5C2UB

Ferredoxin-like domain of nucleoporin nup54 bound to a nanobody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
b'VQLQESGGGLVQPGGSLRLSCVVSGDYYAIGWFRQAPGKEREGVAAISSRDGSTYYPDAVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADRRQRWGPYYYLSALEYVYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title Crystal structure of the metazoan Nup62Nup58Nup54 nucleoporin complex.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Transport protein
total genus 33
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c2uB00
2VAJA 1C08B 1CZ8H 5ALBL 3RTQD 5DSCB 2EDTA 2F54A 1WT5C 1DQJB 4FXGB 2R9HD 4ZFOL 1L4IA 2MCPL 1P7QB 2FJFB 2E6QA 4OZ4B 1BGXH 1S9XB 3EFFB 5JIHA 1AGFB 1EO7A 3MRLA 4PJGE 4QRRA 4NO2B 4AEFA 1JGDB 3L5XL 4BK5A 3CMOH 1PYWB 4FQXC 1SY6A 4V1DA 3WXWL 3OKEA 4XBEL 3VRLE 4Y4FB 5DUMH 4CW1A 5GSRA 1GIGH 2MQ3A 5D7JC 2IBGA 1S9YB 4HIIB 3H3PL 3G5XA 5DVKA 4UNTA 1FZOB 4F9PA 2XPGA 4ZOEA 4CRPA 5EOTB 1WFUA 4XMLH 3MSPA 1VPOH 4IHOA 3CX5K 2ZUUA 3QIUA 3UTSA 3T3PE 1U8KB 3KR3H 5E8PB 1IARB 1MHHA 4OCWH 5DD6A 4FS0A 1QFWM 5F3BB 1EVTC 4UT6L 2NLJB 5CHNB 5C0FB 1OLZA 1ZHKA 3HI1B 3TCLB 3BSZH 4ETQB 3K7UA 1FVEA 3HNVH 3TWCH 1YPZB 4G6AD 3L7FA 4ODTH 1F42A 2JELL 4GQ9H 3TO2B 5FGRA 4X9IA 4M7JH 4U0RC 5DWUL 2GJ6E 3FT3A 4LLUB 5F7LB 2W0PA 4XI5C 1JGLL 3NH7L 4U1GB 1ZA6A 2AJXL 5CEZL 4WWKB 3BZEB 2VDPH 1HH9B 3GBNH 3D9AH 2EE9A 1MEXL 2M8XA 3FO2A 3CCHA 5EOCH 2V2XA 3H9SB 3GZKA 2ZUXA 3PDDA 5LQBH 3ZDYF 1E6OH 4P5TB 5B38G 2FX7L 4CAGA 3RX5A 3LSOA 1BPVA 4I0PB 3O6FB 3OXRA 5ANMA 1W0WA 5DJZA 3BN3B 5FYJD 1FFOA 4GKNB 2P1YA 2W91A 4PJAF 3LQAL 2D7MA 1P6AB 4HT1H 1RU9L 1V3JA 5CEYA 2XZZA 4OZFA 4JQVA 5J6HB 2EYTB 2VWEC 2XZAH 4MXWH 2HT3C 2VUYA 4Q97A 3P0YL 4WDIB 4NWUH 4PRIB 3R8BB 4OLYH 4L8BB 5ECJE 2J1KA 2VLKE 3F7PC 2R56L 4OGYL 4FFYH 1KEML 5LBSL 4F57L 1S9VB 4PRPD 4EI5A 1IM9A 4TUJB 4ACPA 3TBYB 1UXSB 5EPMA 3DNKA 4XC3H 1U8MA 3PHQB 3KHQA 5D7LE 3S3JA 3SKOA 4NKMB 2ENSA 5DD3H 3LD8C 1PQZA 1JNNL 4L8CB 2LVCA 5IW6A 3C5ZD 4JFFD 2X1QA 3B9KD 1T5WB 2Y5EA 3OX8A 4NKOA 5L2JA 3MRJA 3MROA 2A74A 1HOCA 1ETZB 2YN5A 2VE6B 4NYLA 5HPMB 5JPNB 3O6KH 5INCA 4MJ4A 5DT1L 3PWVA 5EOQL 3QEQB 4KVNL 3IDUA 3VRJA 1TJGH 4QY8A 2VMFA 1UACH 3TVMA 1NC2D 2BFVL 2OI9B 2X4UA 4OTXH 4ZAKB 1DQMH 4PJDE 5EN2B 3ECBB 2NW3A 1CD0A 3SOBL 1NCTA 1I8LA 1GAFH 2A38A 4MLIA 1TVBB 4YX2H 1Z3GL 3S96A 1MCPH 3K2UH 3GSXB 4Y16B 4JQVC 5ETUA 3KYOB 4OLZL 4XMPL 5EB9A 5FYJU 3ILPB 3D3VD 3QFDB 4X4XB 1XCTB 2MWCA 4N0CC 3N1MC 4OZIB 4Z6AT 4EI5C 5KS9A 1DVFB 4HBQA 4CMMA 3VFOB 3DBXB 4APQB 2XXCB 4TPRH 5M7QA 5J1TC 3ZLQC 1FBIH 1MCBA 1C12B 4WIQA 3C5JA 4K94L 3RL2B 1L6ZA 1DN2A 1U2HA 3FMGL 5DR5H 32C2B 2V9QA 2JIXB 4POZC 4D3CH 1HDMA 5JNYA 4LHJB 5C0AD 1HKLL 2AV7A 5CJ8A 4JPKL 5FOBB 1KIRB 1YUHA 2J3SA 1DBKL 3VE0A 4UU9B 4X9FA 3IFLL 3WSQH 3OR6B 1J0KA 5SV3A 3KS0H 3TVMC 4KC3B 4OCLC 2YPKA 3DLQR 1NH6A 3B9VA 3D39B 5KG9A 4M7KL 3IJSB 1NAKL 3O3UN 4YH6A 4N0UE 1YJDC 2IAMB 2CQVA 3L3IA 1I8LC 4F7EA 1A14H 4NHUA 3AAZA 3FO9A 2IADB 4LKXB 2RR3A 5MEND 1UWXH 1YYLH 2GW5A 1U8HB 5J12C 5HHMD 5JO5B 5JHLH 5IVNA 1QSFE 3MV8B 4KKBC 3MUGB 1L7IL 5D7LA 1RK0B 3BPOC 2IPUG 1KSRA 2GSGA 5DXWA 2CKBB 5KVFL 1IGCH 3GSNB 3UYRL 4P9HL 3GSVB 5JLZA 3SDDC 1UEMA 2PO6D 4WEBL 2YZ1A 1EHXA 2HWZH 1BOGB 1ROWA 3IDGB 3QZWA 1E4JA 3V5DB 2KKQA 3SDXE 4Y2OA 2Y07L 3VXRB 5AEAA 2D31B 4MLSA 1ODAA 3MRNA 1PZ5B 5E00B 1DEEA 3NZHH 4M5ZH 4MCZA 1DBJH 3WJJC 4LCCB 2VLLA 1G9NL 5HY9B 2E7CA 1IQWL 1UWEH 2X4OA 4S1RL 4PJDA 4U1SB 4OFKA 1MJJA 2VZUA 2I07B 3FQNA 1UB5B 1YN7B 4FMKA 2OR9H 3ARSA 4OV6F 5GXBB 4OCMC 4H25A 4JB9L 3MCLH 1CGSL 2DQIL 3VGDA 4DN3L 4NN7B 2RFXB 4JG1H 4ODVH 2QSTA 1CGTA 2F8XC 4JPVH 3DUSB 2YZ8A 1PJ9A 3L5IA 1VFOA 3HZYA 1AY1L 2NZIA 5EZOL 3OKYA 2W1NA 3FO1A 4BZ2L 1YEGH 3QDHA 3BESR 3OHXA 5JMRA 1SVCP 1HQRA 1LO2H 1MF2H 5K9QI 1U8IB 3QDGA 5KSAD 3GI9H 4NBZB 3EW3B 3RY5A 4G42A 1NUFA 4JCMA 4OFYA 3GSNL 1LP9A 5IK3A 4UT7L 1P69B 1T83A 1B6UA 3FFCD 2J6EA 3OKNA 4LLQB 1FZMB 1F90H 2HP4A 5HVGB 2P5EB 3DTXA 5ADPH 4EDWL 3CVHB 4HKXA 4PJGF 3C2SA 4R7DB 1D5MB 4N0UA 2H2PD 3RBGA 4L29B 4UQ3B 2DI7A 4R2GD 5FIEA 3VRLF 3QO0B 3MO1A 4KZDH 5GGRA 4MNHA 5EU5A 2QSQA 1UENA 3HE6D 4QF1A 5CZKA 1P7KA 5ICXB 4YDKH 1CE6B 4XCCH 1T4KA 2ICWI 4WJ5A 4YC2B 4KJQD 3T1FB 3TYFB 4BQCA 1RK1B 1BD2E 4FTVD 4OM0H 3RZCC 3GHBL 3O41B 4UI2A 3VGAB 5BJTA 5JR1L 2ARJB 4W6XB 4G9FE 2FH6A 3WLBB 4K07A 1TPXC 4LP5A 1FLRH 3MLXL 3TBVA 1U95A 2OP4L 1YA5A 4S1QH 1FNHA 5FB8B 3W9DB 3VFVB 4N1HB 3IXAA 1NGZA 3HC0B 3PP4L 4MA8H 2D3VA 5HSFA 1P7QD 4M00A 5HHXL 1JHLH 5ESAA 4JFXA 1H9VA 3TPKA 5CEZD 3FQTA 2PYEB 4PP2A 4HKZB 4PJ8C 2FB4H 4LNRB 4LRIC 2KL6A 2NCMA 1MJUL 4BK4A 3QEHA 3CVHL 1H3GA 4AIXA 2X4NA 5L7XH 3U30C 1KB9K 4TSCH 3ARDB 3BP6B 1HNFA 4Y4FD 3MRMB 1NGXB 4PJEB 3QIWC 1J8KA 5I15H 3MLSL 4WFHD 5I2IB 3LV3B 1KTLB 5ITBL 4ZD3L 4KKAD 3ZT7A 1FP5A 4I18C 3FT4A 3WFHA 4GOSA 4QRUA 5HGDA 1NFDB 3M8OL 4GRLC 1BLNA 4Z78A 1A2YA 3HAEG 4Q6IB 2VDNL 5IMKB 4NHCH 4JFEE 2UVFA 4X7EC 4HEME 1GSMA 5SWSB 3X11A 3OG4B 5HVWA 5E95B 2DQGH 4GRMB 4U6XA 3CFEA 1O0VA 4Z8FL 1NC4A 1OAZH 1SBSH 5EBGA 4UOJA 3RUGB 2EYRB 3I2CL 2D0GA 2W9EL 5IG7A 5EBLB 4NQXB 4R90L 1QVOB 2BCKA 4CDHA 2D4FA 2W9DH 1BWWA 3BGMA 