5C2UB

Ferredoxin-like domain of nucleoporin nup54 bound to a nanobody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
VQLQESGGGLVQPGGSLRLSCVVSGDYYAIGWFRQAPGKEREGVAAISSRDGSTYYPDAVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADRRQRWGPYYYLSALEYVYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nanobody
publication title Crystal structure of the metazoan Nup62Nup58Nup54 nucleoporin complex.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 33
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c2uB00
4PTTB 5C0JA 3FFCD 3P9LA 3NFNB 5F9WB 1TPXB 2ORBH 2PXYB 2X1XR 3Q0HA 4Z7UF 3N1QC 5F6IC 1FNSL 4X8JA 1QSFD 4I3SL 1XIWC 2IQAA 2QQQA 3UJJH 4XC1L 3QUML 3QH3B 2IADA 1KCRL 3MV7E 5E99L 2Y06H 2Y5TB 3CSGA 4LHUA 3VG9C 1TCMA 5IROC 1CGXA 3E1F1 3OGOE 3ZYOA 1PKQE 4W6WB 2F15A 4LSPH 3QNZA 5FIEA 3Q6FB 1FL6A 5D7LA 5KOMC 5FO8A 4P57B 2UZIL 3MA7A 4MJ4A 1ITBB 4FABH 3R8QA 4UB0L 4XPBL 4BZYA 4P9HH 4KQ4L 2I07A 1OWWA 2AXFB 2GEEA 5EIVA 4ZUWA 5ADPH 1MJ7L 5MP6L 1FGVL 1FG2B 2P8PA 2DL9A 3CFEA 5D1XA 5TJWK 4JFQB 4DKAA 3SJVB 4GG6E 4FFYH 3KNBA 3T1FA 1S7SA 1P4IL 1XFPA 4HDIA 4R7NB 2E7LC 3QZWG 4KPHL 2NTFB 4NO3A 4OZHE 5TGBB 1KJMA 2FH8A 2VITB 3MUZ1 2CRMA 1DEEB 5E6ZA 1EJOL 4LASH 3AAZA 1PG7L 2YEZB 3SDDD 1DVFA 1RZFL 4R2GD 3VRLF 3DX9B 4U1HB 1G6RA 5HHME 3DSNA 1K8DA 1KTDB 3OXSA 5DMGC 1ZHKB 3B9KC 5IJVA 2GTZA 4I5BB 2I9TB 3BQUC 2FJHB 2E6QA 3ULUE 2DMKA 2PR4L 5D2NB 3IXTA 4BUHA 2FEEL 1U2CA 4TTGA 3QZWA 2OYPA 5EC1A 3W9EA 2VLKD 1SMOA 2YPKB 1UVQB 5C07E 1SJHA 1P5VA 5DHYB 4NRZA 3T3PE 4Y4HB 1IGYA 1AXSB 3BIKB 1GGCH 3BDXA 1HQ4B 4M6NL 3HUJB 2ED7A 5EBMA 1IEBA 3QDJB 1AGDB 1Y6NR 2EE9A 3L3DB 5IVXB 2OX5A 4XC3H 5ETUA 2DMBA 1IFHH 3JUZA 2J2ZA 5D8JH 2Q8AL 5DQDL 1AR1C 4RWYL 2NCMA 1H3WM 3ET9F 4IMKC 4YJZL 3BUYB 5D71L 3VDCA 3WD5L 5C0CD 5TPWL 1AE6L 2Z8RA 5T3XD 3CMGA 1J5OH 2OJEA 1CR9H 4Q2ZB 2MCPL 4Z7WB 1KENL 5F3BB 4K94L 4KVCH 3SGJC 1E4XH 3FOLA 3CDYA 3QP3A 4NNYA 1CCZA 4QRSA 2SEBB 4MNGB 3LKRA 4LSUL 1T20B 1GVIA 4HIXL 1JNNL 3ARDC 3KR3H 2Q6WA 4WV1C 1EDQA 1NSNL 1YPZE 3BT2L 5JPMB 4PJ7B 3BP4B 2YZ8A 7CGTA 4HBQA 3ES6A 3IDGB 3O3BA 1T2QH 2OI9C 3W0WA 1U3HB 4U1IA 3Q5TA 4RQQB 5CZXD 2X09A 2BCKB 3MRIA 4J7RA 4DVBB 4W4NA 2Z31D 4OCYH 1OM3H 5DMKB 2IPUK 4LU5H 3X12A 1K2DB 5HGDA 2GK2A 2FL5B 5JQHC 5IHLB 5HPMB 4U6YA 4F2MB 2DWDA 1RZGB 4ZTOL 1CXFA 4QOKA 2W9EL 4M00A 2JB6A 4JGJA 5A2JH 1ZVSA 1KIQB 3KPRE 3MJ7B 4ZUTB 1YEHH 3LS4L 3TH2T 1T83C 2ITDB 3RAJL 1KSRA 4MGXA 4LARL 4XMLH 3EO9H 3OG4B 4E41D 4NIKB 3P4NB 1TQCB 3LEVL 3B2UC 5JNYB 2OSLB 2PN5A 4J3TA 4N0CC 4BZ1H 1EA9C 2UZYB 4JRXE 2ESVD 4TTDD 3GSOB 3QI9C 3MLWL 4PJCA 3LD8C 5MEOB 2UV3A 4WWKD 4OCXH 3MJGX 3O8XC 2R1XB 5DFVD 4I3RH 3HI5H 4JDVA 4MCYB 2IH3B 3DSFH 5FGSA 3CUPB 3MLRH 5GHWL 1J1XL 4H1LG 2DLIA 1M6OB 5EPMA 3TN0D 2MKLC 2QSCL 4F7MA 4CJ1A 3VXUE 1F4XH 2XKNB 3VXTB 1BF2A 3FN9A 2ZP0T 3WBDA 3O6FA 3GHEL 2OL3B 3ZDXE 5I71B 2HT2D 3HRZB 5JOEA 1B6DA 3MNWB 4HKZA 3GK8H 3UPRB 3AM8A 5GS1A 5E1HB 5HGHB 4G8FA 3CZFB 4OLVH 5GGTH 2AJUH 5KVEL 4PIRF 4H1LA 5F1OB 4GO6B 3RWGB 3L3KA 3RNKA 5H37H 4KH2A 3GBNH 4JN2A 2VXUH 3BDYH 5DF0A 1YA5A 4PJ9A 1H0DA 3WIHH 5HTSA 3QDAA 3RWDA 1KXVC 4UQ2A 1ZHBB 4J1UB 2EDWA 4CDHA 4WW2C 4CAGA 5E9DD 1UM4L 1RU9H 2XYCA 2KUTA 2QSQA 1HHIA 5KSUB 5JW4M 5C9JB 4URTB 5JW3H 2VQ1B 3H9HB 1LEKA 4P4KA 4P2QA 5E2TH 4MQXD 2GJZB 3HAEB 1EZVY 2RHEA 3JTSB 3UJIL 1IAOB 4YHNA 4U1GC 2F54A 1J12A 5E2VL 3RJDA 3O4LE 1JZ4A 3TBSA 2HVJA 4UTAL 3SDYL 2XI9A 1RFDL 1U8MB 1UM6L 3MLVL 3P0VH 1TQBB 4K7PH 4FP8H 4UIMA 3QEUB 2XZCH 1I7RB 3F12B 2J6EH 1S8DB 4UV7L 5FK9B 2EYTB 4ETYA 4UT9H 1LP9E 4XTRD 2Q7YB 1IAII 3PDDA 3WFEH 5GSRA 3SQBA 2V2XB 1AXTL 4OIIH 3UTPD 2NW2A 1F3JA 5DZNA 2XN9A 4HWZB 1DUYB 3VXMB 2F19H 3VGAB 4XPTL 2VRAA 2R29L 1JZ7A 1WK0A 3D85A 5JHDD 4NQCB 1XCQA 2A9NH 4KK9D 4MCZA 3W9DB 4JFEB 5FHBH 2Y7QB 3RWCB 3QIUC 5E94B 2WIIA 2P7TA 3HAEH 5E6IA 3DROB 2H6PB 2F74A 5T3ZE 2AK4A 4KGLA 2DQDL 3F6LA 1RZ7H 3QSKB 5HVHB 1U3JA 4OGAD 1AKJD 4FN0A 3TZVC 2NXYB 1BQHA 3L3IA 2X1OA 4QRRB 4BSWB 5SWZB 3SCMB 4NQDB 4LDLB 1B0RA 1NC2B 4LVHB 5A2IH 5TF1L 3T3ME 4MNQE 1IQWH 4LLDB 4M02A 4G7VH 1XGYL 3NFSH 5J12B 1JIBA 1XF3A 1BPVA 1NLDH 5ESAB 3ZSTA 4E41B 2ZSWB 2OP4L 5L8JB 2IAMC 1MIEH 2ZCHL 3O2DA 1QBBA 1IM3B 3K1DA 2E9WA 3C08H 1EHNA 2BSSB 1DBBH 5DSCA 3W11D 3QUMB 1S9XB 1NFIB 3VXQB 3BP7B 3BH8A 5SWQB 5C92A 1N0XL 3MRBA 2L4OA 1W72L 3FFCE 2C4FT 2N7AA 1IARB 1FZKB 1CL7H 1S9VA 5EBGA 1OT1A 1HHKB 1PDKA 3GMMA 4PR5A 3SDXA 3NN8B 3FQNB 3SBWA 4DCQA 3T0AA 1I7UB 3REVB 1EFXB 4JFXB 12E8L 5CINH 3RJQB 2AKRB 4MA7L 4PFEA 1G7IB 3NCJH 1QR1B 2C3WA 4M6AA 1FNEA 3MOBH 4PRHE 2IG2L 2J8UE 3ZHKA 4PP1D 5GRUH 2R56H 3TBWB 3QEHB 1JUFB 4OZGF 1QNZH 2D4FA 2VZ1A 3D18A 3O6KH 5AYUH 3ILQC 3QXAA 5EU3B 1OAUL 2AERT 5DJXA 1BZ9B 2DLHA 4H88H 3LEXB 5AYQA 1GPOL 3AS1A 1FN4B 1FNSH 3LQZA 2OMNA 3RHWK 5FKPA 4I3SH 5CJ8A 3RX5A 2YK1L 3OTTA 4X6DF 1S9YA 4HK3J 3U0PB 1Q94A 5JORB 4XC1H 3RIAF 3QUMH 3DBXB 4MDJA 5ILTL 4OD2A 3RWEB 1KCRH 1B2WL 5E99H 5DUBA 2FH6A 4JRYB 4YE4L 3MRDA 2V6HA 3ZSSA 5FOBB 4L8SC 4CVUA 3H9YA 3N85L 1X5GA 1MCEA 1UFUA 1CG9A 4NKDB 1CLOL 1YNTA 3MRCA 5J1AB 4JY4B 5B38G 1MAMH 4XPBH 3ZE0F 1BBDL 4KQ4H 1X7QA 3UTTD 2VNCA 