5C31A

Constitutively active sin recombinase catalytic domain reveals two rotational intermediates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLVIQILAMVSEQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Sin, putative plasmid resolvase dimer
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
total genus 34
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c31A00
2RSLA 2GM5A 3LHFA 3UJ3X 3G13A 2R0QC 2GM4A 3BVPA 5C31A 1ZR4A 5C32A 4BQQA 3LHKA 1GDTA 2MHCA 3GUVA 3ILXA 1GHTA 5C34B 1HX7A 1ZR2A 3PKZA 5C35A
chains in the Genus database with same CATH superfamily
4UHKA 1UPCA 1UBUS 5FTMA 1BH2A 2R60A 4OUDA 2XXJA 4ZA2A 5LNK1 4L3WA 1IHUA 5GADl 2E85A 9LDBA 1Z45A 3K70C 3RANA 5DYGA 1NHGA 2O7SA 3EZXA 3RNLA 2Y1KA 2UU9B 3EIOA 1KQPA 1Q1EA 3CZ9A 3C85A 2HWYA 3FWPA 5BN4A 5H02A 3RB8A 3KK0A 1IUNA 2BFNA 2H1CA 2YS7A 3QGMA 4LOJA 1A7JA 4FW8A 1DLIA 5B1HA 3RTCA 3KZOA 2I55A 3QKUA 4MARA 4G65A 2HA0A 2DPGA 3EVCA 3W90A 4E5MA 1T8RA 5JD4A 2PUCA 2P9TA 4GI5A 2OC4A 3IEVA 1ODJA 5CJPA 5E3HA 5KYNA 1NI5A 3HLTA 4BNTA 3OQIA 1NXPA 1VL0A 3DAFA 4AKGA 2HNAA 3B52X 4QHSA 1MJ5A 2CMFA 5TS3A 3L1IA 5IF9A 3I2JA 4OQXA 1NQOA 3X1KA 4CIDA 3QPVA 1AURA 3GEDA 5F77A 1E79D 4QULA 2BFDB 1N1MA 4ZQCB 4X65B 1TCAA 2YVKA 2Z4SA 3PD0A 2JEYA 3WSTA 4HNUA 1OFTA 2CHVA 4ASUD 3EFHA 4FLEA 3AW9A 3LGAA 4G4IA 4P53A 4Z7NB 4JGBA 1AO0A 1NI4B 2J7PD 1JJVA 1L5HB 1VIYA 2EF0A 5HFNA 2C2XA 1OI2A 4QGSA 1ETUA 4B35A 1NBIA 5HK8A 4XPIB 5EFZA 1LS6A 1U0NA 1TM3E 4WNYA 1KDVA 4HO1X 3WGQA 4CEIB 5AKLA 2AJ8A 1ZITA 1C81A 1XLVA 4FJ1A 1RKQA 1YVPA 1EK2A 3VSBA 5JEDA 1AG9A 3D8TA 4E2FA 4C6RA 3FGPA 3OQ6A 3RHSA 5DCLA 1KERA 4H7IA 4GLBA 2JFUA 1UAAA 1B74A 1BS2A 3I6MA 1NDQA 4PBRA 3PFIA 2WR8A 3WHIA 4EB6B 1SG6A 1CEXA 3HUFA 5CLGA 1E69A 5CRIA 3TRJA 1NKSA 3A1WA 4MRVA 4BOYA 4IXTA 5DNYB 1BKYA 1KVQA 2YY6A 4QBIA 1N1DA 5ICCA 3DC7A 3NETA 5EXSA 4U3JA 1DIGA 3QJ5A 2W8ZA 2E21A 4WKGA 1XTPA 1X1QA 2OBBA 3N2NA 3NAMA 4BLTA 4ZGBA 3RC2A 2IZ7A 3MD9A 5AM1A 1XNQB 3WTCA 3GVIA 1ESCA 4QUDA 3BGSA 4D3YA 