1WC7B 3WUZA 2EE3A 4E41B 4L8SA 4CVZA 5HYSA 4PJCE 1RUKH 4I13B 4WWKD 4LVNB 5D93B 3WHXA 3DX9A 1H8NA 4XNQA 8FABA 2OXHA 5F88A 2GSIB 4JRXE 4XP9H 1TZGL 2IGFL 3H9SD 2D4DA 1BD2A 5GRVL 4P5TD 1D6EB 4PR5B 1OQOA 4NM8L 5I73C 4J2XA 3ZTJG 3UTPE 3BP4B 4G9FA 1KIQB 3L3GA 4JO3H 4I0PD 3O6FD 5EUOE 4JHZA 1NBQA 5ALBH 1QSEE 5BO1L 4PJIE 4JANA 2MCPH 2IMNA 3DMMA 5DD0L 5JQ6L 5GIRA 4OM1L 5I8EA 1C5DB 4ONGL 3HUJB 2CD0A 3CNKA 2GAZB 1WWCA 3QAZB 4PRID 3ARXA 3WXWH 3RPKA 4PJ7A 3DXAE 4JDVA 2YD9A 4XBEH 1RZGB 4Y5VC 4WO4A 4XX1E 3RVWD 2A9ML 7CGTA 3MLVL 5TDNA 1U92A 2A6KB 4QNPE 4JVUA 2QADB 4L8SC 4MJIB 5DMKA 1JRHI 3S4SA 3MRDB 1EJOH 2YPLE 1T7XA 4HPYH 2ZJSL 1MCCA 4I48A 3S36L 3G9VA 5JXEA 4NZJA 2OM5A 5EOCJ 3F7VA 5AUMB 3H7BB 5JXAH 1NGWB 4WGVB 2IBZY 4U3CA 5IB5A 4JJ5A 1JK8B 2IFFL 1IC5H 5ILTL 1Q9KA 5D2NE 3QEQD 5FCUH 5DYOA 2ARJQ 5DVNA 3MV7A 4HGMA 4M6AA 1TZHB 3AU1B 4ZAKD 5DK2A 2CUIA 4ELMB 5DWUH 2C4XA 3DMMC 1ZWIB 1NBZB 5F6HJ 5ISZA 4NM4L 2DM2A 3A6OA 3RDTB 1KEGH 4Y16D 1JGLH 4Y7MA 2CLVA 3NH7H 3F7YA 2AJXH 5CEZH 1L0XA 3N1PC 4KRPC 1IEHA 2H26A 5BRZB 1L0YA 3BZFB 4I9WD 4YAQA 2B20A 5HYJE 2EH7L 1I1FB 1HHHB 3G5YA 4GXVL 5I71B 3S97C 5J3HD 5DJAA 5DRWA 1MEXH 5FDWA 3UTTA 2WBJA 3ES6B 1DVFD 2XZCL 4I1NB 1QUNA 4I3GA 4APQD 4JRXA 5EU4B 1N59B 2FX7H 4JVPA 2NX5A 2Y06L 3U1SL 3VA6A 4OF5A 1JUFA 4NGHL 2NY2B 3SDXF 1WBXA 5JXEC 1RZJC 1TTFA 2DBLL 3VFSA 1MUJA 4PB0L 4D9QE 4O2FA 1Z5LB 2P8LA 4WEUD 2BY1A 3HR6A 3FN9A 1QSEA 4FMFA 5D70L 1IAOB 4PJIA 1RU9H 3S3PA 1PKQE 2V2WB 1QHOA 4WTXA 4FQHB 3I84A 3P0YH 5LCVH 3UTQA 1I7RB 4N9GA 1B4JL 3D39D 3WS3B 3SE4A 5CKGA 4XNMB 3RWJB 2IAMD 2R15A 2EDKA 5LBSH 4F57H 4GXUN 5IEKA 4GG8A 3DXAA 1R5WB 2YD6A 5FUZL 5CFHA 4P3WA 5T1MA 3I50L 5C0CE 3R1GL 3O3AA 3UYPA 4HKBA 2VXUL 1KB5B 3KPSB 3VD5A 4BSWA 3EJZC 3ZTNH 3MV8D 1D5XB 3FT2B 2YPLA 3K1KC 3LEVL 4KHXL 4YNYA 2X89D 3C8KB 4RGNE 1I4FA 5F97E 1A1OB 3KYKL 3D18B 3EHBC 5ELIA 3BHBB 1G6RB 5DT1H 3GMLA 4KVNH 5JORB 2GTZB 3GMQA 4UDUB 1SMOA 5C08B 4JRWA 1INQA 1KLGA 4PIRF 3VXRD 5L2KA 2F9BT 2BFVH 4P5MA 4F37K 2H3NA 4PJFB 1SBBA 1ZLUH 1XF1A 1CLOH 3BQUC 4U6HA 3IVKA 3KS0J 4U6YB 1Z3GH 3GMPB 4OLZH 4XMPH 2VDOL 3F5WA 4U33A 4HG4J 2GT9B 4O51A 5I1HL 4KK6D 1NBYB 3TBTB 4PGDA 3DETD 2MTPA 4O2EA 2EIZB 1I7ZB 1S9KC 3REWA 3A6BH 4J4PA 5JW3H 5AZEL 1J05B 5HYJA 5E2TL 5TDPB 2AS5M 3HB3D 1KTDA 2NR6D 3I6LE 5EORH 1FFNA 1EFXB 1AQKL 4K94H 4BUGA 1KB5L 5C9KA 3FMGH 3L5WA 1ZVSB 3TEUA 3RU8L 1G7LB 2OS7A 3IDYC 5I6XB 2BVOB 3G08B 1HKLH 1OGAB 4XXDB 5T1DH 5IV2B 3ILQC 1DBKH 2P47B 1DQTA 3M07A 1LK2B 4P5KA 4Z7OF 3IFLH 3O4LE 5TFSL 3K4ZA 3ZE0F 3PGFL 1AGCB 2D7QA 4NKQB 3NBNA 2HKHL 3NAAH 4OZFG 1KTKE 5D2NC 4M7KH 1NAKH 1XH3B 4YGVB 1G0YR 5DJ8B 3SCMA 2L7JA 2P5ED 5FYKE 1BFOA 4M8VA 1AR1C 1MJ7H 4X4ZA 5DC0A 1GGYA 3S37H 1BBJB 3MRQB 4D8PB 1O7VA 2UWEB 1JYVA 4ZO9A 2BNRB 2EC8A 4CUCA 2GTWB 4GBXB 3CXDL 5C0CA 2A1WH 3KPPA 4PRBA 1L7IH 1DUYB 4MGXA 1R3LA 5E7BA 1KJVB 1HSAA 4DZBB 3CFKA 3QPQC 5IFJB 5KVFH 1DQLL 3QG6B 1ZLSL 5FECB 3VH8B 5DHVA 1UM4H 3TA3A 4WEBH 3CZFA 4ONHA 4XNZC 2I24N 1M6OA 4LPVA 2Y07H 2IJ0C 2VITA 1DLFH 4OZHE 1NGPL 3R0MA 2X10A 2HJLA 4HHAA 1IQWH 2E3VA 4S1RH 4LSQL 1WTGT 3VFRA 4X8JA 2ICCA 4BKLA 2IH1A 2E9JA 1S7SB 4PJ5E 4W6YB 2CLZB 5ITFB 5A1AA 5LGJA 2W0LA 4NRXA 2QHLA 4XVJL 4GKSA 4JB9H 4B7IA 5KSVA 2PYED 3CDGA 4ZS7L 2BHYA 4BFEA 1CGSH 2DQIH 4PJCF 4NUJB 3PABB 1IAIM 3EYSH 1D7FA 1FCCA 3ARDD 4G5ZL 4UIMA 4CL7A 3EO1B 1AY1H 5J57B 4BZ2H 2M1KA 3MFGB 4WUUE 1GC1L 2F53B 3P9LA 3VXOA 3JVGC 2L7UA 3VFMB 5IBLD 2DF3A 3TA3C 2R2EB 2CKBH 4AH2B 5HD8D 3GSNH 4RGNC 5EUOF 4UT7H 4YHZL 2A83B 3CUPA 1MCDA 5DUBA 3QDMB 4P2OB 3O4LA 4KUZL 4NKIL 3LKQB 2VQUA 5F7WC 2O5YL 1VGEL 1RULL 4EDWH 5SWSD 5HGAA 5TE4L 5EG6C 4LCWB 5EC1A 3FCTA 2A2QT 1IAKA 1BJMA 3JWOC 1PAMA 2R0ZL 1NL0H 3RI5F 1LD9B 1KLUB 1OP5H 5IQ7L 3I02A 4XCYB 2AEPH 4OD1H 4P4KB 2JKXA 1S7UA 2AXGA 2ERJC 2VDKH 2HG5A 5FF6A 1ZT7A 3IAPA 4BM7A 4JFQA 4UUJA 4K71B 2YUWA 4XVSL 4E41D 4AMKL 1U8OA 3MRGA 1BQUA 4U1MA 3VJ6A 3QH3B 5T5NF 4NRZA 3RWGB 2CMRL 3GHBH 1MCNA 2P5WE 5JR1H 3GFUA 3BWAB 4X7TA 1D9KB 3QZWG 3BN9D 4XCNA 4GLRH 1OAUL 3S6CA 2BSRA 1M05A 5TE6H 4NN5C 2GK2A 3MLXH 5DFWH 1MCQA 3CFDB 3VWJB 2H32A 2Z8WC 4OZHA 4DQOL 1N2RA 3QFJB 4PD4J 5J56B 1KIUA 1EHLH 3ARGB 4LHUB 3PP4H 2W38A 2G5RA 4TULL 4LLVA 2MMXA 4OBSA 2XY1A 4DGIL 5SWZE 4X99B 1I8IB 1YEJL 1SJHB 4PJ5A 3CVHH 3QB7C 1L0QA 5MI0B 4LDLB 5FKAB 3SE3A 4LBEA 1EK3A 4PLKD 1FIGH 1U3HA 1HWHB 1N64L 3MLSH 5ENWB 4ODWB 3L7EA 1ITCA 2APBA 4PY8J 4XWOD 1NGQL 1G9MC 2ARWA 2QADD 4MJID 5EFIA 4WUUA 5I19L 1Q72L 3LRSA 4PLJC 4M9OA 3O3DA 1G7JA 1QFWL 3M8OH 3ARBA 4U1JA 4XRCB 3FL7A 4G6KL 1F6AA 2VDNH 1BQHA 3P30L 4OV5B 4AM0B 4Z8FH 4AT6A 2Q8BL 5JQHC 2EEDA 5E6ZA 1A5FL 1JJUA 3RPIB 2I9LB 3I2CH 3MOAL 2W9EH 4LQ1A 1RZ7L 3TIEA 5AWNH 4R90H 2K9UA 4MNQA 5IESL 2A77L 5DDHB 1RZFL 3ESVF 5C07A 3RDTD 1IQDB 1IGTB 2RAMA 3VGEA 3C9NA 5D7IB 1I1RA 1S7VA 5TH2A 1Y18B 5BRZD 1FC1A 4YHMH 3SE3C 2XKNA 3OB8A 4QHNB 4HWBA 4H26A 3QI9D 4YGAB 2RGSA 4BYHA 1PX4A 3WHE1 4CMHB 3C8DA 4XBPB 4F7CA 2IGFH 4IM8A 1CN4A 2N7BA 5D5ME 3MRIA 1M7XA 2YEZB 1M71B 2VIRA 4NM8H 3RGVC 1H0DA 3C6LA 4G8EB 5DEZA 5TDOA 2NY2D 2V5RA 3P9MB 4GO6B 4NOBA 4M4RA 4F7TA 5BO1H 3ARBC 3UDWA 5IB3A 3CFCH 