1K5NB 4JPKL 1MJ7H 2N1KA 2FO1A 3U82B 5E5RB 5MP6H 1FGVH 1K4CA 3PWJB 3FRPA 5EO0A 4ZOBA 3RGVC 2VL5B 1M1SA 2Q3ZA 3L5IA 2VLKE 1P4IH 2FRGP 5MEPA 4KPHH 2HMID 2E6PA 3VXSA 4ZPVA 4YK4C 3C6LB 4NSKB 5D2LE 3QJFB 5CHNA 4E0RB 1EJOH 1PG7H 1A7RL 4UU9A 2BRQA 1RZFH 3P4MB 4GRWE 3IXAA 4BSVA 5I18L 3HFML 1HI6B 3V7AE 5HYSB 3VFVA 4P23C 4QHKJ 1AC6A 3DV4A 2AV1B 4LNRB 2IH1B 1J8HE 2PR4H 4LCCA 3QQ4A 4PJAE 3GUTB 3VFNA 4IRSA 5HBBA 1JCKA 3U6RB 4WO4D 5T3XE 5J89A 3O6LL 1TETL 3WFHA 1FNGA 2H2PC 2FIKB 2GW5A 1WZMA 5C08A 4DWHA 4RMVA 4LSVL 4M6NH 3QCUL 4AQ1B 1OTUC 1FYTD 1OAKL 1QSEA 4V2BA 2XZAL 3QUZD 3KLHD 3QUYA 5JHLL 4OLWL 4U6VL 4TUJA 3MRGB 3BFOA 1G9ML 5EU4B 1FV1A 2H3NA 2CPCA 2Q8AH 3QFJD 5DQDH 3HS0A 3PQYD 3PWVB 4U05A 1FJ1B 4RWYH 8FABB 2VTFA 1KB5A 3OKEB 4BK5A 1PX3A 3QPQC 5ACZB 5LBSL 5D71H 4ZDHA 3WD5H 5I76A 5TPWH 1AE6H 3DX7B 2EYRB 5GGRY 5T1KD 4MVBD 4BH7A 2DF3A 4XXDB 2MCPH 1KENH 5C0GA 3QEGL 1VACA 4K94H 3RBSA 5GRZA 1N26A 2B4CL 3AB0C 2Q20A 4M48L 3ZDYE 4F7TB 1E4WL 2CLVB 3P0GB 5IW1B 3HCVA 4DOHE 1T66D 2FO4A 4LSUH 4HIXH 1JNNH 2VXQL 1T0NA 2V2TB 3HUJF 3BT2H 5C71A 4QXWA 2Z92A 3U9UA 1QG3A 3ARBA 5LGJB 4YBQD 3FO1B 5IVXF 1ADQL 3D0LB 3C5SA 4U6TA 5HI4D 2FWOB 4OCNC 4H0IA 3DMMA 4GW1A 3QDMD 1X3DA 4LLQA 1FFNA 3UTSB 3SGEH 2VZUA 5JUEL 1BVKA 2FLBT 3MV9A 3W5MA 1WBXA 1QLFB 4GW5B 1LO5B 1RULL 2EIBA 2BVYA 1CU4L 3HE6D 5I30L 1I8KB 1QVOB 1TTUA 3WO3B 4DW2L 1H5BB 4ZAKC 4ZTOH 4Q74A 2UY7A 2W9EH 3BOVA 2ESVE 1NFDE 3LPFA 4FQJL 2CDFB 3WDHA 3IU3A 2X4TB 3UYRL 1RMFL 3JV6A 2AQ3A 4X7SL 3LCYA 3PJSB 5TQ0L 2YS4A 3ISWA 2D7QA 3LS4H 2WQ8A 4K7PX 3TH3T 5J11B 1KTLB 1AIFB 4LQ1A 5ISZE 2W07A 4IM8A 4W6YB 4PJ7F 3RAJH 2XRAL 1V7NL 4EI6B 4XBGA 4YO0B 3WDIA 3PWLA 4LARH 1B4JL 2EDNA 2XA3A 2MHAA 3PL6A 1ZT4B 3LEVH 2VZSA 2O5ZL 3SOBL 3D6GA 4G8GA 1NAMA 4P59L 4R8WL 3TBYA 3QHZL 4MD0A 5EA0L 1BX2B 5DEZA 2VN4A 3D1MC 3MLWH 4QWWD 4BZ2L 1IT9L 2YPLD 3R0NA 4OUUB 3GSWB 3UDWA 2IAND 3VXRE 5DD5L 1MCWM 3RZCA 4M93B 5GHWH 4UT6L 3VFSA 1J1XH 1BZ7B 2NQCA 4ODBD 1ZGLM 4ZYKB 2RFXA 4MB4A 2QSCH 4JFDB 4U7KA 1AR2A 4XNZC 3VMOA 4PLNC 2XT1B 3CFJB 3E6FA 4JKLA 5A43C 3ESUF 1RIUL 2LU3A 3MBED 3GHEH 5JA9A 3X11B 2EDHA 4D0BA 2WBJC 1HEZB 5E7BA 5E9DE 1NKRA 4LHQB 1I3RA 2D7MA 3H7BB 4G9DA 4LKCA 3V7AG 3ZE2F 5L9DL 5IMMB 4HH8A 4LNVA 1RK1A 1WT5A 2YSSA 3ZE1E 4Y88A 2QKIB 1U8PB 1JF1A 3QXUA 1NCNA 2ICEA 4ZO7A 1DLHA 5B39A 3VRJA 4NKIL 3TF7C 4Y1AB 3QEQD 1XR8B 4I0PC 3SE4C 3MOAL 1ERNA 3DECA 5EZLA 2CO6B 9CGTA 3RDTD 3HA0A 1D6VL 3CVIL 4U0RB 4EBQL 1T5XB 3H9SD 1UM4H 2V5RA 5FYKU 1HWGB 1FFRA 1G0YR 2QADD 1QQDA 3GSVB 4OLZL 3EDDA 3TEUA 1I8IB 1BVLA 4KU1A 5I19L 3HZVB 3UTPE 4CMMB 4RAUB 3ME0A 4AEEA 4KRPB 5F7YC 4LSRL 3VXNA 5JHDE 4WDIB 5E2VH 3MRFB 3G6AA 4XNQA 1Z5LB 5T1LB 4ELMA 4UTAH 3SDYH 2HVKA 1MJJA 2VC2L 4LSQL 3JTTA 4D2NA 1RFDH 1UM6H 3D3VB 3MLVH 2CK2A 1C12B 3OAUL 4F8TA 3I2CL 1MHCB 4KHXL 3WUWB 1NL0L 1WBZA 4L8DB 4UV7H 2Z0BA 4MA3A 2VLRA 4HV8A 4ENEC 1FL3B 1CDBA 1AXTH 2G9HB 1U8JA 1VFBB 1KB9K 5J3HC 3RUGA 4XPTH 3P4LA 3I3EA 4XVTL 4ERSL 2R29H 3CIQA 4MXVE 1NC4D 5EO1A 3CFBB 3PWPE 1W72B 2R4RL 4RZCA 1MHHB 2X4NA 5ICZA 1J18A 2WSKA 4PUBL 3K81A 4F9PC 5KS9B 4XPGL 2P8MB 4LOUD 2VR5A 2AEIT 5IMKB 3MLZL 4ONGL 4V1DD 1U8QB 1P53A 4GAGH 2DQDH 1ZSDB 3TNNB 5HHOD 3V6BR 5GS0L 5C3TA 1JWUA 2LTQB 1QHOA 1C5DB 5I75C 1G0XA 1YJDL 3K8KA 5EU7E 5IFHL 3NFPB 5DWUL 3WE6A 5TF1H 3TO4A 3M07A 5GGSB 2X4OA 3U7AA 2R1YB 4BKLB 1XGYH 1GIGL 1MCPL 3VFWA 1S9WB 3QUXC 3U48A 1EEQA 1YQ2A 2OP4H 2ZCHH 3R1GL 5D7JC 3PG2A 5AUMA 2I9LA 4XXCC 5DRWA 4HUWA 1LWRA 3BP6B 4PRDB 3GSXA 1CICC 3LRHA 3HE7B 1QFWL 3V5DA 3JWOL 4Y19A 1N0XH 4G80B 5ISZA 2CJUL 4P0DA 4ZFZA 1RZJL 2AV7A 5IVZA 1WITA 1P9MC 2EDKA 5FYKD 3TBVB 1X9QA 4WI9A 5J1SC 1AO7B 25C8L 2JIXD 3IAGC 4PGZA 12E8H 3KHOA 5D96C 3RWHA 3MBEB 4MA7H 1OGAA 5CJOH 2QJDA 2D3VA 5GRJL 1D5ZB 2BMKB 2H26B 2ITCB 2FEDD 2VWEE 2HG5B 2FLRT 1UADC 1KLUA 2IG2H 5F9OL 1ZA3B 2ENSA 4XPFL 2L0DA 4UOW1 3S9DB 1W8NA 3IKKA 4MAUL 4OGZA 2GITA 1OAUH 5IB3A 4KKCD 5FHAL 3F7YA 3G6DL 1JPFA 4KJPC 4XNYL 1GPOH 1AQKL 5CJXA 4XB7A 1DZBA 2ZSVA 3UTTE 4N5ED 2YK1H 4XNUL 1C08A 1CDGA 4K8RL 4ORZC 2G2RA 1A1MA 1JGDA 5ILTH 1NUNB 3LN4A 1B2WH 3P77A 4ZFOL 4F3FB 5TDOA 4Y5VC 1B3JA 4FQQA 1I85C 1IGJB 2GK0B 2BZDA 4YE4H 1R3KB 4QXGL 2E9BA 3CMOL 1AP2A 3N85H 4AH2A 1ZAGA 5JDJA 3HNTL 1Q0XL 1CLOH 5LCVL 5I73C 4C55A 1I7TA 1NUDA 2P24B 4AG4L 2OR7A 3FL7A 1BBDH 3HZKB 2MCG1 3CJJA 4P5MA 3L1OH 3OR6B 5FO7B 5D70L 3D0VB 2A83A 2BHZA 5D6DA 4NDMA 4QRTB 4CUCA 4M1DL 4OTXL 1U8NB 3FT4B 4UMGA 4KJQC 5HGGS 5IB5B 3BX7C 4PLJD 3QCVL 5CSZA 3MV8B 4N9GA 4EN3C 2X7LA 1YEKL 4IIQC 3QCTL 2R2HB 1CFSA 3BN9C 3M45A 1DBML 1MVUA 1L9MA 1CFNB 1FYTE 3RPIB 4QT5B 1HYSC 1A7RH 4PV9B 3VG0L 4S2SB 4Q97A 1J87A 3I9GL 2R1WB 4U0QB 1KJVB 5DTFB 3N1PC 4WEBL 2ID5A 1V3LA 5I18H 5IF0A 3HFMH 4HXBL 5F1SA 1CYGA 3HNSL 1QD0A 3BDBA 3PDGA 4A6YA 3PQYE 4O51A 3EYVB 1J05B 3VXOA 3CX5K 3WHXB 4YGAB 2NY1B 1I1YA 3EOAB 3EYOA 4HJ0D 3O6LH 5GJSL 1KPRB 3AY4A 1CFTA 5H2BA 1QKZL 1U8IA 4GSDH 5I6XC 5K9JL 3KPSA 1DVFC 3P4OA 3UO1L 2X1PA 2BERA 2NPLX 3QCUH 4K55A 5HYQB 1OAKH 4Y4FC 5JHLH 5M7QA 3WXWL 4U6VH 3WNKA 1H8NA 1UXWA 1CIUA 4LKXA 4OFPA 3KG5A 4ZUUA 4Z7UA 1G9MH 2BNUA 3NABL 1RJYA 5FYLE 1TCRB 5HD8D 