5C2VB

Kuenenia stuttgartiensis hydrazine synthase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
352
structure length
352
Chain Sequence
GYIQGTHVKTDLPGPFHITMSPDGSTLFISNQSGHSVTFVDARTQKVTGEVAVRVQPEASAVTPDGAFLYVCNAESDSVSVVDIQRKQEIKEIKVGDWPSGIKISPDGKTAYVACSGCMWNAIDVIDTGRMEKVRSIYTSDYGPRMVEISPDGKTLVAILDTVGSINRSVDFIDIASGRVVENRVIHESSNLRDVVYTPDGKYIAVTHQTPKNWLPVCEAENGQVFTNNVTIIETKAGGKVARLPLDDLNNYDGNPYGMAMDPKGKYLYIGVRGMHRVTILDMDKVLGLVRSSTQEELDYLRDDLGLVRDYLVARVPTGLGPSSVCLSPDGKFCYAANYFSNNVTVIRTAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDRAZINE SYNTHASE ALPHA SUBUNIT
publication title The inner workings of the hydrazine synthase multiprotein complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 352
sequence length 352
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02239 Cytochrom_D1 Cytochrome D1 heme domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5c2vB00
3RN0D 4FAVD 3DXMC 2MTAH 3EI3A 3OTTA 4H5JA 3MKSB 3C5MA 4PSWB 4X61B 3BWSA 3MKQA 2PM9A 5IJ7E 3PSLA 4KFMB 3SN6B 2OVRB 4PC0A 2CE9A 3AH8B 4TZ4A 2GC7A 5FKSA 2QXVA 3K26A 3CFVA 4QRJA 5GSAA 4EWRA 3IIYA 5EALA 3I2NA 3V7DB 4BL0A 4ES0A 2Q7QA 3UKUC 3OL2A 5EMMB 2AGYA 1GOTB 4ERZA 3N0EA 3A0FA 1NEXB 3UVLA 5FKTA 4FA1D 4N14A 1FWXA 4OWRA 4GM9A 4LGNA 2I0TA 2B5LA 1SQ9A 5SXMA 3EG6A 2IUQA 1TYQC 5A2Qg 3N0DA 4QQEA 4YVDA 3MZKA 2BBKH 1MDAH 3GREA 4FWWA 4J86A 1JOFA 5GMKn 4E54A 1N6FA 4PNKB 3E0CA 3PXTD 3RLMD 4UI9R 4ESGA 3PVUB 5EARA 2G9AA 3KRXB 3V5WB 4CZVA 2IURA 1U2VC 4CY2A 3JB9L 3C75H 2PBIB 4FA4D 3EMHA 3BG0A 4ZN4A 3EI1B 4NSXA 4XYIA 3JZNA 3UR4A 2AQ5A 5B4WA 2HKMA 3C99A 4HDJA 5IC7A 2H6NA 5CXCB 4BUJC 2CO0A 4JSPC 4A09A 3IIWA 4O1QD 1B9YA 4A0BB 4CY5A 3SBPA 5EMKB 5TDHB 1U4CA 1N6EA 4ZOZA 4L1QD 2H13A 2CO0C 1TBGA 4JD2C 2H68A 3SMRA 3SCYA 1P22A 4U7AA 4FA5D 2BCJB 4GQBB 2H9NA 2IWFA 5CXCA 5CXBA 2AGLA 2I3TA 2XU7A 2J55H 4A2LA 2P9KC 4GGDA 3MZLA 4J87A 4FA9D 3I89A 5AFU3 4A11A 5IGQA 2TRCB 2YMUA 3DWLC 3JRPA 3SFZA 4U1EI 5TEFA 3EWEA 5IGOA 3DM0A 5THAA 1XHMA 2GC4A 4PSXB 3EI2B 4A2MA 2W18A 3JZGA 5AMSA 4CI1A 4O3UB 3J81g 3IJ1A 2YB8B 3UVMA 4GGCA 2O9KA 5KDOB 2OK6A 2J57G 4IA9A 2B4EA 3RFGA 3NVNA 2H14A 2YNNA 1K32A 3RN1D 3V9FA 1GP2B 3PXWD 3RMZD 1MG2A 4CI2A 2B5NA 3VH0A 3UKRC 5JWZA 4J82A 4J0XA 4XEIC 5H17A 1ERJA 4L3HD 3B7FA 5FKRA 4D0KA 4H5IA 3I7OA 2AGWA 4D6VA 2YBAA 2OVQB 4AOWA 2XYIA 5I5JA 1K8KC 3I7NA 3PVWB 1PBYB 4FB1D 1L0QA 3SBQA 4X3EA 3OKYB 4R7AB 3SWSD 4A7JA 4MK0B 4A08B 1Q47A 1PGUA 5AJAA 2P9NC 3F3PA 4L9OA 3CFSB 5TF2A 3NVQA 4ZOYA 3PXSD 4LG8A 4JT6C 4Z8LA 3MXXA 4IMMA 2UZXB 3SXTD 5HE3B 3IKOA 5EAMA 3ODTA 5H14A 1B9XA 3F3FA 2XL2A 4ERYA 4J73A 5TEEA 3J80g 2GNQA 2OIZA 5I5MA 3JAMg 2CN3A 3ORVD 3ZWLB 2H6KA 4A08A 4AEZA 5FLXg 4XYHA 4E5ZB 3AL8B 3JZHA 3EI1A 5EM2B 4LG9A 1GG2B 1XIPA 2H9PA 2OVPB 5CYKB 2HESX 2AGZA 2UZYB 3UVNA 3FM0A 1PEVA 5FQDA 5FA5B 5H1MA 1GXRA 4J84A 3I7KA 4K3JB 4O45A 3EI3B 2I3SA 3AFCA 4A0BA 3NVXA 4FAND 2PM9B 1XKSA 3I7LA 5FKQA 2PM7B 3IJ0A 3L4OD 4J8BA 4E5ZA 5HE1B 3GFCA 5EM2A 3I8CA 2CN2A 4QL1A 2IWKA 2H9LA 4J8GA 1PI6A 3SBRA 2OK4A 3OL2B 5EAPA 5GXIA 3W15A 3DXKC 4JSXC 5EMLB 4CC9A 3I7HA 4CY3A 4CI8A 4GZ8A 4CZYA 5HQGA 4FHLA 4L3GD 3VGZA 4GMBA 3HFQA 2QC5A 3JPXA 3MMYA 4OZUA 2P9UC 2H47A 4GGAA 3I8EA 3SLED 2OJYA 4O9DA 3F3GA 2HJBA 3JROA 3OW8A 2YNPA 2IUVA 4O3TB 1VYHC 2H3XA 3P4FA 3EI2A 3I7PA 4E54B 1YFQA 3VA6A 4JSNC 2J56H 2I0RA 3KRWB 3SJLD 4K3ID 4Y7RA 3EU7A 5FXYA 2YNOA 2HYEA 1OLZA 2Z2OA 3FGBA 4GQ2P 5C2WB 5K1CC 3C9CA 1RI6A 3EI4B 2XL3A 