4QQRA 4FZ5A 1CDOA 3O9VA 1SU4A 3W2FA 4PGFA 4D9GA 1M8FA 1YS6A 3LXRA 3OO0A 4JKIA 4JC8A 3DTTA 3R9XB 2R6R1 3O83A 3O95A 4HQ0A 2VCHA 5ELXA 1T1RA 1SKYB 1UT5A 1NJ1A 2PLFA 1M2GA 3SVLA 5EP1A 1E9DA 3HB5X 3CNBA 3RG2A 4WLFA 1YR3A 2AI2A 1V9CA 3I45A 2EL9A 1P4RA 2H5LA 5ILGA 2Y0CA 3DR3A 3WIUA 3VR0A 1XSEA 3PRHA 4LGCA 4NCXA 3LVFO 5HBRA 1N8KA 3LL4A 1ZC3A 2JAHA 3SK0A 5A04A 1IRIA 2IHZA 2J08A 2ZYDA 2HJWA 4KXWA 4ZICA 3RROA 1PJLA 1U2PA 1DXQA 4R16A 1MTOA 3GOHA 4X71A 4B48A 2KBFA 3QLTA 5HKKD 5BMVB 2OQRA 1S4QA 2YV3A 4HAZA 4D3SA 4ZI7A 3HADA 2ISQA 1I2AA 2VBCA 2CHFA 3FCYA 3JQRA 3Q40A 3MWFA 4NVRA 2OPBA 3W7BA 1QXSA 1C0KA 1TQHA 2CL0X 2OCLA 3BCUA 3TKLA 5JNVA 1U2ZA 4JVMA 1IY8A 2R6CA 5JZOA 2HUNA 3TPCA 1E6UA 2HQOA 2O8VA 4CG1A 1I94B 3BJRA 3FWNA 2ETXA 1TL7C 1Z6TA 3I2GA 3TLGB 1Q1BA 5L40A 3AQ4A 3IMKA 2HA7A 3LXMA 2WKRA 2HJHA 1U7ZA 3LDUA 2JFXA 4KKVA 1TB4A 2R6HA 2QLLA 2VI5A 1ECFA 3QU9A 2IYWA 4Z4QA 1KRWA 1YQTA 2CNKA 4N0PA 2JS7A 4OQFA 2W4IA 3AXTA 5IWCA 3RK1A 1CQPA 1KR5A 3FRJA 4CKEA 4QARA 4I4LA 4EX6A 1WHSA 4FYJA 5EUMA 4PINA 3BF8A 1L7RA 4M7RA 2NZXA 5D00A 5KCZA 3FHOA 1NNI1 4YT4A 1C1YA 4AZTA 2IYAA 3KD2A 1MB2A 4HPXB 1RJFA 1UJCA 2QSJA 3LFTA 4GMXA 4KQGA 3F73A 5IAGA 5JAOA 5DBFA 3Q98A 4CV1A 1RPZA 1THTA 3TPZA 3W8DA 4AJKA 3TNFA 2VEOA 3OTGA 3B1JA 4XCVA 1QS0A 1Z36A 2HGZA 1Y3HA 1CVLA 4GOOD 1BMTA 1TC1A 1MO2A 5DO9A 4ALMA 2VHXA 5KHAA 4PG5A 1GZ4A 4O2AA 1FF9A 1WNTA 3ZY2A 3GFVA 4X85A 5TGTA 1GTJ1 1G6KA 3ANMA 4YMIA 1UJ5A 3D1JA 1MDFA 3DE6X 1JDJA 2SNIE 4X3OA 2L2QA 2P35A 4YDSA 4DCSA 2ZUUA 3OPQA 2JL1A 4G07A 4RA9A 4XDYA 3EZGA 2EJTA 1Z88A 3L1VA 1OAAA 4KQJA 1UR5A 5AMXA 3RTGA 1GY8A 2E5LB 3DVAA 13PKA 4AURA 1QVWA 4NBTA 4YUYA 1R4AA 1BKSB 1PUJA 4XW2A 5ESWA 4IOMA 4MULA 4BZQA 4KPYA 5B36A 1I2DA 1XT6A 1U9IA 3DMGA 4S24A 2CLSA 3U31A 2QG6A 3P9IA 2VDRB 5EJAA 4ZOEA 2QYTA 2IZZA 4ZEMA 3FPLA 5AVZA 3KQQA 4OA8A 1NJ5A 4O3MA 2EHJA 1AF4A 4RHYA 2XRFA 4E1BA 1BDJA 2WJGA 4KZKA 3H65A 2NVOA 2VJNA 2ZIXB 4JGGA 4JYCA 3TW8B 3V4OA 4URVR 1CEYA 3M5PA 4DHEA 2HIGA 2HSDA 3FB1A 3C16C 5C35A 