGA 1F6AA 4DZ8A 2KBGA 2EKJA 3QI9A 3HR6A 3EFDL 5FK9A 1AY1L 3DURB 2EYSA 5BV7L 2YPKB 3SDCB 1RZKL 3QHTC 3RKDD 1AI1L 1LP9E 2EH7L 4PJ5A 3QXAA 1FZOA 4JRYA 4K07A 5FV2A 2ED9A 3ET9F 3FB7A 4L9LB 4LCCC 5IB5B 2ADIB 3WS6A 1JNJA 1J5OL 3IETA 3GHEH 1EAPB 3S98A 4PB9H 3SGEI 3O11B 4GMTH 4Y4FB 2FWOA 4UTBH 2ZG3A 4OZGE 2ARJA 4OF0A 1ZT7A 2BDNH 4OT1L 3L3DA 4HHAB 3WUWB 1MJUL 5CHNA 1OAZL 3GI8H 1FJ1A 2DQDH 5KANI 1YQ2A 3JV6B 2V5MA 3KR3L 3L7EB 5JTWA 2DQCH 5A2JH 1DVFB 5AYUH 1U8QA 2HRPH 4QRRD 3HTLX 3B4NA 1TZGH 4OZIE 5I1LB 4ZSOE 3GSOA 5JW4Q 1W8OA 4Q9QH 4PYHA 3DVGA 4KQ4H 3B9AA 1RIVL 5CZKA 1HSBA 1QYGL 2FBJH 1IGYA 3QCUL 5ID0B 4X7TA 4LF3B 3EYFB 3VH8G 3QDJB 5FGSA 1BQHA 5EBLA 3TC9A 5D5MF 5CP3H 4DQOL 4PJIA 4XBGA 1J0HA 4PJDF 4F58L 3H9SE 4OGAC 2X4PB 5DJAA 2LQRA 4QY8B 4JFFE 1FO0B 4BYHA 3MA9H 1P6FA 4XXCC 4BELD 1F3RB 4FQXD 3IU4H 4KI5F 1XCQA 3LPFA 5DJ0A 3WFHB 2D7NA 4PRIB 4OGYL 1JZ8A 1QSEE 5IVXE 3L3HB 1RK0B 4AL8H 3K0WA 5HHQA 5EOQH 4FZ8H 5I76B 4UB0H 2AGJL 1TZIA 1ACYL 1T6VN 5IWLA 1NCNA 1TDQA 5JPNA 3ESUF 1I1AD 3F12A 3F7QA 1ORSA 1A9BA 2UVFA 5BRZD 5C71A 2CIKA 4FFYH 1GC1C 2ITCB 1ZLSH 1T3FA 3MRKA 3IFOA 3PGDA 2EZ0D 1F11B 5HDLA 4M7LH 4PJHB 3DGGB 1N3NB 2XZAH 5E9DD 3CXDH 5IR1A 1LD9A 4KU1A 1SM3H 2DD8L 1RVFH 3BKJH 4M6NL 3BAEL 4K3JH 1XEDA 2C9AA 1MI5D 1K4DB 2J3SA 2CGRH 3O0RH 3VG9B 2G60L 4TSCH 3VGAB 1CICD 3K8LA 4HG4K 4OLEA 5DWUL 1W0VB 2Q76B 4NGHL 3V95A 4CJ1A 4WGVB 3BD3A 1I7RA 4C56E 1TJGH 1KACB 4GAGH 4L1DA 3K1DA 5DJCB 4LCIH 1JMZA 3DVIA 1TCRB 3QUMH 1IEBB 5T3ZD 2H26A 1KJ2A 1NCUA 1R0AL 2YBRA 3GSNB 1K8IA 1KCRH 5TE6H 5EBWA 1DJSA 1KPVA 2Z8WC 4NNYA 4R26H 4M6MH 3GK8L 4DCQA 4X8XA 3FQTA 1JGUH 1SVZA 1NLBH 3VH8B 4X4YB 3BKYH 3EIFA 3MBEB 3HNTH 4O00A 2QEJA 3SEPA 5C0RL 5BCAA 1LO0H 5ICYA 4Y4KA 3GBMH 3FTGB 5SWZE 4H0GA 1FNEA 4OCLC 1NC2D 5E8EA 2LV4A 5IEHB 4G9FE 3P4LA 2GTZB 1S7QA 3JBG7 4AENA 5FUZH 1F6LL 4YNYA 1MQKH 4LU5L 1BVKB 3G6JE 4P23B 1FPTH 1QSFB 4JZNB 1HQ4B 1T89C 3BP6A 2VDMH 1A5FH 3O3EA 7FABL 5HI5D 1U8OB 5LQBL 1OTTC 2OXHA 3HHRB 3B9KA 4X5XA 1KBGL 1HH6B 3MROB 1X5GA 4ZAKA 3GDBA 4H0HB 3O8XA 3SCMB 4KV5E 1AIFA 3TESA 5IB1B 4K8RH 2P49B 4L8SC 4XRCB 4PJGB 4JGUA 2DWDB 4N8VG 3NFNB 1S9YA 3S34H 1VEOA 4NC0B 4JO1H 5D9SB 4BSJA 4ZFGL 2XYCA 4WCYL 4ZS6C 1J0YA 1RUPH 4L3CA 1EUTA 1F5WA 1A6PA 3P9LA 3GMMB 4HWBH 3MLPA 3V6OA 3VFOA 3UTPD 2FSEB 4N1EA 3FOMA 5E08L 3OL2A 1U8NA 4F7MA 4EQ3A 2IAMA 4V2BA 1ZSDB 3LD8C 5FDYA 1YEFL 4RFOH 2DQFB 5SWQB 2BNRA 4OLXL 3VXTA 2ESVA 2HJFB 3RWFB 2EYRB 2DYPB 4NKQB 2K1MA 3AS3A 1XZ0B 4O5LH 3MRDB 1AJ7H 2CXGA 1TQCB 5ACMA 1UJ3B 1MWAL 5C08D 5LAXB 3WFEH 4OKVA 2BVPA 2H9GA 1IKFL 3VGDA 1HHHB 4JRWA 3LIZH 4F33A 5CP7A 4ZDHB 1A6ZB 3WFCH 5I1HL 4HCRL 4ELMB 3AS1A 3S96A 2HTLD 4NYLB 1T4KB 2APWA 2DMCA 3N9GH 4GRLB 4YUEL 2VLLB 2DMKA 4RFEB 4ZPTA 5JZ7C 4YPGA 4I2XB 3QEGL 3FB8B 1CE6B 2V7NA 1ZHLB 3U7WH 5TH2A 4H1LG 1CLYH 4Y4FC 1FGNH 1FIGH 5CGMA 5AZEL 3GSXB 1ODAA 3VFUB 4FHBD 