2AGXA 4GM3A 3AL9A 4ZOXA 3L4MD 2G99A 4ZOVA 2Z2PA 3DSMA 3RSEC 3IJCA 1OMWB 4A0AB 3UVKA 4I79A 4J79A 3PSCB 1A0RB 1N6DA 2AH0A 2CNXA 3CIKB 4CZXA 2P9LC 4GQ1A 2EBSA 2IAAA 2CE8A 4X63B 3RRMC 2B5MA 3BG1A 4A09B 1JMZB 3K27A 3OKTA 4J77A 4PBYA 5K19A 3ULEC 2HXCA 5GXHA 2Z2NA 3FRXA 3EI4A 2P9SC 1SQJA 3OKYA 3UVOA 5I5IA 1QNIA 4A0AA 5EMJB 4Y5RD 3RFHA 4J0WA 3SVWD 1MG3A 5CXBB 4JT5C 2IUPA 5C9ZB 5HYNB 2HKRA 4J78A 1SHYB 3OKWA 2H9MA 2I0SA 4ERQA 2PM6B 2P9IC 4JXMA 4GM8A 4A11B 2P9PC 4X60B 5HE0B 3U4YA 4PBZA 4BH6A 4CI3A 4QT8A 1R5MA 3PE7A 5C2VB 4PXWA 4CY1A 1JJUB 2H6QA 2AH1A 3AL8A 5IT9g 4J81A 5IJ8E 4JSVC 1S4UX 1JMXB 5CYKA 2HJ4A 3SHFA 4G56B 5HE2B 1NR0A
chains in the Genus database with same CATH superfamily
3RN0D 4FAVD 3DXMC 5FFOA 2MTAH 3EI3A 3OTTA 4H5JA 3MKSB 3C5MA 4PSWB 4X61B 3BWSA 1T2XA 3IURA 3MKQA 2PM9A 5IJ7E 3PSLA 4KFMB 3FCSA 1JTDB 3SN6B 2OVRB 4PC0A 2CE9A 3AH8B 1JV2A 4O02A 4AMZA 4TZ4A 2GC7A 5FKSA 2QXVA 3K26A 3CFVA 3V4VA 1YR2A 4QRJA 5GSAA 4EWRA 4RE5A 3IIYA 5EALA 3I2NA 5M61A 3V7DB 4DNVA 4BL0A 4ES0A 2Q7QA 3UKUC 3OL2A 5EMMB 2AGYA 1GOTB 4ERZA 4BP9A 3N0EA 3A0FA 1NEXB 2EIEA 1TYEA 3UVLA 4G1MA 5M5UA 3EQ9A 5FKTA 4FA1D 4N14A 1U8CA 1FWXA 4OWRA 4GM9A 4LGNA 2I0TA 1GOGA 2B5LA 1SQ9A 5SXMA 3EG6A 2IUQA 1TYQC 5A2Qg 3N0DA 3ZE1A 3O4JA 4QQEA 4YVDA 1VZ2A 3MZKA 2BBKH 1H2ZA 1MDAH 3GREA 4FWWA 4J86A 1JOFA 4AX4A 3V4PA 5GMKn 4E54A 1N6FA 4PNKB 1K3IA 3E0CA 3PXTD 3RLMD 4UI9R 4ESGA 4Z7OA 3PVUB 5EARA 2G9AA 3KRXB 2VZ1A 1M1XA 3V5WB 4CZVA 2IURA 5FFGA 1U2VC 3VI4A 4UM9A 4CY2A 3JB9L 3C75H 2PBIB 2VDMA 5E6UA 4FA4D 3EMHA 3BG0A 4ZN4A 3EI1B 4NSXA 4XYIA 1E5TA 3JZNA 4WJKA 3UR4A 3ZE0A 3ZDYA 2AQ5A 5B4WA 2HKMA 3C99A 4HDJA 5IC7A 2H6NA 5CXCB 4BUJC 2CO0A 4JSPC 4A09A 3OF7A 2QZPA 3IIWA 3ZDXA 4Z7QA 4JHPC 4O1QD 1C9IA 3GD1I 3IJEA 1B9YA 5C86A 4A0BB 4CY5A 3SBPA 5EMKB 5TDHB 1U4CA 1N6EA 4ZOZA 4L1QD 2H13A 2CO0C 3T3PA 3IUJA 3K6SA 2BKLA 1TBGA 4JD2C 2H68A 3SMRA 3IUMA 3SCYA 4DNUA 1P22A 4U7AA 4FA5D 2BCJB 4GQBB 2H9NA 2IWFA 2VDPA 4QAMA 5CXCA 5CXBA 2AGLA 2I3TA 5C92A 2XU7A 2J55H 4UM8A 4A2LA 2P9KC 4GGDA 4Z7NA 3MZLA 4J87A 3EQ7A 4FA9D 3I89A 5AFU3 4A11A 5IGQA 2TRCB 2YMUA 3DWLC 3JRPA 3SFZA 4U1EI 4AMYA 2HU5A 5TEFA 4DNWA 3EWEA 5IGOA 3DM0A 4JHNA 5THAA 1XHMA 2VDNA 2GC4A 3KCIA 4PSXB 3EI2B 4A2MA 2W18A 3JZGA 2VDRA 5AMSA 4CI1A 4O3UB 3J81g 3IJ1A 2YB8B 3UVMA 4NAAA 4GGCA 2O9KA 5KDOB 2OK6A 2J57G 4IA9A 5M5TA 2B4EA 4WK2A 3RFGA 3NVNA 2H14A 2YNNA 1K32A 2EICA 3RN1D 2VZ3A 4L1MA 3V9FA 1GP2B 3PXWD 3RMZD 1MG2A 4CI2A 2B5NA 3VH0A 3UKRC 2WQ8A 5JWZA 4J82A 4J0XA 4BCBA 4XEIC 5H17A 3ZE2A 2VC2A 3T3MA 1ERJA 4L3HD 3B7FA 5FKRA 4D0KA 4H5IA 3IVMA 3I7OA 2AGWA 3VI3A 4D6VA 1UOPA 2YBAA 3MUNA 2OVQB 1H2XA 2HU7A 4AOWA 2XYIA 5I5JA 1K8KC 3I7NA 1E8MA 3PVWB 3NIGA 1PBYB 4FB1D 1L0QA 3SBQA 4X3EA 3OKYB 4R7AB 3SWSD 4A7JA 4MK0B 4A08B 1Q47A 3IULA 1PGUA 5AJAA 3EQ8A 2P9NC 4BP8A 3F3PA 4L9OA 3CFSB 5TF2A 1A12A 3NVQA 4ZOYA 3PXSD 4LG8A 4JT6C 4Z8LA 3MXXA 4IMMA 2UZXB 3SXTD 5HE3B 3IKOA 5EAMA 3ODTA 1C9LA 1B9XA 5H14A 1GOHA 1L5GA 3F3FA 3NIFA 2XL2A 3IUQA 4ERYA 4J73A 5TEEA 3J80g 2GNQA 1UOOA 3ZDZA 2OIZA 5I5MA 3JAMg 2CN3A 2VDOA 3ORVD 3ZWLB 2H6KA 3O4IA 4A08A 4AEZA 5FLXg 4XYHA 4E5ZB 3AL8B 3JZHA 3EI1A 5EM2B 3NIDA 4LG9A 1GG2B 1XIPA 2H9PA 2OVPB 4IRZA 5CYKB 2HESX 2AGZA 2UZYB 3UVNA 4MMYA 3FM0A 1PEVA 5FQDA 5FA5B 1H2WA 5H1MA 1GXRA 2JKXA 2VDQA 4J84A 3I7KA 4K3JB 4O45A 3EI3B 2I3SA 3AFCA 4A0BA 3NVXA 4FAND 2PM9B 1XKSA 3I7LA 3QHYB 5M5VA 4RE6A 5FKQA 2PM7B 3IJ0A 4O2WA 3L4OD 4J8BA 4E5ZA 5HE1B 3GFCA 5EM2A 3I8CA 