5C31A

Constitutively active sin recombinase catalytic domain reveals two rotational intermediates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLVIQILAMVSEQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Sin, putative plasmid resolvase dimer
total genus 34
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c31A00
5C35A 3LHKA 3ILXA 3BVPA 2GM4A 1HX7A 3PKZA 3UJ3X 1GDTA 3GUVA 2GM5A 2MHCA 1ZR2A 5C31A 3G13A 3LHFA 5C34B 1ZR4A 2R0QC 2RSLA 5C32A 4BQQA 1GHTA
chains in the Genus database with same CATH superfamily
3OTGA 1Y6JA 4FR0A 4OJKA 1VKRA 4BWYA 3DT8A 1F2UB 3K0HA 1U3UA 4M7OA 5H3HA 1YZVA 4CKBB 5K5EA 3JZAA 1FDSA 2IUSA 2J3HA 4GLLA 1CVRA 4TQUS 3Q0IA 2AV6A 1Y80A 2X3FA 2E1PA 3FHCB 1SVNA 3S68A 4YIHA 4BPBA 1N8NA 2F3RA 2C59A 3PJEA 4TXNA 5EUQB 2DP4E 3IKTA 2VP6A 3E6AA 3VAYA 4HRVA 3GDHA 3HYRA 1QG4A 3MEQA 3DUFA 3H7IA 4KI0A 2NP7A 2ID7A 1UANA 1G63A 2CLFB 3EE6A 4PN3A 2R48A 2Z1NA 4QUJA 3W3AA 2WTBA 4WXHA 4XYBA 2EDCA 1TZBA 1QVRA 3L8YA 4FYIA 3WHLA 2G0NA 5FFNA 2O2XA 4QJIA 3IMEA 4LDNA 3EJWA 2GO7A 4MLZA 5J59A 5TQ0A 5EA2A 1OV6A 3FR8A 4YX9A 4DRXA 1ZISA 2HRZA 3ZGXA 4YTEA 3ZXXA 4CG1A 4QARA 2G5PA 2QQ0A 4BE7B 1C8VB 4EJMA 3MJVA 1MPTA 3ND5A 1X13A 4P4SA 1S01A 1DMRA 1VHJA 1YOBA 1T4DA 3NP9A 4BO3A 2QRVB 1Q3TA 4C3OB 3VNVA 4OYRA 1IN6A 1CUHA 3A7EA 3TE7A 5SY6A 5CLHA 1ULBA 1U8ZA 4B40A 2IYSA 2NXWA 3VH2A 3OQJA 4W5QA 1H94A 3M9XA 4UQLA 2O0MA 5AHXA 3AUUA 4F9EA 1HGXA 4YMHA 1V8ZA 2I3AA 3ZBQA 3WSVA 4EI9A 4Q01A 1C3OA 1HETA 2G6BA 4U7TB 3O90A 3KWJA 3C6KA 2JZCA 3W04A 1FF9A 3IMGA 3D3JA 4FDAA 2A88A 2PRIA 3CZCA 5DX0A 4QG7A 1FJHA 4DDMA 1Y0BA 3O8OA 2HMTA 3L3BA 3QX3A 3ZCXA 4H7JA 3QY9A 4TQGA 4J1TC 1PR4A 2X19A 1NJ2A 1PGJA 4L4UA 3WDSA 1NWHA 2ZUEA 4U8GA 1T9GS 4AICA 4CG3A 2MSWA 3LPCA 5K03A 5BSRA 3KYDA 2QTVB 3TQQA 1AE1A 1GRNA 3PIRA 1L7RA 3R3UA 5CNMA 3VO2A 2ZPAA 4CJXA 4MHOA 2C5AA 4GX5A 4TTJA 3WGKA 4ABYA 2VT2A 3PQ2A 1JXQA 1OLSB 1TGVA 2J0VA 2C2YA 2A9PA 2YR0A 5F1YA 1HTWA 1SBCA 3ZGNA 4L15A 4F5YA 3Q4GA 1XNQB 2IPOA 5AVQA 2C77A 4ZGBA 1YKSA 2E1RA 3GVXA 3EVAA 1TQ4A 1XRSB 2GN4A 3ZD8A 1ACJA 4AU1A 4RV4A 4AKGA 3MWGA 4PG8A 4P53A 3KG2A 1IM5A 1HI9A 3JR3A 3SQXA 2R6HA 4MVJH 1NXOA 4ZT5A 2LKCA 5JROA 2GMWA 1PP4A 2EIXA 4B6JA 3JYHA 1DG9A 1IXSB 3SZRA 1KZGB 2EW1A 3PDIB 1HEYA 4L8VA 4MVJE 4ER3A 1OLSA 2HA2A 3LMKA 4AJEA 4CMCA 4BO4A 4Y6GB 3W3AD 3ABSB 2SKCA 4IMIB 2YX1A 4N5IX 2C0QA 2Q7OE 2PAAA 4N7MA 3ADDA 1W5EA 3QGMA 2OVFA 4TGLA 2BSXA 4OUKX 1R0YA 5TMEA 2NTYC 3SX2A 3E1GA 2OKCA 1C9KA 1XKLA 3G1UA 4AUNA 4CM7A 4DYHA 3V4OA 1JLLA 1CR2A 1W88A 2H1LA 3KD3A 1KYQA 2NAPA 3GAMA 3H11B 1A7UA 2QUAA 1N1EA 2DUJA 5JASA 4INJA 1ODSA 4GXRA 2WSSA 3U4IA 3OIGA 4X84A 2H7YA 1GTMA 5TDHA 3L77A 1XPJA 4RANA 3DC7A 2H16A 4AROA 4HXGA 2IS4A 5BXQC 1U9JA 1I7LA 3IBSA 2QVBA 1W2GA 1VFPA 3H5LA 1QU2A 4HDAA 4CTMA 4HC4A 4G1EB 5IASA 1QJCA 1G9XA 1HL7A 2CLMB 2AJTA 3EODA 1MDFA 3JV7A 3PNSA 3IURA 1I3LA 2PLFA 3GFRA 1YU9A 1R0SA 1RWMA 1ZD8A 2ZRAA 3N28A 3OF5A 4IIEA 1ZU5A 4LKOA 1RU3A 3WLJA 2VKTA 1CUIA 1S7GA 2GRAA 5D3QA 5E7IA 1WULS 5CB4A 4MYRA 2QR2A 3LL7A 1Y63A 2ZRIA 2Q45A 3DBOB 5L45A 2W00A 2YH2A 5GZ3A 4U0JA 2Q2OA 3EEFA 5D6NA 2OZPA 3QE2A 1XJCA 2AOTB 3UWSA 3K9BA 3Q5DA 3C39A 1W36C 4H1UA 3ZWWA 1RJ9A 3LQ1A 1OIVA 3DEYX 4MPRA 4DCGA 1E3MA 1SBHA 3N6RA 1UBGA 4YDQA 4II3A 1NVXQ 3KSUA 4QHSA 4E11A 1COZA 4UUAA 2NM0A 3X43A 4H1VA 2FMXA 3IPYA 5KVVA 4CEHB 2OL4A 1HQYE 1XZAA 4UULA 3DT6A 1Y4SA 2GR9A 4FFSA 4CDRA 1LQTA 2NADA 3OE7D 1JLRA 1UL1X 1YDGA 2XIQA 4AW9A 3SZOA 1T9KA 4L4YA 4QYWA 4OHKA 3ABOB 3PWZA 4OV6B 3HV2A 5CM2Z 2JANA 5BWCA 5JS8A 3U3RA 1A5SB 1M5TA 2GBGA 3BFVA 3IP9A 3ROZA 1QCYA 2FZGA 3BKWA 3D7RA 4UVGA 5LMNB 1LS1A 1L7PA 4MJ7A 3WTCA 4A91A 5EZYA 1YZNA 2E49A 5ALUA 3AYZB 2VVTA 4ALLA 1F0NA 1T9BA 3WSWA 3BL5A 4L6CA 1YB5A 2I2FA 2P5SA 3VSCA 1I6KA 5K8TA 3VZBA 2HRRA 3AK4A 1RE1A 4X91A 4GVXA 3GARA 3CONA 1RABA 2ONYA 2PZFA 3O8QA 5JVDB 4FDUA 4PNPA 1QK4A 2WJPA 2IYUA 2K2WA 1QGUA 3COWA 1ZUIA 4JOCA 3CN7A 2X3UA 1I94B 4Z7OB 1E1KA 3ZDAA 3ZWCA 4EVSA 1IYZA 2XJ4A 2YVAA 2VXOA 1X1CA 4R0VA 3PXGA 2AC2A 4CMEA 4DOMA 6AT1A 4AN4A 5BQOA 2QX6A 2PZ8A 4AYTA 2UUBB 5F3WB 4YP6A 1RM4A 3IMKA 4P93A 1MV8A 5FOVA 3UK1A 3DVQX 3VO9A 4EJSC 1M3SA 4NJEB 2PNJA 2Z83A 2R86A 4ZQGA 3PUXA 5TXGA 1PV1A 1BOOA 3RAGA 1FP1D 2DTDA 4J2HA 2POQX 4MWEA 8LDHA 4UHBA 3TPFA 1AZWA 4N76A 3ROEA 1KGDA 2ZREA 4J9UE 2XMBA 1TCCA 3RVQA 4E88A 4GPIB 1EFPB 2LD4A 2ORED 4BX9A 2ECKA 3QXGA 2X5JO 4M0FA 1KP3A 3ZZUA 1U4SA 4H1TA 4DNOA 4HEA6 4JNCA 2WWVD 4HQNA 1IMJA 3WDLA 4GP9A 4U9HS 5KVAA 4DCPA 4YRQA 3ON5A 1OREA 2C07A 4E31A 4KQEA 2VI5A 5BPFA 5DX1A 2I34A 5HJ7A 1I4LD 1KI3A 2PMKA 2QNIA 2JJ2A 1JS1X 3A9CA 4BVBA 3TB4A 5CXSA 2R3SA 4GKVA 4OHZA 1DC7A 4RVSA 1COWA 4XSVA 2KWIA 2QSZA 2FJPA 3OZDA 2QT0A 1WVMA 2DPYA 3WRYA 2PT6A 3E81A 3INRA 4Z1OA 4HUTA 3F73A 1Q0ZA 1IQ0A 3ICWA 3VHXA 2CZQA 2DWUA 4IP0A 2RHJA 2QL5A 4H7IA 2Z4RA 4NNOA 3IP6A 4ZOLA 2HIMA 4N03A 4CMGA 1GTG1 1BWPA 1OZGA 1UT8A 3R3VA 1CFJA 1G3IA 4LBZA 4MI1A 5GVRA 3WFZA 3I01A 5JS2A 3GLIB 1OGJA 1EFRD 4ROSA 5EXDA 1U04A 1T6XA 1F12A 2IVZA 2YWXA 3BB3A 3BDIA 3K4HA 4NP6A 2ZUTA 3AFOA 2VT3A 3VU3A 4B45A 2DH5A 1L5QA 1E3DA 1Q2UA 1ZCZA 