2JJSC 3MC0A 1HKLH 1JZ6A 2FRGP 3LKOB 4KZEL 1RZJL 1ZA3A 5TQ2H 3RWJA 4O51B 1D9KB 1KIPB 3TIDA 1A6TA 4NQCB 4RMSA 3MNWB 5GS0H 5CZXD 1FYTB 3MLZH 3QA3B 5E8PB 2FEEI 3MLXH 3OR7A 1RPQA 35C8L 4ZD3H 1F3JB 3QRGH 4L4VD 4TTDD 4LEOB 5EA0L 3AY4C 2J4WH 3H9ZA 3QFJD 1RUAH 2V2TA 2IGFL 1WIOA 2XNAA 3EYUH 5BMFH 5DHVA 2XQBH 1J18A 5DDHB 1BZQK 4XPFH 3HG1E 1T7XA 3TNNA 4OJFL 4LLQB 1KT2A 4UI2A 2Z93A 3W9DB 1ERNA 1NSNL 1RIHL 1RMFL 1BF8A 2DTMH 3L9RB 3VFPB 4E41B 3B2VL 4PJ9B 5FO9B 1TZHB 4KK9C 3ZE1E 5E4IA 2DI8A 1Z9MA 3O9WA 4IRZL 4NQED 3E6HB 3QWOA 5CSZA 4HIXL 1A7NH 2AABL 3RUGA 5JOPE 3WFBL 1CGVA 3GSUA 3RNQA 2I07A 15C8L 4XX1G 5HJ3A 2BJMH 3U1SL 5GHWH 4PD4J 4LNRA 4MDJA 4ODXA 1E6JL 3U36A 1KFAH 2VZOA 3DYMA 1RZIB 4MA1C 3X14A 4LK4A 3T1WA 1H3PH 4JPIB 5IESH 3EO0A 4H1LB 1CXIA 5IKCB 4K2UL 1WIUA 3MOBH 4WFEE 4K8RC 3MSPA 2O61A 3I75A 1ZHNA 3FN3A 1YYLH 1VKXB 5F6IC 3QUYB 4HFWB 4DK3A 25C8H 1DE4A 2AXFA 3QO1B 4NN7C 5ESVB 4OV6F 4PJ8C 4HDIB 3VGAC 1LK2A 1S9XB 1UFUA 3D1MC 4MCZB 4GSDH 5HDQH 3UJTH 5L9DL 4IRSB 1NKRA 3BQUB 4KPHL 3AS2A 2DWEB 4J4PA 3HCVA 2FD6L 3L3KB 1AHWC 1IEAA 2DRUA 3QHFL 4LDEB 4ODBD 5I8CB 4FQHB 4L4TE 1OT1A 4PJAB 4QTIL 5HGHA 5CLWA 4GAJH 5TPWH 2WWKT 2HKFL 4GRMA 4JO2H 4DFHA 2BNQA 1X5LA 2JIXD 5EU6D 5T5NG 1PZUB 3IJYA 4IDJH 1IAIL 1L0XA 5H37H 3H9HB 4N90E 5I1EH 3WD5L 1DQTA 4JM2F 4TUKH 3MBEC 3MYJB 5F44A 5L2KE 3AU1B 1A7RL 4LRIC 1AE6L 4LSSH 3V5DB 2G2RA 1CGUA 5C0DB 3SDXB 4L29A 3K4AA 5GZNC 1OSPH 3L5WB 3MRCA 4LVOC 2ERJC 2PTTA 3TWCL 4LPWA 1ZHKB 2NY1D 2R2HB 5GJTL 5EIIB 1BPVA 1TQBB 3VWKD 1V3MA 1IGMH 4R8WL 2H32B 2FX9L 3UBXA 2MKLC 5E2VL 3AMLA 1FV1B 4MS8C 4XNQA 3C5JA 3RZCA 4P3DB 1RUKL 4MNQE 3IKCA 4BZ2L 4YHIA 4JDZA 4LPYA 4M7ZB 2HFGH 3RVUD 3L6FB 4JFOB 4UIMA 3NCBB 5ESAB 1CS6A 4TRPH 3LN5B 2BOCB 2XACC 4FQLH 4PRPE 4P3WA 3LKSA 5IP4A 3WJLC 1N5YL 3I6GB 4LCYA 4B0MM 5CEZH 2ZCHL 2XV6B 3IVKB 3PWPA 5I18H 1MREH 3OPZH 3SE3A 4MA8L 2YPVL 2RGSA 1NH6A 4JR9H 1G7IA 1QR1B 1D5MB 3HE6D 3RDTC 3GIVB 4QXTA 4Q6IB 5ILTH 3P4OA 2ADGA 4L3EA 5C07E 1NDGB 5DD5L 3LS5L 3TZVD 1HHGA 2E7BA 3HZVA 3G6AB 5FYKE 3T1FB 3GNMH 5TGBA 1RD6A 2UWEB 1U3HD 3BP5B 5DS8B 5F21B 5K9QG 2QSCH 2HT2C 5GSVA 2R1YB 4CW1A 4W6WB 3SY0A 2F8XC 2V9QA 3PIQA 1M6OB 5ICZB 4UU9A 2ATKA 4LCWE 4M5ZH 1BJMA 5I1AB 2R2EA 5E00A 3S4SB 3MOAL 2F5AH 5HYJA 3MV7E 2AEWA 3SKJL 1I7UB 3IFNH 4Q9RL 1K8DA 5E2WH 3CPLA 2OYPA 4ZTPH 3QQ3A 4NQUA 4NUGH 4ZXBB 3Q5TA 2OZ4L 5JHLH 4CVZB 3OX8B 3VXPB 4NQSB 5E8DL 2VXTH 3H9SD 4TUOA 1G7PA 4X6DB 4Z7QF 4N8CH 4K71B 4JKPL 5HYQA 3MJ7B 2YUWA 4FTVA 2DQEL 3T08A 4ETQB 3BUYA 1E4KA 3S37L 1CDIA 4KTEL 4XP9H 3GRWA 3KGRA 3SDDA 5A1AA 4XH2B 4KGLA 3JVGC 4GW1A 3U7AA 1T20B 4EUPA 1T1WA 2B2XH 3RTQD 1AKJB 3W2DH 4C54A 2NYYC 3MLYH 3RBGA 2NR6C 4OCYL 1IM3A 5EBMA 4C4KT 4GW4A 1NCBH 1NBQA 3NBNA 1P4BL 5TJWK 1G9MC 5E1HB 1CDGA 3BJ91 4HZAA 1NFDB 3QUKA 4QRSA 1K4CB 5LXGH 4LBEA 1CFQA 2AW2A 3RX7A 4PR5B 3ARGC 4D0BA 4JANA 4HPYH 5ACZB 3KPSA 