1SR8A 1WXXA 4JFAA 4GRIA 4DBLE 4Z3KA 2X9NA 2C5HA 1JHOA 2GJ4A 4L7VA 4O4JF 3P4XA 1I36A 1L0BA 4GHWA 4JA2A 1GFIA 3U0VA 3WK5A 2AX4A 3QUSA 5FX2A 3AM1A 2OHVA 2BL4A 3JVDA 5BN4B 2R1TA 2FJUA 4NXMB 4DAEA 3NOXA 1L4MA 1MJFA 2P2NA 2DXIA 3UA3A 2VWQA 3ZKWA 1Q6ZA 4KV9A 3COSA 1PWYE 4XB6B 1OT3A 3B2EA 2EWVA 1MKYA 1L5VA 3OQIB 1E5QA 2H2GA 2PRZA 3Q7IA 3V1TC 1WABA 2W98A 4TLMB 5JJBA 3EBOA 2JANA 3T9AA 1KZ6A 7ABPA 1EVZA 1H65A 1ZGAA 2P6PA 3C87A 3F6RA 3PGJA 2I8CA 1TLTA 1P60A 2YC4C 2A57A 3BK2A 1E2HA 4OTZA 3EVNA 4KVZA 1DQSA 2FN8A 5EWLA 1KEWA 2CXSA 4BQFA 4JI8B 2PU7A 5FR2A 621PA 3G02A 2OEPA 1SHKA 5HE9A 3HZHA 3OZRA 2E6KA 4MQUA 5EKUA 4QO7A 1JUDA 1YZQA 2PH7A 1YFJA 3MBIA 1YK0A 4MGKR 4MICA 3EGXA 1HE2A 1L6RA 4R2KA 3LNTA 2PWBA 4Z1MD 7ADHA 2PFKA 2Q4DA 3K1JA 4ZHQA 3TW0A 1RJEA 1KMQA 1CUFA 1T26A 3C41J 1PFVA 2OHXA 3BL5A 1VYTA 1BDBA 1DKLA 1V25A 1DAGA 1K0FA 4N5IX 1QJ4A 1JDTA 1Q20A 5ALPA 4O4LA 3IP7A 4L4SA 3JQ7A 4L2IA 4RAOA 1JKFA 1WBJB 3L9WA 5K8TA 3RRBA 1IAQA 1NURA 2CV1A 2BI4A 1T8UA 4HB4A 3IVCA 4U3JB 2P69A 4WA7A 5DGCA 1DWPA 4DLXA 4EFMA 5LZ8A 3IBGA 1H0KA 1DTSA 4K1LA 4YRGA 2QTBA 1PD1A 4M9XA 5EIBD 3AVTA 3EWAA 5DSXA 2ZJ8A 1TYCA 4P4UA 4RVUA 2CF5A 3ZE1B 4G5SA 4C6HA 3U1BA 2YRFA 1Z15A 3PIDA 4TSRA 4QBKA 1VE1A 2M9MA 3FNEA 2R87A 3OTWA 3HU3A 4JVOA 3V9AA 1Z29A 4A91A 2J5XA 2ALJA 1ES9A 1F7VA 3C5CA 3UUGA 2ZYUX 1XQ1A 2G4VA 4HWKA 1E64A 1M5TA 1VPLA 3AEXA 3CKYA 5ERYA 1DIHA 2PGDA 1BU8A 3H05A 4WZAA 3V55A 5CB6A 3EQ2A 2HLPA 4FFVA 4E70A 3QUTA 4MINA 1R1DA 3PEUA 1KU6A 4NMXB 4QDJA 4DABA 4XTCS 3P2OA 4DZZA 3NM5A 1HZZA 2YYYA 3PFHA 2VP5A 1L4KA 1YF3A 3AEUA 5GJWC 3T5CA 4EL0A 1I9GA 1KKLA 1LNQA 3JX9A 3RK0A 4RPCA 4V1CA 1XRJA 3LPAA 1L5YA 2QZJA 4UUBA 3T15A 1LS1A 3S2EA 3BX1A 1YA6A 1WBBA 4Z4IA 4ZVOA 1UDRA 3GEMA 2NXEA 2EWWA 3LUGA 3ORRA 3L40A 1B42A 4ZO7A 4M1MA 1F9EA 4MVJE 1GILA 1XZFA 3D6TB 1E7YA 1VTKA 3QUCA 4ZI7B 2ZKIA 3D6HA 4IAOA 3G0IA 1OHHD 3KYCA 3PWTA 3THXA 2PLWA 2XB4A 4N5DA 1N77A 1UT6A 2AI3A 3HVIA 4DAOA 3CZ4A 2Z1NA 4TWRA 7MDHA 5D3ZA 1CJCA 3I52A 3D7NA 3S27A 5BW8A 