4FABL 1KYOK 5MEQB 5DD0H 5JQ6H 3V52L 1S7RA 1OAXL 3GB7B 1AHWC 4QXUL 3MLTA 5AYQA 4OM1H 3JTTA 5HJ3B 3DV4A 1MCOL 1ZANH 1FDLL 4LLMB 4BH8B 2HLFD 1JN6A 3BT2L 4F3FB 3VXMB 1K85A 4YDIL 2A9MH 3GSQB 4X7FC 1MAML 3F7RA 4HXAL 5ERWA 2DQDL 3M17B 3E6FB 3DIFB 5HHNB 1LE5A 2AXFB 2BVPA 1P84J 1BAFH 1A7RL 3B83A 2HMID 3RQ3A 4Z9KB 1P4LA 3B3IA 3IDMA 1MCLA 3QQNA 5FYJE 3VFNB 1VKXA 3V5HA 1MCWW 2ZJSH 3KPSD 2PTUA 5KVGL 2O5ZL 3WE6A 3QQ4B 2ICWB 2FRGP 5F9WB 1CFSA 1OW0A 4WTWA 2V2TB 2CRMA 2Q76A 3TT3L 1OF2A 3STLB 2J7LA 2VO5A 3ISWA 4YZFE 5C0GB 5ILTH 5GGTL 3H0TA 1FYTB 1FPTH 3GSRB 2OL3A 5AYUL 5C08D 3BH9B 2LU7A 4PRPE 4UDTB 3SDYH 2C26A 1CD9B 2WLYA 2B4CC 5H94B 2DQFB 1A4KB 4K7FB 4NSKB 4YO0B 1D5ZA 5ESVB 4TOYH 2CIIA 5FM8A 1A22B 2DL2A 1HHGA 4JKWA 3S36X 4NCDA 3PHOB 3CSYB 4JFFE 4R0LC 5F1KC 1FNGB 3GBML 3KDMA 5FKPB 3REVA 4JM2B 2EH7H 3GJFA 4HDIB 1JPTH 4GXVH 3RKPA 3LZFL 1WZLA 4RNRB 5HYSG 1C1EL 2DKMA 2E9BA 4WCYH 4FQ1L 3BWUC 5E2VL 2XZCH 5F8QC 1ZA3B 4GS7B 1LO0H 2R2BB 4NBXB 2DQHH 2Y06H 4KK5D 2I9TB 3MLRL 2BOCA 4NGHH 5D5MA 1CDIA 1EFXD 3PQYB 4DEPB 3AXLA 3MGTA 4FFZL 4UTAL 3KPOA 4PB0H 1NANI 3RTQC 5E08H 1EAJA 5BMFL 5C8JA 4J3UA 1QQDA 3DURA 4XB7A 3SGKA 1AKJB 3WXVL 4X98B 4L1DA 2FLRT 1SJXA 3MRBA 3MRFA 3R4DA 1EGJL 1OGAD 5D70H 4JDZA 1QR4A 4R9HA 3TFKC 3OKLA 2Q6WB 1CLCA 1S78D 4RGMC 4UAOB 3RWFA 4H5SA 3OMZA 3X3FL 1I3RB 5F7KC 1JV5B 3MRPA 2W0FB 3F12B 3QUMB 3MFFB 3ARED 5FUZH 1CTNA 2R1YA 1RD6A 3I50H 3R1GH 1MQKH 2VXUH 1T89C 4JM4H 3BPLC 1J12A 2BNRD 4I77L 2QQQA 4GBXD 2VL4A 3N9GL 2QSCL 1BOYA 4HGWB 5IM7B 5A16B 3ZMRA 1YMHA 1I9JH 1WV7T 3LEVH 2FIKA 2HH0H 3HNSH 4G7VL 4OCXL 1P4IL 3BOVA 1RJZA 3KYKH 4Z76A 2P46B 1IGML 4DTGL 2FWOB 3GIZL 4Q6YA 1I7UA 2IPUK 3OJ2C 1MNUL 3C09C 4RMQA 3I6GA 2DIAA 5CJBA 5C09B 4PTUA 1XGQB 2YBRA 5DQ9A 3SGKC 2Y5TA 4YPGB 5MENE 4MJ6B 2BY0A 5IFAL 4QT5A 4NQEB 2KDGA 1DL7L 2VDOH 5KSBE 4WU5B 4FFWD 4I3RL 4KAQL 5I1HH 2AJYL 1NJ9A 1RIVL 1FSKB 3DUHA 3SE9L 2QHRL 4WV1A 4JFFA 1VB9A 5AZEH 2Z93A 1SYSB 2DTMH 4G6MH 1YN6A 5DMJB 5D1QB 4EQ3A 2WSKA 3HLAA 3QUML 1TVDA 4GG6E 1UEYA 4LVHB 1AQKH 3T0AA 3FKUS 3U0TB 2PR4L 1GXEA 1NC2A 3GMNA 3G6AB 4HJ0D 1KB5H 2PW2A 4YFLI 1WBYA 4HUMB 5E5MA 1AC0A 3RU8H 5F1IB 3BRDA 4EDXA 1G0XA 2W65A 2F53D 3WBDA 3MJ9A 4OCYL 2CRZA 4NQCA 5EO1B 3QXVA 4E5XA 4ZNEE 1FO0A 1G6RH 1F2XK 1NFKA 4HAGA 2HKHH 3EDKA 1RVFL 3QDMD 4QHMA 4P2OD 4M93C 1T5XB 4GW4A 1KNOA 3A67L 2NY3B 3VRIA 3PWPB 4KTYA 3D0LA 3P73B 3F6LA 4X80L 2FECL 3E2HC 5BV7C 3J8F7 5TQ2L 3HR5A 3SO5A 5ICZA 1IL1B 1JMXA 3W2DL 4XX1G 2VAAA 3CXDH 4P4KD 1NGYA 3C5ZC 2C3VB 2WINB 4WV1C 1JHTB 4N8PA 3I75A 3QUKB 4MJ5A 4YDJB 3OAZK 5F7FA 4EOWL 3G5ZB 1B6DA 1QBML 3QQ9D 1IZJA 1DQLH 5E8EA 5DK0B 1A1NA 2I60L 2ZP0T 3MOBH 1NAML 3LEXB 1GGBL 5K59F 3LKSA 1CLZL 1VENA 5GRUL 1N5AB 2VYRE 3BPCB 1D9KD 1IGJA 1U41A 3P0VL 2Y25A 2BNQD 1JRHL 2Y72A 1AR2A 1J9CT 5IMLB 4R7NA 3VWJD 1P1ZB 4U1NA 4KMQA 5J11C 5IVZA 3TESA 4JREC 2DLFL 1EV2E 1HHIA 1SYVB 5MERA 3QFJD 1J0HA 4LSQH 2KQMA 5E6YA 3NFNA 3ARGD 4LHUD 4GT7A 1MOEA 3ZT6A 4Y4KB 5DVMA 3JWDL 4XVJH 4A6YB 3INUL 3S8WA 4TUKL 4M43H 3TF7C 4ZS7H 3O3EA 4D9RD 4JN2A 1CICB 4RDQF 4JFYA 5LXGH 5CWSA 1NCWL 4L8DB 4G5ZH 1ADQL 3WO3B 4WHTA 4RMVA 1CI5A 3X12A 1AIFB 2IBZX 4ZFFA 4PJXB 4LMQE 1GC1H 3T2OA 4OQTA 5GSVB 5TJWK 2UVEA 1CXHA 2W92A 5HI3D 4X5WA 3L3OB 1G7PA 4Y4HB 2UYLA 4YHZH 3P4NA 5LAXA 5IROA 3UJIL 2GUOB 2YD3A 3BRGC 1T21A 3T4AA 5E2UL 4NKIH 4KUZH 4PGCA 3S5LA 1QBLL 1JP5A 2LQRA 2R2HA 4CGTA 1V05A 1VGEH 3K8KA 1RULH 3WFCL 4MQ7B 5TE4H 3OZ9L 5DMIL 3DX6B 4WHYH 1X5LA 1T0NB 1Z9OA 3FQWA 3KJ4C 2R0ZH 4K3JL 5IQ7H 5IOPA 2B5IC 1T1YA 5DGRA 5CBAB 2V7HB 2OXGA 4PRAA 5T3XD 3D0VB 5IVXE 1AFVL 1HHJA 4QKXB 1IEAA 3BXNB 1NCDH 2AKRB 3CH1A 4U7MA 2PO6C 4AMKH 4FQQB 1DLHA 3LEYH 4UBDD 2BJML 3CIQA 4ZG1A 3LKOB 1RSFA 3B8SA 3KXFB 3NABL 1HXMB 5EC2B 4E42B 4RIRA 4JZNB 1YPZE 5I16A 1OAUH 5C0BE 5E03A 3MMEB 1XGPB 4Q9RL 2ADGA 4YHIB 1UZ8A 5IROC 2FSEA 2OSLA 1CT8B 3Q5OA 5CP3A 4HZLB 4TULH 1MFAL 4DGIH 1T1WA 3QHTC 2XACC 1YEJH 2GKIA 1FIEA 5F7DA 3SKMB 3AFLA 4JO4H 4U49A 5H37G 4MWFB 5E1AB 3QRGL 3VXMD 3MJ7A 1M7DA 4QRSB 3TN0B 3VXNA 5IP4A 4AZ8A 1MHEA 4Z7VE 1N64H 3H9HA 5GISL 4PJBE 3HPLA 5FGCE 3BVNB 1WCBB 1NGQH 5KSAC 1LO4H 1VADA 2X4RA 1CLYH 3CH8A 3STZA 1XF2A 3TCXA 1Q72H 2KZWA 2DLGA 3QUXB 1GPOL 1WAAA 4BSVB 4FXGA 4ESKA 2J12B 4G6KH 2XV6B 1GOFA 2CDEA 1A6TA 4LHQB 4ODXB 5C0DA 3P30H 2YUZA 1A02N 4JLRB 2I27N 1FYTD 2MHAB 2H2PC 2JJWA 5I17A 1R3HA 4GSDH 4R2GC 4FQ2L 2FNBA 3DV6A 4O02L 2DYPB 4AENB 3KGRA 1A5FH 3MOAH 3N85L 3FQRB 1RZ7H 2H6PB 5HYIA 2XWBB 2YD4A 3BJLA 2A77H 4OLWL 5IESH 1RZFH 3S9DB 2JK5A 4AK1A 1JPSL 3TPUB 4S1SL 4PREB 2FHBA 5IVXA 4KJQC 1LQSR 3HI6L 2LVEA 2NXYB 1T04B 4JM2D 1BF8A 2JCCB 3VXUB 3O9WA 3QXDB 1J18A 4OGZA 3CVIH 4H8WH 2N56A 3QEQE 1KN4L 3W0WA 1A3QA 1KIPB 3PV7A 3RVXD 5HGBB 5HI4D 2HFFA 2IPTL 4J7RA 3CAFA 2CJUL 5ESQB 3HZVB 1EEZB 4I0CC 2YC1A 3GBLA 5IQ9B 5C7XH 3QUYA 3HFML 2NY1C 5C0BA 5LG1A 4CN4A 4XNXL 1G7MA 2WANA 5DUPH 1AKJD 2JLLA 1WGOA 2IQAA 1CD1A 3V52H 1CXIA 4M3KB 1OAXH 1GZPA 4UTBL 4QXUH 4Y5XA 4R4BB 2PCPA 2R4SH 4OZIE 1MCOH 1TIUA 5A43C 4IDJL 4XH2B 3EAKA 4PV8B 3V0VA 5MP6L 5MEOA 3L5JA 4ZOBA 3LY6A 3EBAA 4Y4FC 1R24A 5ID1A 1MAMH 4LPCA 1G6VK 2DQDH 