5EZOL 3REWB 1JZ2A 4PJIF 1CQKA 2GCYA 5GIRA 2X05A 3D9AL 5F7DB 3MACL 1JI1A 3HC3H 3PQYA 4PB0H 4NO2A 3BJLA 2G75B 3QDGB 5IFAL 1KB5B 3AREA 5I30L 2R9HD 1XGQA 4PJ5E 5HI3C 3ZE0E 1VACB 4P46A 3WLWD 1MJ8L 4NHCH 2GYSA 2OTWB 3TYFA 4BQ8A 4Z78A 3SDAC 1QRNB 1YEIL 5C0BE 3BEVB 3MX0A 3WFDL 3QJFB 3FQRA 4YHPA 4BQ9A 2R1WB 4KI5D 5K9OB 1OF2A 4WHDA 4RDQG 4JZOB 3F58H 3F7VB 4S1QL 3ZKNC 1UEYA 3RY6C 1FZMB 4PJEA 1KEGH 2D0HA 4P2YA 1I1RA 3QG7H 4I0PA 2I5YL 1UB6B 2OL3L 2VIRB 4N5EC 5SWZD 3PWJA 4PV8B 1QFHA 5E2UH 2BVQB 2DM3A 4ODTL 3HR5B 1S7SB 3L1OH 2QLVB 5EZIL 5EZJA 3FMGL 2FO4B 5CEXB 1A64A 3O2VH 5FYJL 2O5XL 3GJEB 1X5XA 3RWEA 3RNKA 4MQXD 3DV6B 5JMRA 3B6SB 4PRAA 4QEGA 4JJ5A 4NN6B 3WIHH 5DT1H 4JHBA 5JW5B 4XNZB 2VDPH 4NM4L 1FFOB 2BMKB 1VFOA 1EJ6A 3ELAT 2W9LA 4WY7H 4L8BB 4WFGE 1JFQH 2AV1B 3DRTA 5GISL 2AI0H 1MIML 1UB5A 1HXYB 5FUOH 3A6OA 3BPCA 1U8KA 2EXYD 4TULH 4MZ2A 1YY8A 3SDYL 3U9UA 2OJEA 4KRPB 2E6JA 4YXHH 3CIQA 2O5YH 1A7QL 3O2DA 1AD9B 1T21A 1HZHH 3MRQB 1MHHB 4XPBL 3NZ8B 4Q6YA 3T4YB 2YC1A 4QHUB 5HI4D 5HD8D 4KKLC 4R2GD 2HN7A 5GRXG 1XIWA 2QQLL 3TJHD 1FSKC 1OW0A 2XZQH 1CFSA 4K7PL 1IEHA 1W0WB 3PE9A 1RV6X 2CRMA 4NUJB 5ALCH 5F6HJ 4FQXB 3NACL 3X11A 1LE9B 4F7PA 2P5EB 4TSAL 1NAMA 5BW7A 2Q7YA 5HHXL 1QQDA 4QT5A 1C8PA 5C0CA 3OKLA 4YQXL 1T7VA 2H2SD 4Y19E 3KAAA 1JWUB 2NTFA 4MLIA 1BP3B 4M7ZC 5CJXA 2NLJB 3H7BA 4UV4H 4FFZL 4KRLB 3N1FC 5DA4A 3DO7B 2C7UA 3MRJB 2QSQA 4LMQE 1I1AB 4TYUA 4XAWL 4OLVH 3U9PH 3LCYA 1G7JA 4HUUB 3MODL 4M6AA 4KKCC 1E28A 4F15B 4K9EL 2E7LC 2AJSH 3HAEH 1TPXB 4LKXA 3LRHA 5E9DB 1U95A 2VXSL 4P5KB 5CJQH 1G0XA 4Q6IC 2VDLL 3MRFA 3VMOA 5FGCB 4LPUA 2B0SH 4OZHB 3LKRA 4MDIB 2AK1L 3P30L 3QNZA 4ERSL 1ZLWH 4GKZB 2GSGB 3K80A 3OF6D 3QFDA 1XFPA 4YXLL 3UJIL 2YD4A 4XCYB 3WKMH 4FNLL 1JZ5A 3HRZB 1SVCP 3PP3H 4FABH 4GBXD 2DLFH 4UAOC 4ZQKA 1A8JH 3LEXB 1MFEH 3MMEA 1H5BA 2AK4A 2VYRE 2HP4A 5DJ6B 2DQHH 1JV5A 4N1CA 5AZ2L 3LSOA 1JGEB 4ZODA 4G80B 1NGWB 5IB3A 4MSWB 4G9DB 5TE7L 2H3NB 3GMOA 5C86A 3HG1D 4Q0XL 1JYWA 4OCSH 1UH2A 2OL3A 3U7YL 4K71C 2FIRT 2OX5A 2H1PH 2P5WD 1NC2B 3TBVB 4D9RE 4F37F 2PO6D 3GSVA 4HF5H 2ARJQ 3GJFK 1KTDA 1X4ZA 2C4FT 1VCAA 1DBBH 3NFSH 3ZZ1A 1DQDH 4D9LH 3VWJD 1MEXL 1U8LA 1KOAA 5DRZB 1J8KA 1A02N 3PXHA 1YJDL 3V6BR 4NQDA 4U3XA 4PJXA 3WFZA 3QXDB 1MUJB 3MJ9H 1IGFH 5CGYC 5DO2C 5ENWA 3Q6FB 4J3WA 4DUXA 2V6HA 3BD4A 2R0KL 1NMBH 2NPLX 1EK3A 2UY6A 5IV2B 5E1AA 3C8KB 1MCPH 2BNRE 1HHJA 3SE9H 3UJJL 5CLTA 2WIMA 3OKOA 2HJLA 5AYQA 4D9QE 3JV4B 1W72H 3T0EC 4PIRF 4ODHL 1X7QB 1Q9KA 3GB7A 1F45A 5GS3A 3ZT6A 3IXAA 5B4MC 3LKQA 5DRXA 2IG2H 4KHTH 5FOBA 3ULSA 4YX2L 5TFSH 4LEXL 3HFMH 5CILL 3WKNA 5EU5B 3WXWL 1MJJA 4KHXH 3LY6A 5FDWB 4NKDB 1F4WL 3MV9A 4WV1A 4PY8I 1MCEA 5ITBH 4I3SL 2QL1A 4L8DA 1WBZA 4G8GA 4L4TD 4I5BA 4W4OC 3RGHA 3QBTB 4KVCL 4YHOL 1EAJA 3RUGF 5I8OH 4EDXB 4Y16D 5C08B 1PX3A 3QIBC 3LKPA 2JCCA 4YHZL 4TSBL 1S9WA 4IBLT 4N90D 5L2KD 3QUXA 2YA2A 