3K71A 2CN2A 5M5RA 4QL1A 2IWKA 2H9LA 4J8GA 1PI6A 3SBRA 2OK4A 4D9SA 3OL2B 5EAPA 5GXIA 2XE4A 4MMXA 3DXKC 3W15A 4JSXC 4WK4A 5EMLB 4CC9A 3I7HA 4CY3A 4CI8A 4GZ8A 4CZYA 5HQGA 4FHLA 4L3GD 1O6GA 3VGZA 4GMBA 3HFQA 2QC5A 3JPXA 1GOFA 1UOQA 3MMYA 4OZUA 2P9UC 2H47A 4BCCA 1I2MB 4GGAA 3I8EA 3SLED 2OJYA 4O9DA 3F3GA 5E6SA 2HJBA 3JROA 3OW8A 2YNPA 2IUVA 4O3TB 4G55A 5E6RA 3FCUA 4G1EA 1VYHC 4WK0A 2EIDA 2H3XA 3P4FA 3EI2A 3I7PA 4E54B 1YFQA 2HU8A 3VA6A 4JSNC 2J56H 2I0RA 3KRWB 3SJLD 3O4GA 4K3ID 4Y7RA 3EU7A 5FXYA 2YNOA 2HYEA 1OLZA 2Z2OA 3FGBA 1UTCA 4GQ2P 5C2WB 1VE6A 5K1CC 2XZGA 1RI6A 3C9CA 2XL3A 3EI4B 2AGXA 4GM3A 3AL9A 5HDBA 4ZOXA 3L4MD 2G99A 4ZOVA 2Z2PA 3DSMA 3RSEC 3IJCA 1OMWB 4A0AB 3O4HA 3UVKA 4I79A 4J79A 3PSCB 1A0RB 1N6DA 2AH0A 3MUOA 2CNXA 3CIKB 4CZXA 2P9LC 4GQ1A 2EBSA 2IAAA 2XDWA 2CE8A 4X63B 3RRMC 2B5MA 3BG1A 4A09B 1JMZB 3GC3B 2QR5A 1BPOA 3K27A 3OKTA 4J77A 4PBYA 5K19A 3ULEC 2HXCA 5GXHA 2Z2NA 3FRXA 1O6FA 3EI4A 4AN0A 4NC4A 4NENA 2P9SC 1H2YA 1SQJA 3OKYA 1QFSA 3UVOA 5I5IA 1QNIA 4A0AA 3DDUA 2EIBA 3K72A 5EMJB 4Y5RD 1QFMA 3RFHA 4J0WA 3SVWD 4BCDA 1MG3A 5CXBB 4JT5C 2IUPA 5C9ZB 2VDLA 5HYNB 2HKRA 3IUNA 4J78A 4AN1A 1SHYB 1VE7A 3OKWA 2H9MA 1E8NA 2I0SA 4ERQA 2PM6B 2P9IC 4JXMA 4GM8A 4A11B 2P9PC 4NBMA 4X60B 4MMZA 5HE0B 3U4YA 4PBZA 3MVDK 4BH6A 4CI3A 4QT8A 1R5MA 3PE7A 5C2VB 4PXWA 4CY1A 5M5SA 1JJUB 2H6QA 2AH1A 3QI0A 2VDKA 3AL8A 5IT9g 4J81A 5IJ8E 4JSVC 1S4UX 1JMXB 5CYKA 2HJ4A 3SHFA 4G56B 5HE2B 1NR0A 1VZ3A
chains in the Genus database with same CATH topology
3RN0D 4FAVD 3DXMC 2MTAH 3EI3A 3OTTA 4H5JA 3MKSB 3C5MA 4PSWB 4X61B 3BWSA 3MKQA 2PM9A 5IJ7E 3PSLA 4KFMB 3SN6B 2OVRB 4PC0A 2CE9A 3AH8B 4TZ4A 2GC7A 5FKSA 2QXVA 3K26A 3CFVA 4QRJA 5GSAA 4EWRA 3IIYA 5EALA 3I2NA 3V7DB 4BL0A 4ES0A 2Q7QA 3UKUC 3OL2A 5EMMB 2AGYA 1GOTB 4ERZA 3N0EA 3A0FA 1NEXB 3UVLA 5FKTA 4FA1D 4N14A 1FWXA 4OWRA 4GM9A 4LGNA 2I0TA 2B5LA 1SQ9A 5SXMA 3EG6A 2IUQA 1TYQC 5A2Qg 3N0DA 4QQEA 4YVDA 3MZKA 2BBKH 1MDAH 3GREA 4FWWA 4J86A 1JOFA 5GMKn 4E54A 1N6FA 4PNKB 3E0CA 3PXTD 3RLMD 4UI9R 4ESGA 3PVUB 5EARA 2G9AA 3KRXB 3V5WB 4CZVA 2IURA 1U2VC 4CY2A 3JB9L 3C75H 2PBIB 4FA4D 3EMHA 3BG0A 4ZN4A 3EI1B 4NSXA 4XYIA 3JZNA 3UR4A 2AQ5A 5B4WA 2HKMA 3C99A 4HDJA 5IC7A 2H6NA 5CXCB 4BUJC 2CO0A 4JSPC 4A09A 3IIWA 4O1QD 1B9YA 4A0BB 4CY5A 3SBPA 5EMKB 5TDHB 1U4CA 1N6EA 4ZOZA 4L1QD 2H13A 2CO0C 1TBGA 4JD2C 2H68A 3SMRA 3SCYA 1P22A 4U7AA 4FA5D 2BCJB 4GQBB 2H9NA 2IWFA 5CXCA 5CXBA 2AGLA 2I3TA 2XU7A 2J55H 4A2LA 2P9KC 4GGDA 3MZLA 4J87A 4FA9D 3I89A 5AFU3 4A11A 5IGQA 2TRCB 2YMUA 3DWLC 3JRPA 3SFZA 4U1EI 5TEFA 3EWEA 5IGOA 3DM0A 5THAA 1XHMA 2GC4A 4PSXB 3EI2B 4A2MA 2W18A 3JZGA 5AMSA 4CI1A 4O3UB 3J81g 3IJ1A 2YB8B 3UVMA 4GGCA 2O9KA 5KDOB 2OK6A 2J57G 4IA9A 2B4EA 3RFGA 3NVNA 2H14A 2YNNA 1K32A 3RN1D 3V9FA 1GP2B 3PXWD 3RMZD 1MG2A 4CI2A 2B5NA 3VH0A 3UKRC 5JWZA 4J82A 4J0XA 4XEIC 5H17A 1ERJA 4L3HD 3B7FA 5FKRA 4D0KA 4H5IA 3I7OA 2AGWA 4D6VA 2YBAA 2OVQB 4AOWA 2XYIA 5I5JA 1K8KC 3I7NA 3PVWB 1PBYB 4FB1D 1L0QA 3SBQA 4X3EA 3OKYB 4R7AB 3SWSD 4A7JA 4MK0B 4A08B 1Q47A 1PGUA 5AJAA 2P9NC 3F3PA 4L9OA 3CFSB 5TF2A 3NVQA 4ZOYA 3PXSD 4LG8A 4JT6C 4Z8LA 3MXXA 4IMMA 2UZXB 3SXTD 5HE3B 3IKOA 5EAMA 3ODTA 5H14A 1B9XA 3F3FA 2XL2A 4ERYA 4J73A 5TEEA 3J80g 2GNQA 2OIZA 5I5MA 3JAMg 2CN3A 3ORVD 3ZWLB 2H6KA 4A08A 4AEZA 5FLXg 4XYHA 4E5ZB 3AL8B 3JZHA 3EI1A 5EM2B 4LG9A 1GG2B 1XIPA 2H9PA 2OVPB 5CYKB 2HESX 2AGZA 2UZYB 3UVNA 3FM0A 1PEVA 5FQDA 5FA5B 5H1MA 1GXRA 4J84A 3I7KA 4K3JB 4O45A 3EI3B 2I3SA 