1C5BL 1KCVL 4PJXB 3MROB 3SDCD 5LBSH 5ABDE 4YDJA 3G08B 4KK6D 4LPUA 4PRAB 3EYQC 3SKUD 1G7HB 1HDMA 1I4FB 1SYVA 3FT3B 5D1ZB 2YXFA 2WZPD 1Z6JT 1LE9A 3QDME 5FO9A 3QEGH 1EJ6A 5HYEA 3FB7B 4M48H 4N90D 5E6YA 1E4WH 1KIRA 3L95A 2Q87A 4HIEA 2FBJL 2W65A 3C6SB 5CKAA 3CCHA 2VDPL 1XGUA 4HPYL 4HS6A 2XTJD 1T1XA 2VXQH 1S78D 3BXNB 4OF8A 5CLTA 4P99A 5CD5C 2OTWA 1BREA 1WIUA 2HTLC 3QQ3B 2NY3C 4J3SA 4PG2A 2WINB 1ADQH 4ZXBB 2VLJD 4MAYA 5HI5C 2R8SL 3RNQB 4HUXA 4M6OL 4TNVF 4U1JA 1A4JA 5I16B 1JTTA 2ICWB 5JUEH 4J4PD 3T0ED 3RVXD 3VRIB 4IRJB 1RULH 4N0YL 4P46B 1CU4H 5I30H 3GSRA 4DW2H 3KYNB 2FDBP 3B8SA 4G6AC 5D6CB 3GSNL 2VDRL 1DUZA 4FQJH 3MFFB 3CAFA 1XH3A 4I48A 3UYRH 4JZJC 1RMFH 2R23A 2YPLE 1NGYB 5TQ0H 1T4KB 4U4BA 5CBEB 4HWEL 3MFGB 4N0UA 2K7QA 2FZ3B 3TNMA 3PP3K 2NY6D 5HDLA 3T65B 1I3UA 2E27L 4LCWD 4QRUA 1DN0A 5FM8A 2BSTA 2H45A 3BEVB 5BRZD 2XRAH 1V7NH 4P2OA 1VDGA 3V6OE 1ZLUK 2ZZUT 2O5ZH 1GGYA 1JWSA 5FUOL 3SOBH 4P59H 3QHZH 3ARGC 2PYEB 4ISVA 5EA0H 3DYPA 4LVNC 4BZ2H 1HXMB 4APQB 4DKFL 3DHMA 1IT9H 1V5JA 5DD5H 3HG1A 3NACH 1WZKA 3STLA 4UT6H 5FF6B 3ROOA 2BXZA 3SY0B 2Y5EA 1X5FA 4N8PA 4PJBE 3JVGC 4OBSA 2EDTA 4JZNA 4NN6B 1RIUH 32C2B 5IR1A 4GQ9L 3PHQA 3L6FB 3DARA 1VGKA 4PRPA 4FXGA 5IT2L 1PX4A 2VSCA 4KROB 1WFNA 3U0TA 3FO0L 4KKLC 1A14L 3WIIL 4NZRL 5DEFB 1LK3L 1VADA 4GBXA 2JJSC 1ORQB 1O7SA 5C6PB 1SJXA 4HC1L 1OB1A 1P4BL 2V9QA 1OP3H 3F62A 1NUFA 4YFDB 4X6FA 5F3HA 3MOAH 3PWUA 2X6MA 3WNNA 4HIHA 4JO2L 4FQCL 1D6VH 3CVIH 5F72S 4EBQH 5BQ7A 2H8PA 3IDIB 3CFKA 1KACB 5HYIA 5J1TC 4M7ZC 3GFUA 4OLZH 1QA9A 3G6JE 3GSUB 2C3XA 2VLMD 5DFWH 2QHLA 1T22B 2QBWA 4IMLA 5I19H 1H3VA 5JLZA 5DJ0A 1FVDA 1TZHB 3SDCB 2AJZB 5LXGL 1N59A 3RTQB 8CGTA 2COQA 4I2XE 4MHHI 2ZUWA 3X3FL 3O4OC 2QR0B 1ZT1A 1UZ6E 5KSBF 1FZMB 2VC2H 2Z35B 4LSQH 3ULUC 2PW1A 2IQAB 1ZTXL 3WDJA 1RY7B 3I3DA 3OAUH 4JAMA 3GIZL 1CD1B 4LPWA 2NX5D 2IADB 3QIBA 3BEWA 2IALB 3MJ8A 3I2CH 4KHXH 1RJZB 1NL0H 4V1DE 4LHUB 4XPHL 4WNQA 4QTHB 5DK0B 3IFOA 4DFHA 2YD6A 4NBZB 3QNZB 4X6BA 3QO0A 5CIPH 5FO8B 1KC5L 5AWNL 1R5VA 4MHHG 4XVTH 2AXJA 5EU6B 3UAJD 1NANI 1S7TB 1ZT7A 4Q9RL 1M7IB 3DXAD 4WFED 3BP5A 4Q9BA 5IOPA 4ZUWB 4PUBH 3UTOA 2CO7B 4XPGH 5C0NC 3BQUD 2P8PB 4C58B 3CFEB 3MLZH 4ONGH 2PW2A 4UNTA 2I25N 4N8VG 2GY7B 1L6XA 2NZ9C 3T1FB 4JQVC 4X99A 1P69B 1DFBL 5GS0H 4NO3B 4WVRA 4Y2DB 3SE8L 4MLSA 4Y5XB 3NBNA 1NEZG 4Z7VB 4JHAL 4OFYD 1YJDH 5IFHH 5DWUH 5FYKE 1SYSA 3AAZB 1CFQA 3GRWA 4PREA 1G6RB 2LAAA 3OXSB 5IJVB 2Z8WC 2APXA 4OFDA 3R1GH 1KJ2H 3IJYB 4LPYA 1T04B 3IDXL 2ARWA 2IBZX 5EC1B 2R9HD 1Q9WA 2NY2B 4M3JA 1QFWH 3JWOH 3KXFA 4HJJL 4XB8A 1SJHB 5KS9F 4G6JL 2FJGA 2CJUH 1RZJH 5CGTA 3QXDA 5L8LB 3B5TA 4R0LC 5DI8A 1UB5A 3HZYA 5EBMB 5HYJA 1UCTA 3G04A 1L7TL 5CJ5A 3U4BL 1UKTA 25C8H 1X5HA 3IDJB 1A7OL 3QDGA 4XNMA 5C8JA 1EO8L 3ARDD 4OD3L 5J9PB 2DM2A 3DGCR 1N6VA 1X4XA 1X4YA 3ARRA 5GRJH 3D5OF 2EDOA 1OPGH 4IOSD 5F9OH 1NCAL 5HHVL 4XPFH 4R90L 4AT6A 3F5WA 5JW4R 1T2XA 4G8IA 2FYYA 4WTXA 2P5ED 5F6HJ 3G6DH 5ID1A 4LLUB 4HFUL 4XNYH 2R0ZL 1AQKH 5IB4B 4NNYB 4QHKI 1ETZA 1JHLL 3LKRB 5F6IB 3MLSL 4XNUH 1BF8A 1S3KL 3PNWA 4L3CA 2Q6WB 1F4YL 1K3ZA 1XIWB 2QL1A 3CFDA 4UAOC 5DEGB 4RMQA 1HZHL 4POZD 1BGXL 3SJVE 5E1AA 1QLRB 4JRWA 4OCWL 1FP5A 1A1OA 3HTLX 2AXGB 4LCUB 4HKJA 5EZJA 1C8PA 1GAFH 1A0QL 1BD2B 1FAIL 1G7LB 4QXGH 3VG9B 3CMOH 2E6JA 4PRID 5E00B 3MRIB 3MSPA 5A16B 3HNTH 2YKLL 5I17A 1Q0XH 2V5MA 5LCVH 4FQXC 2FECL 5BJTB 4UNVA 5GGVL 2VAJA 4AG4H 2NW3A 4LLAA 2YWZA 3B2UD 1WAAE 2WAHA 5KTEL 4N0CD 3ARED 4QOKB 1TNNA 4KQ3L 1IJ9A 1AGBB 2Y6SC 2FJFA 3C60A 5INCA 1JPGA 2KZ1B 2R2EA 5D70H 1RUKL 2NX5B 4NO5A 4M1DH 3OXRA 4OTXH 4JFYB 3NCCB 2G75A 3BKCL 1DCLA 3QCVH 1TZGL 2H9GA 4DN4L 1YEKH 3QDJE 3MRLA 3QCTH 1HHHB 5FM5M 3V0VA 3CK0L 3VWKC 4FFWC 1DBMH 3K4AA 4HAGA 2A73B 3QJHA 3GKWL 4PD4J 3VG0H 4ZSOA 3I9GH 4EI5C 2FSEB 1J0HA 5DD0L 3KDMA 1EHAA 1W0VA 4WEBH 4TYUA 4HXBH 3S4SA 3U46A 3HNSH 4XT1C 4U7SA 5I2IB 3B9KB 1WV7T 3IS0X 3OKKA 1DQDL 1U8LA 2EIDA 4JDVB 2FB4L 4Z78B 4Z7WE 2EICA 1A02N 4YGVA 1J8KA 4R4BA 5GJSH 4TN9A 2GYSA 1HH9A 2W91A 5ACMA 5K9JH 2MPAL 2X4SA 2XICA 1FPTL 4OZGA 1BVZA 4JB9L 4MNGE 1AHWA 1D5IL 4G7YL 3UO1H 3VH8B 1NMCB 2IEPA 3O6FB 4LFHD 4N90E 5CS7A 4OCSL 3WXWH 4PJ8A 2YN3A 3EOYG 1LE5A 3NABH 5GS1B 1RK0A 4KI5E 1GOFA 4LLMA 1GH7A 4X6DA 5FKAA 1C5BH 1KCVH 1Q38A 4C56B 2XWTA 4DGIL 3MR9B 2YRZA 4YNYB 4DK6A 3GB7B 2VLJE 1UKQA 4GW4B 3MYJA 3L3KB 3RNKB 4G6KL 3ZL4L 1M71B 4M9OA 5HHXL 4JFPB 3T0DA 1ONQB 3RL1A 3CPLB 2JF1A 4JVPA 1XGTA 3IETB 1UZ8A 4OLXL 1NMAL 4JG1L 1NGZA 3T0EE 4XVUD 3RWDB 4UQ2B 1R3LB 4G42A 5B4MC 4E5XA 2FBJH 4Z0XB 2VDPH 3FFDB 5EFIB 4HPYH 4JPIA 3WNOA 5FYJE 3O9WA 3D39D 1I1AA 4WV1B 2X9XA 1XF1A 4P4KB 1LEGB 3LKQA 4KK8C 4PTTA 4P2QB 5MEQB 5M94B 4X6EB 2PXYA 3FOMB 3TYFA 4M6ML 3MLUL 1IEHA 1JMZA 5GS2D 3CDFA 3ZE2E 4CDGC 1DQTA 1RZ8A 4LCWE 3BI9X 2F54B 2R8SH 4HKXB 4M6OH 1W8OA 1OW0A 1CS6A 5HVFB 5EWIL 5KVGL 1OQOA 2HLFC 3QH3A 4N0YH 3C8HA 4PJHE 1E4XI 1JGEA 2Y5TA 2UVFA 4JFFD 3QG6A 3QIUD 4YBLB 3GSNH 2VDRH 2EXWD 1P2CB 2NY7L 4Y89A 4D0CA 5I1KL 2EKSB 4PLKD 3Q6FA 4GAYA 4P57A 4ZG1A 2W9DL 4O00A 2NY4B 2NW2B 4HWEH 2XN9B 5BS0B 2YZ1A 4X5WB 3C5ZA 3HN3A 2E27H 3F7PC 2DLTA 2JJTA 3UROR 3D85B 43CAA 