3B2UC 3RKDC 4XP1L 4Z7NE 3Q3GB 3KJ6L 5JO5A 3KS0H 3GHBL 2G9HA 2NXZC 4Y88A 5IK3A 3LPWA 4C58B 3EFDH 5DHYA 1AY1H 1HDMA 5BV7H 3FRPA 1AI1H 4CDGC 2XQYK 4LSQL 3EGSB 5JHDE 2EH7H 3V0AC 1G6RH 1U92A 3TT1L 1U8MB 4OLUL 1JGDA 3SGJA 2ADJB 1JPTL 4MNQD 2EDYA 1A21A 4NN6C 3IXTA 1J5OH 3S5LB 4NQXB 1I1FB 4QRPD 1EMTL 2YPKA 3D0LB 4PRPD 3FT3B 1V7NL 4OT1H 1MCWW 4P99A 4RBPK 4HV8B 3ZYIA 4DUVA 2HT4D 4D3CH 4G6AD 1RAMA 4L9LA 2ADIA 1MRDL 3UTSD 4JFHE 4MD0B 5IJKC 3RKPA 4HIHB 5HYIA 5HHNB 4L4VB 4O9HH 3LZFL 5C07D 3IDUA 4ELKA 1GOHA 3QFJB 1IQWL 4FQ1L 5IJVB 3MRIB 4U1GB 4EI6B 1XCTA 5JDSB 3C5ZB 5CBEB 1ND0B 2DKSA 5DJ8B 5FYKD 1YN6B 4FXGB 5GRYA 1ZLVK 3TBWB 4NFDA 1JPFB 1AD0A 3QCUH 2B5IB 4FXKB 3K1KC 2CLRB 3PGCB 4LCWD 4DQOH 5I1LA 5IBTH 5CJ8A 1MVUB 1ZHBA 1EEZB 2C1OB 5KSUA 4F58H 4LLUB 4WUKL 1U8JA 3FO2A 4NQEB 5KS9E 3BKCL 5TDOA 2KDGA 4LLYB 3QEHA 1CDJA 5ID0A 1R3IL 2MHAA 5FOJA 4BSWA 4OGYH 3VCLA 4MJ5B 4TUJA 1RZFL 4XAKD 1IGCH 4NCC2 1ACYH 3I85A 1S8DB 3MLTB 4QY8A 1BX2B 1CI5A 5CINH 4O2CB 1NGZB 2CR3A 3DX6B 3REVB 2QHRL 1TENA 3WE6B 3TT3L 4BZ1L 2J12B 3ALPA 1I9EA 1B88A 4PRIA 2BNQE 4PJCA 5EU3B 3RFZC 3RA7L 1JHTA 3L3HA 3SOBH 4ZOEA 5I9QB 1P2CB 4ZUUA 2XN9D 4OV5A 4CU6A 4FA8A 4GXUN 2APFA 1WT5C 1F42A 1CICC 1RULL 3ARBD 4WU7B 1N64L 2DD8H 4POZD 4M6NH 1G1YA 3BAEH 3HMXA 2ITCA 2DM7A 1G0YR 4RZCA 3BDBA 4WWKA 2BY1A 4XNXH 3N06B 2G60H 3D3VE 4JQXA 3TJEH 4LLVB 2QADD 1JGVL 4NNXA 1H8SA 4HWUA 3MR9A 4NGHH 3S3SA 4PJHA 4IMKC 5EU6B 3K2MC 4HIIA 4WFFE 4E5XA 1SBBA 3K8MA 1KPRA 1D6EB 3QI9D 1A6VL 5C0NC 4HJ0C 1DBML 1K4DA 2J8UF 5C0AB 1IAOB 1Y6KR 2WBKA 3GK8H 5MP6L 5IW6B 4PJ5D 1ZTXH 5FF6A 2CMRL 4JRYD 2IMMA 3MBXL 3AXLA 3PWPE 2NY1B 4HBCL 5C0RH 3VWKB 3DRQA 5DJCA 4C57C 1DZBA 4MVBD 3HN3A 3DOSA 1L6ZA 3GSNA 4L3EE 4A2LA 2L7JA 2F54A 1MCQA 4APQA 1ONQB 3FT2A 5CBAB 1PQZA 4O58L 4MAUL 1GPOH 3VH8A 4F3FB 5HGGS 1MVFA 4JFPB 1YEGH 1LP9B 2FATL 5EC2B 2QKIB 3M17B 2Y06L 3FTGA 2EDQA 1KLGB 3IU3B 1KIUA 5LQBH 2YD2A 1CD1B 5IEHA 1BJ1J 1PFCA 3RHWK 5HYJE 1ZXQA 1KBGH 1TTFA 1BVKA 4P23A 1QSFA 4P57A 2LVEA 1OM3L 4RAUB 4NRZA 2EIDA 5D72L 5MEOA 4X7CC 1AGBA 3KYKL 4Z7WE 3NMEA 4ZFGH 3MNZB 1CD9B 4WCYH 3HS0B 3O3AB 4OZIB 3GBNL 2C5DC 4FTVE 5J12B 2D0GA 4XBPA 5D7IB 1JZ4A 3NIFE 3ARWA 4U1KB 4PD4K 5E08H 4DGVL 2A83B 4LSRL 1A4JB 4PJGA 4ODUB 1OAQL 5BJTA 4GKNA 3OKDB 5E8OA 1RZ7L 1PYWB 1XGUA 1YEFH 1BLNA 5HYSG 1CD0A 4OLXH 4LHJB 1UVQA 2DQIL 3R06B 3E3QC 3WNLA 3HI6H 2MWCA 5ANMA 2P8MB 4GQPH 1AC6A 1CT8A 1VGKA 1MWAH 4OCXH 3THML 4EIGB 1KIQB 3KYMA 3NPZB 2IPUK 4LSTL 4Z7UF 1ZSDA 2FB4L 4YHML 2DQFA 3BZDA 3FCTA 4LSUL 4HCRH 1PZ5B 2UZYB 1FVDB 3NCMA 5IMKB 1I9RL 4QWWD 4NN5C 5IVXB 4YHLL 1IC1A 3KPSE 3IAQA 4LDLB 3JV0A 4YUEH 3UTZB 2KQNA 4FG6D 5LAXA 1WUNT 3QEGH 2A6IB 3I84A 3RWDB 4ZDHA 5AZEH 1A6ZA 3V7MA 2HJKB 3CUPB 3GMPB 1T4KA 2O5ZL 3QDHA 4KVNL 4TOYL 2Z4QB 4GRLA 1E27B 1FNGA 1FLTX 4I9WE 1XMWA 5B8CA 4KZEH 1RZJH 1GZPB 1JF1A 1X4YA 4I2XA 2JKXA 1MAMH 1CE6A 