3AFCA 4A0BA 3NVXA 4FAND 2PM9B 1XKSA 3I7LA 5FKQA 2PM7B 3IJ0A 3L4OD 4J8BA 4E5ZA 5HE1B 3GFCA 5EM2A 3I8CA 2CN2A 4QL1A 2IWKA 2H9LA 4J8GA 1PI6A 3SBRA 2OK4A 3OL2B 5EAPA 5GXIA 3W15A 3DXKC 4JSXC 5EMLB 4CC9A 3I7HA 4CY3A 4CI8A 4GZ8A 4CZYA 5HQGA 4FHLA 4L3GD 3VGZA 4GMBA 3HFQA 2QC5A 3JPXA 3MMYA 4OZUA 2P9UC 2H47A 4GGAA 3I8EA 3SLED 2OJYA 4O9DA 3F3GA 2HJBA 3JROA 3OW8A 2YNPA 2IUVA 4O3TB 1VYHC 2H3XA 3P4FA 3EI2A 3I7PA 4E54B 1YFQA 3VA6A 4JSNC 2J56H 2I0RA 3KRWB 3SJLD 4K3ID 4Y7RA 3EU7A 5FXYA 2YNOA 2HYEA 1OLZA 2Z2OA 3FGBA 4GQ2P 5C2WB 5K1CC 3C9CA 1RI6A 3EI4B 2XL3A 2AGXA 4GM3A 3AL9A 4ZOXA 3L4MD 2G99A 4ZOVA 2Z2PA 3DSMA 3RSEC 3IJCA 1OMWB 4A0AB 3UVKA 4I79A 4J79A 3PSCB 1A0RB 1N6DA 2AH0A 2CNXA 3CIKB 4CZXA 2P9LC 4GQ1A 2EBSA 2IAAA 2CE8A 4X63B 3RRMC 2B5MA 3BG1A 4A09B 1JMZB 3K27A 3OKTA 4J77A 4PBYA 5K19A 3ULEC 2HXCA 5GXHA 2Z2NA 3FRXA 3EI4A 2P9SC 1SQJA 3OKYA 3UVOA 5I5IA 1QNIA 4A0AA 5EMJB 4Y5RD 3RFHA 4J0WA 3SVWD 1MG3A 5CXBB 4JT5C 2IUPA 5C9ZB 5HYNB 2HKRA 4J78A 1SHYB 3OKWA 2H9MA 2I0SA 4ERQA 2PM6B 2P9IC 4JXMA 4GM8A 4A11B 2P9PC 4X60B 5HE0B 3U4YA 4PBZA 4BH6A 4CI3A 4QT8A 1R5MA 3PE7A 5C2VB 4PXWA 4CY1A 1JJUB 2H6QA 2AH1A 3AL8A 5IT9g 4J81A 5IJ8E 4JSVC 1S4UX 1JMXB 5CYKA 2HJ4A 3SHFA 4G56B 5HE2B 1NR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN0 D;  4FAV D;  3DXM C;  2MTA H;  3EI3 A;  3OTT A;  4H5J A;  3MKS B;  3C5M A;  4PSW B;  4X61 B;  3BWS A;  3MKQ A;  2PM9 A;  5IJ7 E;  3PSL A;  4KFM B;  3SN6 B;  2OVR B;  4PC0 A;  2CE9 A;  3AH8 B;  4TZ4 A;  2GC7 A;  5FKS A;  2QXV A;  3K26 A;  3CFV A;  4QRJ A;  5GSA A;  4EWR A;  3IIY A;  5EAL A;  3I2N A;  3V7D B;  4BL0 A;  4ES0 A;  2Q7Q A;  3UKU C;  3OL2 A;  5EMM B;  2AGY A;  1GOT B;  4ERZ A;  3N0E A;  3A0F A;  1NEX B;  3UVL A;  5FKT A;  4FA1 D;  4N14 A;  1FWX A;  4OWR A;  4GM9 A;  4LGN A;  2I0T A;  2B5L A;  1SQ9 A;  5SXM A;  3EG6 A;  2IUQ A;  1TYQ C;  5A2Q g;  3N0D A;  4QQE A;  4YVD A;  3MZK A;  2BBK H;  1MDA H;  3GRE A;  4FWW A;  4J86 A;  1JOF A;  5GMK n;  4E54 A;  1N6F A;  4PNK B;  3E0C A;  3PXT D;  3RLM D;  4UI9 R;  4ESG A;  3PVU B;  5EAR A;  2G9A A;  3KRX B;  3V5W B;  4CZV A;  2IUR A;  1U2V C;  4CY2 A;  3JB9 L;  3C75 H;  2PBI B;  4FA4 D;  3EMH A;  3BG0 A;  4ZN4 A;  3EI1 B;  4NSX A;  4XYI A;  3JZN A;  3UR4 A;  2AQ5 A;  5B4W A;  2HKM A;  3C99 A;  4HDJ A;  5IC7 A;  2H6N A;  5CXC B;  4BUJ C;  2CO0 A;  4JSP C;  4A09 A;  3IIW A;  4O1Q D;  1B9Y A;  4A0B B;  4CY5 A;  3SBP A;  5EMK B;  5TDH B;  1U4C A;  1N6E A;  4ZOZ A;  4L1Q D;  2H13 A;  2CO0 C;  1TBG A;  4JD2 C;  2H68 A;  3SMR A;  3SCY A;  1P22 A;  4U7A A;  4FA5 D;  2BCJ B;  4GQB B;  2H9N A;  2IWF A;  5CXC A;  5CXB A;  2AGL A;  2I3T A;  2XU7 A;  2J55 H;  4A2L A;  2P9K C;  4GGD A;  3MZL A;  4J87 A;  4FA9 D;  3I89 A;  5AFU 3;  4A11 A;  5IGQ A;  2TRC B;  2YMU A;  3DWL C;  3JRP A;  3SFZ A;  4U1E I;  5TEF A;  3EWE A;  5IGO A;  3DM0 A;  5THA A;  1XHM A;  2GC4 A;  4PSX B;  3EI2 B;  4A2M A;  2W18 A;  3JZG A;  5AMS A;  4CI1 A;  4O3U B;  3J81 g;  3IJ1 A;  2YB8 B;  3UVM A;  4GGC A;  2O9K A;  5KDO B;  2OK6 A;  2J57 G;  4IA9 A;  2B4E A;  3RFG A;  3NVN A;  2H14 A;  2YNN A;  1K32 A;  3RN1 D;  3V9F A;  1GP2 B;  3PXW D;  3RMZ D;  1MG2 A;  4CI2 A;  2B5N A;  3VH0 A;  3UKR C;  5JWZ A;  4J82 A;  4J0X A;  4XEI C;  5H17 A;  1ERJ A;  4L3H D;  3B7F A;  5FKR A;  4D0K A;  4H5I A;  3I7O A;  2AGW A;  4D6V A;  2YBA A;  2OVQ B;  4AOW A;  2XYI A;  5I5J A;  1K8K C;  3I7N A;  3PVW B;  1PBY B;  4FB1 D;  