4HUNB 2VZOA 5T3XH 3WIHA 5BZDA 5D1ZB 1A7RH 4Z7WA 4Z95L 4Z7VA 4KKAC 4GG6F 1NCAL 4PJBA 4NQVB 3PV6A 5KVGH 3DUUB 2O5ZH 4NC2B 2G75A 3LQAC 2DQCL 2VDMH 4HK3N 5KAQF 4WFGD 3O9WC 2IC2A 3PJSB 4LSUL 5GS1B 1A4JA 3P4OB 4UILL 3PE9A 3TT3H 3D39E 2DQTL 3DVNA 1BQHG 4ONFL 5AYUH 4NIKB 4JZOA 1YNKL 4XPFL 4LLDA 5C09D 1S7WB 5T1LB 2CPCA 4F33A 5TE7H 2XQYG 1K8DB 2APXA 2VKXA 4PJHB 3HI5L 4G43B 4NQED 4Y5XC 1JGEB 1L7TL 3FO0L 4U1GC 3MV8E 2R2CA 5F89A 4Y8AA 2R23B 4WWKC 3S98A 3GBMH 2YWZA 5DJDA 3O3BA 3LZFH 1JPFB 2AQ3A 3DO7A 3GIVA 4YR6A 1W72B 1FZKB 1RZIB 4NQUA 3PWLA 5D1XB 5E2VH 4Y1AB 4HGKC 4RISL 4D0BA 2V7NA 1QLRB 4P5TC 1WFTA 5D1QD 1CD8A 3QJFA 4X6DB 3QDJB 1X5ZA 4M3JA 3ROOB 1U8PB 2K7PA 3MLRH 1MLBB 4I0PC 3O6FC 1I1YA 1NDGB 4FFZH 1XF3A 1Q94A 3FFDB 2J5LC 1OAKL 1VFBB 3EGSB 3ECBA 1IM3B 1DUZB 3KPLA 3TBSB 1X44A 4YIQA 1EGJH 4TNVK 2FJGB 4EUPB 3MV11 1DEDA 3CX2A 1X6NA 3CGTA 2GITA 4R26L 3M1BA 5DLML 5FO8B 1X5GA 3SKJH 5EH1A 5BXFB 3WO4C 2AJSL 5FGBA 2D9CA 5GGVL 3X3FH 1GGCL 5DJ2A 3BMVA 4EI6A 3RVWC 1X5KA 3IRZA 2NY3D 2EYSA 4MCYA 3ZYOA 1ED3A 3PWPD 2R0KL 5IUSA 3P4MA 4MD0B 3L3JB 5TGBB 5DD1L 2FX9L 5I18L 5FA4A 4P2CG 4DKAA 1WK0A 4I77H 4XCFL 3ZKMD 4G6JH 2VABB 3WL9B 5E8OA 1GH7A 5E6IB 3U82B 5F96L 3RHWF 1RUQH 1W72L 4G7VH 1KFAH 3O81A 1P4IH 4OCXH 4RMWA 5E94B 5ADOL 5GS0L 2C5DC 1FL5B 2Y7QA 1IGMH 1Q0YL 3O2VL 5I1CL 1F45A 1XMWA 5IB2B 2W60B 1NFIB 1MNUH 3O45B 2HJKA 2OI9C 3D39A 3T4YA 4Z7UE 1OB1A 2CDFB 4NT6B 4ZAKC 3OXSA 1S5HA 5BZWA 1YY8A 1MIEL 3K3QA 4MMZC 5IFAH 1V3KA 3WD5L 4OQ1A 2BHUA 1RZ8B 1DL7H 2VR9A 2ZUWA 3FRPA 3VW3L 1UQSA 3O2WH 4KAQH 1J8HB 1WUNT 2ZSVA 4G80B 3L1OH 1RIVH 5FGBC 5J3HC 4KROB 2EIDA 2VZTA 4PG9A 3SE9H 2QHRH 4Y4KD 2OR8A 4P9HC 1Q9LA 3IGAA 3WN5A 2AQ1A 1DVFC 1MRFH 1RI8A 4X5XA 3SY0B 1IAIL 3H3KA 3K4DA 1X5IA 3W5NA 4JQXA 4APQC 1S7XA 4E9LA 3QUMH 1CICD 2GFBB 1R5IA 4OLVH 1FG9C 4PY7A 4X0KA 1N4XL 2ZCLL 2PR4H 3GEWB 2FBJH 4M61B 3OKDB 3SDCB 1T03L 3ZL4L 1G9NC 5DZOA 4YLQT 5J06A 3KWWA 1YPZF 3KPRE 4OCYH 5DJ0A 3WKML 3K2MC 1ZHBA 3FB7A 3L95B 4MZ2A 4Y4HD 2DAVA 2PYEE 3BRFA 4FQCL 1EO5A 1HEZB 1RVFH 4PG2A 2BX5A 2AK4B 2ITDA 4P4RB 1LE9B 3VXSB 4YDLC 4CADB 4I2XB 3CSPA 5GRWA 2VDRH 3C2AL 3QNXA 2LTQB 4HIEB 2XN9B 5CMAA 2X9YA 1ZHLA 4X80H 4LSSL 5F44A 5FO7A 1KV3A 3WCYA 3GM0A 4JR9H 5CD5D 3T65A 3MYJB 1JYXA 3OKOB 3LKRA 5HDLA 4E0RA 4KHTL 3WNOA 1A7QL 5DJXB 3BEVA 3WN5C 1OPGL 4Y8DC 3MNZB 4JFOB 2R39A 4HS3A 2XG5A 4JQXC 1XGUB 3K4AA 2GQHA 1CFNA 4JVWA 1NFDE 5JDSB 1XIWB 2APTA 2I60H 3GSWB 5JW5B 1QACA 1V7NH 1GHFL 3DRQB 1GGBH 3LN4A 5FHAL 3WNPA 4J3XA 3UJTL 2NY4B 3KXFD 1HHKB 4R3SB 4R96A 2E8YA 2Q86A 43C9A 1NLDL 1JRHH 1ZAGA 4ZODA 2WUBL 3BZ4A 3O2DA 4Z7UA 3RUGE 4PBVC 5HHOD 3RA7L 4W6WB 2IPKA 3CC5B 1KPVB 5B38B 2DLFH 4KK6C 3T2NL 1BFTA 5MEPA 3HE7B 4KTEL 4M6MH 1QP1A 4HH9B 2WBWB 4S11A 3QEUA 3LMJL 5HHQA 4E41E 4JY6B 3RJDA 3JWDH 5F7HA 2A6JA 5I8KH 3INUH 4TUKH 4XGZA 2WWMD 4FQJL 3V6FA 1T66C 3D2UB 2RJMA 5FYLL 5DD5H 2NR6C 4NN7C 3I9GL 4G8IA 2DM3A 2PW1A 5D2LA 4L9LB 1N5YL 5IB1B 1NCWH 3B9AA 1U36A 3OR7B 3R06B 1ADQH 1H3XA 3TN0D 2E6JA 3MACL 1YNLL 3WLWC 1HI6B 3RVUD 1HCVA 1GOHA 4N0FB 4HCRL 3LB6D 2DLTA 2EC9T 3KPRA 1TXKA 3QUXD 5TF0A 1ORSB 1UB6B 5D8JH 4P23B 1UXWB 3UJIH 4HJJL 1JWMA 1BZ7B 4NO5B 5E99L 4QHLB 5E2UH 4XB8A 1QBLH 4CNIB 1QD0A 4EBQL 3WFCH 1Z0NA 3OZ9H 4OZIF 5HVFB 2FD6H 3CX5J 1CDYA 5IHZB 4U1KA 2DYPD 4K3JH 4JN1L 5KSUA 3F7QA 1A1MB 4Z77B 2FO4A 2DDQL 3CPLA 3UPRA 4MJIE 5FM5M 4HIXL 5I2IA 5C9JB 3PWUA 4OT1L 4QGYA 4YFEA 1F3JA 1MRCL 3QWRD 1T80A 4A6YH 1UH4A 4YC2C 1DQQA 3SKNA 2NXYD 1FNEA 1F4WL 4CJ1A 4JO1L 3VXTA 3VXUD 1KLFA 4Y0GA 4ZUSA 2GHWB 1RUPL 4NPYB 5ICYA 1VACA 1YMMA 1JWSA 2C1OA 4TUOA 1PG7L 4HW6A 4M03A 1SM3L 4RFEA 2DWEB 5DJYB 1RMFL 3DVFA 4HUUA 1MCRA 4ORGB 4YDVB 4Q9RH 5KVDH 2CXGA 2ED9A 3RBSA 4RAVB 1S9WB 4YHNA 4B7LA 3MXWH 1QLFA 2EDNA 2V5MA 4MB5A 2ICES 5E9DE 4NNYA 4C83A 4WU7A 5C0JB 1QR1B 2ICEB 5TQ0L 1FFPB 3N50A 3O4OB 5HYQB 2K1MA 3MR9A 3ARDC 1NLBL 1EBPA 3LIZL 2ZCKL 3MV9E 5I9QC 1B0RB 3EYOA 3AM8C 5GISH 4DOHB 3PWJB 5GJTH 2E27L 3EO0B 5D1ZD 3RWHA 4D0CA 5IBLC 1MVUB 4M8QA 4XMKL 4DVBA 3ARUA 4NO3A 5HD8C 3MLUL 4TVSa 1SJEA 3DECA 3EDEA 5EBMA 1GPOH 4ODHL 1XGYL 1TFHA 3NCYP 5ACLA 4Q6IC 4GH7B 4LF3B 3AS3A 4NQDB 2ZOLB 3JBG7 4C4KT 4HS6B 3S5LG 4JKPH 4K3DL 3MRKA 3OTTA 1T3FA 4J8RA 4O02H 2XZQL 4PRDB 4B0MM 3N1GC 3D25B 3N85H 1CFTB 5T1LD 1ORQA 4WW2B 2B2XL 2IANA 3ZE2F 1KCUL 5E4IA 1JPSH 3KPSE 3OGCB 4XPTH 5DHYB 2JE8A 3LKPA 3TIDA 5SX5H 3TP4A 1LHZA 4HS8L 5D93C 3EYFB 1H5BB 3BP5B 3QNZA 1A7OL 4NZTL 4AEHL 2UZXB 1X4XA 1BIIA 2Z91B 1MH5B 1TZIB 5GS0D 1WBZA 3CFBB 1KN4H 5D1XD 4Y1AD 3K74B 5DEFA 5K9KA 2BC4A 5C08E 5DEGB 4ZYKB 3B9EA 5B8CA 3EJYD 3LKNB 4PJFE 3QDJD 3V9FA 2CJUH 3U4EA 4XAWL 2W0KA 3FQUA 3HMXA 3WFBH 3HFMH 4P0DA 4OZGB 5EULV 1BZ9B 2L0DA 4ZXBA 1MSPA 4HSQA 4MA1B 5IIEB 4M02A 2F5BH 1TENA 5F9AC 3T0WA 2E7MA 1OSZB 2ATPB 4UTBH 1MREH 4K3EL 2D7TL 1I75A 4I5BB 4EVNA 1F4XL 3VMNA 4X4YA 2P8PA 5E9DA 2HLAB 4IDJH 3QAZC 1VDGA 5TPWL 5EWIH 1C7SA 4MNGE 2BP3A 3QXAA 2F15A 2BXYA 4PLKC 3QI9A 4FP8L 2OZ4L 3W9EA 1CIUA 1Z9MA 1MCSA 2GIYA 1XR9B 2FX8L 1BX2A 4XWOC 3MV9A 1ULVA 1CGYA 4ZFZA 2QADC 5DTFA 4YHLL 1NCAH 1VFUA 3DSNA 1RPQA 4TYUA 1OGAE 5DURB 3MZGB 