1G7QB 1ZHLA 3NABL 5IHBA 3QJHB 2WBJC 1RHHA 4PJEE 4U1GC 35C8H 3D48R 3DIFA 5D5MB 1XGRA 4Y4KD 2MSPA 2VWEE 4G7VL 5EA0H 3C60A 3LQZB 2IH3B 4PJDB 4R4ND 4W70A 4TN9A 4X6CE 3L3IA 1D9KA 2EDLA 4NO5A 5ECJE 2IGFH 4NQCA 1S7RA 2E9BA 5D2NB 3MNWA 4HH9B 4WEBL 1FYTA 1OHQA 1OY3B 3QA3A 5E8PA 4OJFH 5DJDB 1UT9A 2DQGH 1F90L 4N8VA 1RIHH 1NSNH 4HXAH 1RMFH 1JL8A 4LEOA 1FG9C 4XVJL 3B2VH 1RUMH 4X5WB 4PBWD 1R3JB 3ROLB 5JUEH 2Y23A 3W0WA 3B9KD 4PJBE 4HZLB 3AAZB 4HIXH 1MSPA 4ZAKD 4I77L 2VAAA 3O8XD 4LLQA 3WFBH 1YECL 4D9RD 4LIQL 1BREA 5KOVC 1UGNA 15C8H 3VFPA 4GOSA 4R4FH 4PJ9A 2EDWA 1OTUD 1TZHA 3U1SH 4UIKH 4OM1L 2R8SL 1T1YA 1KTKE 4NNPL 4YFDB 3E6HA 5CZVL 4QCIB 1E6JH 1WBYA 5J6HB 5F96L 2B4CL 4J3SA 1UADC 5BXFB 2APVA 1OOAA 2IAMD 1KC5L 5GGSY 4K2UH 5DZLA 5IVZB 2WUCL 4LPVA 2AQ1A 4CN1A 3T04D 2NW2B 4ZMAT 2BNRD 1X6LA 2ESVD 3F7PC 3GFUA 5FYLE 5KVMC 2DLGA 5EC1B 2BFVL 4P59L 1H8NA 1RZIA 4MQ7B 4Z7OE 1QA9A 1T0PB 4YFLI 2ICEB 2HFFB 3QDME 5IG7A 4V1DA 1DN2A 4KPHH 3WS3B 2ILLA 2X5PA 3AC0A 5DVNA 4QO1A 3LN4B 4I8DA 3QHFH 2EXWD 1T83A 4QTIH 5J1AB 1VKXA 5E4EB 2HKFH 3QUYA 2I9TB 4R2GB 5INDB 5C0JB 1S5HB 1IAIH 5A2FA 4MCZA 5L8JB 4LLAA 5D7JA 3WD5H 2GJ6A 2NNAA 4X5LA 3Q48A 2NY1C 3BQUA 5DTFB 3UTTE 3UYRH 5I1JL 1A7RH 3N1QC 4OB5H 3MXWL 1AE6H 4RMUA 3VFVA 4RNRB 1WFNA 1FFPB 3BVNB 5HPMB 5K59E 1NLDL 1Q1JL 3HMWL 3KPRA 2AJVL 3G5ZB 4Y2DA 3TWCH 1JI2A 1P7KB 2EDTA 5DFVD 5GJTH 3I3EA 1J9CT 4XMPL 4R8WH 4OZ4B 5FM4A 3RVUC 1ETZB 1VFBA 3VD5A 1VESA 3H9HA 5DUBB 2FX9H 5JW3L 2DIBA 1LO4L 3V5DA 1RUKH 4QRTA 5C0DA 4BZ2H 4ZO9A 3W82A 1EEYA 4P2OA 2X70B 3FQUB 3EJZC 1Q9OB 5AD0B 1N6UA 2FIKA 3AB0B 3TVMC 3OR6A 4OCMC 5DXWA 5IHUL 1D5XB 2AK4E 3FO9B 1TIUA 3HE6C 1ZVHA 3MRLB 5H2BA 3SO3B 4IHOA 1YQVL 4XPHL 2ZCHH 3VJ6A 3ZYJA 2HKHL 1QLEL 2AEIT 3TZVC 4MA8H 2YPVH 3SKOB 4WWID 2YXFA 3LDBC 2V2WB 4UT9L 1EGJH 1YEDA 2UYLA 4NFBA 1U3HC 2ZUVA 4GXUM 4PLKD 2VUOA 3LN5A 2E3VA 1WJ3A 1ZA6B 5DD5H 2UY7A 3LS5H 1F4YL 1AXSA 1IGJB 3BX7C 1LO5B 4GBXB 2V7HB 4U6VL 3FB5B 4JFHD 5GGSB 1DQQB 3O9WD 4GQ9L 4PJ7A 2NY2C 4X80H 2X1OA 3B9DA 3O4OB 5DJ2A 2CKBL 4I18C 3RU8H 2JK5B 3GIVA 2EICA 2YRLA 3QXWA 1EXUB 2ZOLB 3MOAH 5EO1A 1I3RB 1NDGA 2AERT 1VADA 4PJXE 1YC8A 3BW9A 4ZPVA 3SKJH 3KJ4C 3DBXB 1Z6JT 1IL1B 4YO0B 1NEZA 3BGMA 3SPVB 5MI0B 3BP5A 2A38A 3UTOA 4MCYA 3TO2A 2P5WB 5JOEA 2OZ4H 5ADOH 5H35B 5ICZA 1CLZH 4JN1L 4R96B 5IFHL 2P1YA 2CR6A 4FXLA 1MAJA 4HWZA 3CVHA 4JKPH 2DQEH 1T0NA 4HUVB 4XCEB 2Q87A 5DJXB 3S37H 3VXSA 3D6GA 2JELL 4P2QB 1VSCA 4KTEH 1OP3K 4CVZA 1JPGB 1O7VA 4LLDB 3RTQC 1F00I 3BZFA 5CD5D 4J12A 1N5AB 2FX7H 2GTWA 5F7EH 5IF0A 3DJ9A 3O6ML 2NW3B 1HILA 1JGLL 1WWCA 5MHSD 5D93B 2LE9A 4H5SB 2X1PA 4J4PD 1DBAL 2A6DB 2IADB 1YYML 4EVNA 3BIBX 3DSNA 1G7MB 4OCYH 4RMTA 2BRRL 1CBVL 2BNQD 5DSCA 2ICES 1P4BH 2JCCE 1V8HA 3L3OA 1A7PH 5DZOA 3E6FB 1QEWA 2K3TA 1HCVA 5EFIA 2DLEA 2J5LC 2VLME 1MLBB 2VLJE 4FQCL 4B7LA 4Y4HC 5HY9B 1K9TA 3UPRB 3H8NA 4HKBB 