1ARZA 1WZNA 1B74A 1GNQA 2BFAA 4WW0A 4YRDA 4JP8A 4YDSA 3L6DA 4ID9A 3TZ6A 3DC2A 4EJSB 3GGDA 3GIDA 1E5DA 1UPUA 2QZJA 2V58A 1R4NA 4IJUA 2LCFA 5KAMA 3NALA 1MRZA 4IFBA 3DDHA 1NQAO 2UKDA 3L9XA 1E9BA 2JJ8A 5E2IA 2J6IA 5A6VA 5JNSA 1B14A 4NDNE 1RYEA 2NYAA 4PZ9A 4LNAA 3EEBA 2W2VA 1P1IA 4PZ0A 1XLTA 4PXAA 4F5DA 4E3ZA 1ATZA 5F98A 1SUWA 2AH5A 2J9GA 1J0EA 3NNDA 3GLIA 4IF4A 4J0DA 4N01A 3F78A 4UU7A 2X0FA 4GE0A 1S89A 2ONZA 4YIKA 5EGSA 3FKQA 1QYVA 1FNDA 3DO6A 2FXVA 1YOVA 3EAFA 1U6IA 2H4ZA 1KP2A 1E4EA 2MSLA 4U7DA 3JRNA 1EWVA 1N6KA 3H9BA 3O84A 1R7RA 5BSVA 3M83A 1V8OA 4R05A 5HZGA 4LCEA 4EPYA 1K7FB 2RI0A 4O25A 5F78A 4GBJA 1J8DA 3QVLA 1V25A 4CTOA 1P1CA 3VDMA 5AOBA 1S8OA 3SKVA 2QT9A 1DAGA 2VPIA 3FUUA 4H3SA 4MAFA 4O29A 1LY1A 1G9TA 4UMEA 3RS7A 4ENRA 3AR2A 4GLBA 3UUGA 4R2XA 1MGOA 1OI7A 4ARZB 2O8BB 3E7DA 2JARA 2O3TA 5LP1A 1N9GB 1C7JA 1NN5A 1JECA 3KQSA 3WA6A 3TSYA 4DZTA 1AKRA 1JB1A 1QRDA 4A0FA 4RIEA 5BPHA 3G7SA 1EGAA 3OLVA 1N0IA 4TTPA 4X1IA 3H5OA 2J9YB 2L17A 5AH0A 5J4KA 1R0KA 3ZTTA 1VL6A 1V3QE 2NUAB 5CAEA 2QUZA 2Y1LA 3CNEA 4DILA 5FNVF 2LV8A 4AI6A 3LDFA 1E99A 3IT1A 5M2QA 2NZJA 2ZJZA 2I22A 3QV1A 2Z9CA 3CXUA 2QRLA 1Q77A 4G85A 1GPYA 3B20A 3ROQA 1BVHA 3M5DA 1L7NA 2FAXA 4MEJA 4B48A 2OC9A 4DHEA 4KK4A 4TKVB 4M0UA 3T9CA 4AO8A 4BEWA 4A10A 4DA6A 5JXHA 4DTIA 3DFIA 2Y2UA 1ORVA 3BFJA 4Y2UA 1N5DA 4KKVA 3TIXB 3GBVA 3MJEA 1UM9A 5ALMA 2CBXA 1DC6A 4J0CA 3VU9B 1JR6A 1P17A 1FYFA 4B8YA 5DP1A 2JFOA 1TF7A 4KRYA 2G0AA 2NZYA 4PYRA 1QRTA 1P9RA 4NX2A 5B2ZA 2Y1EA 1CY6A 3DEAA 2VHYA 1DNPA 4C7OB 3AIIA 4OJMX 1K8QA 1Z4NA 2BI7A 5JMPA 4UQOA 2XGMA 1H3NA 4Z8XA 4OATA 5EERA 3ZX4A 5AW0A 1EA7A 4IHJB 5EJEA 4M21A 2R65A 4ARIA 4I46A 5IN4A 1N25A 1Y48E 1R37A 3EF3A 1MQAA 1APBA 2GM4A 1N2CA 1AGRA 3N2KB 4I81A 1P1KA 3TW6A 5BYAA 5IT4A 1X3SA 1YS6A 5JSZA 1P0FA 4DV1B 4AT1A 3CVUA 4D3YA 4EIWA 4ZYTA 2P2ZA 1I3OA 1P2FA 2GDJA 2JGEA 4MQ4A 1QHIA 1RQPA 5JLJA 3L7IA 1T8UA 3OICA 3L4JA 3BE4A 2V6GA 2XVXA 3D6MA 2G4VA 2ONKA 2ZM5A 2D00A 4NI5A 2ECQA 4X1YB 4TS9A 1A3CA 2F67A 1XKTA 4Q3EA 5H4GA 3C6XA 4EHNA 5HQTA 1Q44A 1Z2DA 1ZCBA 3WNQA 3WMXA 1UBNA 2WNHA 2RSLA 5K0SA 5LWQA 3TEMA 1CZKA 4WZAA 5KOHA 3A4VA 1MFZA 1K7CA 2OSBA 1CCWA 3HJHA 5FL7D 3K6SA 2C8LA 2XOKD 5CFRA 3AR8A 1A9XB 1E2LA 4Y2HA 6REQA 1E6MA 2ZR7A 1KC1A 5H81A 5DO9A 1CY1A 3STXA 3GFFA 4C21A 1Q84A 5DHUA 1AQIA 5C5CA 1CUXA 4INAA 3F6EX 2P65A 3GEDA 4LV6A 3QPWA 4RFSB 4UC0A 4S0ZA 3PC7A 2CXTA 1DHTA 1Y9EA 2P2NA 3EIHA 1AKWA 1RJDA 1T9ZA 1RZVA 4YO7A 1U31A 2VPYA 2IHJA 3PNVA 1DFGA 3A1CA 4L74A 3F3SA 4FYPA 2ZIFA 5IBPA 1MOSA 4S3MA 4V1CI 3G5LA 2BEVA 3I76A 3VU8A 2P30A 4HFJA 2GD2A 2QN8A 4V0QA 5JQGB 3Q15C 1N7IA 3IA7A 3NYIA 3BB1A 3VX4A 4YRGA 1TA9A 1NBWB 2H2FA 4LJSA 4WXEA 2XAAA 4LJ9A 1TLFA 1RCUA 5B6PA 2NIPA 3FYUB 3I9V6 4GKAA 2XX3A 5FUQA 1UEJA 4W7SA 1Z63A 5A0VA 3KUUA 3MBIA 4MWZA 3HY3A 3GEPA 3KQLA 4A23A 2X40A 2QUBA 4GPTA 2ZSIA 2FDRA 4YEDA 2C4NA 4LC0A 4DAOA 3WK5A 4IHJF 4G37A 4H7FA 4O2BB 3SAJA 2IRWA 1ZJJA 1Z7WA 1UEIA 2HN9A 3BFKA 4W6QA 3ZH2A 2P35A 4MRRA 3T4PA 2G70A 3UXEA 5K8LA 1RFGE 1N36B 4K26A 4EW6A 4C0BA 1QQ6A 4EF6A 1C2YA 1X14A 1PJCA 2FFRA 1B8PA 1HNNA 1KFJB 1RLOA 2BEUB 4P7KA 3BZBA 2HGSA 1YFJA 1D6MA 1GFSA 2VQSA 1E9DA 4N6GA 2FR1A 3NV9A 4FE3A 4EYQA 3C3EA 1SKUA 2EERA 3NUZA 1FP6A 4FXPA 3L2OB 4GVLA 4KMRA 5DGCA 4HDOB 2G1AA 3CT4A 3OOYA 1K88A 4MEBA 4K6GA 5ALGA 2FWIA 4X85A 4C89A 4OIMA 1ZL0A 4TZKA 3FZYA 4L6AA 9LDTA 5CFZA 4XFDA 4Q1DA 1ITZA 2QY6A 1G21B 4KVZA 1QBKC 1N3IA 4EKNB 4HWGA 2BBSA 2X8LA 4Z0PA 3DW3X 4M4SA 3HUUA 2Z9DA 2YWEA 1IUNA 3U7FB 2H85A 2J9ZB 1DG3A 1X3LA 2FPPB 3P2IA 3NONA 4A7PA 1U0JA 4XXHA 5IJXA 2PYIA 4I55B 3NP7A 3FSJX 3ZCUA 4W7IA 3GGGA 4HD8A 3JQGB 2B1RA 1XX6A 5A3VA 3RKRA 4BLPA 1NRJB 2ZAOA 4NHEA 4LJAA 1RHQA 4L5BA 4P81A 1N34B 3HVKA 2QK4A 2APJA 3A9UA 3STVA 3V8PA 2J7KA 4DBVO 1HNZB 1UC4B 4TV8F 1PIWA 1NAHA 3IEMA 2X8BA 3UJCA 5JNTA 4KXVA 1M34A 4UBOA 3TCKA 4JASB 4INZA 4OUDA 2WSBA 4H7PA 4ONEA 3BMNA 1BA2A 2JAXA 4RSHA 4XUCA 1IM8A 1WJGA 5E6SB 3R44A 4R9RA 4C4TA 4Z9AA 2VTDA 2JVIA 4AJLA 1Y1PA 1ZD2P 4K40A 4URXR 1QKIA 3KSDO 2W83A 4HYQA 5A4FS 2HTEA 3GT3A 1XU9A 4BIIA 2Y05A 3EEIA 2XDAA 3RVDA 3ZLUA 1QRRA 1T0PA 1GNLA 1ISFA 3QLVA 721PA 3SM3A 4EY8A 4XA8A 4H6PA 1C9DB 5EC8A 4YAJA 1NFRA 4Q6BA 5A4DA 2YJTD 4FDVA 4CU2A 5JV5A 5THKA 4ZPXA 6CHYA 4QODA 4MUBA 3CO0S 4M9QA 4DV2B 4A8HA 5EHXA 4OI0A 2VF5X 1XNJA 3A1SA 2O8DB 1NBIA 5JO9A 3GFGA 3FYTA 3L8CA 4N18A 1E3WA 4ZT6A 3B52X 4ZC1A 5TEWA 3V80A 1UPFA 3E15A 5IC5A 1YT5A 4KTTE 4UU0A 5EWJA 4LBWA 1TVKB 1EWTA 3H2BA 4BDTA 4TRJA 3BXEA 4HXYA 2BI4A 4JQCA 3FNIA 3MWJA 5BR8B 1K5GA 1R0ZA 1CQIA 2ISSD 5EE9A 5EUCA 4KFRA 2Y8EA 4NE2A 4D3DA 4DJAA 1BHO1 4R1MA 1C9MA 1HUQA 1TM7E 2H07A 5CVUA 5LQDA 1USKA 2Y0PA 3VZDA 4JL5A 4CM1A 4A9AA 3P32A 4NY1A 2DJ5A 3KSRA 4TM7A 1A69A 2YWHA 1VC2A 1N2XA 1T0BA 1FYXA 1X0XA 2HM7A 3QHAA 5A4IS 4TLMB 3SSMA 2QRGA 4U8HA 4JZKA 3FWHA 5FA6A 4K1XA 1YSCA 1RYMA 2GZAA 3DHEA 1E2MA 1RRKA 4G89A 4PAGA 1JGTA 4ZKEA 3ZY6A 5JYDA 1QHFA 1T2DA 2FJ0A 1GSIA 4X7RA 2VJYA 3DE0X 3ZEIA 2NZWA 1LSOA 4TL7A 3SYLA 1T9GR 2FUKA 2ZJ4A 3KV1A 3HYTA 2J09A 1E3SA 4Z7JA 5L3QB 1EDBA 1OR8A 1R0WA 1HLDA 1RLTA 2JB9A 1K27A 3MTQA 