4FTVD 3O2VL 1CK0L 3QIWA 5M95B 4JFQA 4X83A 4FQHB 5FUOH 4OLEA 1KCUL 4N0FB 1QTYT 2P7TB 3TVMC 1PLGL 2JJUA 4NYLB 4R7NA 2CIIA 3MOQA 2F74B 4HH9B 2NTFA 5D7SL 4DKFH 2AK4B 5TGBA 4IJ3C 1OTSC 3VGBA 2VITA 3QI9B 3WNMA 5KSVB 2OLDA 2AJSL 1DEEA 3CZJA 1DE4A 3L3IB 3O8XB 4HF5L 1L7IL 1QRKA 2YEZA 4LIQL 5D4QA 3DX9A 4U1HA 1D9KD 5IFAL 4DFIA 4HK3N 2P5WB 5I1AA 2E7MA 4I5BA 4CJ0A 2I9TA 5FM5O 2FJHA 3Q2CA 4GQ9H 2F53D 1XF3B 5D2NA 4I18C 1UH3A 1BFSA 1NBYB 4YXHL 5IT2H 3OKDB 3BIAX 3FO0H 1A14H 5DJ2A 1UVQA 3IAPA 5INDB 5IV2A 3FMGL 5DHYA 1LK3H 4Y4HA 3T8XA 2VLME 2IJ0C 1HQ4A 3HUJA 3MRBB 1IM9D 3LH2L 4ZODA 4HC1H 3ILQD 1P4BH 1AGDA 3SDDC 4R2GC 3L3DA 5IVXA 1S9VB 3D25B 1EV2E 2Y25A 4PR5B 1DQLL 4XBPB 3DX8A 4JO2H 1OAQL 1P6AB 3V9FA 2WUCL 3HR5B 4FQCH 4NQED 1ZLVK 4ELKB 2BNRD 2OXHA 5GRXG 2MFNA 4WW2B 2CXGA 2L7JA 1T7WA 2JTDA 5F3BA 1FNAA 5TH2A 1Y0LB 3VXME 1IVLA 3B5HA 3D18B 4S1DD 3QXAB 5DJXB 2YMXL 5LXGH 3BPCB 1M4KA 4NQCE 3I02B 1T20A 3X3FH 3U7WL 4HLZG 4JFEE 2IPKB 2APVA 4R6UA 4U1GB 1YEJL 5A2FA 3AMKA 3UTZB 5DQ9B 5ESQB 1KGCD 1S9YB 4PJ7A 3BP4A 5DDHA 1ZTXH 2AGJL 1RUPL 1JF5A 1CN4A 1U3HA 2KQMA 1GC1C 3HI1A 4JM2A 4Z77B 5DUBB 2BCKA 4XPHH 3DO3A 3HPJA 4FG6C 4DVBA 1X5YA 4QRRE 2GJJA 5DMKA 3CSYB 4MX7B 1GOHA 1KC5H 5AWNH 5KSAD 5JXEA 2IWGA 1AGEB 1YNTB 2NY0B 5HPMA 3EIFA 1Q9LB 4HCRH 1QSFA 1RZGA 1A6PA 4Q9RH 4ZO6A 4NKQB 1N2RB 1X7QB 3TA3C 5LWYL 2VH5L 4Y4KC 1NCCL 2ICWJ 1N6QH 4KDTA 3BRDA 3PP4L 1OARL 1YN7B 5F7NC 3MJ7A 3GMLB 3BZDA 1CGUA 3LVEA 1OOAA 4QYOB 1XCTB 3B9EA 5K9KB 3WJJA 3PE9A 4MJIB 5GGTA 3CH1A 4MA1C 4PJ5D 2V7HA 4PJGF 4BQ9A 2Z31C 5MEPB 1DFBH 2FGZA 2J7LA 2N7BA 1VPOH 2H2PD 4MS8C 3SE8H 3VXSB 3KLSA 3NH7L 3TZVB 1Y18B 4JHAH 5JNYA 2OSLA 2MWCA 4JR9L 5IK3A 3NIGF 3WIHA 3GSOA 4KKBC 4FTVB 1IEAB 3BKJL 2HH0L 5E8EB 1A7BA 2R1XA 4TNWK 5IMOA 4LGSB 1NLBL 3DV4B 3PHOA 4MCYA 2IH3A 5DD6B 2PKDA 3IDXH 3QQ4B 3TH4T 1NCTA 2IAMB 4IRSB 3VFNB 5E24E 3WHE0 5BMFL 4D8PB 1M6OA 1HYRC 2EC8A 1AGCB 4HJJH 4FS0A 3MPCA 1J88A 1FNGB 4G6JH 3VD5A 2XKNA 2YOCA 1FNLA 4YWGL 1DQQA 2C26A 3G5ZA 3LRSB 4NO0D 2P5EE 3BPOC 4TTDC 3UPRA 3QXTA 1L7TH 3QUYB 4XCEB 1BBJB 1A7OH 1TJHH 5CEZE 5HGHA 1A6WL 2FNBA 3KPPA 4PY8J 4LSSL 4QRPD 3VFOA 1FV1B 3CZFA 1EO8H 4NC0B 4WHDA 5DFVC 4Z7VF 1OD7A 4L3ED 5I8OL 2J6EA 3EBAA 3RWGA 4Z6AT 3HAEG 4ZQKB 1QPXA 5I76B 4WJ5B 1NCAH 5HHVH 4XP1H 4CKVX 3OQ3B 4R90H 5EUOE 2O93L 3EYSL 1MVFA 4PRIE 4HPOL 5C0GB 1ZHBA 1F6AA 1IM9B 4J1UA 4X8XA 2HT2C 4GRMB 3B6SA 1GJIA 3DVNB 4HFUH 2R0ZH 4GRLD 3A6CL 5KSUA 1JHLH 5FDWB 3MLSH 4F7PB 2VQ1A 1S3KH 3H9HA 3Q5YA 4ZAKD 1F4YH 3D2UD 4D9QE 3S97C 1JRHI 2GJZA 3HAEA 4L4TD 1HZHH 4HG4J 1BGXH 4JREB 3VJ6B 1E6OL 4AZ8A 1C16A 1IAOA 4OCWH 2XPGB 5C0CA 5SX4H 4I9WD 3GJFB 4RX4D 1EIBA 3VFTB 4GKSB 1A0QH 3KLDA 1FAIH 2X4QA 2JCCE 5IBLD 4GW1B 1MCRA 3FONB 2NXZB 1FFNB 2YKLH 1O7VA 4L8SB 1A5FL 1U8MA 4KDWA 5T5NG 5GGVH 1BVKB 3LN5A 3MV9B 1MELA 1I7RA 4JHBA 3IFNL 4QHNA 3LQAC 4Q6YA 2EYTA 1IE5A 2Q7YA 3OAZH 3V0WH 5KTEH 4XRCB 4MQXC 4KQ3H 2V2XA 1SMAA 3IU3B 3HPLB 4XI5C 3JV6B 4RAHA 2YUVA 1DUYA 1RUKH 2IF7A 4CL7A 1QEWA 2DWEB 2WW8A 3GI9L 2BRRL 3RGVB 2C3GA 3BKCH 3BH9A 1TZGH 5DJ6A 1N5YH 1IKNC 4DN4H 5SWSE 3QB7C 3W9DA 4JFEA 2Y7QA 1BLNA 5FV1L 3RWCA 3TCLB 4M3KB 3CK0H 2MHAB 3PL6B 5IFJA 2XG4A 3GKWH 5TDPB 3DROA 1G7QA 2H6PA 2XG5A 4G8GB 4XTRC 3P73B 1A9EB 3DRTB 5DD0H 4MD0B 3H6JA 3GJFH 3LPGA 4ODSL 4P23B 1DQDH 4BSWA 4LRNL 5SWZA 3SCMA 4NQDA 5D9SB 2FB4H 1NC2A 3RZCB 5DYOB 5J56B 4LLDA 2GJ6B 1FFQA 2MPAH 3ILPA 3UPCA 1FPTH 4JB9H 1D5IH 4G7YH 5CZKA 2EE2A 4E41A 2ZSWA 2HAZA 3FT2B 1IM3A 3ULVD 1MI5D 4D0BB 4FHBD 1GGTA 1HN1A 4QCIB 3QUMA 2IFFL 1S9XA 3MRPA 4OGAC 5SWQA 4WWKA 4JJHA 1JK8A 5TE7L 2YSSB 4LMQI 4ZPTB 1PY9A 4DGIH 1JF1B 1Y6MR 1FZKA 3B2VL 4YC2C 5I74C 4G43A 2D31A 1HHKA 3V5HB 2ICEB 3FQNA 3V52L 1MHEB 5B39B 3TN0A 1YY8B 4G6KH 3ZL4H 1IAIM 1I7UA 3REVA 5HHXH 1EFXA 2XKUA 5F7KC 2BSRA 4JFXA 1RUAL 4WUUD 4XVSL 4OLXH 1NMAH 2AKRA 1G7IA 2GKIA 2KPNA 3S35L 2UUDK 3W11C 3ARVA 4JFFE 3QEHA 1T7XA 1JUFA 4QRPB 3P2TA 1II4E 2PYFA 1BOYA 1BVLB 1BZ9A 5EU7C 3SDAC 4M6MH 3MLUH 5ITFB 4OZ4A 1IL1B 3OJMB 1FN4A 3S5LB 4LEOB 5DUML 4RFOL 3ZLQC 3VXNB 5H94B 3U0PA 4XNQB 5EWIH 2Q8BL 5JORA 5KVGH 3EFFB 4R97B 4WI5A 3RWEA 4ELMB 2HVKB 3I84A 3JTTB 2AJ3B 4EUPB 1PD6A 3QWRD 3MCG1 4PP1C 4JRYA 5C1MB 3ZDZE 1CDHA 4M61B 1MCOL 4DAGL 1YMMD 2NY7H 2FIRT 1WBZB 5I1KH 2BC4B 3KVQA 4UDUB 4L4TB 2VLRB 4CW1A 1U95B 2W9DH 1IGTB 5JDSA 4F58L 4JY4A 3RX8A 4UTBL 4MD5A 4KTEH 3PIQA 1LO2L 4NZUL 1T1WB 1K5NA 2A6DA 3VWJC 4X6CE 1XEDA 3O2VH 1CK0H 1BWWA 4P5TC 2VWEC 3SGEI 3T4YA 3PV6B 3QFDB 4HIIB 4EQ2A 5BXFB 3VE0B 4G9FD 1RIHL 2XWJB 4ALAL 5D7JD 3ZKSD 5D7SH 4ZNEA 1CICD 1EBAA 5C0AB 3C6LA 1SJVA 2AJSH 4NSKA 4NCC1 5B3JE 2ARJA 2WWMD 3RWJB 5ICYB 4E0RA 4NT6B 4HF5H 1L7IH 2ZCKL 5EIIB 3CXDL 4LIQH 3P4MA 4EUPH 4OV5B 3OAYK 5IFAH 2LVCA 4M5YH 4TQEL 1HI6A 4PGJA 5HYSA 5L2JB 2AV1A 1CDYA 4LNRA 2IH1A 3VFWB 3TBTA 7FABL 2R0KL 4LFHG 2A9ML 1OWRM 1T89A 1NDMA 4YXHH 1IGIL 3U6RA 1JNLL 5HVWA 4UINH 2I9LB 2ICES 2WBJB 3FMGH 1MQKL 2FIKA 2CLZB 2B1HL 3LZFL 3V5DB 4N0RA 4C83B 15C8L 3W39A 4JLRB 3LH2H 4ZFZB 2AV7B 2YD2A 3MXWL 4L9LC 1DQLH 3MRGA 4KJPD 1YNLL 1CXLA 5C09D 3D3VE 4ONFH 4XP4L 1OAQH 3MGTB 2WUCH 1G7PB 4I0PB 