1L0Q A;  3SBQ A;  4X3E A;  3OKY B;  4R7A B;  3SWS D;  4A7J A;  4MK0 B;  4A08 B;  1Q47 A;  1PGU A;  5AJA A;  2P9N C;  3F3P A;  4L9O A;  3CFS B;  5TF2 A;  3NVQ A;  4ZOY A;  3PXS D;  4LG8 A;  4JT6 C;  4Z8L A;  3MXX A;  4IMM A;  2UZX B;  3SXT D;  5HE3 B;  3IKO A;  5EAM A;  3ODT A;  5H14 A;  1B9X A;  3F3F A;  2XL2 A;  4ERY A;  4J73 A;  5TEE A;  3J80 g;  2GNQ A;  2OIZ A;  5I5M A;  3JAM g;  2CN3 A;  3ORV D;  3ZWL B;  2H6K A;  4A08 A;  4AEZ A;  5FLX g;  4XYH A;  4E5Z B;  3AL8 B;  3JZH A;  3EI1 A;  5EM2 B;  4LG9 A;  1GG2 B;  1XIP A;  2H9P A;  2OVP B;  5CYK B;  2HES X;  2AGZ A;  2UZY B;  3UVN A;  3FM0 A;  1PEV A;  5FQD A;  5FA5 B;  5H1M A;  1GXR A;  4J84 A;  3I7K A;  4K3J B;  4O45 A;  3EI3 B;  2I3S A;  3AFC A;  4A0B A;  3NVX A;  4FAN D;  2PM9 B;  1XKS A;  3I7L A;  5FKQ A;  2PM7 B;  3IJ0 A;  3L4O D;  4J8B A;  4E5Z A;  5HE1 B;  3GFC A;  5EM2 A;  3I8C A;  2CN2 A;  4QL1 A;  2IWK A;  2H9L A;  4J8G A;  1PI6 A;  3SBR A;  2OK4 A;  3OL2 B;  5EAP A;  5GXI A;  3W15 A;  3DXK C;  4JSX C;  5EML B;  4CC9 A;  3I7H A;  4CY3 A;  4CI8 A;  4GZ8 A;  4CZY A;  5HQG A;  4FHL A;  4L3G D;  3VGZ A;  4GMB A;  3HFQ A;  2QC5 A;  3JPX A;  3MMY A;  4OZU A;  2P9U C;  2H47 A;  4GGA A;  3I8E A;  3SLE D;  2OJY A;  4O9D A;  3F3G A;  2HJB A;  3JRO A;  3OW8 A;  2YNP A;  2IUV A;  4O3T B;  1VYH C;  2H3X A;  3P4F A;  3EI2 A;  3I7P A;  4E54 B;  1YFQ A;  3VA6 A;  4JSN C;  2J56 H;  2I0R A;  3KRW B;  3SJL D;  4K3I D;  4Y7R A;  3EU7 A;  5FXY A;  2YNO A;  2HYE A;  1OLZ A;  2Z2O A;  3FGB A;  4GQ2 P;  5C2W B;  5K1C C;  3C9C A;  1RI6 A;  3EI4 B;  2XL3 A;  2AGX A;  4GM3 A;  3AL9 A;  4ZOX A;  3L4M D;  2G99 A;  4ZOV A;  2Z2P A;  3DSM A;  3RSE C;  3IJC A;  1OMW B;  4A0A B;  3UVK A;  4I79 A;  4J79 A;  3PSC B;  1A0R B;  1N6D A;  2AH0 A;  2CNX A;  3CIK B;  4CZX A;  2P9L C;  4GQ1 A;  2EBS A;  2IAA A;  2CE8 A;  4X63 B;  3RRM C;  2B5M A;  3BG1 A;  4A09 B;  1JMZ B;  3K27 A;  3OKT A;  4J77 A;  4PBY A;  5K19 A;  3ULE C;  2HXC A;  5GXH A;  2Z2N A;  3FRX A;  3EI4 A;  2P9S C;  1SQJ A;  3OKY A;  3UVO A;  5I5I A;  1QNI A;  4A0A A;  5EMJ B;  4Y5R D;  3RFH A;  4J0W A;  3SVW D;  1MG3 A;  5CXB B;  4JT5 C;  2IUP A;  5C9Z B;  5HYN B;  2HKR A;  4J78 A;  1SHY B;  3OKW A;  2H9M A;  2I0S A;  4ERQ A;  2PM6 B;  2P9I C;  4JXM A;  4GM8 A;  4A11 B;  2P9P C;  4X60 B;  5HE0 B;  3U4Y A;  4PBZ A;  4BH6 A;  4CI3 A;  4QT8 A;  1R5M A;  3PE7 A;  5C2V B;  4PXW A;  4CY1 A;  1JJU B;  2H6Q A;  2AH1 A;  3AL8 A;  5IT9 g;  4J81 A;  5IJ8 E;  4JSV C;  1S4U X;  1JMX B;  5CYK A;  2HJ4 A;  3SHF A;  4G56 B;  5HE2 B;  1NR0 A; 
#chains in the Genus database with same CATH topology
 3RN0 D;  4FAV D;  3DXM C;  5FFO A;  2MTA H;  3EI3 A;  3OTT A;  4H5J A;  3MKS B;  3C5M A;  4PSW B;  4X61 B;  3BWS A;  1T2X A;  3IUR A;  3MKQ A;  2PM9 A;  5IJ7 E;  3PSL A;  4KFM B;  3FCS A;  1JTD B;  3SN6 B;  2OVR B;  4PC0 A;  2CE9 A;  3AH8 B;  1JV2 A;  4O02 A;  4AMZ A;  4TZ4 A;  2GC7 A;  5FKS A;  2QXV A;  3K26 A;  3CFV A;  3V4V A;  1YR2 A;  4QRJ A;  5GSA A;  4EWR A;  4RE5 A;  3IIY A;  5EAL A;  3I2N A;  5M61 A;  3V7D B;  4DNV A;  4BL0 A;  4ES0 A;  2Q7Q A;  3UKU C;  3OL2 A;  5EMM B;  2AGY A;  1GOT B;  4ERZ A;  4BP9 A;  3N0E A;  3A0F A;  1NEX B;  2EIE A;  1TYE A;  3UVL A;  4G1M A;  5M5U A;  3EQ9 A;  5FKT A;  4FA1 D;  4N14 A;  1U8C A;  1FWX A;  4OWR A;  4GM9 A;  4LGN A;  2I0T A;  1GOG A;  2B5L A;  1SQ9 A;  5SXM A;  3EG6 A;  2IUQ A;  1TYQ C;  5A2Q g;  3N0D A;  