5ALKA 4PPFA 5HUJA 2CCGA 1FS5A 4FC7A 4Q4AA 1AUOA 3GJ3A 2DAPA 2PUJA 4G5FA 3ZXUB 2R7KA 1W7AA 3E9EA 1XCBA 2IHUA 3S2FA 5TX7A 3AR9A 3JD3A 4B6GA 1J6UA 1PJTA 3TYXA 2Q1TA 2L42A 3O2NA 3RC8A 4BP9A 4LX0A 9ATCA 5HK9A 2FA9A 2FPSA 1POXA 3CVOA 4MV7A 4UTNA 4AUKA 3CV3A 1CLEA 5A2QA 1ORTA 2I67A 2LXNA 3K94A 4RZIA 1TPZA 4PO1A 1BMQA 2KBEA 4NEHB 2CMDA 2OE2A 4IJKA 2ZE8A 3SXUA 3TRFA 2OCKA 4QXRA 4CIAA 1LDMA 1L5SA 2XUGA 2YOGA 5DGDA 2H65A 3V34A 4WY2A 2E87A 2W22A 3M6XA 4W1RA 4G63A 3D5EA 1G3UA 3JQ9C 5KNBA 3WL5A 1Z0DA 1DUVG 1P39A 2FSGA 5IAGA 2GASA 4KV7A 3ZCPA 2O5EA 2VTVA 3I1FA 3L05A 2YCLA 3LLCA 2GLXA 5CB8A 4HDNA 1QF7A 5FI1B 3BRWD 3T7RA 3ZWYA 4MMYB 1O9GA 4NAUA 2IZ6A 3MUEA 3PTLA 2ZW9A 1L5LA 1IY8A 4A2CA 3VR3D 3LWNA 1NUQA 5KJ6A 1DJOA 2EEZA 2W2PA 1HRDA 4J6EA 3UT5A 4CEIA 1RHUA 5IVDA 1CQPA 3CLSD 4UM9D 4IMRA 3AX6A 2ERCA 4S1OA 3HU3A 1T5HX 5LYJB 1T9HA 4CMAA 3PGKA 3TGPA 2VDVE 4QBTA 4TV8B 1MH1A 3VZRA 3HPQA 2BN4A 4BJ5A 1B23P 4BATA 5JS6A 3QA9A 4H35A 2XQVA 3FCOA 3R0VA 3AONB 4LZLA 1GGMA 3OURA 1XEXB 4MS3B 1M2FA 4PGHA 3A58B 4TS1A 4DXDA 3BDAA 3ONNA 1W6UA 3BF8A 4O4JA 1TK9A 1LFAA 2PX6A 1U0GA 2EHDA 2Y92A 1L8LA 4U1RA 5DYGA 1PK8A 4MCIA 1VG8A 4TSFD 2PKCA 2IXFA 2Q5CA 3USES 4DARA 4F8JA 5HSGA 3BXPA 5D84A 3GLQA 1ESNA 4OTZA 5FYDA 1J2TA 2QUKA 2HLDD 2X86A 2Y9PB 2Z3WA 1NVWQ 1UOOA 3FCXA 1N2SA 3OQBA 4MKXA 3PPWA 3TLEA 2IF0A 4Q4DA 5G4KA 3O4VA 4YACA 4W1QA 3UH0A 3GCXA 3STWA 3G9XA 4YC7A 4IKEA 1AQUA 5E4YA 1MC4A 5A5DA 5BYKA 3ZEAA 4I2NA 5IN5A 4TSKA 1NMYA 2J5RA 3FOCA 4UREA 4A0RA 4CVNA 1RKXA 3L1UA 5JI3E 3BAFA 3KVNA 3KUXA 1Y7IA 3OQPA 4Q3OA 4DR7B 1VJDA 2BAGA 4FWBA 4XEHA 5B1EA 2UU9B 3IDOA 4Q4AB 1W8DA 2VDQB 5FAXA 2B35A 2XBUA 3SYTA 3WP0A 4B3CA 2A0KA 1W9MA 2H0QA 2Z9BA 4N82A 5L3QA 3OC0A 1ZP6A 1Z6YA 1C9EA 3PB3A 1HKUA 1DCMA 1OOEA 4FOTA 4MVCA 5DT2A 5C1BA 3IPLA 2OHIA 3C3BA 2LR0A 3IHTA 3GFSA 1G4AE 3PFHA 2WU3A 4DM4A 1Q1ZA 2B1GA 4V38A 3KKKA 3AXTA 3C3CA 1N5RA 2D0PB 3LDGA 4UTXA 5KVQA 2CUTA 1B41A 2UAGA 3P52A 3LSYA 2DKNA 1DAFA 1V1MA 3WL4A 1Q3KA 1KAGA 4URFA 3PC3A 5E6SA 3WK6A 3D3WB 3N0RA 1BE1A 3F6YA 4JC5A 4XD7A 5KTSA 3U4QB 4AC9A 1KMCA 2P67A 3ELWA 4PCUA 3UXMA 1GGFA 3RUDA 1ZJ6A 5GVSA 4MWCA 4EB6B 1FX0A 3NC4A 3I4FA 2GXAA 3CZ5A 2G36A 2KHZA 4P2GA 3O8LA 5AW3A 4IQFA 4BQPA 5FEUA 2GDZA 1OMOA 4Y6OA 2CC2A 3CSDA 1PHPA 4FE7A 1VG0B 2VQFB 3H4MA 4CLEA 1NXSA 1IJFA 2HJ9A 1BDHA 1JZQA 1YS9A 4HGOA 3LSTA 2OD9A 4N40A 3HB7A 1QG6A 4ZI5A 5B1SA 1NMEA 2IOHA 5DASA 2G4CA 1TM3E 3WIBA 4R8KA 4BKPA 1UK8A 1H0SA 1DUIA 3G5AA 3SN6A 3SQMA 3DMHA 1P19A 2CJWA 5JY1A 1WF3A 3RFFA 3W5AA 1LGYA 3JATB 2OXTA 2WK1A 2DHCA 4V2IA 4EHIA 5CBPA 4KWIA 1P7CA 1GSAA 3K1YA 1C3VA 4WRRA 1QANA 3P2KA 3ZDXB 4TLBA 1FRFS 4KYVA 3U7QA 1P5ZB 3IP5A 2Q41A 3N75A 2Q5QA 1KYVA 1J2EA 2FPMA 2II6A 4Y2GA 4BP8A 4DIBA 2RHLA 3OUTA 4I4LA 4JN6B 1RAHA 4UTVA 3NJ4A 4HYEA 4OL0A 1RSZA 4UBKA 3WGYA 2DFLA 2IKSA 3ZK9A 4GKJB 4J4HA 1RIFA 1M6NA 4PLTA 3CURA 1GL6A 4BC0A 4K3VA 5IXYA 3B78A 2OY0A 1YZ3A 2ZYIA 4P08A 4AS3A 2D2EA 1OB2A 5F2NA 3O3CA 1G5FA 2I6XA 1CHNA 2QX4A 4X1KB 1GTVA 5E9AA 4MUXA 2VLIA 5A9SB 5CLLA 5BUZA 3LK6A 1JEOA 1X7XB 2D74A 3E3LA 1EB8A 3OA0A 5TF0A 4IUCS 2VPQA 3PD0A 1U3DA 4UTOA 3KEMA 2FK8A 4AY2A 1DB3A 5AKXA 3AUJB 5F3RA 4Y2VA 3DOUA 4K3UA 1IN5A 1E89A 1CR1A 1Z47A 2Y1DA 3MCAA 1M8JA 1CFZA 3D0RA 4HTFA 4K6FA 1L4FA 1UC9A 3BA1A 3CW2A 3KB2A 3L0DA 3AB7A 4M2LA 4NG5A 2IL1A 1H0RA 3WLPA 2JFNA 1DWOA 1UOPA 2AT1A 4L3VA 1V8DA 1XKQA 1VPVA 2FR0A 5KYVA 5J9FA 2E4YA 2ORWA 3Q1KA 1BE8A 2XF8A 2PKWA 3E4DA 2PRYA 3HHEA 3K8OE 4XYEA 5D87A 4YRZA 2PL1A 3ZJTA 1OGYA 5SYNA 2JNWA 4A0SA 5F12A 3IQFA 4Z53A 2DUWA 3JQBA 3H5IA 4BNMA 4YMTA 4MV9A 3VBEA 4EPWA 1JHDA 4FZJA 3K7EA 5CPBA 3RYCA 3RUPA 4NV3A 1DC4A 1M0TA 2VRCA 3SIPA 2ZJ5A 1SUIA 4JVOA 4CCWA 3OCWA 1JEDA 3A1FA 4LZNA 3UEOA 4E09A 4K9OA 4CI0B 1AMOA 5EI5A 1TC1A 2RE8A 4Z4GA 5KYTA 3MMZA 3S70A 3KR2A 3VPHA 1AJEA 2J33A 4QGHA 3X2FA 5KVSA 2QAJA 3DXFA 3WL3A 4GZ5A 3K70C 1P6UA 3EG9A 2Q3CA 1JIQA 4PR0A 2JFFA 4Q7MB 3RI3A 3GMIA 4AXXA 4RKYA 2ZRJA 3RVSA 1UBFA 3GJSA 1TMYA 4CLOB 1IZYA 1FUYB 2G6TA 2JDID 3TZKA 4TVOA 4W8GA 3E22B 3FNQA 1K0FA 2WW8A 1Q5PA 4YWHA 3Q5EA 4WOKA 2OAGA 3D8SA 2BTOA 3D6JA 4GZMA 3FGZA 3RSCA 6REQB 5I8PA 1RKBA 2Z09A 3AJAA 4BLTA 3FBGA 1XEWX 2P4EA 3B1FA 3FTNA 3HCEA 2NO0A 1HFKA 1QXSA 3FF1A 4Y2YA 3V5NA 4R5HA 3HL4A 4ETNA 3VR5D 1UBUS 3EIOA 2VNSA 4GUDA 4HTAA 3FTFA 3FZNA 1H1LB 4BVAA 2DPHA 2JFQA 2OZVA 3B5JA 1ZUNB 2BM1A 2QTWB 3B9QA 4PYMA 1GRRA 2QBYB 1THTA 3AZOA 1ETUA 4XX1A 3DEZA 4WV3A 2JAPA 5C8YA 4L28A 3E5NA 3A9SA 2AKAB 2XEXA 4RQAA 3QLUC 1SBIA 4DDWA 3U5TA 4YAEA 1L5YA 4O02B 1T6YA 4X45A 3B1YA 1E2GA 2PSEA 1W4RA 4PTZA 2CFTA 4EATA 1NQVA 2XVMA 4MUYA 2FW6A 3DAHA 3GROA 4RVFA 2ZQ5A 4EG5A 4GG1A 1K4KA 4EBBA 5HIMA 4GFDA 2HPZA 1FE8A 1AO3A 2PX5A 2XMQA 1YHYA 3ZVRA 1UWKA 4JGIA 3VPAA 5IPFA 4A2PA 4FGZA 4JDUA 5AKIA 5BQ3A 1ZSNA 4PSVA 5EWLA 5IAEA 2FPKA 4N5DA 3ELBA 1T4GA 1RPZA 3MIZA 4WNAB 3R20A 2XMZA 1S7CA 1ZW6A 1IN8A 3BA6A 1PGNA 2QE6A 2ZIVB 1TEZA 3LT4A 3M3HA 4WKBA 2OMEA 4QOEA 3ORFA 1BU8A 2CLIB 1XEXA 2H1WA 1KH1A 3OT1A 2PFSA 3C8DA 1QWOA 3B1ZA 1VHTA 1Z4KA 4QPNA 1M6WA 4LPKA 5ANRB 3RYTC 1N0WA 4AB1A 1VB5A 4JOSA 4N3BA 5HVNA 