2EDYA 4L4VD 5FGBC 3PWVA 5KZCB 8FABA 2KKQA 1VESA 1OGAB 3GJEA 1ZEAL 3KAAA 1JBJA 4WO4C 3DX7A 2EYRA 2VZOA 4WFGD 1KLUB 3GI8L 4PRNB 4NUGL 3ELAT 4LPVA 3ROLA 3VI4F 4LVEA 4QHMA 4C4KO 3D48R 3S7GA 1ZWIB 5IB3B 3KLHC 4F7TA 2YMXH 2DYPD 3R0MA 1XR9B 2JB5L 2CLVA 4RFEA 4XAKD 1JPFB 4P2RB 3U7WH 3GM0A 3M17A 1YEJH 4JPWL 2V2TA 5E0QA 1WICA 5EN2B 2G2RB 3MREB 2AGJH 5ACLA 2ZUQC 1RUPH 3FO1A 3ZTJH 3MGOA 3LN4B 2FWOA 2VDML 5TDOB 5GZOD 4U6HA 1IC7H 3UTSA 2RCSL 4KJQD 3RY6A 5LQBL 4AH2B 1S9KC 3ARFC 2XV6B 3E6HA 1QLFA 4GW5A 1NGXA 1LO5A 4WW2F 5H35B 2W0LA 4U31A 4XAWL 1NPUA 1MREL 1INEH 1QVOA 3BN9D 3T08A 3ZT7A 1H5BA 3CU7A 3SKNB 3W82A 5JPNB 2DQJL 2OK0L 4G6ML 1HYSD 3GMQB 5LWYH 3QYCA 5A2LH 2VH5H 4LLWB 2X4TA 3GM8A 2EE6A 1NCCH 1NH6A 3BVNB 5DURB 1T21B 5D1XD 5D5MF 5TDNB 5CBAB 3PP4H 1OARH 3PJSA 4P3CL 2V9RA 3MUHL 5HHNA 3U4EB 5CEYB 1KTLA 1AIFA 4NDMB 3JSSA 2B8OT 3RL2A 1NKOA 4EI6A 4YO0A 3L7FB 5CSZB 4N9GB 2OR8A 2X7LB 5C2BL 1ZT4A 3HE6C 1CFSB 1DVFD 4CNIA 1L0YA 1U2HA 5L0QB 5EH1A 5I75B 5CILL 4Y4FD 1CFVL 5ANMB 1HKLL 3BKJH 2HH0H 2E8YA 1NLBH 1R5WA 2CR3A 3DI3B 4L3EE 5IGXL 3QUKA 3QUXB 3VGGA 4JFOA 4O51B 5AG8A 2EECA 3IKCA 5D7JB 1BZ7A 3OJDB 5BMFH 4ZYKA 2Y4SA 3EYOB 3EYQD 5CUSL 4JFDA 1QFPA 5CFHA 3CFJA 5F7UA 4J23A 4NM8L 5MEND 4YWGH 1PW3A 3P4OB 3X11A 3RIFF 4DJMA 2MNUA 1CXHA 3L5XL 3NIDF 4QWWC 4LKXB 4PGEB 4ZUUB 4LSSH 2RB8A 5KSBA 5I8OH 3QWQB 1FFOA 5CD5D 2ZCLL 2HTLD 4WRLA 1QRND 2NY3D 5E2UL 4Y1AA 1F3RB 1HHJB 4Z7NF 4I9WE 1XR8A 1SYVB 4X7CC 5L2KD 1OY3B 5E95B 3SGKA 5D7IF 1VERA 3V6OC 4Z7QF 3EYSH 3QAZC 4HPOH 3EDJA 5FO9B 2W1NA 1BZQK 1T5XA 4KV5E 3QUZA 1PVHA 2ADGB 5IBUB 4Z76B 2JJVA 3A6CH 4HIEB 2W65B 3A0OA 1LVEA 2VXVL 4X7TB 4G6AD 1T1XB 2LU4A 3JV5A 4OLYL 3EOTL 3HZVA 5C6TL 3U9PL 4OBRA 5F8RC 3W0WD 3GMNA 1E6OH 4MJ2A 4CMMA 1RHHB 4CMHC 3OMZA 4RAUA 4W81A 4PY7A 4MAYB 4ZD3L 5T1KA 4K7PY 1DBAL 4WDIA 5DGRA 5T1LA 1A4JB 1A5FH 4BSJA 3SO3B 3D3VA 4UT7L 5CEXB 2EDRA 1X6LA 2QADC 1VGEL 1WQVT 2VR9A 4NQSA 4J12A 1U8KB 1MHCA 5E5MB 3WUWA 3GSRB 4L8DA 3T0WA 2CR6A 4PJFE 2E7BA 3ARGD 1DUZB 1FL3A 4I48B 2HWZL 2A6JB 2G9HA 4B7LA 5D1QC 1YEFL 3MLXL 3FO2B 1HOCB 2CK0L 3GI9H 4GG8B 2CDGB 3TNMB 2RBLA 4QRUB 1DN0B 1MHHA 4O2EB 2DKUA 4NQVA 2O61A 4EN3B 5KS9A 2R2CA 2P8MA 5IMKA 3ULVE 1U8QA 1BFVL 1B0WA 1ZSDA 3TNNA 1Q1JL 4KKAC 4PJXE 3UYOD 1I9JL 3DX6B 1A3RL 4ODSH 4LRNH 3GKZA 2DM4A 3STLB 2VN7A 3LAFA 4OB5L 3C9NB 1AY1L 2PO6C 3ROOB 2R1YA 2X89D 4BKLA 3PGFL 4L29A 3AVEA 3STBA 3GMRA 1MPAL 1S9WA 3VFUB 4WUUE 3SE3A 4JZNB 3L9RA 2UWEB 5IR1B 1INDL 1FO0L 4FA8A 1G1YA 4O4YL 4Y16B 4PRPB 4YQXL 3BP6A 1A6ZA 5GGRB 1H3PL 3OKLA 2WP3O 4DGYL 4G80A 1EVTC 3WN5C 1RUQL 1NJ9B 3LN9A 5DJCA 4J8RB 4QTIL 3TC9A 1VADB 3O3EA 2DIJA 2Z93B 3B2VH 1CLCA 2P4AB 4S0SD 3EZ8A 1OB1B 3V52H 4N68A 3DHJA 1AO7A 4PJ9D 5E03A 2EH8L 4WI7A 4X6FB 3BWUC 5F3HB 3S88L 1RUAH 4OZIE 4XVSH 1AH1A 1GXEA 1HQRA 3MBEA 3O2WH 4EXKA 3B83A 1D5ZA 2BMKA 3CXHJ 3ULUD 3S35H 1J0YA 2Q86B 5FV2A 4TULL 1IZJA 1J7VR 1ZA3A 4PG9B 4P2CG 5C07D 2NR6C 1FSKB 1YMME 1QA9B 3NOIA 4G6FD 2X4PB 5JLZB 1FVDB 4UNUA 1RJCA 1QRNB 3QEQA 5DUMH 5F97E 3T77A 4RFOH 1QUNA 1MHPL 1F6FB 2VQTA 1ZT1B 2Q8BH 3RDTA 5IUSA 4KRMB 3DTXB 3H9SA 3WNLA 2PYEE 2FEDC 2X9WA 3I3BA 4BQBA 3H0TA 4JAMB 4K71C 4GAJL 1IGJA 4G9FE 1TPXC 5C0ND 1R3KA 1MCOH 4PBXA 3CGTA 4F7CA 3MGAA 2DQFB 4HHAB 4KKCC 4RRPG 2PETA 3IFOB 1F97A 2XQYG 4F58H 4JZJB 1CQYA 1H8SA 3OGCB 5C0IA 4UTBH 1WZ1L 2P24A 5FECB 5J6HB 1TTFA 1UT9A 1UH2A 2MQ3A 4P9ML 1LO2H 1ZMYA 4NZUH 3U0WL 1S7UB 2EIEA 5GGQL 1TXKA 1UACL 3H2WA 2DMCA 3IT8D 3EW3B 3OR6A 2ZUXA 1PFCA 2D7NA 3D0VA 2BDNH 5E6ID 3VFPA 2QTEA 5CLWA 1A6AA 5BV7C 1RIHH 1MCQA 3FT4A 4ALAH 4RRPA 5IB5A 3MV8A 2MMXA 4LVNB 4RGND 4X99B 1U8OB 2R2HA 1OHQA 2JJTC 4GAFB 1XF5A 4NRXA 3RPIA 2ZCKH 4QT5A 1XGRA 3CXDH 4PV9A 4YHIA 1F2XK 4F9LC 1NC4A 1LO4L 2R1WA 1KJVA 1JGVL 5DTFA 3AMLA 4TQEH 1CFQB 4FQPA 4PREB 3PABA 5C09E 3S3SA 1MOEA 7FABH 2F58L 2R0KH 3EYVA 2A9MH 3MV7B 3AS0A 3KPRD 3WHXA 3NTCH 4JQXC 4GUPB 5F7MC 4OF7A 1IGIH 1BM3L 3L5WB 1JNLH 4RISL 1DN2A 4GXUM 5BW7A 4KZEH 4LRIA 1KPRA 5HHOA 1MQKH 4PYHA 1Q9WB 2B1HH 3OKMA 1PKQB 1U42A 3LZFH 1ADQA 15C8H 1ZV5A 2IPTL 1ND0B 2FJGB 43C9B 5HYQA 3V6ZA 2APFA 3QXDB 3MXWH 5DI8B 1UB5B 3HZYB 5HYJB 4AL8L 2ICWI 2AJXL 1I3VA 3H42L 1YNLH 1Q8MA 3MJ6A 3QDGB 3P30H 4ACPA 5DRNB 2XOTA 3RVTC 1A7PH 5C8JB 1HILA 4XWGL 3MROA 1KN4L 5T1MB 1JMXA 1ZEAH 1R5IA 3G08A 5IWLA 4HJ0C 1YC7A 4YIQB 4DKDC 4GG6B 2NY5C 3DJ9A 4Y0GA 3FT3A 5D1ZA 3GI8H 2IQ9L 4NUGH 5D7LE 2VXUL 3EDKA 4GKNB 1ES0B 3HKFA 5I8EB 3FB7A 2FX9L 4X7FC 3IGAB 2FYYB 2JB5H 5ID1B 3C6SA 4FQXD 4UBDD 4X4YA 5HHMB 1MLBA 4JPWH 1J0IA 3UMTA 3LKPB 1ACZA 3BXNA 3O4OB 5HD8C 4JE4B 4L3CB 5EDXA 5B8CA 2WINA 3CFDB 4HZAA 1RPQA 4F7EB 4OSUL 3BUTA 4PJIF 2WLYA 3MC0A 2VDMH 5FA3B 2B5IC 3VI3E 4JO4L 5C07B 3FZUD 3RNQA 5IKCB 1HWHB 2EXYD 2ICWA 4RCAA 5ALCL 5LQBH 4NN7B 1P7QB 4Q6IC 1BECA 3KLAA 4YHKL 3VRIA 4IRJA 3CDGB 4XAWH 3P0VL 1LO3L 1MREH 1X5LA 4PY8I 4KI5C 5D6CA 2CD0A 2EO1A 4OQ1A 2NW3B 2OK0H 2DQJH 4G6MH 3MFFA 5E7FA 5T1DH 2HLAA 4UT9L 3ZKXB 4EI5D 3BMWA 5IJKC 4PD4K 1NGYA 5INCB 1T4KA 1FQ9C 4P3CH 2ZNXA 4U1SB 5CBEA 3KPOA 2R2EB 1N3NA 4BQ8A 3T65A 2HT3C 3EDEA 3OXRB 5DR5L 3BEVA 2XXMB 1HHGB 3A67L 4YDVB 3KYOB 