3ZE1 A;  3O4J A;  4QQE A;  4YVD A;  1VZ2 A;  3MZK A;  2BBK H;  1H2Z A;  1MDA H;  3GRE A;  4FWW A;  4J86 A;  1JOF A;  4AX4 A;  3V4P A;  5GMK n;  4E54 A;  1N6F A;  4PNK B;  1K3I A;  3E0C A;  3PXT D;  3RLM D;  4UI9 R;  4ESG A;  4Z7O A;  3PVU B;  5EAR A;  2G9A A;  3KRX B;  2VZ1 A;  1M1X A;  3V5W B;  4CZV A;  2IUR A;  5FFG A;  1U2V C;  3VI4 A;  4UM9 A;  4CY2 A;  3JB9 L;  3C75 H;  2PBI B;  2VDM A;  5E6U A;  4FA4 D;  3EMH A;  3BG0 A;  4ZN4 A;  3EI1 B;  4NSX A;  4XYI A;  1E5T A;  3JZN A;  4WJK A;  3UR4 A;  3ZE0 A;  3ZDY A;  2AQ5 A;  5B4W A;  2HKM A;  3C99 A;  4HDJ A;  5IC7 A;  2H6N A;  5CXC B;  4BUJ C;  2CO0 A;  4JSP C;  4A09 A;  3OF7 A;  2QZP A;  3IIW A;  3ZDX A;  4Z7Q A;  4JHP C;  4O1Q D;  1C9I A;  3GD1 I;  3IJE A;  1B9Y A;  5C86 A;  4A0B B;  4CY5 A;  3SBP A;  5EMK B;  5TDH B;  1U4C A;  1N6E A;  4ZOZ A;  4L1Q D;  2H13 A;  2CO0 C;  3T3P A;  3IUJ A;  3K6S A;  2BKL A;  1TBG A;  4JD2 C;  2H68 A;  3SMR A;  3IUM A;  3SCY A;  4DNU A;  1P22 A;  4U7A A;  4FA5 D;  2BCJ B;  4GQB B;  2H9N A;  2IWF A;  2VDP A;  4QAM A;  5CXC A;  5CXB A;  2AGL A;  2I3T A;  5C92 A;  2XU7 A;  2J55 H;  4UM8 A;  4A2L A;  2P9K C;  4GGD A;  4Z7N A;  3MZL A;  4J87 A;  3EQ7 A;  4FA9 D;  3I89 A;  5AFU 3;  4A11 A;  5IGQ A;  2TRC B;  2YMU A;  3DWL C;  3JRP A;  3SFZ A;  4U1E I;  4AMY A;  2HU5 A;  5TEF A;  4DNW A;  3EWE A;  5IGO A;  3DM0 A;  4JHN A;  5THA A;  1XHM A;  2VDN A;  2GC4 A;  3KCI A;  4PSX B;  3EI2 B;  4A2M A;  2W18 A;  3JZG A;  2VDR A;  5AMS A;  4CI1 A;  4O3U B;  3J81 g;  3IJ1 A;  2YB8 B;  3UVM A;  4NAA A;  4GGC A;  2O9K A;  5KDO B;  2OK6 A;  2J57 G;  4IA9 A;  5M5T A;  2B4E A;  4WK2 A;  3RFG A;  3NVN A;  2H14 A;  2YNN A;  1K32 A;  2EIC A;  3RN1 D;  2VZ3 A;  4L1M A;  3V9F A;  1GP2 B;  3PXW D;  3RMZ D;  1MG2 A;  4CI2 A;  2B5N A;  3VH0 A;  3UKR C;  2WQ8 A;  5JWZ A;  4J82 A;  4J0X A;  4BCB A;  4XEI C;  5H17 A;  3ZE2 A;  2VC2 A;  3T3M A;  1ERJ A;  4L3H D;  3B7F A;  5FKR A;  4D0K A;  4H5I A;  3IVM A;  3I7O A;  2AGW A;  3VI3 A;  4D6V A;  1UOP A;  2YBA A;  3MUN A;  2OVQ B;  1H2X A;  2HU7 A;  4AOW A;  2XYI A;  5I5J A;  1K8K C;  3I7N A;  1E8M A;  3PVW B;  3NIG A;  1PBY B;  4FB1 D;  1L0Q A;  3SBQ A;  4X3E A;  3OKY B;  4R7A B;  3SWS D;  4A7J A;  4MK0 B;  4A08 B;  1Q47 A;  3IUL A;  1PGU A;  5AJA A;  3EQ8 A;  2P9N C;  4BP8 A;  3F3P A;  4L9O A;  3CFS B;  5TF2 A;  1A12 A;  3NVQ A;  4ZOY A;  3PXS D;  4LG8 A;  4JT6 C;  4Z8L A;  3MXX A;  4IMM A;  2UZX B;  3SXT D;  5HE3 B;  3IKO A;  5EAM A;  3ODT A;  1C9L A;  1B9X A;  5H14 A;  1GOH A;  1L5G A;  3F3F A;  3NIF A;  2XL2 A;  3IUQ A;  4ERY A;  4J73 A;  5TEE A;  3J80 g;  2GNQ A;  1UOO A;  3ZDZ A;  2OIZ A;  5I5M A;  3JAM g;  2CN3 A;  2VDO A;  3ORV D;  3ZWL B;  2H6K A;  3O4I A;  4A08 A;  4AEZ A;  5FLX g;  4XYH A;  4E5Z B;  3AL8 B;  3JZH A;  3EI1 A;  5EM2 B;  3NID A;  4LG9 A;  1GG2 B;  1XIP A;  2H9P A;  2OVP B;  4IRZ A;  5CYK B;  2HES X;  2AGZ A;  2UZY B;  3UVN A;  4MMY A;  3FM0 A;  1PEV A;  5FQD A;  5FA5 B;  1H2W A;  5H1M A;  1GXR A;  2JKX A;  2VDQ A;  4J84 A;  3I7K A;  4K3J B;  4O45 A;  3EI3 B;  2I3S A;  3AFC A;  4A0B A;  3NVX A;  4FAN D;  2PM9 B;  1XKS A;  3I7L A;  3QHY B;  5M5V A;  4RE6 A;  5FKQ A;  2PM7 B;  3IJ0 A;  4O2W A;  3L4O D;  4J8B A;  4E5Z A;  5HE1 B;  3GFC A;  5EM2 A;  3I8C A;  3K71 A;  2CN2 A;  5M5R A;  4QL1 A;  2IWK A;  2H9L A;  4J8G A;  1PI6 A;  3SBR A;  2OK4 A;  4D9S A;  3OL2 B;  5EAP A;  5GXI A;  2XE4 A;  4MMX A;  