2G25A 3TXYA 3V2GA 2GF9A 2QSUA 3QBTA 2F1IA 5M7EA 4MKFA 4IIBA 4TM8A 5I9SA 3ODPA 4KB5A 1WG8A 4XQGA 4N0MA 2XHEA 1VDMA 2F55A 1MB9A 3GRYA 2LDXA 5GGYA 2VATA 4B7XA 4O2RA 1WNTA 1LDBA 3OEWA 2OZKA 3GP5A 3SHFA 1UH5A 4CKXA 5D86A 4MA5A 3B1KA 1L7XA 1EUDA 4LYYA 3NATA 1SBQA 5ER6A 3JALA 2HA6A 1RC1A 2I4OA 3JTMA 3VO8A 4RFSA 4YFYA 2I1QA 1WMSA 1OJLA 2XNDD 1XI2A 1P81A 1QX3A 3OZTA 4FVTA 4ZYWA 2DM6A 1BXRB 1H2BA 4KTVE 4E03A 4PSCA 4DNXA 4CIYA 2DY1A 1P44A 3BRQA 1XQYA 3NT4A 4RL6A 2ZI3A 1JIXA 3UC5A 4GEGA 2R8PA 5CVTA 4MDYA 5HRCA 4FCCA 4F3RA 1P74A 2FRXA 2JCVA 3ICQB 1UK6A 4BFXA 2BKUA 4RHEA 1R6BX 1HFJA 1Q74A 4WMLA 2ZDQA 1BWRA 3BICA 3OCXA 1FIUA 2C9BA 4ASUA 1M2EA 2ZUSA 1AKEA 3ZH9B 1JLKA 4F3CA 1K7SN 1XRMA 2I4IA 2QPOA 3L6EA 2DHQA 1NRXA 3M5PA 4M60A 4S1WA 2NU6A 4I8IA 3AF4A 4NBNA 1ATIA 4V0ME 3RVLA 3W90A 3ZWOA 4JOQA 4MMXB 1QWSA 2B6HA 1Y1TA 4IQ8A 1XC7A 3IAM1 4OEHA 4E7PA 3WLEA 2WFAA 4QOSA 1UBOS 4QO7A 2GD6A 2GKGA 3GVPA 1KS2A 4DLWA 1KZ4A 3JR7A 2AX4A 1HY3A 1NT4A 1SRRA 4EL5A 3S81A 1M34E 4URVR 4OJQA 2J5XA 3GH3A 2XCIA 3OKAA 2HU2A 3MJTA 2JIOA 1II8B 3M33A 5K99A 4EG3A 1SCIA 2C2MA 3GIWA 2A7XA 3DEIA 4WCDA 3JWJA 1ADBA 1G5TA 3G9ZA 3KOXA 3LZDA 1DS6A 4YV0A 4BNDB 2B34A 2X15A 2FLKA 2R96A 4XQCA 1BOFA 4EMTA 1JTVA 2H5LA 1ZH6A 5BNZA 4EFNA 4GPD1 4BNIA 4D02A 3JQPA 3T94A 5FLYA 4PC1A 4ASUD 3EDQA 3WV5A 1ILEA 5JU6A 3DAYA 2B78A 4BEVA 3DKRA 3FTDA 4LE1A 4Z0HO 3H0CA 1NQOA 4N65A 5FXMA 4D0RA 1ZBDA 2FCRA 3AVQA 2I6QA 1JV2B 1LLCA 1K4MA 3JSAA 4WVFA 3GAZA 4AJ1A 3JQGA 3BJZA 1EK6A 2HJRA 4CM8B 1O58A 2C88A 1RR6A 3RT1A 3I92A 1D2EA 4HSGA 4HDCA 4LX8A 4XJVA 2RC5A 3OJOA 2BJHA 3OBIA 4I3HA 1TF2A 3HZOA 4J4BA 4XCXA 3QFSA 3OQIB 4KBGA 3R7DA 2C78A 3AUXA 2NXEA 3RS0A 3IDSA 1SZCA 3U7QB 1YQQA 1DKUA 1TT7A 3CNQS 1ZDMA 4L9SA 4E4YA 2AR9A 2NVWA 3R3ZA 2WM9B 1D09A 2B30A 3OM0A 4HZIA 5CX1A 2FSPA 2HI0A 1VXOA 3H83A 4OXNA 4TN5A 1TT5B 4PX3A 2WJHA 3EG9B 3F4BA 1AXRA 1ONNA 1V7PC 2ALJA 2BFBB 3SICE 1U94A 2EP8A 1SN7A 2X6TA 2GD0A 1AU9A 4JJFA 3B82A 2AJBA 1Q95A 1Y7PA 1A96A 2Q6KA 3Q12A 4P36A 5ARDA 4E4RA 3IBFA 5B2FA 1HNWB 2F43A 4OOFA 5DCYA 4B3HA 4C08A 5IM4F 3S2YA 1XD2B 5PGMA 2CUZA 5JNUA 2UYHA 4OHOA 1JQJC 2IIBA 4KCGA 4RW0A 3UXHA 2DFTA 4JAVC 3KXPA 4CLDA 4E94A 5IHPA 1VRWA 4IV0A 1CUJA 1HZZC 3AI1A 3MWKA 1T6NA 2CNDA 4P4TA 4XTCS 2WTNA 4ZO8A 1KHTA 3NHUA 3ZHZA 3UJHA 1C8KA 2PZMA 4A73A 2IXAA 3K9NA 4HFNA 4ZHQB 5LP6B 2GO1A 1ECLA 3D4IA 1NASA 3FX2A 5K20A 2W6ID 1FLDA 1IQPA 1WBJB 3RW9A 4HH4A 4IM7A 1SC3A 1X2BA 2X6QA 3KSMA 1HDXA 3KFXA 4HBZA 1NDQA 4Y6PA 4D42A 2BGUA 2P0YA 4EB8A 4K0KB 2C57A 4RGVA 1KY3A 4TXJA 3BTOA 1D9ZA 4Z8YA 4GL2A 2AZTA 1R9MA 1CJUC 4YCMA 2DR2A 2CNWD 2CNBA 1CF9A 1X1RA 2D5BA 1O6GA 2FSVC 2YV3A 3CX8A 1CYDA 2BMVA 2XHZA 3BE5A 1LUAA 3BK7A 3MB5A 5EJ7A 1O8BA 2JCYA 3ZI7A 4WUVA 2ZI6A 2P4UA 2JJYA 3ANXA 1MV5A 4E2FA 4MA4A 3K4QA 4DPKA 2A58A 2PLWA 3FUVA 4E51A 1HSZA 4OXXA 2BR5A 4HWKA 3RF7A 4DZRA 3IT3A 2ZTHA 1KH2A 1AXGA 3D8BA 3GZTB 5IT5A 1ZINA 3QFRA 5FA8A 1G8MA 4KHPB 2Q3FA 2EJWA 3ZY2A 1S8NA 3W6PA 4M0PA 3RBVA 2NVUB 3P2YA 3ZQKA 4U9IS 5LU9A 3HXQA 3B3GA 4NXNB 3B13B 1DQRA 3M2TA 4BLWA 2IQIA 1JJVA 5C8DA 3DEJA 2NX2A 4OX9Y 5FP0A 2YHSA 1E63A 2ZBEA 3NDRA 4QU8A 1O08A 4UBMA 4X61A 3BDVA 4WTOA 4OF4A 3WTBA 5DHAA 3TO5A 5C4IA 1YB7A 5LN1A 1U65A 1YUMA 2ZJ2A 3I12A 2G04A 4F46A 1A9QA 2WJ3A 4HNTA 1Z22A 4MW2A 4XYLA 2CFRA 1MJNA 2I4LA 3ANTA 5ALIA 4AS1A 4RGYA 1L7QA 4JK3A 1JBEA 2NLOA 1XDGA 3CEAA 2RH8A 1UFOA 4DYVA 3C4JA 1PS9A 1R18A 3HB9A 2ZIWB 1C8BA 1ZXXA 4FT2A 3RVMA 3T54A 4EFMA 1B7GO 2G5CA 4KBYA 4OFZA 5EUMA 2ZAGA 1ZK2A 4OHXA 4P7FA 4U5QA 1WKVA 5DM60 3L82B 2V7EA 2HA5A 2X77A 3G2NA 4EAAA 3RHFA 4WINA 4L07A 1XZIA 2XKJE 3DLPX 4EOGA 4QRDA 2A59A 3KTAB 3OOJA 3TNFA 3PDUA 5FWYB 4D92A 3IOBA 5EHGA 3HKEA 1W48A 3O2QB 3AKYA 4ZVUA 3S2IA 3L7JA 1WVIA 3P2EA 4GBED 3LPDA 3SI7A 1IONA 5HFNA 1EM8A 5ILOA 4Q3AA 2X5XA 5DBEX 5AJZA 4WNCA 4CG2A 2IX3A 2AE2A 1UM8A 5JATA 1AUVA 1QP8A 1GT91 3TLAA 3LXRA 1CEYA 3HXKA 2Q6TA 3TR5A 3EWSA 2CL0X 1YHZA 3K1JA 4QPPA 4JENA 2B7CA 4CV0A 1Z2OX 3V3TA 3QF7A 3TWOA 2Q8QA 2AN3A 3UTCA 2XBMA 3ZI0A 2FWAA 4MWTA 4IKOA 5CA0F 3KOUA 4JI1B 1GYRA 3C5VA 3QLJA 4V03A 2J4CA 3S4YA 4EB6A 4HMQA 1ECJA 1F6WA 1GQRA 2VH5R 4P83A 5HQJA 4EFKA 1FXUA 1UDXA 2A0YA 2R7LA 2GF2A 2Q5JA 3CINA 3NAZA 4G1UC 2CDRA 5JVDA 5HK8A 2VZ8A 1JVSA 2LW7A 3SD7A 1T2CA 1I1HA 3TLGA 2YNMC 1FUUA 1PJAA 1TXGA 3TNDA 4QO8A 1RYZA 4PZAA 3DE4X 4Z3KA 1NC3A 3FFBA 1P72A 2X3YA 3LHDA 4DL9A 1N5MA 3JY6A 4M7RA 2AG0A 1SMKA 2DGDA 4FU0A 5EWMA 4BVJA 4ZEOA 3H84A 1R4ZA 1R50A 2N1BA 1Y1KE 2B21A 2X58A 4LHZA 5KSYA 3PUIA 4N3NA 1L0BA 3DO5A 3ONVA 2HA7A 1Z35A 2ODEA 3CMCO 4UATA 4XPIB 3U39A 4ENPA 2ZBVA 6YASA 1UKZA 2AG1A 1FSGA 4NFHA 1X80B 3EZYA 2VKQA 3FB4A 5C1DA 4YY3B 1ZJ4A 5FBWB 4AN0A 3HXOA 2YZMA 2PZKA 3P26A 3N2LA 5FPPA 1PWXA 2EX1A 2OSVA 2C2OA 2NQ2C 1OX4A 4UUQA 2CK3A 2LRHA 2PX3A 2B5OA 4FLEA 3EPLA 1D4OA 1GNRA 2XXJA 4KXNA 2QPAA 4QYXA 5H3LA 3O0TA 2WILA 1DIOB 1NYLA 1TA0A 3SKXA 2CVOA 2FVYA 3X1ZA 2ZVJA 4JJ6A 2AQHA 4BVHA 1LVGA 1H8HD 4HPXB 4UDYX 3SXJA 2DECA 3N8GA 1QB7A 2GKSA 3I0ZA 1Y5MA 3ORQA 4URUR 4R8RA 4V0NA 2ZCJA 1EAMA 1KI8A 5FWNA 2VAWA 3F47A 3ZOZA 1Y6RA 3ZU3A 1FQJA 3NDIA 