2W0FB 4J4PC 3L3GB 3T0EC 2H9GB 2DB8A 3AS2A 5FHBL 4RBPK 5C2BH 1MCCA 4WEUD 2YA2A 3MV01 1JNHA 3V0VB 4HIJA 1PQZB 2VZVA 5CILH 2PYEA 2RR3A 4IS6A 3QJHB 2DDQL 1UWXK 3CVHL 1CFVH 2AW2A 1YPZB 4APQA 3KDMB 1SJEB 5T3XL 1W0VB 4IOIB 4X4XB 3S4SB 4I4WB 4RSVA 1GC1L 2XTLA 1NBVL 5IGXH 3NPSC 2NY6C 4ZUVA 3HC3L 4LVOC 5FF6A 2EDBA 3CFIC 2YD8A 3IJHB 3SY0A 5CUSH 5C08D 2OZ4L 1NCWL 3IDMB 2D7PA 2ADFL 1HH9B 4NM8H 4OI9A 1QSED 32C2A 1AC0A 3B8YA 3K3QA 3L6FA 1AHWB 2Y07L 4R0LB 2A74B 3L5XH 3EAKA 3KPLB 4PJ8B 5B4MD 3DGGA 3FAWA 5T3ZD 1NCBL 1GZPB 1O0VA 1DJSA 5J7CC 5FKAB 1LILA 2BK8A 3W0WE 2ZCLH 5E2UH 4UDTB 1Z0NA 3MYJB 4MNQD 5I71C 2EDQA 1KCLA 5CIPA 4LK4A 3QPXL 1QFWI 1UZ8B 4NQUA 3MRHB 4QOKE 3FB6A 4MQ7B 3BRFA 2R15A 4JRXB 4E5XB 3ZKND 4DVRL 2VXVH 4UZGA 3GSUA 3ARTA 4JPIB 2R56L 3UCRA 3GDBA 3O9WB 4OLYH 4KWUA 3EOTH 5C6TH 2G5BB 3U9PH 1TZHA 4LHUG 3LKQB 3SDCA 1M7DB 2AJZA 2VIRA 4UAOB 4H88L 3C8KA 1FHGA 4ZOEA 3S35X 3DMMD 3RTQA 3TYFB 1K8IA 3QG7L 1HXYB 1ZA6A 4ZD3H 1DBAH 2Z4QB 2GHWB 2QR0A 1RZ8B 1I8MB 4CRPA 1FZMA 1KLGB 2Z35A 3VXUB 4PJGA 5J13B 1EO5A 1KBGL 4NCC2 1JF6A 4UT7H 3MLYL 3RY4A 1CD1A 4QNPF 5L88L 4Z7OE 4JY5L 3WLBB 1VGEH 2IALA 3MO1B 1JGEB 3RZWA 3NZ8A 1RJZA 4PRHD 2V5SA 4PJCE 3QG6B 2VUYA 4JO1L 1QO3A 4QTHA 5DK0A 1MUJB 3TVMD 1KJ2A 2HWZH 4D0CB 5JMOC 4F15B 4Y5YC 5EO9A 1YEFH 4GAYB 3MLXH 4LQFL 1OTSD 2VXSL 4RGMB 3WS3B 2CK0H 5EU6A 3TO2A 3L7EB 2HFFA 1MAML 1S7TA 3C5ZB 1M7IA 2V17L 3WSQL 4S10A 4NCDA 43CAB 1J1OL 1R6VA 2HJKB 4P2YA 3QIWB 1OLLA 5FXCH 2XQYK 3L5JA 1DTUA 3TJEL 2ADJA 2Q7NA 3HRPA 3VWKB 3TIEA 4JCLA 4HMCA 1BFVH 1PSKL 5JIPA 3VGAC 1TENA 1Q1JH 2N56A 3BSZL 2CIIB 1HSBB 4I1NB 5JOFB 1DANU 1I9JH 2V2WB 4Y2DA 1A3RH 2BNQB 4Y5XA 4Z7VA 4OB5H 1EAPA 1AY1H 1DE4B 3UAJC 4LCYB 1HINH 1QFOA 3KYMB 5B38B 5JW4N 1OAYL 5DJ8A 4ESKA 2ZNWA 3O4LB 3BN3B 2M2DA 1JTOA 3PGFH 1MPAH 5C0BB 5I1AB 1MCHA 3HMWL 1BEYL 1INDH 1FO0H 1ZLWK 3IJYA 2HA1A 1T04A 4O4YH 4YQXH 1R3IL 4IOFC 1I8LC 1H3PH 4DGYH 4P2QE 1LP9B 1T7YA 5DJ2B 5IV2B 5K9OB 1MCLA 4ZFOA 2ZUVA 1I7ZB 1RUQH 3G5VB 4QTIH 3T8XB 3WL9A 1MCDA 2QQNH 2CKBL 1OLZA 3EYFA 2F54E 1KN2L 3IDYC 4V2CB 4YR6B 2DJSA 2EH8H 2EO9A 2O5XL 4E42A 1U9KA 3IDJA 1MWAA 1MSPA 3GNML 3S88H 1MCSA 3DX8B 3EJZD 5J9PA 2E9JA 3U2SB 1K6QL 4HFWB 3C87A 1J8HD 3FQRA 3O41A 2OXGA 5CP7B 5GGSY 5DHVB 2R9HC 4TULH 3O3AA 1BQSA 3V8CA 5C70A 2YUZA 3VCLA 3N1GC 3VD4A 4CN1A 3U36B 2R2BA 1JZ3A 2UWEF 3E3QE 5TH2B 2XN9E 4FG6D 3B43A 3ARZA 1DL7L 4LLUA 1JN6B 1FL5B 4MSWB 5IB4A 2X1WL 1QACA 1MHPH 1T7ZA 3CC5B 3S36L 2DQUL 4PGCB 3FQUA 3K7UA 1XIWA 3LDBC 5DEGA 1A6VL 2KL6A 3TA3D 1BQUA 4Y4KD 5DDHB 3RWIB 2EIZB 1QLRA 2C1PB 3AC0A 4GAJH 2AXGA 2AK4E 4LCUA 4NOBA 3BGFB 2CUIA 3HI1B 4JM2B 1BD2A 4JKKA 1FVEB 1G7LA 4HUUB 4PGBB 5F21B 1Q72L 5E00A 3HPJB 5A16A 3B9VA 5IROA 3IFPB 4RGNE 5BJTA 3FFCB 2F8VA 1WZ1H 3DRQB 4MS8D 2P5WE 3VU2A 4P9MH 1ACYH 3U0WH 1QSFB 2X10A 5DHVH 5GGQH 5F7EL 1UACH 1PYWB 3VI4E 4POZC 4XVJL 3N1FC 1AGBA 4KKBD 1M05B 3MNZB 3SPVB 2ERJB 2NX5A 3WJLC 5JOPE 4M1CD 3H3BC 1F4WL 3VGHA 2J8HA 4JFYA 3TJHC 2CXKA 2IBZY 3WO4B 3CH1B 3TVMB 2V7HB 1RD6A 4LLYA 1B6UA 2E7LA 4CVZB 1HHHA 1QBLL 1U0QA 4NZDA 3SDXE 3RHWF 3TO4D 2A73A 5FUZL 5IK3B 3VH8G 5K59E 1LO4H 2FSEA 3AREC 5L6YL 3V2AR 1JGVH 3BESR 3DXAA 3BKYL 3C09B 1DQJB 3FB8B 3NA4A 5C9KA 1LO0L 3V6FB 3Q6GL 5I2IA 3B9KA 4H0GA 2F58H 5IMOB 3PHOB 4Z78A 1BM3H 3FB5A 5GGUB 4RISH 1CE6B 4I18B 4Y19D 5EU5B 2W59A 5ISZD 1R3HA 4JG0L 1UXSA 3O3DA 2A1WL 5DMYA 4ZO8A 1U93A 1TNMA 5L8KB 2IPTH 5EOQH 5I9QC 4M8QA 4MZ3A 3VH8A 1SEBA 2EZ0D 5KVDL 4OFYA 1DQQB 3L3JB 1OAXL 3G5ZB 1JZ6A 5GS3A 3SDDB 4AL8H 5DQJB 1X5KA 2AJXH 3H42H 4R2GB 2VOTA 1PJ9A 4C54A 2B7DT 4YEFA 2NYYD 4JANB 3WCYA 4KY1L 4S11A 4CVXA 3KPPB 1BFOA 3VFOB 3VXRD 4C56A 4XWGH 1KN4H 3GSNA 2X2YA 3I85A 3MR9A 4YNYA 3QRFM 1BOGB 3GB7A 2ED9A 4GW4A 4IMKA 4ODHL 5GPRA 2VLKB 2ADIA 1G1CA 2IQ9H 2ATKB 1M71A 1YZZA 4JFPA 1ONQA 3CPLA 2VLLB 4JHWL 2APTA 5DVKA 4FOMA 3U4AA 3IETA 4L5FL 3U1SL 1YN6A 5D2LB 3SGJA 2FX9H 1OP5K 1F6AB 1R3LA 1KEGL 5JTWA 3B6SB 3CNKA 3BWAA 3FFDA 4Z0XA 4GRWB 5EFIA 3E2HC 4TUKL 3ARDA 3IDUA 4WV1A 3ORJA 1LEGA 5MEQA 2OTPA 4X6EA 5FB8B 3FOMA 4OSUH 3CVHB 4XI5D 4HUVB 2OM5A 1C16B 4KJWC 1QYGL 5C0CB 3NIDE 4EJ1C 5KANI 4JO4H 3O0RL 3GGWB 1PZ5A 3GIVB 2W38A 5EOCL 4HKXA 4B41A 3VXSE 1KEML 2DN7A 4ZFFB 5EB9A 4F80A 2X4QB 1NCDL 5DC0A 5ALCH 4JO3L 4XVUC 1Y6KR 1A2YA 1H9VA 4YHKH 4NM4L 4GG6F 1SBSL 2G60L 1LO3H 3K46A 4NN5C 3LN5B 3SGDH 5J4MA 2P48B 4OZHF 3UEZA 4LSDA 1P2CA 4QHNB 1L9NA 3REWB 2EKSA 2FHFA 4X0KB 5BS0A 4X5WA 5KANG 1QEWB 1S7XA 1H15A 5DR5H 1BQHG 1T83A 4NC1E 5C08E 3BH9B 3A67H 4GRWH 5DJ6B 4HC1A 3EO0B 4QEGA 4K9EC 4WY7L 4OI7A 2Z31B 3MCKA 1QSEE 4JM4L 3KPQA 1BLNB 2DLGA 4FQHA 5FAAA 4N0FA 1QR4A 4DOHB 2EXWC 4FQIL 5IFJB 2OJZH 2DDQH 3T3PF 1KOAA 4NYLA 3CVHH 1G7QB 4HH9A 4PLKC 4GAGL 4X80L 5T3XH 3QI9A 4YDIL 1GC1H 3UYPA 5KSVA 3NVQA 1NBVH 4RNRB 3O8XA 3HC3H 1LNUA 4WU7A 3SKMA 5KN5A 3ZT6A 3LHPL 3RA7L 3KPSD 2F8OA 5IQ7L 2DM3A 2OZ4H 2P5WA 1NCWH 3PWPD 3V0AC 2ADFH 3S98A 1AXIB 1JWMB 3ILPB 5FYLL 5D72L 1OVZA 4MQTB 2Y07H 1NBYA 3OKDA 4BH8B 1UJ3C 3RVUD 2E5EA 3BPOB 5INDA 2ESVB 1NFDB 4FZEH 1TVBB 3EGSA 5I1IL 1NCBH 3MRPB 4HT1H 4PLOB 4WWKB 1RURL 5I1GL 4X5XB 1JK8B 4K2UL 3IRPX 