3DXK C;  3W15 A;  4JSX C;  4WK4 A;  5EML B;  4CC9 A;  3I7H A;  4CY3 A;  4CI8 A;  4GZ8 A;  4CZY A;  5HQG A;  4FHL A;  4L3G D;  1O6G A;  3VGZ A;  4GMB A;  3HFQ A;  2QC5 A;  3JPX A;  1GOF A;  1UOQ A;  3MMY A;  4OZU A;  2P9U C;  2H47 A;  4BCC A;  1I2M B;  4GGA A;  3I8E A;  3SLE D;  2OJY A;  4O9D A;  3F3G A;  5E6S A;  2HJB A;  3JRO A;  3OW8 A;  2YNP A;  2IUV A;  4O3T B;  4G55 A;  5E6R A;  3FCU A;  4G1E A;  1VYH C;  4WK0 A;  2EID A;  2H3X A;  3P4F A;  3EI2 A;  3I7P A;  4E54 B;  1YFQ A;  2HU8 A;  3VA6 A;  4JSN C;  2J56 H;  2I0R A;  3KRW B;  3SJL D;  3O4G A;  4K3I D;  4Y7R A;  3EU7 A;  5FXY A;  2YNO A;  2HYE A;  1OLZ A;  2Z2O A;  3FGB A;  1UTC A;  4GQ2 P;  5C2W B;  1VE6 A;  5K1C C;  2XZG A;  1RI6 A;  3C9C A;  2XL3 A;  3EI4 B;  2AGX A;  4GM3 A;  3AL9 A;  5HDB A;  4ZOX A;  3L4M D;  2G99 A;  4ZOV A;  2Z2P A;  3DSM A;  3RSE C;  3IJC A;  1OMW B;  4A0A B;  3O4H A;  3UVK A;  4I79 A;  4J79 A;  3PSC B;  1A0R B;  1N6D A;  2AH0 A;  3MUO A;  2CNX A;  3CIK B;  4CZX A;  2P9L C;  4GQ1 A;  2EBS A;  2IAA A;  2XDW A;  2CE8 A;  4X63 B;  3RRM C;  2B5M A;  3BG1 A;  4A09 B;  1JMZ B;  3GC3 B;  2QR5 A;  1BPO A;  3K27 A;  3OKT A;  4J77 A;  4PBY A;  5K19 A;  3ULE C;  2HXC A;  5GXH A;  2Z2N A;  3FRX A;  1O6F A;  3EI4 A;  4AN0 A;  4NC4 A;  4NEN A;  2P9S C;  1H2Y A;  1SQJ A;  3OKY A;  1QFS A;  3UVO A;  5I5I A;  1QNI A;  4A0A A;  3DDU A;  2EIB A;  3K72 A;  5EMJ B;  4Y5R D;  1QFM A;  3RFH A;  4J0W A;  3SVW D;  4BCD A;  1MG3 A;  5CXB B;  4JT5 C;  2IUP A;  5C9Z B;  2VDL A;  5HYN B;  2HKR A;  3IUN A;  4J78 A;  4AN1 A;  1SHY B;  1VE7 A;  3OKW A;  2H9M A;  1E8N A;  2I0S A;  4ERQ A;  2PM6 B;  2P9I C;  4JXM A;  4GM8 A;  4A11 B;  2P9P C;  4NBM A;  4X60 B;  4MMZ A;  5HE0 B;  3U4Y A;  4PBZ A;  3MVD K;  4BH6 A;  4CI3 A;  4QT8 A;  1R5M A;  3PE7 A;  5C2V B;  4PXW A;  4CY1 A;  5M5S A;  1JJU B;  2H6Q A;  2AH1 A;  3QI0 A;  2VDK A;  3AL8 A;  5IT9 g;  4J81 A;  5IJ8 E;  4JSV C;  1S4U X;  1JMX B;  5CYK A;  2HJ4 A;  3SHF A;  4G56 B;  5HE2 B;  1NR0 A;  1VZ3 A; 
#chains in the Genus database with same CATH homology
 3RN0 D;  4FAV D;  3DXM C;  2MTA H;  3EI3 A;  3OTT A;  4H5J A;  3MKS B;  3C5M A;  4PSW B;  4X61 B;  3BWS A;  3MKQ A;  2PM9 A;  5IJ7 E;  3PSL A;  4KFM B;  3SN6 B;  2OVR B;  4PC0 A;  2CE9 A;  3AH8 B;  4TZ4 A;  2GC7 A;  5FKS A;  2QXV A;  3K26 A;  3CFV A;  4QRJ A;  5GSA A;  4EWR A;  3IIY A;  5EAL A;  3I2N A;  3V7D B;  4BL0 A;  4ES0 A;  2Q7Q A;  3UKU C;  3OL2 A;  5EMM B;  2AGY A;  1GOT B;  4ERZ A;  3N0E A;  3A0F A;  1NEX B;  3UVL A;  5FKT A;  4FA1 D;  4N14 A;  1FWX A;  4OWR A;  4GM9 A;  4LGN A;  2I0T A;  2B5L A;  1SQ9 A;  5SXM A;  3EG6 A;  2IUQ A;  1TYQ C;  5A2Q g;  3N0D A;  4QQE A;  4YVD A;  3MZK A;  2BBK H;  1MDA H;  3GRE A;  4FWW A;  4J86 A;  1JOF A;  5GMK n;  4E54 A;  1N6F A;  4PNK B;  3E0C A;  3PXT D;  3RLM D;  4UI9 R;  4ESG A;  3PVU B;  5EAR A;  2G9A A;  3KRX B;  3V5W B;  4CZV A;  2IUR A;  1U2V C;  4CY2 A;  3JB9 L;  3C75 H;  2PBI B;  4FA4 D;  3EMH A;  3BG0 A;  4ZN4 A;  3EI1 B;  4NSX A;  4XYI A;  3JZN A;  3UR4 A;  2AQ5 A;  5B4W A;  2HKM A;  3C99 A;  4HDJ A;  5IC7 A;  2H6N A;  5CXC B;  4BUJ C;  2CO0 A;  4JSP C;  4A09 A;  3IIW A;  4O1Q D;  1B9Y A;  4A0B B;  4CY5 A;  3SBP A;  5EMK B;  5TDH B;  1U4C A;  1N6E A;  4ZOZ A;  4L1Q D;  2H13 A;  2CO0 C;  1TBG A;  4JD2 C;  2H68 A;  3SMR A;  3SCY A;  1P22 A;  4U7A A;  4FA5 D;  2BCJ B;  4GQB B;  2H9N A;  2IWF A;  5CXC A;  5CXB