4DKFH 2DQCH 4PTTA 4ZUVA 2VR5A 5E6ID 2EDWA 3C60B 4P3CL 1EO8L 5C0EB 3O6ML 4LSUH 4UILH 3TO4B 5L9DL 4EN3A 3V5KB 5B8CC 4P57B 2DQTH 4ONFH 3T8XB 4Q2ZB 1AD9B 4IIQB 1EVUA 4QOKD 4XPFH 4ZXBC 3EOTL 5C1MB 1RHFA 5EO0A 5I1LA 1ZT4B 3GSUA 3NOIA 1KT2B 4C54A 3IS1X 3SQOL 4XZUB 1WZKA 1U6AL 1BMGA 3RDTC 2BNRE 4PV9B 1AGEA 4HBCL 4PJEF 1N0XH 2VLJB 1UZ6F 2VISA 1BFSA 1DANT 4JQIL 5FHBH 4BFBD 4DGVL 1J8HD 2ZZUT 1TVHA 3VFTA 2OTUB 5I71C 3QI9C 4KROD 4WUKL 1ZV5A 5SWQB 2YKLH 3FT2A 4OFDA 2YA1A 3EOBA 2J8UE 5IMMA 4RISH 3AS1A 1NFDF 1KJ2H 1UJ3B 3MPCA 4PGEA 3PGDB 4KY1L 2HFGL 3JV6A 4C56B 3SDCD 4OD2A 1OAKH 2P24A 3O11B 4L3CB 3WMSA 5DRXA 4Y5YB 5FUCE 1P6FA 2Y36L 4CJ0A 3RUGF 3TV3L 3DGCR 4EN3C 4ERSL 5IFHH 5KANI 4ZTPL 4OF3A 1MJ8H 1AO7B 4R26H 2HLFC 3O8XB 4NKDB 2EXYD 2AJSH 3OJDB 5HGHA 2AK4D 1GGCH 2DQEL 1P4BL 4NCC2 4L9DA 2H41A 3VXSD 1QFPA 3H9ZA 5FYLD 4MNGA 3MBXH 4JHAL 4JEGB 2XN9D 2R0KH 2WWKO 3HAEB 2E5EA 2HMIC 1A3LL 5DD1H 1NBVL 5DI8B 5I18H 3U46A 2XRAL 1CGVA 4JG0H 3WIIL 2EDQA 2AEIT 1JWUB 1XF5B 3AMKA 1HH6A 2R1WB 3FONA 3PIQA 4XBGA 5JHDB 1AGBB 1FRGL 2ADJA 1ZSDB 5F96H 1E6JL 1GGIL 4RZCA 5ADOH 1W72H 4M5YL 5GS0H 3GMMB 1XIWD 1Q0YH 3O2VH 2X4PA 3KG5A 2V5SA 3G6DH 2GCYB 4OI7A 2VDQH 2NY4D 1MAJA 2H45A 3CZJA 2XWTA 1BZQK 3LQZB 4XVUD 1KJ3L 3HUJF 4K9EL 1EUUA 1CXFA 1MIEH 3G6JB 4LGSB 2IG2L 3CMGA 3WD5H 3BH8A 3AREA 3IF1B 3UPAA 2QKIB 5EZJA 4HMDA 3WFBL 4H0IA 4LCYA 2WIIA 4M1GL 3ZHKA 4ELKA 4OCRL 4EUPH 2BSTB 5E0QA 3RL1B 4W81A 2BMKA 3HE7D 2WBKA 5IKCB 3E1F1 3SDAB 4HMCA 3SGDI 3TBWA 1JZ5A 1IBGH 3MRRB 5I74B 1F97A 1GZQA 1IAIH 3HC3H 5I66A 4ZDHA 3D2UD 2XKUA 4Z0XB 1AJ7L 1B2WL 3FQXA 3VCLB 3AROA 3VI4E 2ID5A 5B3JF 2J8UA 1S7TA 3GI8L 4L5FL 2BNQE 1QPXA 1N4XH 2ZCLH 4KV5E 2H8PB 1T03H 2JJSA 5A2LH 2NZ9D 1D5BB 1UVQA 1DDHB 4W4OA 5I6XC 4MD5A 4A2LA 1UWGH 5DQJA 4RMUA 1A64A 3QFJE 4KQ3H 4KVCL 4LCUB 2DS4A 1JF1B 2H9GA 4HPOL 4ELMF 1KB9J 3UTZA 2AEQL 3SJVA 1R3JA 3F65A 3KR3L 4P23D 1BVKA 5CGTA 4ZPTB 4FQCH 3KYNA 4ZQKB 1JZ2A 5DVLA 3VGGA 1WEJL 4NRYA 4X6CE 4XC1H 1P2CB 4XNYH 3C2AH 1JZ7A 3AREC 3F58L 3BSZL 3HNVL 1B0WA 5K93A 3TWCL 3FTGA 1U8JB 3RWEA 2WK2A 1GC1C 4KHTH 1A7QH 4JFHE 1OPGH 1ES0B 1J0JA 4KJPC 1A6UH 8CGTA 5FA3A 1D5IL 5DJCB 3ARTA 3S35H 1C16A 4A2MA 3RNQA 4AIZA 4DW2L 1GHFH 1EX0A 1CFQB 2VDPL 3HA0A 3D9AL 1QEWB 3UJTH 4YWGL 3VFWA 4IMLB 4XWGH 1W0VB 2ZWLT 1F3DH 1JF6A 2NY5L 1NLDH 1V3MA 1R3KA 1FV1B 2WUBH 4LLYA 1A6AB 5BW7C 2A73B 2D7PA 4YBHA 5FUCC 3KPNB 3M45A 1A47A 3K1DA 4OB5L 2Y6SD 4RQQA 5IWLA 1KXTB 1MCWM 5INDB 3KNBB 4UINH 3LMJH 1CGWA 4MAYB 2J8OA 3FRPG 1S8DA 5IB4B 1FVDA 1N8ZB 3HZMB 5T1KA 2PXYA 4FQJH 5B39A 5DC9B 5FYLH 1I1AA 5SX4I 3I9GH 5J0BA 2F54B 2BSSA 2VXTL 3T0EA 4HJ0C 4FFYL 5CUSL 1YNLH 2BOBA 3U7YH 3MRLB 5E2WH 3VXPA 4QRRB 2BNQA 1NUGA 1BP3B 4PJFF 5B3NA 4V1DB 3OKEB 3TZVA 4HC1L 4HCRH 1CG9A 4CW1B 1YEFL 5GSRB 1I3UA 3T3ME 4HJJH 4JAMA 3G5XB 3P77A 5E99H 2YR3A 1K4DA 1JNHA 5FGSA 4EBQH 4NQDD 3VXME 3BKJL 4IHOB 3UTSB 3QIUB 1ERNA 1NANH 2E6PA 1CR9L 1UCTA 4X6CA 4WVRA 1MHHB 4ZS6C 2WUCL 1WFOA 4FOMA 3PL6A 5DD6B 3ZDXF 1CYGA 2VH5H 3UBXI 2EE6A 2DDQH 2BVQA 2EIEA 2XG4A 3WUWA 4LEOA 1ZHKB 4JHWL 2VLRA 4OT1H 4YX2L 1FVEB 2O26U 1MRCH 3BIAX 3GO1L 4K71C 4U3XA 4MA3B 3L7FB 5GRZA 4PS4L 2NNAA 1E4XL 4KKLD 4JO1H 1QA9A 2YXMA 3H3BC 4DKEH 3FT3B 1RUPH 3OGOE 5LWYL 2IH3A 2DKUA 5FO9A 1PG7H 5DFTA 5JW4N 1ZA6B 5C0IA 1SM3H 4HFUL 5K9OA 2NTFA 4S2SA 1S3KL 3MA7A 1MWAA 3LD8B 3VWJC 1HKFA 4L3EE 3BZDA 1FG2A 3FO2B 3CCHB 4WNQA 5DR5L 3ARGC 2V2XB 5CLTA 4D3CL 5F7UA 4JPWL 2G5BA 2UWEF 3LSOB 4TN9A 4BH7A 1ZOXA 2D7NA 3DYMA 3ALWA 5I1EL 3OXRB 1QBBA 5ANMB 1W0WB 1X5AA 1UADC 2CR3A 3UX9B 3PL6C 1FFOB 1NLBH 2C3XA 3LIZH 4OKVA 2ZCKH 1PG7X 2IALA 3V2AR 2AP2A 4F9LA 4C4KO 2FYYA 5CEYB 4JRYE 1KACB 4OZFB 2OQJA 5GGTA 4GJTB 4N68A 3I3EA 3NIFF 1JVKA 4LPYA 4R4NC 4X6EA 4X9GA 4QYOA 5DURD 2NYYC 3OKKA 1IM9B 4ODHH 3C60D 3R0NA 4X9BA 1UYWL 1EXUA 5EPMB 1XZ0A 1U8MB 3ALPA 3TO4D 5D6CA 3ZDYE 3SKOB 3H7LA 3WNLA 1PQZB 4IEFB 3FOLA 2X4SA 1KOAA 5IW6B 2XZQH 3H8NA 3OX8B 4NKOB 5L2JB 3MRJB 5BS0A 4PJ9A 3MROB 4R97B 2A74B 1HOCB 3L3DA 4NYLB 3NZHL 2B2XH 5EU6E 3ARFA 1DBJL 5INCB 1EFQA 2FR4A 3PWVB 3Q3GA 2AQ2A 1H3UA 3VRJB 1UWEL 1WVZA 4LU5H 4QY8B 3C8HA 2VLJD 3QULA 1FNAA 3TVMB 4WFGE 2XQYK 3MYZA 2RB8A 5T3ZE 4UBDC 2X4UB 1DP0A 2NW3B 3SO3B 4Y19E 1A7OH 4NZTH 1D6VL 4CMHC 4F9LC 3S96B 1NMBL 5CIPA 3GRWA 2R1XA 4HIHA 3QG7L 4YJZL 5ETUB 3VFPA 1Y0LA 1OVZA 3QUZA 3SGEI 4ODVL 5GGUA 4JPVL 1CDJA 4DUWA 1FAKT 4C56D 5KS9B 4CMMB 1RHHA 4L3EA 4QXTA 4MD4A 2D7TH 3GI9L 1F4XH 3C5JB 4YXLL 1AO7D 2D03H 4P2QA 1UGNA 2ATKA 3O8XD 4LLWA 3U4BL 1HDMB 3CLEL 3RAJL 4ZUTA 5JNYB 4FP8H 2OZ4H 3QP3A 2AV7B 2Z35A 2RQ8A 1F90L 5MHSE 4X6BA 3ARFC 1YUHB 2FX8H 3VE0B 5EIQA 1VEOA 2AGJH 1WWAX 3QXUA 4TVPE 4YHLH 2YPKB 4JRYA 3ULSA 3VI4F 5KG9B 5D72L 3NZ8A 3U7WH 5E8NA 3IXTA 4XPGL 1IC4L 3L3IB 4LVOC 2YUXA 5JHDD 1KENL 4S0TD 4F7EB 3BMWA 4P3CH 1EO8H 2YD8A 3AAZB 4NHUB 1KPRA 3FO9B 3O6MH 2HAZA 4YDKL 1FZJA 3QNYA 2XTJE 5L9DH 3QUZC 4NJ9H 1MCEA 5DZLA 4N90D 4GW1A 4G9DA 1CFVH 1FJ1A 5D7LB 2BVUA 3PWPE 3EOTH 2EKSA 3B6SA 2GSGB 3RNKA 5J6GA 4XVTH 3OSKA 4RWHA 5JLZB 3VD9A 4LPWA 4X6FA 4Q58C 1EEYA 3QZWB 4HBCH 5GS3A 3HHRB 5CGYC 5IR1A 5D9SA 5EU6A 4PJAA 4DGVH 