4YZFF 4M43L 1DBJL 4JKPL 3MNVB 2OBGA 4ZMAT 1T1YB 4WIQA 3SDAD 1D9KC 1YPZF 2D31B 3D25A 4G43B 3NPZB 3PP3H 5BCAA 4XBPA 3TN0B 3MODL 5ALBL 1E4KC 3HR5A 1SBBA 3MV9E 3QPXH 4TVPE 3BHBA 2BSRB 3WNPA 1FE8L 4CN6A 2VDKL 4HCRA 4ELKA 3MMEB 5CJOL 4XGZA 3OB8A 2WK2A 4WW2A 1ZLUH 4P5KA 4LHJB 3NIFE 4DVRH 4NO2A 3OKNB 4BQCA 1Y0LA 3F7RA 2BY1A 4OFIA 1N8ZB 1EEZA 1FDLL 2PYFB 5DVNA 5D5MA 3WS6C 5F7DB 3BPCA 3I02A 1HSAB 3KJ4B 3QG7H 4OZ4B 4POYA 4FFVD 2IPKA 4U2YA 3UTZA 5DQ9A 5ESQA 1KBGH 3FN0L 3MLYH 3VWJD 1SQ2N 1E6JL 1URLA 4G8GE 5L88H 4RA3A 4JY5H 5E9DB 1JHTA 1RZKC 4P5TD 4OI8A 3SE9L 4Z77A 4OGXL 4JO1H 5E70A 3FRPG 4K3EL 4OKVB 2HTKC 4KRPC 4S1DC 4U1NB 2C7UB 3CSYA 1IAKA 3BZEB 4MX7A 4EEEA 4MMZC 2W9LA 4LQFH 1EMTL 4CW1B 1T2JA 2VXSH 5JDSB 4Z9KB 2DBLL 1AGEA 2AAVA 4LL9A 4YDKL 1AFVL 2X41A 1Q9LA 4J3XA 4MD5B 5IBTL 3MLPA 3PIQB 4A2MA 4RMTA 1N2RA 2V17H 3MBXH 3WSQH 4P2OD 3LSOB 1EBPA 2CKBB 2A6DB 1J1OH 5E8PA 1YN7A 3L1OL 3GMLA 3ZHDA 3SHSA 1E0OB 4QYOA 3MLTB 3TJEH 3T4YB 1XCTA 3QIUA 5K9KA 2FECI 4EZMA 3FQWB 1CT8A 4MJIA 1PSKH 1A3QA 1CZ8H 3BSZH 3HG1D 4HUNB 1AJ7L 3ZDXF 3D9AL 4W4OC 2DS4A 5KSAC 5CJBA 3TZVA 1Y18A 5HGBB 2ARJB 1JNJA 3WFDL 1BJ1H 1YNKL 5GGVY 2H32B 5E8OB 3WKNA 1OAYH 2ZOLA 3MRNB 5JHDB 4NNPL 4FTVA 1IEAA 5E8EA 1WTGT 3CSBA 2YC1A 5D7IA 3HMWH 1BEYH 2FGWL 4WUKL 3LQAH 2UVEA 5DD6A 1DDHB 3TBTB 2LTQC 5DS8B 2IAMA 1R3IH 1NDMB 4D8PA 1U3YA 1F58L 5JMRA 5HXMA 1AGCA 4GBXD 1RZIB 4GSDL 4LAQL 2IBBA 5I0DA 1AKJB 2I24N 3W39B 2CKBH 3LRSA 3B4NA 1KN2H 3AXLB 4D3CL 3WYRA 4YC2B 2O5XH 4IRZH 4XCEA 1BBJA 4ELME 3GNMH 2FHCA 4LIQE 4KVNL 5KW9L 3FQXA 1K6QH 5E2WL 3HE7C 1BMGA 5LG1A 1A4KA 4ZS7L 5HHQB 1EPFA 3GJEB 4RMRA 3QQ9C 4ZQKA 4WJ5A 2NNAB 2VLRE 4LGPB 3SKJH 2H32H 5MHSD 3WFBL 3ROLB 3RUGE 1IM9A 1F2QA 1F11B 4QHMB 1DL7H 1OL0A 4GRMA 1ED3B 3T0VA 3DVNA 3ARFD 1LP9F 4RFEB 3ZYIA 5FDWA 1LEIB 4F7PA 3S36H 2DQUH 4DTGL 3M17B 3LKNA 3T04D 4EDWL 5FYLD 1A6VH 4PJDA 5I8CB 3BD3A 4DEPC 3QIBD 3VJ6A 4BUGA 1FLTX 2XPGA 3QISA 2XFXB 1N0LA 3GJFA 3MGOB 1T80A 3VFTA 4GKSA 4ODWA 4HGMA 1Q72H 4U6HB 3FONA 4L8SA 3R06A 2G5RA 4K3GA 3E6HB 1NGXB 4GRLC 1QFHA 4KUCF 4WFHE 1KIUA 4HZLB 4XRCA 2D9CA 5F7EH 4XVJH 2P42B 3CLFH 3HPLA 1KFAL 3MUGB 3HR6A 3QRGH 5IHZB 2DWEA 3T3MF 4P5TB 1F4WH 5HHNB 3RGVA 4GOSA 4HX1A 4Y19E 5IBLC 4KDVA 3RL2B 5FYKL 3DOSA 5DRXA 1QBLH 3S96B 3TCLA 3ZTNL 4K23L 4JM2F 5TDPA 2VO5A 5FUZH 2XY2A 4CNIB 3P73A 1A9EA 5L6YH 3DRTA 3UTTB 4DUVA 5CD3A 2D0FA 1G9MC 3BKYH 3PWNB 4BJLA 3S37L 5KVFL 1OGAE 1LO0H 1PAMA 3Q6GH 5CP3H 3FKUS 1QZ1A 5KG9B 1KB9J 4P23A 1MEXL 3NACL 4NBXB 1R5WB 5D9SA 3QUKB 3O45A 4JFOB 3KXFD 5AD0B 5DYOA 3IKCB 2GJ6A 4JG0H 4RDQG 1WGOA 1JL8A 2A1WH 5B39G 1W2KT 1MCNA 4Z18A 5KVDH 2B4CC 2HP4A 2KBGA 3FT2A 2KH2B 1SM3L 4GJTB 1OAXH 2MJWA 4QCIA 4L9LB 5JO5A 2AEQL 4GMSL 5DVLA 1CGYA 1F6LL 3C5JB 4KY1H 3S34L 1CDJA 1FC2D 4M5ZL 5BV7L 3RI5K 4ZPTA 5KSBB 3DUUB 2VKWA 3V5HA 1FFOB 1MHEA 4ODHH 1YY8A 4K3HA 4WO4B 3RWFB 1ZK9A 1EH9A 1YECL 5HPOA 2YRPA 2YD7A 4JHWH 4I13B 4L5FH 3U1SH 3TP4A 1YQVL 3UC0L 1QSVA 5HDQL 1WVZA 1YEGL 3ULVC 1KEGH 4JEGB 4LDOB 1FYTB 1HNFA 2Q76B 3QUZB 1G84A 1U6AL 4TUKH 1KIPB 4QRPA 5JIHA 3TIDB 2AABL 5FA4B 2HFEA 3QFJB 3PQYB 1P84K 3MZTA 5ITFA 1IL1A 3GMNB 3MRRA 2ZUQB 3S5LA 5D1QD 1QYGH 4LEOA 4PGDA 3O0RH 1QBML 3ALXA 4PY7B 4WTWA 3QNYB 4YFLF 1MJ8L 3FTGB 4IBLT 5EOCH 5T1KB 1KEMH 5H94A 4CU7A 3MRJB 1NCDH 3EFFA 4JO3H 1RSFA 2AJ3A 4NM4H 4EUPA 1SBSH 2G60H 1OTTC 3V8OA 2O5YL 4F37K 4NRYB 4M61A 1TJIL 2OMBA 4NQSB 4ZXBC 5D93C 3D2UA 2X4RB 2BC4A 4UDUA 5D2LF 2DAVA 4KKNA 4L4TA 1U95A 4KKAD 1IGTA 2NY5L 2HKHL 5IB2B 4GRWF 1J0ZA 1CF8L 1U92A 3GBML 4JQIL 4IRJC 1T1WA 4Z5RB 2Z91B 3KPSE 4P46C 4EOWL 2BVEA 2PO6D 4U3HA 3QDMB 4PJAF 4WY7H 4NQVB 4JM4H 2O61B 3PV6A 3QFDA 4HIIA 5BXFA 5I8KL 3VE0A 3HE6B 1F02I 1WBYB 2XWJA 4FQIH 4Z7UE 1FG9C 5C6WH 4X80H 4YDIH 1V7ML 5C0AA 6FABL 5FOJA 3RWJA 4QNPE 5ICYA 4KUZL 4L8CB 1GGUA 4NT6A 4H25B 5EIIA 2HJLA 4QO1A 3DVGB 3LHPH 1MQ8A 3RA7H 4OV5A 4JCMA 5EUKB 5IQ7H 5I0ZA 1K85A 2WWKT 5L2JA 4L29B 1KT2A 3GMRB 5LKNA 5FYLH 5D72H 3L9RB 3WUZA 1KJ2L 2BOBA 2WBJA 2I27N 2FR4A 3QNXA 1PG7X 2VQUA 4H5SB 5C0EB 4KRNA 1A6ZB 1T5WB 2CLZA 5JW5B 4ORGA 3OKLB 5I1IH 1ZHLA 1I3GL 1MCIA 3CXHK 4C83A 1JV5B 3ZDYF 2YPLB 4AEFA 2NR6D 4JLRA 2WWMC 2IANB 1RURH 1CE1L 5I1GH 5DJCB 4K2UH 1BJMA 4M43H 1DBJH 4JKPH 3O3EB 4RAVA 4NN6C 4PJIA 4O2FA 5DMIL 4OFKA 1D7FA 3MODH 3MGTA 5ALBH 3PGCB 4KROC 1G7PA 4I0PA 3SE4A 4WTZG 4PB9H 3DUSA 5FYJL 1J10A 4QRQB 1FE8H 1HQRB 2VDKH 1MLCA 4JGMA 4JPVL 3CX5J 1MI5A 3LKSA 1I1AD 1OPGL 2ARJQ 5DGQA 3VRLE 4PRNA 5JR1L 4KFZC 3HB3D 3U79A 5FGCB 4JFHD 5KAQF 2PXYD 1FDLH 1ITCA 4N0UE 1ZWIA 3BAEL 3FHAA 4IDLA 3GHBL 1MNUL 1XR9A 1NFDF 4WTZA 4P2RA 4CMHB 3QEQB 3OV6A 2H2SC 3T77B 4HJGB 4PJBB 4J2XA 4BK4A 2V7NA 5EN2A 4XX1E 4MJ6B 3FN0H 3MREA 3RDTB 1E6JH 3H9SB 5IEHB 3SE9H 2IPUG 2I60L 3H0TB 4OGXH 2QADB 4K3EH 2J1KA 1B0GA 2ZG2A 3U30C 1GAFL 3MRKA 3B9AA 3HG1E 1BJ8A 4TUOB 4F7CB 1HH6B 5DUPL 3LV3B 2QSTA 5H35A 1EMTH 2OL3L 3THML 1MWAL 3G9AB 2DBLH 4YDKH 1AFVH 5C0IB 3H8NA 5IBTH 1CXKA 1SEQL 5JXAL 3SKNA 5JPNA 2HT4D 3GMQA 4LLWA 3IVKB 3BVNA 4JVWA 1T21A 2E8ZA 5TDNA 5I1EL 5CBAA 4PRPE 3SJVD 3BIBX 1ZHNA 3U4EA 5CEYA 4F9PA 1NDGB 4WWID 3VFPB 5GZOC 