2IOFK 4P9NA 4C4YA 1NRIA 1ENYA 3S6JA 1QYDA 5EP4A 3ZJUA 4BQIA 1XMJA 5KHOC 3PQ7A 3QEJA 4TT8A 4GD3Q 3OMLA 1NW4A 2NU7A 1IU9A 2B9EA 3HUEA 3KDSE 2BKEA 4IIJA 2X7XA 3L8DA 2PO5A 1ZUWA 2OCDA 2O2EA 3DL4A 2LZ0A 4A2QA 5HZHA 4CQLA 3H9QA 2LKDA 2WFLA 1OQAA 3TRIA 4CGYA 4DPMA 3W34A 1W4BA 3BC1A 1MT3A 3STTA 4C0SA 4MP8A 4W82A 3G7UA 5AQ1A 1E2BA 1N1DA 1HRKA 1VGRA 1LK7A 2CXXA 4N5MA 4PY2A 3VH3A 4F4UA 1VM6A 4JU9A 3UK6A 2J9XB 3HA7A 1CPYA 1PD1A 2I8CA 4OGLA 1MT0A 2O6LA 2HQBA 4RLSA 4FFLA 3UICA 3CF4G 1YQGA 2VNJA 1K6IA 2BHNA 1UINA 4K9NA 2REQA 4OMUA 1TO2E 3G2IA 3O8DA 3NASA 1E9FA 5LJIA 1MVOA 1KEUA 5JXGA 2OBNA 1V48A 1VLLA 4PHFA 1GNPA 1AKVA 1NKVA 1PFKA 4JJEA 3CRNA 5EKXA 3AF1A 3VU0A 3EQZA 3N2EA 4NZNA 3O3MB 4UNSA 4JH0A 3UMCA 2GCEA 4IHJA 3WK8A 3ZV6A 1E5TA 2JIQA 4IBOA 1OZHA 3UUFA 4EHHA 3TLGB 3TSAA 1E8NA 2YV1A 4BMVA 3UPDA 1UC5B 5AI6A 4BYMA 2P1ZA 4L75A 4PYIA 5JPCA 3KLMX 1PF7E 3LXXA 1NU8A 3JVDA 2WVGA 2VHZA 2HK7A 2CD9A 4TV8A 3HCNA 3P2JA 4O4LF 3RAPR 1LX6A 2A0FA 3IQIX 3NTLA 1EM6A 1T6BY 4GI3A 1OW3B 1SULA 1I5OA 3IA2A 4MVJM 3T8YA 3V4VB 3PEWA 2I5PO 2I54A 4QOIA 4EAQA 2FFHA 1XZKA 4TWJA 2W4MA 1S02A 2BMDA 2MDTA 3I8SA 4QOHA 2HSWA 2VHVA 3R7WA 3W3ZB 1USGA 3ZPXA 4NZMA 3PQ5A 2P77A 3OX2A 1RZRA 1N57A 5TY0A 4D4JA 2E37A 3AFIA 4RQTA 4GYKA 5FR2A 4LBYA 2FR8A 2R87A 5BWOA 3HFSA 5EJ4A 4RK1A 1KETA 1E3LA 4R6XA 1SCJA 3NVKI 5SY9A 5ICMA 3IR7A 5EEHA 4D8YA 2OYCA 1EH5A 4EPRA 3RSQA 3X1WA 3RTAA 3G02A 3NEJA 2P9HA 3ZWAA 3VYTB 5LD2C 4IJMA 2AMVA 1HK7A 4I08A 3VZCA 1JMVA 4B7UA 2PM8A 1SVWA 4R83A 3V8VA 3CWQA 3R5HA 3RC1A 1JDBC 1L5VA 1PUJA 4B2IA 1E3EA 3C7CB 2DPGA 3I6IA 2QV0A 4LOLA 1IVYA 5AM2A 3VPFA 3G9QA 1XEFA 3GG9A 3L8HA 2QV7A 1XZDA 1BCSA 5F5XA 4CUJA 5HCNA 2OHXA 1V26A 3FLEA 4OQEA 4DR6B 2F64A 1Q0TA 1VIVA 2WM2A 4NJOA 4XCVA 2DBYA 3SX0A 3NT2A 4YWJA 4JSRA 2WE8A 3TD9A 1PFWA 2I6TA 2VS1A 2PGDA 3I05A 4EZIA 3MOGA 1J90A 3QPUA 4O1HA 2Y1FA 1FJ2A 2WHXA 1NW5A 5JIBA 3H5WA 5JISA 4JLSA 3N5CA 4ZQIA 3UYKA 3GRAA 1HOTA 4LZOA 3H2HA 5I7EA 4N0PA 3DR3A 3QP9A 3SSNA 4D79A 5KQGA 3IHLA 3WQSB 4JUDX 2K6GA 3RYIB 3QWHA 1V5WA 3KVYA 1OF1A 1Y34E 3OZEA 3WGOA 1NN1A 2WB4A 3CU5A 3O93A 3RFTA 1CF4A 3D6FA 3M9LA 4MQEA 1FX0B 2RJNA 4AJOA 5JSUA 1SD5A 1MABA 4NCXA 3UMRA 4N0DA 3ZVLA 3R0IA 4BVLA 4QU5A 1X8LA 4D0NA 1TB4A 4JQZA 3E7XA 4RNCA 5EE1A 3HJUA 1V39A 4MS4A 5GOTA 2C3YA 2ZYHA 3C5EA 3PS9A 3GFPA 5DMHA 4UE6A 3Q7TA 7MDHA 1UBLS 4HSEA 5JJKA 1TYBE 1U0LA 2AC4A 4DQUA 4DMUB 4JEUA 3FHLA 3O6VA 5B3AA 5D1HA 1C4WA 5K0ZA 3H2GA 1V95A 1Z4MA 2H48A 3AVWA 2SKDA 2QGZA 1HDOA 1DPFA 4GNKA 3VR0A 1K9SA 4PZCA 5CYGA 4GRIA 3K2EA 1W49A 5G4LA 1USIA 3PGXA 1PJRA 4CF4A 1NVVQ 2FY8A 4JQSA 3FNEA 4AJIA 2P2LA 3IAUA 4IIVA 4CMBA 1G8JA 1E2HA 1R0BA 1XMVA 3AR6A 3ECCA 3K1AB 3MWEB 4L16A 3GPBA 4ZXPA 4H3VA 1SBTA 1UFQA 1XTSA 3BK1A 4MGIR 4S2UA 3IIMA 5REQB 3U0VA 1T3SA 1V8BA 2WQ6A 4MZDA 3CLRD 5LKAA 4GLFA 4CKCA 3SBOA 2VDWA 5LQJA 4E15A 4BU1A 4PNZA 2AMJA 1THMA 5DWVA 2OK7A 3FG9A 3SC3A 3C3PA 4ER0A 1GNSA 2P9EA 1Q1GA 3UK0A 2ZSKA 3OESA 4HH1A 1NJ8A 2AB0A 4CQNA 2C00A 3OHMA 3LUDA 3GJ4A 1L4HA 4JYBA 1JHXA 3TAUA 1WB6A 4AMVA 4OH1A 3ZYZA 2B1IA 8ABPA 3BEOA 1JEQA 5IJ0A 5JDIA 1S3IA 4E5VA 1KAQA 1OLUA 4R6WA 4MKGA 4YA6A 2BE9A 2EGUA 5F73A 2BGTA 3UGJA 3HA3A 4XJSA 5FBQB 4O2BA 2R6CA 5CFNA 4JODA 3O83A 1ZVJA 4XASA 1FU4A 5LQAA 4JP5A 4QUBA 1X7XA 3UHAA 2NSDA 4NF2A 3AL0C 3O7MA 3UHFA 3KKZA 3CA8A 4YJ3A 5ALJA 4ESHA 1Q1NA 2JRLA 5CA0A 2QDKA 1ZNZA 1U2QA 3ZWDA 5K0JA 3FCEA 2F59A 3RWOA 1J33A 2D2XA 3KQYA 2D1QA 2OQIA 4EJ2A 1XTJA 4M7PA 3V7NA 3W2FA 4AUMA 2CXRA 4ZFNA 5IUNC 1QIEA 1YZGA 3BILA 1HQKA 3CW8X 3U7RA 1ZICA 1MTZA 3OZXA 3CLUC 1XLTC 3DV0A 3SE7A 1U1CA 3AESA 3EGCA 1N9KA 1V96A 4OP1A 3EGOA 2IDMA 4ICIA 2UUCB 1G60A 3BQMB 1MOQA 1X7YB 3WL6A 3QFHA 4B2LA 4F91B 4TQAA 2VK8A 1T3TA 3AF5A 3JWIA 4W99A 1BTOA 2RFLA 1MOZA 5ELMA 4NHOA 4KIGA 1QG2A 1A77A 4WBSA 4EF5A 2D54A 1T5TA 3Q11A 3JWEA 4GT1A 5FPKA 2FZ4A 3K53A 4IMJB 4HNHA 4CMIA 2YN0A 1TMGE 4HG2A 4LOIA 4ZGGA 4YECA 5IVPA 2V3VA 5EJAA 3TL3A 2W90A 2WTXA 1RHJA 3DR5A 2DFPA 1S2MA 2XDWA 4I5IA 2YZKA 4HDMB 1EE2A 4R0NA 2PBZA 2QT1A 4PC7A 2KYRA 1Z29A 2PZJA 1IFXA 1LFDB 4UOQA 1Y89A 3I2FA 1U1IA 1NP7A 3DPIA 2YNMA 4HLQB 4HXEB 3TG2A 2WSYB 3PDWA 2RGCA 3CGWA 4NBKA 1O7JA 2O0HA 1CUEA 3BZWA 2VQDA 3IE2A 1QIIA 3QXSA 2FP4A 2HJWA 5B7GA 3K1AA 1SWVA 4ETWA 2XT6A 3BGSA 3REOA 2ACVA 4CHGA 3FR7A 1N5IA 4DXAA 1NF9A 4LC9A 3ZI4A 5CGZA 1HMYA 1DAPA 2YYAA 1YQWA 2CLLB 1TQDA 3LWZA 3LX4A 3QNWA 5AW9A 4L7QA 5DXJA 2PS1A 3OTQA 1J1ZA 4IH4A 3Q87B 1P61B 3T7TA 1ZMOA 2FYTA 3FDIA 3K35A 4IO1A 4BFYA 4OOEA 2C9YA 1U0EA 2YYYA 3LQFA 5DTJA 4CR8A 3CJRA 4RSGA 3RS2A 5IH7A 1E1RA 3OVMA 4BBJA 2Q1WA 3GLTA 1GPMA 4IJQA 3QW2A 3LX8A 1B26A 1QGDA 3KVOA 4PXSA 3NJRA 5A4KA 2ZSDA 3DAOA 2GERA 4EY5A 4X1IB 4FLMA 5G40A 2GB4A 4OX9B 2H2HA 2BY4A 1LXCA 4MX8A 5L4LA 4C4OA 2XBLA 3ZNQA 4LKRA 4Q9DA 2GF0A 1NULA 3BKXA 3WQHA 1XEWY 4F4JA 4A27A 4HP8A 3EY9A 1GM5A 3GDWA 5L9AA 1U1EA 2YW9A 2ZSFA 5G1OA 2N75A 3K4PA 2Z8YA 4YJDA 3VYUB 5D3MA 3A6PC 1OT3A 1AUQA 3OJXA 3ETLA 3A6HA 5J2TA 3M1LA 1E1RD 2XF2A 4LI0A 3WLRA 3M3DA 3DV2A 4OMDA 3RAFC 4MWBA 4TS4A 2ASEA 3Q3VA 1WW2A 4RHXA 4CF5A 2KLBA 3EVEA 5UKDA 3UQYS 2Q62A 3LM8A 