2XI4A 2YZ7A 2HF7A 4YRRA 3ZS8A 1B76A 1G2QA 1A27A 2GCGA 2QGZA 3GFOA 2H1VA 3UTCA 2HV9A 4ND8B 4AJPA 1CUWA 5DLEA 1JPVA 2CDBA 1PJSA 1GTVA 2O14A 4QXMA 4CKEB 5LZ2A 5CD1A 1WHSB 2I1QA 1YHYA 2XZOA 4DLBA 4MQ4A 5FI0B 5EXTA 4E14A 2DLDA 5INTA 4J8PA 4YCDA 5KTSA 3HJHA 4PANA 1WZ2A 3BCSA 2VL7A 2YVAA 2H1IA 3PUHA 2LBPA 4FVTA 3WHKA 4QOHA 2DQ4A 3JASA 5T6BA 2NUPA 4YY3B 2PJDA 3TZEA 4EPYA 4YPVA 3VYWA 1K86A 4WFIA 5AM0A 1QS0B 1X94A 1KI1A 1RM5A 2OY0A 3GRZA 3KUCA 1QIHA 4R1NA 3VTAA 1BNCA 2CLDX 2RHMA 2ZR9A 1GNPA 2F6RA 2HA2A 3DL7A 3MCAA 2CFSA 3U61B 2PZLA 2PM8A 4MQ5A 4O2AB 3S5JA 4Q39A 4YRSA 3OM8A 2JHFA 4FSDA 3RVNA 5CDUA 1XDBA 3HBMA 2Q5OA 5C34B 1ENPA 4MUEA 3LXXA 3FOWA 5DTRA 3AM5A 1YRYE 3EASA 3EOAI 1V8BA 4A73A 2ECOA 4RA9B 1Q91A 3E1KA 4KRXA 4M1WA 5IMBA 3WIDA 2R66A 2WVGA 1QF6A 1DELA 2LIVA 1OBVA 3HA7A 2H7XA 1RWXA 1TIBA 4TV9A 3REGA 3WZMA 3IVMA 3OQHA 3DVAB 4WESA 5JRZA 4AG6A 1EMDA 3EC1A 3QFTA 1K68A 3KL2A 2F1RA 1T5OA 4QPCA 3KX2A 2BFWA 4J76A 3BRWD 4CL8A 4NECA 1SC3A 1AB6A 3N0XA 4PTYA 4PYIA 3DPIA 3TOVA 2OBNA 4E5UA 3EDOA 3ETLA 1T1JA 4P34A 5ED0A 5EPOA 1TZMA 1QNLA 2UYYA 3RIXA 1IY2A 2ONJA 1KI6B 1K7CA 4OLFA 2JLXA 2VNSA 1PK7A 3U7HB 1LBQA 2H0QA 2I3ZA 4PPYA 4EUSA 1PR0A 3B1XA 4GP7A 4RPLA 2MCFA 3GLGE 1PG5A 1WUIS 4L9WA 4TV9F 5MN6A 4AJLA 1PVVA 1E79A 4UUNA 3FTFA 4ECEA 4ZTUB 1UQRA 4OQZA 5ECWA 1VLLA 4EHJA 1ZH4A 4NENA 2OHOA 4LJ6A 1IXZA 5F5LA 2J7PA 1YOVA 1FLNA 4J16C 4DWWA 3FSGD 3DLBA 3BSSA 4C3VA 3UG6A 1IK4A 2JI7A 2R1TB 4M46A 3STUA 1YZYA 2Z8XA 3OY2A 5EE1A 1XG5A 1EEXB 2DBQA 4QTZA 3BA1A 2C9YA 1H4QA 4WOBA 1HDYA 1NN1A 1L5QA 2JKVA 2GYWA 2M98A 2VK1A 1LX7A 3R4VA 3ZKWB 2LUOA 1NE7A 1JLHA 1U80A 1KYVA 1N1GA 1PBNA 1DC5A 3NDRA 1YDFA 1SUFA 2PL1A 5EQDA 3ZN2A 2RB4A 3QXJA 4OHUA 3QYJA 1I2CA 3C24A 3TTXA 2GFIA 1H85A 3FDXA 4MYCA 5BR8B 1BCRA 1FJHA 4XX1A 1NYLA 2IELA 2NPFA 4M0LA 4DDHA 1N0HA 2XE4A 3RJ5A 7AT1A 1U6KA 3HEBA 1RM4A 1BGVA 1ULSA 1TPZA 4PZUA 3JYLA 4G3XA 2BRUA 3E2IA 3QX9A 4JLSA 4IIHA 3PBKA 4QYXA 4U2EA 4YRQA 2C99A 3FPAA 3T8YA 1QWOA 1SU7A 4I9NA 4GEKA 