1VSCA 3DX8A 4JM2C 3MRNB 4LPTA 2BY2A 2R0LL 3BW9A 4AEIH 1DEEB 4J23A 4MA8L 4WUKH 4MCZB 2XIDA 1JHLL 2VLLB 4UV7H 3SDAD 2NXZB 2X4OB 3QWOA 2MQ0A 4PJDB 1OAYL 1WWBX 4Y19A 1YEIL 1MJJB 3DVGA 3RVXC 5HI4C 3FQNB 2DWDA 5ALCL 4KY1H 1RJLA 5L7XL 3GJFK 1OSPL 2HFGH 4DEPC 1OTUC 3IB4A 4S1DD 4TSCL 4H25B 3IDNA 3QIBA 3RWCA 2V9RA 3UAJD 4HKJA 2CDGA 3NCEB 5A2KH 4ZTPH 4ZFGL 3VWKA 5CCKH 3HZYB 1URLA 3FO1B 2VERN 5D7IF 3OHXB 1HQRB 1P4BH 4MVBC 3QDGB 4PGBA 5KJRH 4G42B 1NAMA 4JHAH 2DKSA 1LP9B 2DI9A 4YHPA 3NA9H 5IK3B 1FNLA 5D1QA 1MLCA 4Z5RA 1A3LH 2G9HA 1NBVH 1SBSL 1TJIL 2XRAH 4FQXA 2GJZA 4PJXE 3O0RL 3OKNB 3WIIH 2M2DA 1H8OA 2EEBA 3DTXB 4HKXB 5D7JA 2MKLC 1G7HA 4FG6D 3THML 1E6JH 1GGIH 5AD0A 3OB0H 4N0UB 2DB8A 5IEHA 4M5YH 2NY6C 4JKLA 1E0OB 3MO1B 2WMPA 5GGRB 1QFUL 4HD9A 4MNHB 5CP7A 5EU5B 5L8LB 4HZAA 1ZE3C 1FFRA 3NN8A 4QXGL 1UA6L 1P7KB 4UV4H 5IJVA 2ZUVA 1V7ML 4K9EH 2X40A 1H3PL 3ARZA 1T4KB 4U4BA 2IG2H 4WJ5B 5FXCH 4IRJD 4QTHA 4LPUA 5ID0A 2ESVA 3JSSA 5CBEA 1RJYA 4JO3L 4M1GH 4P46D 3VWKC 4OCRH 3HG1A 4PP1C 5BJTB 2DIJA 3LN5A 5B4MD 1YEHH 1TQCC 4MAYD 3BD4A 1Q9OA 3TBVB 1LEIA 2VDLL 1A7BA 4WRLA 1U95B 3C5SA 1YNTA 4GAYA 5D1QC 1AJ7H 1B2WH 1OP3K 3IXAB 1NGZB 2F54D 3DHJA 3HAEH 4LVHC 4CU6A 2FEDD 1KGCE 3GI8H 4L5FH 3JV4A 5ESAB 4JFXB 4F2MA 3FQTB 2J6EL 3WV0A 5HHOE 4PP2B 4MQTB 5E4EB 1EEQA 2VXVL 3GNMH 4QRRD 2Z31A 5CZXD 2DIBA 3QEHB 3BP7A 4KMTL 4KVCH 2X4NB 4PRNA 4V1DD 4BFIA 5FV1L 4LP4A 1NCUA 1P7HL 4HPOH 1EJOL 3AY4C 2ZPKH 4HPYL 5IW1B 5JUEL 2AEQH 1K5NB 2XTJC 1F3DJ 3IRPX 5JXAL 1LDSA 2BNUA 3U0WH 1WEJH 3S88H 5FFLA 2YPVL 4JM2F 5I73B 1J1XL 1IC5L 3F58H 5F1NA 3UTSD 3FT4B 3QIUD 3WFHB 43CAA 4QRUB 5FCUL 5HGDB 3KLHD 1CBVL 4QEGA 2XWJA 1BLNB 1Y6NR 3NA4A 4ZO6A 5F1SA 4Z78B 1VFAA 1A2YB 3PHSA 1DANU 3ZTJH 1E28A 3CFEB 4U6XB 3CXHK 1A9BA 1KEGL 1NC4B 1D5IH 2OBGA 4ZSOA 4O58L 4KZEL 4DW2H 1FN4A 4QTIH 1YEKL 3PP3H 1T7VA 2WAHA 3MCKA 1CXEA 1U8QA 2BCKB 4YWGH 4FRWA 4KRMB 1N3NA 3U9UA 3BGMB 2NY5H 3ZKQD 2Z31C 4L8SB 3VDAA 4CVZB 5HYSB 4WW1A 3WHXB 1ONQA 3DX9B 1DQDL 2D7OA 2GK0A 4XNQB 8FABB 3QPXL 3UC0L 5F88B 2EE2A 1LNUA 1VEPA 1HCFX 4OB5H 2LAGB 2HVJA 1BWMA 3FRUA 1BD2B 4X8XA 2AAVA 3PG2A 2X70A 1KCSL 3OJMB 4G9FB 3L3GB 2ZUQB 4MDJA 3D69A 3P2TA 4QRTA 5KN5A 4QWWD 2Z92A 5LCVL 1TQBB 4YXHH 1DBMH 4Z7WF 4JANB 2VXTH 4OF7A 4PJGA 1KYOJ 3DMMB 5DRZA 2VJXA 4RBPH 5CUSH 2P7TA 5GIRB 4X4ME 5I8EB 1F11A 1PX3A 3L9RA 5I8CA 3UZEA 4LSRH 1ND0A 2BZDA 5HHOA 1V5JA 4MS8D 4OI9A 4PJ7B 4JDVB 1A6ZA 4HC1H 4WO4B 1K4CA 4Y4HC 1YEFH 4TQEL 2ZUYA 3V0AC 3ZTNL 5TDNB 1U92B 2PKDA 1JFQH 1IM9D 2J4WL 4OF8A 1F13A 1QOKA 1FLTX 2VSCA 5DMKB 5AG9A 3QJHB 2AERT 3S4SB 3BKJH 4I48B 4HWZA 5CSZA 1CR9H 3DWTA 3F7VB 1YDPA 1F58H 2WUCH 3GMRA 5CD5C 5LGHL 1EMTL 5IB5B 4NZRL 4JJ5B 1CLOL 5IHUH 1PY9A 1Q9KB 4JHWH 3NCMA 4FQPA 3P3YA 3GO1H 5K9JL 5DYOB 3MOQA 3TVMD 4HLJA 3MV7B 2GJ6A 3K0WA 4PS4H 4I0KA 2HFTA 1E4XH 3DSFH 5DK2B 1QKZL 3FOMA 12E8L 3A6BL 3FN3A 5EBWA 5ISZB 5JW3L 3K8MA 1M7IA 4NQSA 4QCIA 4Q0XH 5GHWL 5LWYH 2FGWH 1UKTA 2QTEA 2CLVB 3E0GA 3F7YB 4HFUH 3JTSA 2H26B 3W5MA 1S3KH 4YAQB 3SDDA 5EORL 3IDJA 3G5YB 5DJAB 5DRWB 1EIBA 5FDWB 1SY6H 3UTTB 2WBJB 4PJHE 4O4YH 4QXWA 1NPUA 2GYSA 2OMBA 2CK0H 3L6FA 4JPWH 4JRXB 4L4VE 2NX5B 3WJJA 2V6HA 2WWMC 1JUFB 1Q0XL 3NMEA 5T1DL 3P40A 5I1EH 1WBXB 2ZOKA 3VFSB 1MUJB 4BFGA 4HWUA 3PWNA 5IMOA 4O2FB 5B39G 3ARVA 3NAAL 2P8LB 1K2DA 4P59L 1QSEB 1K8IA 4PJIB 1HE7A 1KN2H 2FHFA 2VLKA 1MJ7L 3I6KA 3S37L 1BVLA 3UTQB 1A0QH 3QCVH 5J4MA 4N9GB 2V17L 4X4MA 4CVUA 3QO1A 5DJ6A 3LB6C 3QUXC 2EECA 1HK6A 1CCZA 5HPOA 5HHVH 1WITA 2A1WL 3AC0A 3NVQA 5IEKB 4GG8B 3DXAB 1UYWH 5T1MB 3ZO0A 3O3AB 4HKBB 4X9HA 3KPMA 4RGOL 2R69H 1UM4L 4BSWB 4Z0BH 1CK0H 5D7LD 3QDAA 4YNYB 2B8OT 1Q1JH 1I4FB 2YA0A 1DLFL 5GGQL 1QRND 1TTGA 3GMLB 1CXKA 4YEEA 3O6LL 1IFHH 1FL6A 4G8FA 3WUWG 3GMQB 4OCSH 5LVEA 1KG0A 1INQB 1KLGB 2NPLX 4PJXF 3T77A 5L2KB 4P5MB 1S7QA 4PY8I 2H3NB 2FLBT 2NXYC 4JFDB 2WLZA 4ZOAA 1D6VH 4U6HB 4EIGB 3IVKB 1NMBH 1R3IL 2NXZD 3HPJA 3QG7H 3LQMA 2DM7A 3F5WB 4O51B 2XQBH 4QOKE 4OZFH 4PGDB 5A2IH 2J2ZA 4O2EB 3EYSL 4POUB 3REWB 3RZCA 2AJ3A 3UJJL 5HYJB 4KI5D 3LH2L 4KDVA 4MX7A 1KTDB 2PTVA 3EDJA 1J8HE 1FORL 4GMSH 2ILLA 1FFNB 2CKBL 4YXLH 3WDJA 4L4VA 3G04A 3L5WB 4KU1A 4R6UA 3U4BH 3CLEH 3RAJH 5C2BL 5DRNA 3QDGD 1B0GA 4P5KB 4OFYD 4PJ8A 4LRIA 1Z6JT 4ZUUA 1J1PH 3CDCA 5D72H 1NL0L 1L9NA 1MY7A 1T22A 2DQUL 2AEPL 4XPGH 1IZKA 4RWYL 1EEUA 1IC4H 2HVKA 3JWNC 4OD1L 3SCMB 3U0PA 1IE5A 3QIWA 3P4LA 2FL5A 2VDKL 1IGYA 2YA2A 1BFOB 1KENH 2HTKC 3BI9X 5GS1C 1CE1L 3TGXA 1QSFA 3DYOA 3HZKA 4YUEL 4LL9A 4HV8A 3OAUL 4TSBL 2RIKA 1IKFL 5C0CB 4I18A 3U6RA 3KPPB 4PRBB 3WNNA 1R3LB 2X1XR 4GRLA 1HSAB 3CFKB 4LMQI 2EDFA 1BBDL 1DN0A 1ZGLA 5DHVB 3SDXA 3TA3B 5FOJA 2QQNL 1TETL 3CZFB 5TE6L 4ONHB 4RGNB 4ODUA 4UIKL 4MD0A 5C92A 1M6OB 3BGAA 2EZ0D 4Z7OE 4P2RE 5DGQA 2VITB 3Q1SL 3ZE0E 2R0LH 1EHLL 4KH2A 4LAQL 1A9EA 1I3GH 2EKJA 5GS0C 2HJLB 5D71H 5GJSH 5I1DA 4HHAB 5D1XC 1OAYH 1YEIH 5I8OL 5C2UB 1FL5A 3VFRB 3EJYC 4X8JB 1QO3A 2IH1B 4BKLB 5ALCH 1JL8A 2Y1VA 4LEXL 1CDGA 1OSPH 2ERJB 5LGJB 2EDDA 4NRXB 1FIGL 4QOKA 4GKSB 5KSVB 1NQBA 4QRQA 3CDGB 4LKCA 2XKSA 2OTPA 1AH1A 4Q74A 3FN0L 1OAQL 4F37F 4YXKL 4HLZG 4ZFGH 4UIMB 