2HJHA 1VB3A 3QNMA 3KE8A 5IDYA 5EKSA 2WUVA 4P82A 3KJGA 2V5UA 3ZZ1A 3AHFA 4I9HA 3C6ZA 5B3LA 3T5AA 2QD5A 2EV9A 3SJ7A 3RSZA 2CJWB 5FJIA 2HPVA 3QG1A 2X7JA 4KR9A 1FFWA 1RWNA 2OILA 4QYIA 4WZBE 1PZMA 2KB0A 1H3EA 4O4LA 3R7SA 1W34A 5FOWA 3U31A 3P0HA 4IDHA 3E9DA 4YMSA 2P3QA 1FA9A 3T7CA 4KL8S 1E7SA 5C7YA 4EVQA 3IP8A 4TQ9A 1DKOA 3O31A 2BDTA 4XGIA 3SQOA 1SVLA 4JMLA 3QEAZ 2W0SA 2OCLA 3RF6A 1JJ7A 1W8IA 4J0GA 1V1RB 3T34A 1OPXA 4ZN6A 3MWYW 3U1BA 1DPGA 2KMLA 2NU8A 1I1OA 4WK0B 5KOIA 4HNQA 3C4QA 4BNHA 1ZEJA 2WAAA 4RK0A 1H1DA 3BMOA 4NCJA 5D00A 1HDRA 1X77A 1GN8A 2QOEA 4L9AA 5IDWA 3HCWA 2VP0A 3D4BA 2WA2A 1N0UA 3UB3A 1QZUA 2ECPA 2WAYA 1FW8A 4DFDA 2OO5C 5EMKA 2A5JA 2PG3A 1D2RA 1J56A 1QQTA 4CFZA 5K1ZA 5LP6C 3S28A 2QM8A 3EOAI 3RDPA 3S2GA 1JHYA 3TXXA 4C0AC 1P9NA 3WRXA 4DHWA 1UJ6A 2XQGA 4JR1A 4F4CA 1IOWA 4ZDIA 4Q3NA 4QRHA 5LQRA 4D97A 3T3HA 3B89A 2CHGA 5FBKA 5EG5A 1ZITA 3VZPA 3QVGB 3C0KA 4BBAA 3IB3A 1L4YA 2OBFA 1XQVA 3KEOA 1VMDA 4RS3A 1B8NA 4B44A 1JEQB 4E08A 1W1UA 3OCYA 5I9BA 3NC0C 4DW8A 1SPXA 2HKIA 4GMKA 4KQMA 1U0HC 2E4AA 3WL8A 1VJ5A 3FW1A 1C3XA 1T6ZA 4Q82A 5EJ2A 1K2VN 4MIOA 5KCMA 3DDZX 2P0EA 3VKGA 2E6UX 1VGVA 1RJFA 3IX7A 4IFIA 3WYBA 1JU9A 3UYLA 421PA 2V3CC 3DCYA 3JD1A 3O0DA 3RSGA 2ASVA 2VQ6A 2HBQA 3NM6B 1EINA 2V8OA 3Q3JB 1T13A 5FUYA 3S1AA 5JW6A 2JK0A 3HUDA 1LZLA 5HRUA 4XIFA 1JWLA 2AVNA 1SNYA 4R2MA 2P1RA 1LC3A 1QCDA 1JJIA 1MNQA 4HR7A 4DAEA 4W7HA 4B75A 3QU5A 5HFAA 2AZXA 2QAGB 4B73A 1YR3A 4TUYF 4S12A 2A9FA 2WU1A 5HCUA 4ID3A 3ZU6A 4BKUA 1Y8AA 1FY2A 1PLJA 2WF7A 5G02A 3KR0A 1M6YA 4EENA 2W8ZA 2AR0A 1W0KD 1N1GA 1ECFA 1DT3A 1PBNA 1VKJA 3N1UA 3QFFA 5CVCA 2Q1UA 4FJ2A 1NVTA 2QGNA 4WLOA 4J3NA 3SQLA 3T38A 4PWZA 2SHKA 1ZO8A 4HXFB 1T2EA 2QM3A 3U9LA 4B5KA 3VPBA 1UDWA 3PX2A 3X3HA 4WJLA 2EAUA 2P41A 2V03A 2AMLA 2OBYA 3DBLA 3ENZA 4FFMA 4L0DA 4LVUA 4BGIA 5IJWA 5JCOC 1AHHA 2Q0XA 1YDFA 3HABA 3JVIA 1YZHA 3VPXA 1BZYA 1N5OX 4M9XA 3EJ6A 4C7OA 2Z5LA 5CW1A 2AYYA 3KO8A 1FBNA 1N92A 2WYOA 3DMYA 3HLKA 2FGKA 4JJZA 2NSHA 4OB7A 3PNQA 4YRFA 2YIVX 3G88A 3NRBA 2PH5A 2XWJI 4BFWA 4H77A 2B3DA 2HYDA 5H9WA 3IP7A 2FW9A 2IOYA 2ZKLA 1JVBA 2QN7A 3IAEA 4PZZA 5CK5A 4DV7B 2Y77A 3JAMA 2C95A 4YUZA 1C1HA 1H42A 1SHKA 3C7KA 5JANA 3BJIC 2CDBA 5D1NA 4R8MA 3ZCVA 3M6UA 2DKFA 1CY8A 2R8OA 4WKOA 1K6JA 3HDJA 4BKMA 2B8WA 3ER6A 4PYJA 3AI3A 4Y2JA 5FOQA 2VNKA 1LTKA 4PC3A 1YC5A 2CXQA 1V9CA 2Z2XA 2XGOA 3EYWA 2BELA 1X1SA 4J94A 2QQ5A 1MAVA 5DOZA 1NSTA 1DTEA 1VRVA 1V0JA 2QZZA 4B6EA 4I66A 2OHOA 1J8VA 3P7MA 2WM8A 4CR7A 3AY0A 4RZSA 4CTJA 1E32A 4EHBA 5DCLA 1R5NA 2GJKA 2QRNA 3SC2A 1P60A 3ETDA 1MVLA 1V2HE 2O3QA 3NKVA 1WIWA 5KQMA 2VJMA 4BMYA 1HYEA 4J76A 3L6UA 4WK2B 3G8YA 4MVJF 3TTVA 3WKCA 5K09A 3LQRA 4IOKA 4P33A 5G1PA 1NBEA 2UVQA 1NSFA 3MUOA 3NS7A 5TC4A 1OSNA 4MV4A 4XUGB 3W3AH 4NK5A 5EZQA 2AFHA 4FMDF 4YHBA 2I7DA 4Z51A 2J46A 5JJ5A 4JEHA 5K0NA 2B8NA 4QAQA 2XWBF 4RY8A 3MMXA 2DPLA 3LUGA 3N8IA 4Z3DA 2C04A 4TYYA 3U1VA 4J4TA 1GEGA 4H9GA 2GZDA 4MP6A 4U2KA 3C1OA 3O95A 4NBLA 1DINA 2RI6A 1DFIA 1F51E 2QTGA 3TM4A 5L7TA 4UKDA 5HUQA 3Q3HA 2AGVA 4ALNA 1A2KC 3B1XA 4KVGA 2VRNA 1QHXA 5L3RA 2AG5A 4EO7A 1EWRA 1YK0A 3CEJA 3F74A 3QELA 4GE3A 4ZCQA 5B6IA 2AEFA 1I3MA 1OI4A 1ORDA 1QLJA 3GLHB 4RVNA 2IS2A 1Y4ZA 2WUGA 1EE1A 2J8ZA 3MHPA 1CTQA 1LW6E 1UXIA 4CMKA 5IS2A 5JTTA 2EQAA 4ETIA 1ESZA 1GGNA 1Q91A 4DBLE 1AT1A 4ARVA 2REXB 3C98A 3OPYI 4WLUA 4TLLB 3A11A 2RHMA 5IG2A 4P8RA 4CCSA 3PFGA 1PWZA 1EFHA 1VIDA 3DL0A 3ENVA 3HWRA 3KU4A 4FOPA 4HDRA 3KFLA 3TL6A 3PSHA 3H86A 5J2UA 3LT2A 4KGZA 1QP4A 4PQRA 1UQUA 4I3FA 3DNFA 2R25B 3P4XA 2XCOA 3D6UA 4X20B 4AP6A 4C9BA 2VZ9A 4D45A 5KOHB 2X1VA 2COKA 3HNRA 3MLEA 4RDHA 4UZSA 3Q0EA 4HMOA 3WNZA 3G79A 4MR9B 4PHGA 3GQVA 4ENQA 3O8RA 1SKQA 5CJPA 3FCCA 4ML3A 1E98A 1EWKA 2W6MA 1TAUA 1RXEA 1DCFA 1B43A 3UWKA 4OLBA 5JCPA 1RDFA 3N05A 1UJ4A 3V6LA 5FWAA 1D1PA 2HEGA 2J85A 1H2EA 3RU3A 1JT9A 3E61A 5M04A 5JQGA 4NU5A 1UFVA 3GJXC 3FNRA 1P7YA 3GEBA 2V7BA 2LWIA 2PQMA 2WF5A 2I62A 3I37X 4NOMA 3U3XA 3MELA 2QYHA 2YINC 3ORHA 4BL5A 1V11B 1YMQA 2IF2A 3GI1A 2ZLBA 1O0SA 3FZQA 3TKYA 1OCEA 3QUBA 4AF7A 1BW9A 1GLGA 4C1BA 4RPGA 3DQPA 5F9MA 3ZV5A 3GLFA 4RLQA 1NURA 2W2LD 1DXQA 2ZS8A 4HZGA 4JA2A 5DHFA 4YP1A 3QVOA 4G0UA 1KZHA 4N12A 4DUYB 4B3TB 5KTKA 2UZIR 3HZRA 4DYDA 4YONB 4DC9A 5BO5A 2PHZA 1GDDA 1ZVKA 3IUQA 4BNYA 5KHLB 1ZK1A 1VZ3A 1SXJA 3CRQA 4XUEA 3KAJA 4PSDA 1DJMA 1IXKA 1GSOA 1KYTA 4YR7A 1QMPA 4TMKA 3MGCA 4COOA 4FZ5A 2G88A 1VHDA 3KYBA 4BRSA 4DJJA 3JZMA 3SP1A 2VJBA 2BTEA 1JIUA 4Z9FA 3HDGA 5J4VA 5IXJA 4KO8A 5AM1A 5AXAA 1JEYB 1FDVA 3LY8A 4HHEA 5I7AA 3HKBB 3IEPA 2D1RA 2AUTA 3R3HA 4HX5A 4IIGA 2WJ6A 4BZPA 4YCLA 1VI6A 3WR5A 2WT4A 3Q3EA 2DLNA 1RYDA 4OL9A 1G4UR 2VJLA 3Q5GA 4XPIA 5E38A 5IHXA 3DTNA 1A95A 3DD5A 3CPEA 1TI7A 1XDDA 2QNBA 2WIAA 3JQBC 4LE0A 4XR4A 3KD2A 3V8NA 4HWPA 4CL2A 4D43A 5D7BA 2P27A 1CS0A 1VG9B 3QE4A 3DKKA 5EMJA 5B37A 4AJKA 4BGDA 1Q1BA 5LZ7A 1G9SA 3PCXA 1MB3A 3RRFA 1FNNA 1O97D 3CBQA 2R0QC 4D3FA 2BFBA 2EFHB 2ZRKA 2GFHA 3N5KA 3NBKA 3NNNA 1ZC4A 3MJHA 2YHBA 4RV9A 5J5CA 2D7DA 3FOZA 4C2UA 3EGEA 1OKKD 2MU1A 3L0BA 3ONFA 4TSFA 4YRSA 1BQ3A 2OV3A 2BF4A 1B8VA 