2R9HC 5EZOH 1FDLL 4GLRH 1LDPL 2VITA 3BP7A 4HLZH 3D9AH 1CFVH 3EKCA 3MACH 4KKAD 4D0DB 1U58A 2VL5B 2EIEA 1DN0A 3HUJE 4L4TB 2YA1A 4UILL 5IFAH 3IDMA 1MY7A 4JHWL 5I30H 3DVNA 3KPPA 4DGIL 4NKMB 2FCBA 5DD3L 4PR5A 1MJ8H 3RZCD 3V7AG 4WFFD 2BCKB 4NWTH 1NPUA 2O26U 1YEIH 5ACZA 4OQTA 3WFDH 2IALB 5F3BB 2JB5L 4QGYA 1F13A 4JCLA 3Q1SL 3VFGH 2MMXA 5L2KB 5F7DA 1KENL 3L3JA 4YK4C 5F7LB 1N59A 2W9DL 5C70A 3BDXA 5DI8A 4S1QH 4G43A 1HWHB 1I8KA 2WLZA 4IOIA 4F7CB 5KN5B 2Y6SD 5DLML 5FO7A 1VACA 3PWPD 3KPOB 4DKAA 4PJFA 1W2KT 1QRNA 4LRNL 2I5YH 3BH8B 4ZFZA 4PJCF 5F88B 3PWLA 2EC9T 4J2XA 2X1XR 4L3ED 4NOBA 4MQXC 4MNQB 5MEPB 4JZOA 1K3ZA 2VDRH 3FMGH 1FAKT 2B1AH 4UQ3B 3WDIA 1FZMA 3U48A 5FYJH 3NCJL 4QRPB 1HSAA 2PCPB 5B3JE 4OGXL 5GRJL 1I8LC 1UZ8B 4N9GA 4OD1L 3CLFL 4K3EH 3QZWA 2B39A 3TYGL 4DFIA 5DRWA 2EXYC 2BVQA 3UTSB 4E0RA 1OAXL 5HYJD 4WW2B 1A47A 3HPLA 5ETUB 1C1EL 2FO4A 2OS7A 2P24B 5CEXA 5IHZB 1I9JL 1MIMH 5HGBA 3BO8B 1EEUA 3UAJC 4G8IB 4YDLC 1Z9OA 1WIPA 2RIKA 4OLWL 3HAEG 5AWNL 3SDYH 4ZFOA 4NBXB 5HI4C 3IAGC 1MIEL 3OGCA 5J6GA 3LRGA 2XI9A 1H3XA 4R2GC 3TJHC 4CU8A 4FTVD 2AV1A 4XPBH 2DQTL 5E5UB 1HXYA 4JG1L 3MFFB 3CU7A 3SE4A 1YEHL 4RGOL 3H0TA 3LKNB 5C6WH 1J11A 3W5MA 2QQLH 4PRIE 3SDDD 1IAII 2WINB 3KPQB 2H2SC 1J0KA 3S3JA 4K7PH 3KPLB 3UTQB 2R0ZL 3BPNB 1RI8A 3E2HC 1AD9A 1NFKA 3CH8A 5JA8B 3P73B 4OTXL 5L2JB 5E24E 5HHXH 3KXFA 2MFNA 1R3LB 4QHUA 3VW3H 4YQXH 3DUSB 3C09B 3I6KA 1L7TL 1U3YA 4XXDA 1JUFA 4RIRB 2EO9A 2X89A 5GS2D 1EFQA 3S36H 2HRLA 3T0VA 4U3HA 1TITA 1GC1L 5GRVK 4K94L 4WEMB 1LE9A 2P5EA 5BQ7A 5KOMC 3BT2H 3MODH 3C6LA 4PJHE 1P9MA 3I3DA 3X3FL 3KPSD 3S97C 1HXMB 3GJFH 5D1QA 4MJ4A 3WXVH 1BQHG 4K9EH 1E4XL 1JWUA 3ZE2E 3WHXB 3PQYD 2E6PA 2XN9B 1EBPA 3FL7A 3Q6GH 5GPRA 3PDOA 4NJAL 3ARED 2FGZA 4X4ZA 5TE4L 2Q86B 4GKSA 1VENA 5D2LA 3SGKA 3ARBB 4JO4H 5M7QA 1C12A 1V3KA 2VRAA 3T65A 4P46D 5F9AC 2BXYA 4HUUA 1IKNA 3H7LA 3IKKA 5SV4A 2AK1H 3QH3A 4GBXC 5A16B 4ERSH 3D85B 1A7OL 5F7YC 1IFHH 3V0WH 1UYWH 2YD5A 3EDDA 4YXLH 3O4OC 1MJ7L 4FNLH 4AEEA 4UOJA 4MNGB 4IJ3C 1F6AB 3T8XB 4ZFFA 4DZ8B 1VB9A 5F7NC 4CGTA 2EYSB 3HAEB 4I0PD 3O6KL 4MDIA 2I60L 3ZDZE 2EDJA 1XF5A 5MI0C 2EDHA 1Q94A 2GSGA 4PJ5B 5AZ2H 5IB4A 1FZOB 4JRYB 3ESVF 3QXUA 2PO6C 4XCYA 5TE7H 2D4FA 1NEUA 3IETB 5EPMB 4PG2C 5DJYB 3S37X 4Q0XH 4GXVL 4Y7MA 3U7YH 3VWJC 2FWOB 4QF1A 2Q8BH 2DIAA 1QSFE 2OSLA 3LPGA 4YBQD 4TNWK 1ZT7B 4N0CD 4WFHE 1BMGA 3CX5K 2NY3C 3L3DB 5CHNB 5HVHB 1FJ1B 2UUDK 1NGWA 4G80A 4UZGA 5C3LD 2Y36H 4G9DA 1MEXH 3QIWB 4LFHD 3ZT5A 3RQ3A 5DQ9A 1OLLA 3TCLB 3MV8A 1MLCA 1TFHA 4PB9L 3IDYB 4GMTL 1YJDH 3GSOB 5K9KA 3RHWF 3TBVA 2BDNL 1CZ8L 3DVGB 1JNHA 3ULVE 4OZFH 4OF7A 4R97B 4PJGE 4OAWA 3CFEA 4U1LA 4H25B 2DQDL 2GEEA 4WTXA 3NAAL 3HE7C 3V0VA 2R0KH 1T22A 3DXAB 1IGYB 2DQCL 1HEZA 4X7TB 3DV4A 3MRMA 1BQHB 2HRPL 5EBLB 3UJJH 4PJIB 4XBGB 1QFWI 3GGWA 1UC6A 1N0LA 1MUJA 1BQLL 5DJAB 1XIWD 5GRZA 4JE4B 4U0RB 4O02H 3Q6FA 