4M62L 3SEPA 4KK8D 4TSAL 1RQ5A 1ZT1A 4L4TE 2VRAA 3P9LB 4F58L 3BISA 3VXOB 1XGTA 2ITCA 3BEWA 3EIFA 2JCCF 3BIKA 4P2YA 3CUPB 1TJIH 2VC2H 3NGBB 3R8QA 3NCYS 3O0RH 1UH3A 3O4LB 4N5UA 4Y5VA 4U6VH 5E6IC 5AWNL 5HGAB 5EC1B 5FCSH 3THMH 3FCTB 1NC4D 1IAKB 1AE6H 4MXVE 1G1YA 3MGOA 3I02B 4DK3A 1QFUH 4YHML 1S7UB 2Q3AA 2AXGB 4M1DL 2HG5B 4K55A 3V6BR 4QXGH 5FF6B 1UA6H 1ZT7B 4N8VA 4JFQB 4ISVA 4UUJB 5GPRA 1V7MH 1X7QA 3T2PA 1H3PH 2ZSWA 3IDIA 1U8OB 3MRGB 3BIBX 4U1MB 4F8TA 2HT2D 3VJ6B 3ZE1F 2QLVB 4NRZB 5F9OL 1UM5H 1TITA 4FN0A 3OF6A 4X7TB 3BUYA 3MNWA 1KCLA 1FL3A 1Z9LA 3CFCL 1BD2D 3QT2A 4XCNB 1JHKL 4P2RA 2BSRB 5FV2A 1M05B 2AI0L 4KJYB 1LWRA 2VDLH 4XCEA 2H32B 4OZHB 3DOSA 4BELD 1FNSL 1N2RB 1G7IA 1ZANL 4CVXA 3RY6C 3NPSB 4EKXA 4EIZC 4LLVB 3SDCC 1PKOA 2J6EH 5EU3A 1MFNA 4PJ5B 2VXVH 1T7ZA 2GY7B 1BAFL 4KMTH 3QQ3A 4XP6L 5KZCB 3DRTA 2X7LA 2YRLA 1I9EA 5J89A 35C8L 1FVCA 3ZKSD 1II4E 5BOPA 4LBEB 3T0BA 5CS7A 3WDIA 2Z4QA 4WO4D 1U3HB 5JUEH 5FYKL 1U8LA 4FXKA 3V8OA 2EXYC 4PJHF 3L7EB 1QYGL 2C1PA 4NN6B 1HXYA 3IJYA 2YPVH 5EFIB 3F6IA 1J1XH 1N0LA 2OTWA 4WUUB 1G9ML 4L4TA 3LRSB 1NDMA 3CK0L 5JXED 2A6IA 1FPTL 3O3DB 1CBVH 1G7JB 3T04D 3ARBB 1N26A 4JFEA 4U1JB 5LGKA 4DOHE 3SDYL 2Y23A 1F6AB 1OT1A 1BQHB 2C4FT 3U4AA 4X6DF 3WS6C 2MKWA 4TOYL 2H2SD 2VN7A 1JPGA 1C5BL 2Y4SA 5E1HB 4AT6B 1JGVL 4IOIA 5A3ID 1XIWC 3MV7D 4KZEH 4O58H 5D96B 1YEKH 4MSWA 2P8MA 3TIEB 4CU8A 1JPTL 1MFBH 3VXQA 1G84A 4H1LA 4MNQB 5E7FA 5C6TH 5ISZD 4PJCA 4NQDE 5IW3A 2OJEA 5C07B 3IFOA 4WCYL 3C9NB 1RURH 3C08H 1LO0L 1IGFH 1S7VB 5TH2B 1K3IA 2DQHL 1J88A 4LCIL 1X5HA 1DQDH 2XKNB 4H26B 4QHKI 3QPXH 4Z7NF 3UC0H 4G8GE 5E08L 3SPVA 4F7CB 3UTTD 1WQVT 2WBJD 4YBLC 5JA9A 1Q8MA 2JIXD 3BO8A 1U58A 3MRIB 1OGTA 4JRXD 4XPBL 3EHBD 4WI3A 2NX5D 5EUOA 4EXKA 3MREA 3BQUA 2VIRB 1F3RB 1VGKA 1KCSH 1H0DB 3C6LB 4N8CH 5SX5K 5TDOB 1EUTA 4IJ3B 4YQXL 4F7TB 3Q0HA 3JXAA 5EIIA 4L9LC 5IB3B 3UTPD 4WI9A 5EZLA 4ZUWA 3V4UL 2Q7YA 5F7NC 1QSED 3FZUC 1S7RB 2HRPH 4D9LL 3PDOA 4K7PY 5CJXC 2NZ9C 3MLTB 2Q3ZA 3JTTB 3DV4B 3VFUA 1T0MA 4K8RL 2D0FA 4HFWA 4BQ9A 3MLYL 1JN6B 1MQKL 4JM4L 2BVYA 4U1LA 2GEEA 3X17A 3DPBA 4P23C 4TQEH 3X14A 5ERWB 3DXAD 1I9JL 2J4WH 1LE5B 2BVPB 2HH0L 1P4LB 3HNSL 3B3IB 3IDMB 2A9NH 2HFEA 1VKXB 4K3GA 3V5HB 4JKMA 3QA3A 3WE6B 3E6HA 1CFSB 2XFXA 15C8L 1KCVH 5LGHH 4HWBL 3N0PB 1EMTH 2VLMD 1YECL 5D2NA 2HT4D 2Q76B 4NZRH 1OF2B 3FB5A 3ILQD 3OPZL 4UT9L 3H0TB 2OL3B 5K9JH 4RGMB 1U2CA 4TNWF 2V9TA 3V0WH 5L2KD 4JY4A 4OBRA 4JFDD 1D5ZB 2D9QB 1QKZH 1JZ8A 3MLZH 12E8H 2CIIB 2X4QA 4WTZA 4HAFA 3D5OF 4K3HA 5GHWH 1AR1D 1HHGB 1CFBA 3EDDA 5JPMA 2DTML 1XF4B 2RCSH 4G6ML 4GLRI 2IQ9L 3KDMB 3REVB 3X13A 1SEBA 4F7MA 3HC4H 3GJFB 5GGSA 3KLAA 1KJMA 4J4PD 4RX4A 3MXVL 3NPZB 5AAWA 3QPQD 1SEQL 3BKML 1UKSA 3D85A 3ARYA 3HS0A 4G8GA 3PGCA 4U1IA 1Q0XH 3PXJA 2BOCB 5D5MB 3UBXA 2DJUA 3AXLB 3MGTB 3KPOB 3WFZA 5C8JB 1KULA 1G6RL 3MRHA 1QQDB 3DURB 4MB4A 1PKQA 2MNUA 1JZ3A 4P59H 3MRBB 3MRFB 3SGJA 4JDZB 1HQ4A 3MNVB 3WIFA 3OKLB 2GY5A 5SV4A 4C56E 3RWFB 2V17H 4H5SB 5H35A 2OL3L 4AEEA 4P49A 4JO2H 1OQXA 3SGDH 3MRPB 3SCMD 5DA0B 3IKCA 2NY0C 1GVIA 2R1YB 1CL7I 5IGXL 1AO7E 4Q9CA 3J7HA 3JVGA 4LSPL 4RGOH 3MOBL 2AV1A 4KQ4H 1JZ6A 1VESA 5C0CD 4DKDC 3GSOA 2HN7A 1YMHB 5L0QB 5CJQL 5C3TA 2FIKB 2FDBP 4WFFE 2B7DT 4ENED 5H2BA 3QEGH 2LE9A 1RJZB 4MAUL 5GGQH 4Z76B 5HHPA 3RFZC 3S37X 1U93A 3LCYA 2K7QA 4KKCC 1I7UB 3O6LH 4RGND 4HUVA 3RP1A 4P3DB 4YHYB 4GAJL 3I6GB 1X5FA 4PTUB 3TNNA 2YBRB 4KKLC 5DQ9B 1H5BC 3VDCA 2Y5TB 5BQ7A 4QT5B 2PYFA 2X5PA 3HKFA 3SGJC 1T20A 1R3IH 4LDEB 4N90E 4M43L 3E2HB 1OY3B 4MXVF 5BV7B 1G7QA 1CF8L 1J0IA 1E4KC 1MQ8A 4KJWC 1NJ9B 4GAGL 3PNWA 2AABL 4RFOH 5GZNC 5LXGL 4WV1B 4JFFB 5EO9A 1OWRM 3OAYK 2Z93B 3UJJH 1ZMYA 5BOZG 3W39A 1YN6B 3LH2H 5CSGA 1SJVA 3FB8A 3HLAB 4GKZB 1FORH 1RV6X 5JOPD 4OIIL 3IFPA 1NC2B 3GMNB 3TH2T 2PW2B 3I6LD 3EYQD 1KCKA 4K23H 1WBYB 5E5MB 5DC4B 3QYCA 4HK0A 4EDXB 2G2RA 5C2BH 2W65B 4DCQA 1AD0A 5GRXG 4NQCB 4PRHE 5F93C 2R0WL 4NO0A 4QRPE 3T2QA 4E5XB 1WIOA 2BXZA 1ZEAL 5J11B 5CZVH 4M1CC 4JREB 4KGLA 2VQ1A 1FO0B 4RRPA 3IKKA 1W2KT 4QHMB 1VCAA 3MBEA 4YFLF 4GW4B 1DSFH 2DQUH 3TJEL 1KNOB 4RWYH 3VRIB 2CLRA 4GXUM 3D0LB 1F2QA 5SX4H 1CE1H 4GMTL 1MI5E 4K7PL 3TO4C 3HR5B 1NCDL 2B1AH 4GW5A 5ICZB 5FYKD 4YUEH 3OAUH 4TSBH 1LO5A 1IKFH 3LEYL 2VAAB 1NGYB 3I75B 3MRCA 2BSED 4MJ5B 1B88A 5AAMA 5FK9A 5E8EB 1A1NB 1BBDH 2XA8H 3N1FC 4OUOA 2QQNH 1M4KA 2ADIA 1TETH 4YPJA 4UIKH 3CFIC 3BPNB 3CU1A 3LKSB 5I0ZA 2X1OA 3Q1SH 1TCRA 5KBNC 1IGJB 4LAQH 4FXLA 1J11A 3DYPA 2F5AL 4R7NB 1KPUA 4U1NB 3MJ9L 2IFGA 1CDBA 4FZ8L 5IVZB 3KJ4B 4AJ0A 1UJ3C 1HHIB 5MERB 5I8OH 4JO4L 3ULVL 4N9OB 3RWIA 2B5IB 3NFNB 4HWEL 4LEXH 3WKNA 3MBEC 4K9EC 3H42L 5J9PA 1U8NA 2LV4A 4TNWK 4PJ5D 3O3EB 4Y5YC 1C8PA 3FN0H 1OAQH 5F9JA 5I0DA 4JN2B 3VU2A 5JW4Q 5EA0L 4YXKH 1LO4L 1CLYL 4IRZH 2QKIA 4JFYB 3RGVA 5CWSB 4WW2F 4HULB 1U3HD 1NEZA 4M62H 4WHTB 4PPTA 3X12B 1WLHA 4R8WH 4Y2DA 4ZFFB 5K59E 4TSAH 4LPXA 4LSDA 3MJGX 3WJLA 4H20L 1R5VA 4F58H 5FYKU 4BZYA 4LSVH 4X5WB 2F54E 3RIFK 3TYGL 1AHWA 4WUUD 1G7PB 4O9HL 5F7MC 3SBWC 4X7SL 5DHVH 2UYLB 4PRHA 3P4NB 5LAXB 4RCAA 4QRPA 1FC2D 4GSDL 3ARBD 2XOTA 1A3RL 1T21B 5B22A 3T4AB 4BUHA 4QRRE 