2HSZA 3JQRA 4HGPA 8ADHA 5MF6A 5TIIA 1T4CB 5B12A 1HZJA 2FN8A 3GFTA 3KQVA 2HUNA 4NYJR 1YRWA 1E60A 3CIFA 4P3YA 3I6QA 3SDSA 1CRLA 1SHTX 2YUTA 3HGTA 3HH8A 3I04A 3U56A 4KODA 4QXOA 3BXXA 3DLAA 1GJRA 1JQ3A 4BE4A 3MWDB 1SOWA 2L82A 2R85A 5DMXA 1T24A 1TQHA 5AW2A 4AZWA 2BZ0A 3IUEA 1C2TA 1JF8A 2BM8A 3CPJB 1FQWA 2QRHA 1VSVA 4KN8A 4QXAA 4UXHA 4YBRA 4YXWA 2WYVA 4NIMA 4XEUA 4CIVA 2WB2A 4BBPA 3PC6A 4X54A 3CZMA 4IGFA 3JPYA 1E6EA 3IMCA 4GYYA 3GFBA 4GOKA 2QXUA 1QGUB 1QG0A 4G0PA 2AE1A 3CUSA 3AXSA 1Z62A 1RPAA 4Y1GA 2A0UA 4EPVA 1KSFX 3F3KA 3JX9A 3INGA 2R7NA 1I4OA 3BRWA 3ISJA 1VRCA 3PCTA 4WGFA 3IAAA 4HNUA 3I62A 3KCNA 1NIPA 5KJCA 5ILQA 3AVTA 1ZAKA 3LY9A 4PSUA 4R51A 4YYZA 4X8OA 5IBQA 2LIPA 1EWQA 3E5HA 1I2MA 4RTOA 1XP5A 5C7OO 4RA9A 4G25A 3MWDA 4R54A 3ZU2A 1G21E 1Y6ZA 5CM8B 4RO0A 5CG1A 3BL8A 1CK4A 4GH5A 5E3IA 1Z2NX 5JARA 5KWIA 3EPKA 4D9NA 5KOJA 1J20A 4G9GA 3P2OA 1ZNYA 4ZA2A 3K5HA 3GHHA 4I50F 2QTHA 4K9MA 1CUAA 4ZP1A 4B76A 4ON9A 1Q0SA 3MIIA 2GHIA 1C0EA 1V7ZA 4LQDA 4AMZA 2DJIA 3A8TA 2F8SA 4RJKA 1HFWA 2COEA 1MR3F 1HDYA 2DQKA 2YBDA 4HRXA 4NTZA 4YDRA 5CR9A 3ZQJA 4EFLA 4EI7A 4FDLA 4L9RA 3BS4A 3CG0A 4HYTA 5HCIA 5DNUA 1V7QA 4Y9DA 2VQEB 1XSEA 2NO4A 2QQFA 1UJ2A 3HR4A 3CLVA 3OLWA 1VLZA 2R60A 5GJBA 3WB2A 3DWIA 3KRTA 4WH0A 4E70A 1W75A 1O03A 1U0OC 1U2RA 3T1NA 4BJHB 4FGLA 2HDWA 3REQA 2JGLA 5JS1A 1UUFA 4QGBA 4DKXA 5C34B 2NVOA 2DQZA 3PVSA 1A9PA 2EKDA 3KAKA 3R76A 5DV9A 4BQOA 1B4DA 4HNAA 3TOSA 3CKYA 3AEQB 5FT9A 1GGVA 1KEEB 2WTAA 4OO3A 3E9RA 2PXHA 3UNXA 4DUZB 3IEVA 2IYWA 2H1OA 1G8GA 2Y0CA 4IX9A 3EXFB 3VOTA 3NGLA 5HIAA 4N1AA 4OB8A 4POAA 4A8TA 4M1TA 4Q4JA 2NVBA 4ZC8A 2I87A 1H2WA 3FA2A 4ZPJA 1MP0A 1I2BA 4UDNA 5TS3A 4JIGA 4ZTZB 3N2ZB 1KQ3A 3EZ7A 1DP4A 3C1AA 4CKEA 1AKYA 3ZXIA 3CH6A 4ESOA 4TKVA 1IRIA 5DM2A 1GQYA 1XXHE 3A1NA 4EGSA 1U0NA 5LP6A 1Y9DA 3F5DA 4HAYA 3L9WA 5CT9A 5LMCA 2J59A 2XB9A 2Z6VA 3QI7A 1EAYA 5EMLA 5F5LA 4C4XA 1RXCA 3PGA1 1N7GA 3OQOA 3OPVA 3RYFA 3F2IA 3VNQA 1EJBA 4BJ3A 3R7NA 2JH3A 1X7ZB 2EVWX 2D0IA 3GEHA 4Q24A 3F5QA 3HDQA 1P75A 1QORA 2QB5A 2VJNA 2LPMA 2QAGC 2P62A 2X0NA 1FYWA 1F8UA 2XH8A 3ODGA 5CDUA 3AUFA 1SC6A 3HB1A 3P8ZA 1QIJA 4MPJA 4LZWA 4RVHA 1MX9A 2QP4A 2YXDA 4KLZA 1VHQA 4YRIA 2WP0A 2H6EA 2ZWPA 4HGRA 1H23A 4KPUB 4GGMX 4MRMA 1CULC 3UAXA 3WMGA 1GCAA 4P0PB 3UJ8A 3UOAB 3L6CA 5KYXB 4MGEA 1AZLA 3OTIA 2DXIA 1DT5A 2NT3A 3ZHOA 4DIEA 1U8UA 2QTZA 3PF8A 3EVCA 4OKIA 1JQAA 1UOQA 2I6SA 4KUGA 3DVLA 2NQ8A 1W2HA 1SHZA 5TPZD 1VHWA 1QYXA 2I6GA 4FFWA 1BNCA 4QDZA 1G291 4JYMA 1FL9A 1W59A 3U6BA 4KFUA 1Y3DE 2ZRDA 3GRRA 5F1OA 2HAEA 2P68A 2GZHA 4Z4CA 1SXJB 3IQXA 3PHCA 4I9FA 5FWDA 3VX3A 3CCCA 1EKXA 1A9TA 3ZHSA 5AI9A 5AKZA 1K5DA 2R2AA 1JDNA 3LTEA 4GQBA 1V37A 1BHJA 4MUIA 5BSUA 5LDHA 4S05A 3EVBA 1SBZA 5GONB 2XZOA 1BDBA 2VBIA 3KQQA 1AURA 4YN3A 2O2ZA 4HCJA 2M2IA 2XUZA 3Q6MA 5BMOA 5LJLA 4HAZA 2ATIA 3KUKA 4GPZA 1RBMA 3KQMA 3WRVA 3FPJA 4QOFA 3PEFA 4AY4A 4XVQA 3E35A 3RR2A 1Z82A 3ASZA 1QFXA 3TF5A 3OEHD 4B81A 1IM2A 3O47A 4WKCA 4Z54A 4KIUA 1S2IA 2F90A 2XITA 1V47A 1Y5IA 1G6HA 1AKNA 1D04A 4Q1EA 1DX4A 4W5HA 5E9QA 5E6UA 1ABEA 2PUHA 2JC3A 3EVDA 4F0JA 1IG0A 2ODBA 4XM2A 4ARCA 2EJUA 1RBQA 1QFMA 1PBTA 4X6YA 3R6LA 2W11A 3E9QA 1ADFA 3V48A 3REQB 1LV7A 4YAGA 5JZBA 2Q3JA 4IJWA 4FYHA 4G0YA 4GMFA 2FFQA 1FS4A 5I4KA 1VHLA 3KVRA 3DWEX 3WICA 4ANFA 3E0XA 3R3XA 2B0CA 4LF8B 2C5LA 3U3MA 3FIUA 2Z5GA 2QVXX 3NOXA 1IIRA 3BH0A 4WN9B 3LBAA 5INTA 5K7SA 1NYTA 5AK4A 1MW8X 1EXVA 3R3WA 2QXYA 3AUTA 3GC6A 2PMWB 1JYEA 2OZLA 1E9CA 1ZRNA 4S1VA 3TLMA 4L95C 4R84A 5LSAA 4OP3A 5GADl 3KHSA 1P29A 1TOAA 2CB0A 4X7MA 1KI4A 3UJDA 3QQPA 2EZ4A 5TJHA 3RM3A 4US0R 2VNHA 4KG7A 5FTKA 1BIFA 1H8ED 2ZS9A 4GL4A 3L8FA 4F92B 3BT7A 2GPJA 2J45A 3FZGA 3MAAC 1EFCA 1KI6A 3W6OA 5BN1A 3I61A 1UFRA 1KYIA 4MDEA 1T0IA 1Z15A 1OHHA 1T36A 1ZCFA 2OM2A 1FFEA 2ZEJA 2WPDA 1Q7TA 4TV9A 2NU9B 5LQUA 4RADA 1UZAA 1U2GA 3DXYA 2B1JA 1YASA 2AZMA 5BN4B 3R5TA 2B0JA 4U7HA 3HFRA 1OX5A 2F1RA 5BW4A 1TL7C 1TLTA 4EG4A 4FZRA 4BXOA 4GYJA 3U3OA 2FSSA 1R4NB 1XQ1A 2XCLA 3B5IA 5EVCA 1U5CA 3UAGA 4D9JA 1O6CA 3U7EB 1SQGA 3SHVA 3QUAA 4FHFA 3D43A 3ADCA 5JSQA 4DABA 3G0GA 4ZI3A 2YV4A 4BAZA 3T4EA 1ICIA 2BBOA 3ZCSA 5FL7A 2RG7A 3JAWB 1IRXA 1HEIA 3TK1A 1KR2A 4MUEA 1CBUA 4H6XA 4R1NA 1EVIA 3NFRA 5BWMA 1ZBQA 4TLDA 4FD2A 3UG7A 3WBKA 3PWTA 5BWNA 10MHA 4LJRA 1F7UA 2OBLA 2ZANA 1A9SA 3VDNB 4TKLA 1R0CA 1NBMA 3DHYA 2J3IA 1Y9AA 4HVCA 1G3RA 4CQMD 4YUXA 1AQJA 1UQRA 2O2YA 4EX7A 3IE1A 1HE2A 3IOMA 3DXZA 4KW7A 5CBPB 3AILA 1RYBA 3MJRA 3NBAA 1SG0A 3FYDA 5M34A 1ACLA 1U8EA 5LQSA 1S5PA 1E1DA 1UJBA 1T5LA 3WWDA 3A9RA 4Z2YA 4ZV7A 1VLJA 2C2WA 3HR7A 4K2HA 4A3SA 2EXXA 3H5RA 1NVVR 4CDGA 4KQWA 1WXFA 1UDBA 4UCWA 5I3ZA 2IC5A 4UM5A 2E4ZA 3HKCB 3I9JA 1GZSA 1DOHA 2YDXA 3A3OA 1CR0A 1M2OA 5EIOA 1U63A 2ZYGA 1Y8ZA 4X3PA 2KI5A 1GQFA 1SUAA 2CLHB 4GOOD 1VL1A 3E1SA 5AJUA 1GLVA 2H57A 2JFPA 2X41A 3EMBA 5BW6B 3VMMA 4ENSA 5B64A 3OECA 2W6OA 4U7GA 2F17A 2YFQA 3MTAA 3SLGA 2A9QA 3LLVA 3QVKA 5JCJA 4IZIA 3TQRA 4I1PA 3HDYA 2E18A 5KDDA 1RAAA 1QAOA 1JHMA 4LOHA 1I2DA 2UDPA 2FCAA 2C9OA 1USWA 4UBLA 3UN1A 2FV8A 3NHLA 1SCUA 2FEMA 5B4TA 5BP7A 5IK2D 1R8QA 