5IW1A 4X9BA 3T2NL 5SWSA 2EE3A 2FBJL 5FYLD 1A7BA 1REIA 4GS7C 2YUXA 4YX2H 4LEXH 4Z95L 3QULB 3JV4A 4GLRI 5C0CD 2F74A 4Z18A 3WXWH 3TA3C 4RBPH 4Y16C 1RIUH 5HHQB 4KJQD 1TZIB 4I3SH 1FORL 3MA9L 5J3HC 1YPZA 3D18A 3W11D 5JPNB 4KVCH 4YHOH 3IU4L 4JAMB 1A9BB 4X4XA 4ELME 3I3BA 2CIKB 1QBMH 4YHZH 3U46B 4TSBH 5EU5A 4X99A 1T3FB 4AL8L 3GBLA 3MRKB 4NKDA 5EOQL 5HDBF 1ZLVH 4UB0L 3IFOB 3PGDB 3WLBA 3NPSB 3KPTA 2UZXB 4I2XE 4JPVL 4XP1H 1A2YA 1LD9B 3R8QA 3KJ6H 2X1WL 4EDXA 3GHBH 3QG6B 4UDUA 4BKLB 2WIIA 3EZ8A 4FFYL 3TNMB 1HCFX 4LSQH 3C5SA 1H8OA 2R15A 1LGVA 4Y5YB 3VMNA 4FQJL 1I7RB 2K7PA 2EIZB 4NQCE 5KSAC 4PBVC 2HT4C 3VRLE 1FYTE 1H3VA 4R0LC 4IOFD 3BKJL 2H26B 1XGYL 2YBRB 3NIDE 1U93A 4WW2C 2AK4D 5EBWB 1KPVB 3RVXD 2RR3A 4NNYB 4DCQB 3FQTB 2F19L 4HEME 3HZYA 4JVWA 1C08B 3WDHA 2QBWA 3W0WE 4NQXA 1UWGL 3SKNA 5ICYB 1I1FA 4Y4KB 4LCIL 1YNLL 2XWBB 3LZFH 3V6FB 1P4IH 1X6NA 5E8EB 1NCTA 1IQWH 3D0LA 3GIZL 3RIAK 1S7QB 3P0GB 2EH8L 4K7PX 2BSTB 4HV8A 4L3AA 5D96C 4YNYB 5EBGA 1FO0L 1NLBL 1QLRB 5C92A 2YD8A 3MFGB 5JW4M 1WWWX 3BP6B 3VFNB 5KVGH 4KMQA 3KNBA 3O3EB 4NQDD 3T2OA 3FFDB 2OQJA 5FGBC 2KQMA 4WUKH 3B9KB 2VISA 4EI6A 1I75A 4X5XB 1NCWL 5JDSA 3C5ZA 5CBEA 3IDXL 2LABA 5DJ8A 1YN6A 3NA4A 4FXGA 4JQVA 4CDHA 4UNVA 4L5FL 1JJUA 3WJJA 1R3IH 1FE8L 3GZKA 2CLRA 4XNMA 1S9KC 1FCGA 2VE6A 4X9GA 1EEZA 1S9YB 2C1OA 1RZFH 1WWAX 4KUZL 3OWEA 1HHIB 1Q38A 1YJDC 5IVOA 2AEPL 5EO9A 1H0DB 3P9LB 2FLRT 1FBIL 1V5JA 4LLYA 3SQBA 2QHRH 2CJUL 2VZ3A 4YEEA 1N4XH 3VFOB 4BZ1H 3TT3H 3FOMB 3LEYL 4F7MB 2IAMB 1KJ2H 1NBYA 4OIBA 4U2ZA 4LCUB 2YXMA 3RA7H 4MJ5A 4WI8A 4WO4C 3OQ3B 3S34L 4POZC 4JO1L 4JDTL 3MV9D 2BNRB 2GJ6E 3VXTB 2ESVB 2AV7B 1BIIA 3MLTA 1CG9A 3ISWA 4PJ7F 4G8GD 1NGZA 5CP3A 3REVA 3OKMA 1RULH 2QADC 1N64H 2X9WA 1WAAE 2H9GB 1Z9SA 5EU3A 2E27L 4FFWC 3O6LL 3QI9C 4AM0B 2W59A 4F33B 3QUXD 5CP7B 4XWOD 4GRWE 5I73C 2VLMD 7CGTA 3NH7L 4O5LL 4YDIL 3SDXE 1VDGA 1AJ7L 4FZEL 4JM4L 4XC1L 4JY4B 4YHKH 4JZJA 1X5IA 3WS6C 2ICWB 1A6VH 4YPGB 3D39A 1DBMH 2EC8A 1GOFA 5TH2B 5EZLA 5MP6H 2PTUA 2CMRH 4LLVA 4QRUB 4HS8L 3KPNB 3BGAA 3MBXH 2ZG1A 5T3XE 4WDIA 2HAZA 4HBCH 5HVHC 1Q72L 3KHQA 2PR4L 1UCTA 1NBVH 2JE8A 4C83A 2RHEA 4U49A 1JWMB 2NCMA 2FJFA 3FB6A 4XX1E 3TIDB 2V9TA 3U7WL 5C0AA 1IAOA 1SEBA 5J8OA 1X3DA 2R2BB 1FGNL 4O58H 5FA3A 3GM0A 4K7FA 2LTQB 4P5TB 4R97C 4XHJD 5KJRH 4I4WA 3P11H 1HKLL 2A1WL 3VXNA 4OCWH 2ZWLT 1ED3A 2XNAB 5D8JH 1U3ZA 5D6DC 1N7MH 1NMCB 5DHVB 5CBAA 3QUMA 3MLXL 5I15L 2Z93B 1OM3H 3KYOB 3JV5A 4QXUL 5D72H 3QRGL 5EC2A 3LRSA 3M17A 4U6HA 5LGKA 3IU3A 3KYKH 3SQOL 5E6YA 4UBDD 4XP6H 1NUFA 1CFTA 1CD1A 1IZKA 3O9WB 4Z76A 3EYUL 5BMFL 4XP5H 3QWOB 3GBNH 5CSZB 2BC4B 3RUGB 5E2JA 3CFJA 3VXRA 3VXSE 2FYYA 2ZNXA 4RAUA 4YBLB 3C8DA 3RNQB 2I07B 4DGVH 4LSRH 1T0MA 1OAQH 5HJ3B 3ULUE 4BQ6A 2DTSA 1DQLL 5C8JA 1MAKA 3NZHL 3WO4C 3KWWB 4MDJB 4ODXB 3HS0A 3U36B 2DQIH 4YFEA 1EHLL 1GGBL 1A7NL 4GG6A 3X14B 1Y0LA 1MRCL 