5IIEB 1A6AB 1ZLVH 1C1EL 2QV2A 3G6JB 2CUHA 5FYJU 1G7MB 3L7FA 5HGAB 1PG7W 1AJ7H 3FQTB 2AEPL 3D9AH 1P7KA 2FHBA 5A40E 4U2ZA 1XF5B 3WFDH 4NRXB 1YNKH 1XGRB 2X40A 4YHIB 4NNPH 2PO6B 3ZE1F 4KGJA 1NC4B 5D1XC 5ANMA 3PGDB 3PABB 2DRUA 2FGWH 4XH2B 2B20A 4WUKH 4EVNA 1KJ3L 4X4MA 1NGPL 3QUXA 3RVTD 4WI8A 1EHXA 3BYYA 5D7JA 3OJDA 2RGSA 1YEDB 2D0GA 4XXCA 4DKEL 3ALPA 4Y4HD 1F58H 4V1DB 3S3JA 3J7HA 3MRMB 3NGBC 3NZHL 2JK5B 5HHOB 2J5LB 4S1QL 3OKMB 3QDJD 3EKCA 4LAQH 5MHSE 4I3GA 3WN5B 4WU5B 3V4PL 1JPST 4H26B 3V6ZB 5F44A 4D3CH 3TWCH 1P9MA 5F89B 1MFDL 1KELL 4PGEA 5AG9A 4YHML 4KVNH 5IBUG 1HCVA 3LKOB 3WIFB 4K8RC 4JJ5B 5KW9H 3UZQA 4OQTL 1KG0A 4W70A 3VMNA 5E2WH 5D7KE 1HILB 4GS7B 4ZS7H 1V8HA 1C7TA 1R5IB 1HHJA 1FZOB 1GOGA 4FMFA 5F7WC 4PBWD 2BY0A 2JLLA 3WFBH 1D5BA 5GRVK 5HDBF 4EXPX 3LB6C 2ADGA 1JRHL 4Z76A 1CWVA 4ZO9A 4DTGH 4X7TA 4X4YB 1T03L 2YWYA 4KI5D 2JIXB 3X14A 1MLBB 4EDWH 4L4VA 3PDOA 1TZIB 4JFZL 4GLRI 1DSFL 1FNHA 2W92A 1U3HD 3OB0K 1RHHA 1KYOK 5B8CB 4MXVF 3T2NL 4HGKC 1A6TA 4K71B 1I85A 3J8F7 4N8CL 3TPUA 2HT3D 3ECBB 1OSPL 4HMDA 2E3VA 5JXED 4GT7A 4PRBB 5CEXA 1FORL 4ETQB 2DYPA 3KLAB 2VISB 3X13A 1U8KA 1FFPB 5E5MA 2EH7L 1GCFA 4NWUL 5FYJD 1S7QA 4XX1G 5FUCE 3L3OB 3MRQB 1UWEL 2A6JA 1C5CL 2HLAB 1KFAH 1BJ1J 4HK0B 2VE6B 3FO2A 3T0XA 1HOCA 5E8NA 3KPOB 2VYRE 1N3NB 2CDGA 4GG8A 4KI1A 4RGOH 3KXFE 5BV7B 5FYKH 1OSZA 4O2EA 4EN3A 3ZTNH 1MRCL 4IIQA 1PY4A 4PP2B 5HYJE 4K23H 4NKOA 1ZLSL 3I6LE 1WTLA 1JNHB 3QDGE 4HIJB 4QGTA 1XT5A 4IS6B 2ZOKA 3EJJX 3S37H 1A64A 5KVFH 3I50L 1QP1A 3DX6A 1MH5B 4KTDH 3NCFB 1GZQA 1MEXH 4P3WA 4WHTB 1VEPA 5F88B 3C9NA 1VHPA 4Y5VA 1TFHA 4ZUVB 3KWWB 3VFUA 5CEZL 4GXVL 2UWEA 4NZJA 5IMLB 1JPTL 3H3KA 3QT2A 1SM3H 2FX8L 4Y16A 4XWOC 1UWGL 2VDOL 4Y4FA 5GGRA 3LS5L 1NQBA 2AEQH 4GMSH 3O11A 3DGGB 3RPKA 4M5ZH 3S34H 5BV7H 1NJ9A 4J8RA 3LMJL 2X5PA 2Z93A 3RKPA 2BVQA 1D6EB 5T5FH 4QGYA 4W6XB 4GH7B 1NMCC 4NUJB 1YECH 3O6FC 3AS3A 1LDPL 5CIPB 5MENA 1YQVH 3UC0H 1TJGL 3AM8C 5GS1C 5HDQH 3V7MA 1YEGH 3ARXA 2YUXA 2Q86A 2X70B 3FB6B 4PG9A 1NBZA 1U6AH 3EYUL 2DKMA 4O2CB 4TSCL 5IESL 3WMSA 1MRDL 3O6ML 3R8BB 1YYLL 4HS8L 4NQXB 2AABH 1DEDA 4KXZI 2DLEA 2CUMA 2X4PA 1U41A 2A6IB 1QRNA 4HS3A 3UXFA 4PJ9C 2VIRB 3C8KB 3BZFA 5ELIA 1QBMH 1NFKA 1K8IB 5L2KA 1T7VA 4NNXA 1MJ8H 1ZA6B 3I6GB 2B5IB 2Y1VA 1X5XA 4QHLA 3DTXA 5LVEA 3FHQA 4PJGB 5J8OA 1FZJA 4YZFE 3GEWB 1YMHB 1UEMA 4ODUA 1RIVL 2MQCA 4ZSOE 4Q6IB 4XCFL 4P4KC 1WCBA 2O5YH 2KDGA 4K7FB 1TJIH 4LF3B 3NZ8B 2QHRL 4G8EA 2XTJB 1QO3B 2DQFA 4HHAA 3VXMD 1KJ2B 1SVZA 2YRLA 2NY5H 4JZJA 4CGTA 1F4HA 2HKHH 1WZLA 3OGCA 5EO9B 1CIDA 2BHYA 5FECA 1CF8H 2VLJB 3K8MA 4DQOL 5J6HA 1Q0YL 4L1DA 3GBMH 3DYOA 4JQIH 4NQCD 4YHYC 3TO2B 5ADOL 4JFED 1S7UA 1VFOA 4HCRL 2HFFB 4EOWH 1CI5A 4OZGE 3KPNA 2QEJA 2YA0A 4YBLC 4S1SL 4UOJA 4U1MA 5HJ3B 3T0EB 3BGAA 1N6QL 3UTQA 2XY1A 5I8KH 4ODXA 1S7VB 2OTUB 2ADJB 5CCKL 2NY4C 1FIGL 4MXQD 3E3QC 2UUDH 2GT9A 4HLJA 3ARGA 3TIEB 2NXYD 5CZVL 4X6DE 3OR7B 2ZG3A 4UI2A 4IOFD 5DZOA 2DQEL 5E2JA 2VERN 1V7MH 1KF9B 4QRRD 5SWZD 1U8OA 3SCMD 6FABH 3GSQB 4NQDD 4YX2L 2NZIA 1VPOL 4D0DA 1NC2D 3MQIA 3HLAA 4KUZH 3KPMA 3GBLA 4LBEB 1FC1A 3NPSB 2NY6B 1G7JB 1EAPB 4LVOB 4LCWB 4EDXB 1EGJL 5DJ8B 4Q0XL 5BRZB 3Q1SL 5FCUL 1KNOB 1OAZL 3JVGA 5E6IC 4PJHB 2E7HA 3MV7A 4CADB 2P8LA 4GUPA 1QOKA 3L5WA 1XGQB 4LP5A 3ZE0E 2AS5M 4I77L 2H41A 3NCEB 4RGNC 1OP9A 1CDCA 1EEUA 1PKQA 2OCFD 3FRUA 1I3GH 5BVJB 3HZMA 4JFHE 1ND0A 3F7QA 5SX5K 4ZFOB 4HLZH 1CE1H 43C9A 5E4IA 3K4DA 5F1IB 3WL9B 2JJSA 2ZUYA 1T6VN 4XCNB 3EYFB 4K9EL 1EFXD 4L4JA 5GIRB 1D5MA 5DMIH 2X89A 5DK2B 3ABZA 4E42B 1TJHL 4XP9L 5DRNA 5ERWA 1MWAB 2CMRL 5FYJH 5KJRL 5T1MA 4OV6F 4JPVH 5EOCJ 3FQRB 3O41B 4GKOA 4YIQA 4GG6A 1KTKE 1UB6B 5F7FA 1MJUL 1Z9OA 3O3AB 5JR1H 1QSZA 1CBVL 3VCLB 4XP1L 4OZHA 4GKNA 4PJEB 3V5KB 1ES0A 2R2BB 4U6XB 1MY5A 3BAEH 5I8EA 4BYHA 1A7QL 3SBWC 3IGAA 3GHBH 1WC7B 1MNUH 4LLVB 1CQKA 3DVIA 1VB9A 1VSCA 2XWBB 1XAUA 5CEZD 3LKPA 4WW1A 3INUL 3OAYH 1MCBA 4XNXH 3FQUB 4OAWA 5GQBA 1BAFL 4JRYD 4F7EA 1VENA 2APBA 5LGKA 5C0DB 5FA3A 1CVRA 2I60H 5C07A 1ORSA 4S1RL 2BNQE 5IKCA 2EEAA 5DUPH 2EDJA 3TJHD 3N9GH 1P7QA 3JV4B 4WHYG 1OCWL 2AJYL 1R24B 3CDGA 2CGRL 2OL3H 1WFTA 3THMH 1MWAH 4Y5YB 3O3UN 4UBDC 1FBIL 1SEQH 5JXAH 5C0BE 3F8UB 4M7LT 5J06A 1I1FA 3JUYA 1RVFL 1IC4H 3V0WL 4D9QD 5I1EH 5D2NE 5JW4Q 1X44A 3IJSA 4U1SA 1XZ0A 5IVOA 3S4SG 3ZYJA 2WWKO 4PJBF 1EVUA 1P1ZB 3FZUC 4NFBA 1C1EH 4BFGA 1HHGA 2BHUA 2EXYC 3C6LD 2NY0C 3KYOA 4YDVA 2J8OA 2W0FA 1N5YL 3HUJE 3L3GA 2HFGL 2AEPH 4JQVA 4WFFD 4LLYB 5HYFA 3AGVA 1E4JA 4IHOB 4F33B 1AGFB 4OD1L 5IVXE 1PQZA 3NCYS 4X98A 1D5XB 1TVHA 2HKFL 1AI1H 2PNDA 1YPZA 3QO1B 2D7TL 4NP4L 5I1LA 4KAQL 1K4DB 1SJEA 1ZGLB 2DM7A 4IOIA 1JZ8A 3DXAB 4X4XA 4I4WA 1RZKL 2CLRB 1D3CA 3UBXB 1KJ3H 4HWNA 1NGPH 2PTVA 2EC9T 3BQUB 3IJHA 4DKEH 3FB5B 4NPYA 3IDMA 4M7JH 1R3HB 1WISA 3NZHH 3S37X 1JGUH 1UXSB 3O3DB 4S1QH 5SWSD 3KJ6L 4PBVC 1U93B 1H8OA 5BZDB 1A6UL 4M8QB 3V4PH 1SEBB 4MA8L 4KK5D 1PEWA 4R0LA 3G6JF 1F42A 2A74A 4K3DH 3N1MC 1MFBL 5IB1A 1MFDH 3KPLA 1VFAA 3IDYB 1KELH 1UKSA 4R26L 4OT1L 4LCCC 4YHMH 1JHKL 4PJ7E 1B4RA 2EYSB 1IMHC 1GZPA 4IRSC 4OQTH 2DIBA 4NHUB 4CVXB 1BFOB 4OUOA 1JYNA 5HI3D 3KPRA