1OLLA 4PGCB 3S5LB 3KJ6L 2R2HB 5F21B 4XTRD 3GMOA 3WEXA 2W9LA 4K8RD 2XNAA 3H9YA 4GUPA 5ACZA 4OZGF 3FQWB 5E56A 5IBTL 2NW2A 5IOPB 4N5EC 1T1YB 1VHPA 1MI5A 4PRAB 2CO6B 4M1DH 4MNQD 3BDYL 1HHJB 5C07D 3CVIL 4H8WL 1IEAB 4I4WA 2O61A 3CH1B 5H37H 1DLHB 2EDBA 1MFEL 2P5WA 4MZ3A 2ZCHH 3VA2C 5F9OH 3FHQA 4NFDA 1T2XA 2CIKA 5F3HA 1HYRC 5C7XL 3BGFC 1E27A 1Q9WA 4UB0L 4Y2DC 4ZPVA 4RIRB 4HX1A 3WJLC 5DUPL 2JB6A 2UUDH 5I16B 1JHKH 1JGUL 3U2SA 2AI0H 3CSGA 1ES0A 4OQTL 2ADGB 3C6LD 2R4SL 1FNSH 4DZ8A 1HZHH 1UZ8B 4M6NL 1AP2A 2FSEB 4K2UH 2EDRA 2OSLB 1LEGA 4R0LA 5DMGD 5SWZA 3I85A 2BRQA 2DMBA 2I26N 4HUWA 4U1HA 4Z7QF 1BF2A 1AQDA 1NCBL 2NY5C 4PLOB 1T1WB 2CRYA 1PD6A 1CDUA 1IKNC 5F7DB 3UAJC 5T3XL 2ZG2A 4UQ2A 4XPHH 3C6SA 4XP6H 4IRJA 35C8H 3V6ZA 4OLXL 4P46A 3MJ7B 4NBYB 1M7DB 4YFDB 3IETA 1ZHNA 3DGGA 3VXNB 1MHEB 5FYKH 3FB6A 3RTQA 3TJHC 1LEKA 2VDML 3HPLB 4UOW1 1QYGH 1FGNL 3CFJA 2X4TA 5ANME 1VADB 2X4RB 3STZB 1MHCA 1LDPL 1PSKL 1XF2B 1G9MH 3CK0H 2NY1B 1QSVA 4HUXA 1F4AA 1LILA 1ZS8A 4RAUA 1QBAA 4NP4H 2CDEB 3KYAA 1A6TB 3RWDA 5C0DB 5TE7L 3ARPA 4FG6C 3TFKD 1HSBA 1C5BH 5I17B 1R3HB 1JGVH 3T0XA 1DBBH 3ZSSA 3DV6B 4ZTOL 1H15A 5JZ7C 2H32H 1T89A 2MSPA 1VA9A 4OFVA 4DAGL 1J87A 5F7EH 3OBAA 3AB0B 5HI5D 4DVRH 2JK5B 3DX7A 5IF0A 1N6UA 1INDL 5IVXB 4IRJC 4N8VG 4LCIH 5KANG 1PGRB 3GUTA 4P46C 1INEH 3RIAK 2BK8A 1D3CA 3O9WB 5B4MC 2VUOA 2DMCA 2CXKA 2QQKL 3DROA 3ROLB 1GL4B 2R9HC 4MAYC 3W0WB 4XPBH 2HFFB 1P5VA 2E7HA 3D3VE 2HTLD 1T1XA 2YC1B 3EOAA 4PYHA 4MA3A 1XR8A 4J3OC 1DE4B 3QUYB 5C0BB 4YQXH 2BHZA 3V7AE 1G7MB 1UFUA 3ZT5A 3SKJL 2FEDC 2W07A 3V4UH 2IQAB 1CD1B 4NUGH 4D9LH 1GZPB 4Y5XB 2PCPB 3GGWA 5CZXC 4K8RH 4NNXA 3MLYH 3V0VB 2DI8A 5MEOB 5KS9E 3G6JF 4J1UA 1R24B 4NDMA 2F74A 5C0AE 4G6JL 5ID1B 3B4NA 2A0LD 5BZDB 4Y88A 1NEUA 4Z7WB 4F9PC 3VG0L 4Z7VB 1GRWA 1AGDA 1RUQL 1KFAL 5JOFA 4PJBB 5FGCB 3LS5L 1A21A 3QIUC 3PV6B 3IFNH 2CRIA 3UMTA 1NKRA 3KLHC 2G75B 2J5LB 4YBQD 4G6AC 15C8H 4HWBH 3TNMA 2JB5L 1A4JB 1YECH 1RUML 3HCVA 2HKFL 3OPZH 4PRPA 4UT9H 3MX0A 3DVNB 4V2CB 3CSBA 5HHME 3ZHDA 4JZOB 1M1SA 3WO4B 3O2WL 4YHOL 4LLDB 1TDQA 3I3BA 1BFVL 3L1OL 4F33B 4XAKD 1IEBA 1N6QH 2B4CH 3C5ZA 5L6YL 3B9KA 3S34H 1JPST 3EUUA 4M7ZC 1MRFL 5F89B 4H1LG 3HTLX 2IQ9H 2FJHA 3SKUD 1N7MH 2Y9RT 5DJDB 3O3BB 4EZMA 1I8KA 2EH8L 5F6IB 1I85A 1ZTXH 5C86A 3DO7B 3GIVB 2COQA 4OLVL 4YR6B 1QRNE 3MXVH 2FBJL 3PWLB 1SEQH 2A6DA 3BKMH 2VNCA 4D0BB 2V7NB 3BAEH 1SMAA 3QJFB 3Q6FA 3LPFA 3WIHL 1FHGA 5J1AA 3VI3E 1EAPA 1I1YB 3ZKND 1XF3B 1Q94B 1U91A 2CK2A 4QWWC 3UXFA 4D0DA 5KTEH 3D3VA 2PTTA 3EYVA 4KXZI 5ABDE 5F71A 2FZ3A 1BVZA 4O2CA 3KPLB 4JFPA 4YIQB 4NQCD 2VDRL 2GITB 3ULVD 2BVEA 2FO1A 4LCWD 3M1BB 2C4FU 3KYMA 1A8JH 4KI5E 4MS8C 2OL3H 4JR9L 4QHUA 5DJ2B 5CEXA 4EI6B 2EDOA 4BQBA 2EYSB 4MCYB 1ED3B 7FABL 1QFWI 1FGVL 3B9KC 4LSTL 1V3LA 3P4MB 5IGXH 3Q6GL 1T1ZA 5C0AA 5FDYA 3MV01 1WISA 1PEZA 5CD3A 4LSPH 4GRWB 1YQ2A 3RX8A 1MHPL 5FA4B 3FFCE 1V7NL 3GJEB 2IF7A 4DFIA 5BVJA 4RFNC 5E8OB 1I85C 3QDGE 5T5NG 2DICA 2PN5A 3GJFH 5CJQH 3WNKA 1LP9E 4R97C 4JKKA 4YK4C 1OTTD 5HGGS 4MAUH 3STBA 2Y7QB 4FQIH 5AZ2H 1MCIA 2YSSA 2Q8AH 5EUKA 2CGRL 2YK1H 1OTSD 4AL8L 1NSNL 4LARH 5MENA 1W8NA 2HJKB 2VL5A 4GAJH 1DJSA 3I3DA 3T4YB 1OB1B 1WTLA 3OXSB 1S5HB 4M6ML 5BZWB 1YY8B 3SO3C 4G7YL 4YDLB 3IU3A 3NIGE 5KSBA 3OB0K 1GCFA 3U36A 4JPIA 1KUMA 4U05A 5I8KL 1V8HA 4FTVE 1CF8H 1UQSB 4WTZG 5DD5L 1XGRA 2PO6A 3KPQA 1J0YA 2ZSVB 1MFCH 4GAGH 2C7UA 2AABH 2ZG1A 1IVLA 4HMEA 4PG9B 4F7PA 1FFQA 1Q9LB 3IGAB 3WN5B 2ORBH 4X5XB 1B90A 4GG6A 2YMXL 1YEDA 5AG8A 3IJHA 4IOFD 4ONOA 1S7XB 5E2JA 2Q87A 3Q5YA 1QRNA 1R5IB 3VD4A 1I7TA 3VG9B 2KQNA 4OIIH 4PY7B 2X42A 4X0KB 5D8JL 4HXBL 5CEZE 3KWWB 3UBXG 5FYJH 5DJ0B 4ZNEA 1JCKA 2R0WH 5DZNA 3HRZA 1ZHBB 5KW9L 1ZEAH 3FB7B 4IS6A 2FD6L 2LFGA 1YEEL 4WFHE 2ITDB 3TJEH 2MCG1 1I9RH 4YHKH 5EZIL 3MJ8A 3QNXB 2LU3A 3NFSL 3L3HA 4XHQA 5CMAB 1ZHLB 1TJHH 5FO7B 5DS8A 4GMTH 2VZ1A 4K7PH 4I3SL 4A6YL 5KSAA 5I76A 2IWGA 2XXMB 3T65B 5BV7H 3LKRB 4TNVF 1OP3H 2CUMA 4ZFOA 4E0RB 3EYUL 3BEVB 3FFCA 2SEBA 4OUUA 4HS3B 1I8MA 3IDXH 3VD7A 1CFNB 1A6VL 4HIJA 5I1JH 1PBYA 1ITBB 1BIHA 1HILA 4I8DA 3LN4B 2HJFA 4GFTB 6CGTA 4NZUL 1TNMA 5KVDL 2OK0L 3ZKXB 4R96B 2Q86B 43C9B 3MXWL 5I1AA 3HE6A 2OJZL 4JE4B 4K7PX 3BZ4B 3W82A 2F5AH 4Z7UB 2NXZC 2QR0A 2IPKB 3MJ9H 4MDIA 4FZ8H 1X5XA 1MPAL 3OKMA 3PP3K 5MEPB 3ULVH 4HWEH 1Z2KA 5B21A 3QEUB 3PUCA 5HHQB 3N1QC 1FO0H 3H9SE 1JTPA 3UPCA 4FTVA 1QPPA 2I25N 5JTWA 1QNZL 5J13B 4KI5C 2A6JB 3H42H 2F8VA 4XGZB 3V6FB 4OCNC 5ACMA 4DUXA 4JDTL 5GJTL 2AJZA 4IRSB 4WHDA 4DGYL 5CILH 1AXSA 4G8IB 5EA0H 2PW1B 4Y89A 5D2LB 3T3PF 3AGVA 2DLHA 1C08A 2CUHA 2YS4A 2DRUA 2EO1A 5DSCA 2MPAL 1DQJA 4H20H 1I3VA 1P7QA 2FJFA 5HBBA 1T6VN 3U9PL 4OZ4A 1S9XA 3EFFA 4PRIE 3TYGH 3BD3A 5CLWA 1AGFA 4O9HH 3KPRB 4X7SH 4NO2A 2NY1D 1JGDA 1T83C 4JKPL 1MCKA 1JWMB 1PYWA 4OGXL 1A3RH 4RBPK 4P9ML 3KJ6H 4Y4FA 1IMHC 4RRPG 4OKDA 3HE6C 1S9YA 4PJ7E 4HIIA 4HF5L 2B1HH 1FZOA 3O2DL 4XPTL 5IBTH 5KS9F 2UZYB 4U1KB 5EOTA 5KSUB 2FO4B 5C70A 3CPLB 3LOWA 5IW1A 4CDGC 1K5NA 5I9QB 1U8KA 3UPRB 5E8PA 3NTCH 1ZGLP 3BDYH 3PWUB 1F3JB 3VMOA 4KPHL 2M26A 5F3BA 1SHMA 2NLJA 5CHNA 5C0FA 1DQQB 3HI1A 1MFEH 3TCLA 4PGZA 3SKNB