3QWRA 3RGVC 3NVQA 1ZANL 5GRUH 4HX1A 4EN3A 3THMH 1KJ3L 3EO0B 4LHUG 4PRID 1N6VA 4QWWC 1FLRL 3MRNB 3OKDA 2BJML 2DLTA 4ENED 1B0RA 4XTRD 5GHWL 2FB4H 2O61B 4QLRA 4YHMH 1ZHNB 4OBSA 3G04A 4ONFL 2XFXA 5C0GB 4LSUH 3UPCA 1DE4B 2AXFB 4S11A 1G7LA 3FRUB 4J1UB 1I9RH 1LK2B 4B53A 2P7TA 5DRNA 2DQUL 3BRDA 1W8NA 3RVVD 2IQ9L 3RY5A 5DR5L 3HCVB 1OLZA 5GSRA 4WWKD 4BH7A 5F70A 4UTAL 2HLAA 4XZUB 5HGHB 3FZUD 4HWBA 4TVPE 1G9ML 2IANA 3KPMB 4GRMB 1NJ9B 4Y1AA 1GCFA 5C2UB 4F2MA 1MWAB 2HT3C 4LOUD 2BNQB 5IMKA 1X5YA 3IJYB 2D9QB 4TOYH 4LVHC 3UTZA 1ZT1B 1XF4A 5F8QC 3GO1H 1KCVL 3BYTA 3ARTA 3PABA 2G2RB 4Y4KC 5DQJA 4JVPA 3NABH 1CK0H 4R4NC 1JWSA 1SY6L 5TPWL 3MRCB 4MXVF 4ZOCA 4PJFE 1QRNE 3HNVH 1XR9B 3S7GA 2Z4QA 3G5VA 1HK6A 1N26A 4MB5A 3UBXB 3RZCB 3C5JB 3TIEB 1G7QA 2F54D 3IKCB 1O7SA 2YD6A 3VXOA 4YHIB 4JDZB 4APQD 5CGTA 3H3BC 1OSPL 4KDWA 4WEBH 3RL2A 2IBGA 2IFFL 5FKPB 1UACL 3MQIA 1B0GB 4UIMB 2IEPA 2D7MA 3B9KC 2AXHA 3VFTB 1F90H 4ONHA 2Z92A 5D5MA 2NY4D 4ZAKC 1YY9D 3LQZA 3O8XC 2IH3A 4LCYB 4XVJH 1TTUA 3Q5OA 1G7IB 2HFGL 3G9VA 1F6FB 4Y8DC 4P23D 4QXTB 4I77H 1QSFD 1CYGA 2ADGB 1C7TA 4L3EB 1YECH 5ABDE 1IAIM 2F53A 2VR4A 4WVRA 3RDTA 1HHGB 3ARDA 2DOCA 5CEZL 1CDCA 5HYSA 3HZVB 5TGBB 4OM1H 5D2LF 2R8SH 3ROLA 1CN4A 3CXHJ 4NNPH 3RVTD 3UZQA 4HZLA 2CK0H 5GSVB 5CZVH 1BVLA 1WFTA 1WV7T 4XMKH 5LCVL 3P2TA 3STZA 3SY0B 4UU9B 2ATKB 5F96H 2R2EB 4DOHE 4X9IA 1K5NA 1B3JA 4ORZC 5DQDH 3ULVD 1KCKA 1KC5H 2X4QA 1K8DB 5F7UA 3CPLB 3ZTJH 2P4AB 3QQ3B 2WUCH 4FQQA 1KYOK 1MCFA 3OJMB 4LNVA 4M8QA 4P59H 4JN2B 5CIPH 4TUOB 1G7PB 4XNUL 4CL7A 5BXFA 4GO6B 2J8UB 4UDTA 3IFNL 4PG9A 1F2XK 5E2WL 5HYQB 4FTVB 4IRJC 1LO3L 4ZTPL 3BUYB 3ALXA 4NUGL 3QQ9C 1TVBA 1YZZA 1GL4B 2NW2A 4QRQA 3UX9B 4TPRL 5JHLL 3U30C 2P5EE 5EC1A 5C09B 5TDPA 3SDDB 1CL7H 2HFFA 5DFVC 5I1JH 3WS3A 3O6FA 1MH5A 1T1WB 3MXWH 3MCLH 3MJ8B 4XCCL 1NLDH 1Q1JH 3HMWH 4S1DD 1CLCA 1JK8A 5EBMB 2I9TA 4X4ME 4GW4B 5C0JA 5I1IL 5GGUA 1QBAA 1DUYA 3D2UA 4XMPH 2NX5A 5DVMA 1FFNA 1LNUA 4GRLD 1CIUA 1MCCA 4NHUA 3QUKB 4QRSB 3NCYP 2ATPB 5F9WB 4LBEB 1CFQB 1LO4H 2B2XL 5H8DA 4D0BB 2DM4A 5E9DE 3DSFL 3KPSB 3B8YA 2GCYB 2GFBA 5GIRB 4J6RL 4ORGA 5FGCE 3LV3A 4RX4A 1S7TA 3ARGA 1P7KA 3PQYB 4NO2B 5IHUH 4OZHE 3MUGA 4Y5XB 1ETZA 4PLKC 3C60D 5DUBA 4ZG1A 2EDFA 4XT1C 2R4SH 3OZ9L 1YQVH 4XPHH 1D9KD 4P46B 2HKHH 1QLEH 3TYFB 4Z78B 1UENA 2ID5A 1OP3H 4NQCD 2IF7A 4HPYL 3FQUA 1FYTD 3MRGA 4UT9H 3QRFM 5AD0A 1Q9OA 3FQRB 1MFNA 4YDJA 1IMHC 3SDAA 1MFBL 4AMKL 5T3ZE 3HC3L 4PB0L 4Y5VB 3DPBA 1KUMA 1OF2B 5T1KB 1D5XA 2CDFB 2H6PA 1F4YH 2AQ2A 4ETYA 1IQDB 1KJVB 4PJEB 2XWTA 5GS1C 3T4AA 4OIIL 5EN2B 4U6VH 1MFAL 2EDOA 3BWUC 3F7YA 1PLGL 3GI9L 5DYOB 3W0WD 4LGPB 2WWMD 4GQ9H 4I0PB 2DJ4A 1QFWM 4YC2C 2CKBH 3MV8E 3U0PB 1P84K 2A77L 2HLFD 4S2SB 4FMKA 3PWJB 1OP9A 4KXZH 5E2TL 4LQFL 4Z7UB 4PGEA 4EUPH 1I8IA 4TNWF 1ADQA 2A0LC 4PJ9D 1CFBA 1KEGL 3EJJX 3FB5A 5GGSA 1LILA 4HUXA 1L0YA 2Q6WB 3RNKB 2FLBT