A;  2AGL A;  2I3T A;  2XU7 A;  2J55 H;  4A2L A;  2P9K C;  4GGD A;  3MZL A;  4J87 A;  4FA9 D;  3I89 A;  5AFU 3;  4A11 A;  5IGQ A;  2TRC B;  2YMU A;  3DWL C;  3JRP A;  3SFZ A;  4U1E I;  5TEF A;  3EWE A;  5IGO A;  3DM0 A;  5THA A;  1XHM A;  2GC4 A;  4PSX B;  3EI2 B;  4A2M A;  2W18 A;  3JZG A;  5AMS A;  4CI1 A;  4O3U B;  3J81 g;  3IJ1 A;  2YB8 B;  3UVM A;  4GGC A;  2O9K A;  5KDO B;  2OK6 A;  2J57 G;  4IA9 A;  2B4E A;  3RFG A;  3NVN A;  2H14 A;  2YNN A;  1K32 A;  3RN1 D;  3V9F A;  1GP2 B;  3PXW D;  3RMZ D;  1MG2 A;  4CI2 A;  2B5N A;  3VH0 A;  3UKR C;  5JWZ A;  4J82 A;  4J0X A;  4XEI C;  5H17 A;  1ERJ A;  4L3H D;  3B7F A;  5FKR A;  4D0K A;  4H5I A;  3I7O A;  2AGW A;  4D6V A;  2YBA A;  2OVQ B;  4AOW A;  2XYI A;  5I5J A;  1K8K C;  3I7N A;  3PVW B;  1PBY B;  4FB1 D;  1L0Q A;  3SBQ A;  4X3E A;  3OKY B;  4R7A B;  3SWS D;  4A7J A;  4MK0 B;  4A08 B;  1Q47 A;  1PGU A;  5AJA A;  2P9N C;  3F3P A;  4L9O A;  3CFS B;  5TF2 A;  3NVQ A;  4ZOY A;  3PXS D;  4LG8 A;  4JT6 C;  4Z8L A;  3MXX A;  4IMM A;  2UZX B;  3SXT D;  5HE3 B;  3IKO A;  5EAM A;  3ODT A;  5H14 A;  1B9X A;  3F3F A;  2XL2 A;  4ERY A;  4J73 A;  5TEE A;  3J80 g;  2GNQ A;  2OIZ A;  5I5M A;  3JAM g;  2CN3 A;  3ORV D;  3ZWL B;  2H6K A;  4A08 A;  4AEZ A;  5FLX g;  4XYH A;  4E5Z B;  3AL8 B;  3JZH A;  3EI1 A;  5EM2 B;  4LG9 A;  1GG2 B;  1XIP A;  2H9P A;  2OVP B;  5CYK B;  2HES X;  2AGZ A;  2UZY B;  3UVN A;  3FM0 A;  1PEV A;  5FQD A;  5FA5 B;  5H1M A;  1GXR A;  4J84 A;  3I7K A;  4K3J B;  4O45 A;  3EI3 B;  2I3S A;  3AFC A;  4A0B A;  3NVX A;  4FAN D;  2PM9 B;  1XKS A;  3I7L A;  5FKQ A;  2PM7 B;  3IJ0 A;  3L4O D;  4J8B A;  4E5Z A;  5HE1 B;  3GFC A;  5EM2 A;  3I8C A;  2CN2 A;  4QL1 A;  2IWK A;  2H9L A;  4J8G A;  1PI6 A;  3SBR A;  2OK4 A;  3OL2 B;  5EAP A;  5GXI A;  3W15 A;  3DXK C;  4JSX C;  5EML B;  4CC9 A;  3I7H A;  4CY3 A;  4CI8 A;  4GZ8 A;  4CZY A;  5HQG A;  4FHL A;  4L3G D;  3VGZ A;  4GMB A;  3HFQ A;  2QC5 A;  3JPX A;  3MMY A;  4OZU A;  2P9U C;  2H47 A;  4GGA A;  3I8E A;  3SLE D;  2OJY A;  4O9D A;  3F3G A;  2HJB A;  3JRO A;  3OW8 A;  2YNP A;  2IUV A;  4O3T B;  1VYH C;  2H3X A;  3P4F A;  3EI2 A;  3I7P A;  4E54 B;  1YFQ A;  3VA6 A;  4JSN C;  2J56 H;  2I0R A;  3KRW B;  3SJL D;  4K3I D;  4Y7R A;  3EU7 A;  5FXY A;  2YNO A;  2HYE A;  1OLZ A;  2Z2O A;  3FGB A;  4GQ2 P;  5C2W B;  5K1C C;  3C9C A;  1RI6 A;  3EI4 B;  2XL3 A;  2AGX A;  4GM3 A;  3AL9 A;  4ZOX A;  3L4M D;  2G99 A;  4ZOV A;  2Z2P A;  3DSM A;  3RSE C;  3IJC A;  1OMW B;  4A0A B;  3UVK A;  4I79 A;  4J79 A;  3PSC B;  1A0R B;  1N6D A;  2AH0 A;  2CNX A;  3CIK B;  4CZX A;  2P9L C;  4GQ1 A;  2EBS A;  2IAA A;  2CE8 A;  4X63 B;  3RRM C;  2B5M A;  3BG1 A;  4A09 B;  1JMZ B;  3K27 A;  3OKT A;  4J77 A;  4PBY A;  5K19 A;  3ULE C;  2HXC A;  5GXH A;  2Z2N A;  3FRX A;  3EI4 A;  2P9S C;  1SQJ A;  3OKY A;  3UVO A;  5I5I A;  1QNI A;  4A0A A;  5EMJ B;  4Y5R D;  3RFH A;  4J0W A;  3SVW D;  1MG3 A;  5CXB B;  4JT5 C;  2IUP A;  5C9Z B;  5HYN B;  2HKR A;  4J78 A;  1SHY B;  3OKW A;  2H9M A;  2I0S A;  4ERQ A;  2PM6 B;  2P9I C;  4JXM A;  4GM8 A;  4A11 B;  2P9P C;  4X60 B;  5HE0 B;  3U4Y A;  4PBZ A;  4BH6 A;  4CI3 A;  4QT8 A;  1R5M A;  3PE7 A;  5C2V B;  4PXW A;  4CY1 A;  1JJU B;  2H6Q A;  2AH1 A;  3AL8 A;  5IT9 g;  4J81 A;  5IJ8 E;  4JSV C;  1S4U X;  1JMX B;  5CYK A;  2HJ4 A;  3SHF A;  4G56 B;  5HE2 B;  1NR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...