3MT7A 2ZULA 2FEXA 4KQ6A 5LYJA 1H69A 4UE2A 1B6RA 5KI6A 1MZPA 5E4JA 1FZQA 3HUFA 3DEKA 4FJ1A 1EIWA 1FFXA 1B1CA 2QXTA 1ZR2A 1UBCA 2ORVA 3F90A 5KBYA 4BWGA 5DWQA 1P8AA 3BGDA 5TQVA 1MN6A 3A6ZA 2ZI9A 2Q6LA 1NR5A 3CRVA 5HFJA 5AW8A 3GOHA 3V3KA 2JGFA 4Y2XA 1KJ9A 2DFDA 3R7LA 3QEMB 3SZUA 4EHKA 2QENA 2A1TR 2OK8A 5AM3A 3T9EA 5DN6D 4M0MA 4I4CA 2W9XA 1QUEA 1RACA 2F7SA 1EXNA 4MUMA 5T4BA 3TEFA 4ZICA 2RAUA 4UUPA 3OZAA 1C9YA 1TM5E 2WWWA 1Q19A 1EX9A 3NANA 5F1KA 4D8XA 1L5MA 1M6EX 1UPBA 5LA6F 2QTLA 4Q9HA 1RVDA 1TK3A 1V6CA 1XDWA 4UNPA 3UO8B 4M55A 4CRWB 2HSDA 2JRCA 2P9GA 4PWYA 1KY5A 3MBOA 4K9LA 2NN3C 3OIVA 1CZLA 4RIHA 1KRWA 2B4YA 1N5KA 1CVLA 4JGBA 4PF1A 1M2WA 4A8JC 3OFVA 2W2KA 1B15A 1IWBB 5EESA 3L01A 3K9FC 2IZ5A 4PGGA 2W6QA 1M74A 4FINA 2YY7A 2BM0A 1NBMD 5DP2A 2J4DA 2GPBA 5EE3A 3V2HA 3G49A 1BO6A 3LOQA 3UCFA 1EWYA 2GHTA 4D8WA 1BHQ1 1R5OA 3HADA 1YD7A 2PSDA 1TYCA 3BIOA 2NGRA 5LLSA 3EUEA 4MV8A 3WXBA 4EKIA 3U3JA 3D6VA 3KSAC 1NVGA 4JB0A 2D5IA 3IXLA 1NOKA 1QB8A 1U5BB 4BV2A 4F45A 1K98A 2QU7A 3F4LA 4EBFA 2C3PA 3AUYA 3L0SA 3VR4A 2AN1A 1YS4A 2Q2VA 3FFTA 3NCTA 1G16A 2HQOA 3UB2A 5CDYA 4I55F 2X7HA 2JLRA 1CR6A 4J49A 3PF9A 4PSKA 4N3AA 2FXIA 3LK7A 2PGLA 2P2DA 1IB6A 2X1HA 2G1UA 2JI9A 5EHQA 2M6KA 5A4MS 1G6KA 1QS0A 2VRCD 3BD6A 3KM0A 4FFBB 3ZE9A 5MN4A 3W2IA 4FN5A 4C04A 1XCGB 2DY0A 2VT6A 3EY4A 3OT5A 4ILEA 4JLBA 5F7ZA 4CMHA 5AVVA 3LX6A 4LZAA 5SZHB 6NULA 1WAMA 3SYNA 5KWEA 2A9RA 2WUFA 3NVMB 5AM5A 4R01A 3P9ZA 1S96A 1YXMA 4FLFA 4DLPA 3EUAA 1R6XA 3KC2A 4D26A 3AWDA 4RMNA 3UAOA 3FHJA 1NUHA 4I4TF 4HDKA 4P35A 1CUCA 2CLKB 4RIGA 4WXMA 1ISRA 3VU1A 3W7AA 4WCFA 4NPHA 1MVNA 3FD8A 5G0UA 2IQ5A 4QSMA 4YV7A 3THWA 1DC8A 2PKYX 1FB5A 1P1RA 1WXXA 4NMLA 3OA2A 3BAZA 4IO0A 4UVHA 5D3KA 3DKIA 4G4SO 3RH0A 4BQNA 1T36B 1WRBA 2J87A 2TRSB 1FFXB 2GPNA 2PH7A 3TSWA 4UXJA 3PA6A 4MGHA 3H4IA 4UXIA 5JOQA 1KI6B 3OU7A 4IIFA 1YBHA 3DBIA 2QE7D 2WU8A 2O7VA 3CZ4A 3P0IA 1K86A 5ALLA 3TAXA 1R6VA 2EU8A 4NE7A 5FFMA 1KTVA 1W87A 2JJ2D 2WDPA 3D7NA 3JWPA 4H08A 1RTTA 4S1NA 4R3UC 1OV4A 1HPLA 1VPLA 4A5OA 4ZZIA 3BXOA 4I1OA 2QYSA 3GT0A 5J43A 1I14A 5BQFA 2DEUA 1TW3A 2XNDA 4UEJA 4L3OA 2XA2A 1D1SA 1WHSA 3MMSA 3QWIA 1J39A 5CB0A 1KQOA 4PG5A 1SQ5A 1XEAA 1NN3A 5EOVA 4HVLA 3R5FA 4L8GA 4MWGA 2BKLA 3H5AA 2XUFA 3T1VA 1U7OA 3VVCA 1Y1RA 1W35A 2BFEB 2WE7A 3KJXA 5DGIA 4WXPA 3KKEA 3I83A 3V00A 1CJTC 1M73E 4TMFA 4JXJA 1D7OA 2YN4A 1VYTA 2H31A 3MXOA 1Z45A 4YRCA 4Y6RA 1OH8A 1F48A 2DHRA 3AHCA 2XNHA 1KQFA 2FE4A 4GHWA 5JFOA 4YDHB 5ALNA 2D5LA 1W30A 2GNAA 1PL7A 1AKMA 1XN1A 2EATA 3AV0B 3D81A 3IUYA 4B6RA 4J91A 3MRVA 1JP7A 2A86A 2DULA 1XTUA 2G72A 2JI6A 1G8HA 5CK4A 4TVSA 1G2OA 1ULSA 1P0CA 1KDZA 5DLYA 2PU5A 5L4NA 3F9CA 1Z74A 3ND7A 3ZLBA 2X0RA 1SQFA 5HMLA 3WMWA 4EO9A 4YAIA 2XMCA 3U4QA 1TCUA 3ZHCA 2FDXA 3BWEA 4KVFA 2QLNA 1KPIA 3GJZA 4Q93A 2JFUA 2YXPX 2ZUUA 4RUKA 3OIYA 5AI4A 3SYRA 2YIMA 1PQUA 4QFBA 4M3NA 4EKGA 4UAGA 2ATCA 1L8QA 5A6SA 1XAGA 1NYQA 1ECCA 2HO5A 2WMNB 4FONA 5BNFA 4RZ3A 1CQWA 4N7BA 4Q1AA 1DHRA 3B9RA 2RGNC 2PA3A 3GFQA 2YOHA 1X42A 1N3BA 2IBSA 3S2EA 4G4GA 3NJ8A 4NOLA 1XCLA 4R2LA 1PVOA 3W1WA 1DWPA 4OFBA 1XZJA 3B3QA 4Q12A 5LD2B 1AQ6A 2OHGA 1ZU4A 4HPWA 4ESVA 1NXTA 3U4MA 4PO9A 4RF2A 3FVTA 3IR5A 4IOJA 3TFQA 4FP9A 1JG1A 1LK0A 4O5AA 1I01A 2Z58A 5ESXA 4C7MA 1RWPA 3ENNA 4L72A 2CCKA 4NNPA 2KPOA 3P9XA 1N0VC 1R3UA 1S3FA 1XROA 2GFQA 2C3UA 5CVJA 3C97A 2I1LA 3VR5A 1UDCA 2DKOA 5E6RB 5MGNA 3FSGD 4WEOA 4XW2A 3VJKA 3TJRA 3ESQA 2ID4A 2OV4A 3CR8A 1IY9A 1SHLA 3EN0A 1CB7A 2WKPA 4YCBA 1M2GA 3MD9A 3IAFA 4ZOEA 2PK3A 3ZXSA 4DADA 3GD5A 3E18A 1EUZA 1PNTA 2VJAA 2WWGA 1OFTA 3K9GA 4P58A 2FW0A 4YRTA 4WADA 3UUWA 5CFOA 1QU3A 3NBFA 1BWSA 5GP1A 1AK1A 3G68A 3D6TB 3L7KA 1CUGA 1FNBA 2O5VA 4RL4A 1YJ8A 4MS1A 5E8JA 4CKWB 1QH0A 1Q6ZA 4M6WA 1FNCA 1VCMA 5T3YA 1NJGA 1N2IA 1JPUA 2P9YA 5D01A 1RADA 1A9XA 2WABA 3LUHA 1UPTA 3P71T 2G1JA 4HAWA 1N32B 4KI7A 2XOXA 4M8LA 4QEKA 4QFDA 4PLCA 1KI7A 5K0CA 3JQ9A 4MYCA 3T1OA 1NW3A 2BSAA 2QRZA 3AP3A 3NHJA 4ZQCB 4FYVA 2PGOA 1NMZA 4RYLA 1NTOA 4OJTA 4UFPA 1U98A 4IG4A 3UJ9A 1KPGA 1WBBA 1FTSA 1JNYA 1Z13A 2BPOA 3ITNA 1UPAA 3OCUA 4R8LA 5AI0A 4C0KA 4I6GA 1NP3A 3EBLA 4GRAA 3W05A 3GCZA 2FMKA 5KKAA 3TIGA 1EG7A 3SFZA 2WWTA 3LLUA 5FWYA 5IJZA 1L5RA 4IF6A 3UPTA 1JIKA 4D0LB 4CIDA 1W1IA 3N53A 4KE8A 4FYMA 1N2GA 5FCDA 5L7WA 2BM9A 2PT9A 3LGXA 1HYQA 2XTZA 5DYTA 3TW4A 1UXJA 1NF2A 3KOOA 4UTZA 4ZI7F 2BZSA 1VSTA 3DMTC 1YR9A 4ZU6X 1RNLA 4Q37A 2B94A 3L8GA 1ODFA 1DBPA 2Z04A 3ULKA 3ZCRA 1B2LA 3LNTA 3L5KA 4LFBB 2XJ9A 4EQZA 5EKTA 1I0ZA 1QIHA 4RA6B 2O7RA 4X8LA 3WGHA 2ANCA 1NFQA 1FFAA 1NVBA 1RLMA 3COSA 3HJNA 4GPEA 3S29A 3C6YA 2DUUA 2HRCA 4ZCTA 2XB4A 5DDIP 3OFNA 1KC3A 4HNVA 5D3MB 2DWQA 3O38A 3AU8A 3FHTA 2YCBA 1ABBA 3O2JA 1IG3A 5L3SB 1WUTA 1KMNA 4GO1A 4JIMA 1XFAA 3DS8A 3GGJA 2ENUA 1P5RA 3RWBA 2ZWAA 2ZWIA 2PT7A 3KJFA 1OB5A 2EFGA 1O95D 1CWUA 5FOSA 1S2NA 3K0SA 1AB6A 1E1MA 2VLBA 3IQZA 4O2AF 3FWYA 2IVFA 2UZ1A 2ZCUA 5C80A 2CJYA 2YJ5A 3VQTA 3QVJA 1Z6ZA 5F3DA 3QSYA 1WPXA 3QITA 2XYPA 4XAQA 5EPUA 4C0JA 3TDKA 3W4IA 3WK7A 4EZEA 3O7WA 3AINA 2BGGA 2BL4A 2BJVA 2XWPA 2D59A 3D3WA 3HPRA 4X7BA 5DM70 3PQDA 4CODB