2VF8A 2XEDA 2GCOA 5FUVA 2REXB 1RLTA 2GKGA 4L5BA 1XRPA 4D5EA 1ATZA 4C43A 3U0BA 1FYEA 3V8BA 2X6QA 4UE6A 4BFZA 2BCJQ 1UWVA 5D5HA 3EGXB 3GH3A 4OLJA 5I8ZA 5KJEA 5AVYA 5K0SA 1NVTA 1YB7A 3TXYA 3KKKA 4FKMA 5GM2A 2IS4A 4ZHQB 2QXYA 5HXAA 4IY1A 5C7LO 2ZATA 5IRCD 1I1OA 3PWZA 3QFRA 2CLLB 3OZEA 4S04A 1FQKA 1CQJA 3C6KA 4TS9A 3UAYA 1V3QE 1L1RA 1HYQA 1R3UA 1JFSA 2GM9A 3B89A 3GDFA 4XGNA 1L4FA 2V0CA 4R1PA 3DAPA 4UQPA 4O4LB 3L02A 1DIOB 3H16A 1F8UA 3JQ7B 3LECA 4L2IB 2AN1A 4Q82A 1A2OA 2YNMD 3QSYA 5JFGA 2BWJA 4K7JA 3VO9A 1AMUA 4H7HA 3KV3O 1I4WA 3T1VA 2BSQA 5CX1A 1PTJA 1D6MA 3PFBA 4RTSA 1E5XA 4HAXA 3DEIA 1T4MA 3HBJA 4IQ0A 1U6JA 5ADHA 1TTTA 2QRHA 2WWYA 4Z0HO 3LS2A 1EUCA 4A0FA 5IKMA 1NC3A 1SO8A 2JASA 3DW3X 2Q29A 3JR3A 4J0KA 3TLKA 2IOYA 4H2DA 2MJLA 5JMOA 2CMDA 1EGAA 2PANA 3ZNOA 3ADKA 5AJHA 2ZJFA 2B5VA 3NCHA 4QU8A 3DAGA 4WZAB 4KFRA 2PCLA 5KNDD 3BGVA 1UMDA 4H35A 1OZFA 1T8PA 2VWGA 3DAYA 1J06A 2WNIA 1UQUA 1TU4A 3CMMA 3H5LA 2I1WA 1J39A 3H2SA 2HDWA 4WN9A 1HETA 1EDEA 1OYYA 2DB3A 3OAAD 3AEUB 3GBSA 1XU9A 3EG9A 3L6OO 4K28A 3T0IA 3IR6A 4KQ1A 4JUDX 3LE8A 1JHAA 4H1TA 2XUKA 4V1CB 5CIYA 1GRNA 1I7LA 2FLWA 3UV6A 2E4AA 4DCPA 1AF7A 1E92A 3CX3A 3L7NA 4P81A 1KVSA 5K3DA 1KYIA 3FCSB 3V48A 1C2TA 3BXZA 3OCUA 4XSGA 1NF2A 3KYCB 3IURA 3THXB 3WWEA 2VSYA 2RGNA 1OI4A 3GFFA 3OU2A 1TYBE 1ISPA 5IZCA 1FK8A 3CLUD 3N8HA 1CNMA 2VF7A 5GJVC 3QA9A 4ENUA 2PLAA 3MAAC 1ORWA 2GN4A 4XIJA 5AI6A 4B5LA 1XPOA 1W25A 1XDZA 5CH5A 1EWKA 3WDKA 4OP1A 4NRDA 2OORA 3UV3A 2ZYHA 3IB3A 4LDJA 5HWSA 1ZSVA 3BICA 3IPCA 4ZMBA 5EE5B 3V7NA 1J20A 1H0HA 1M2FA 4PAMA 4R2XA 4TTPA 1KARA 5ALWA 5DYYA 2BEVA 4NZYA 4E5DA 2SHKA 1C9NA 3LQ1A 3COWA 3K0AB 5T4HA 2OGUA 1Z8DA 5EJ2A 3QEJA 1CRWG 2UUBB 2MT9A 4X63A 5LP6C 2VNJA 4OQDA 5FUMA 1C5KA 2PTHA 4Q19A 5AW7A 3ID6C 3GG9A 1LWOA 2WT9A 3NBYC 1G8SA 5DASA 2VKTA 1R0KA 2VA8A 2F2TA 4FU0A 4JCCA 5AOCA 4B3TB 1RWBA 1T10A 2XE8A 1P7ZA 2NUPB 2Z1DA 3H5VA 3B1KA 3EJWA 3JASB 4OYLA 5AUOB 5AESA 2FK8A 4HN9A 1G60A 2GEVA 2ILVA 3OQPA 1XO1A 4B76A 4ZZIA 1UBMS 3HUUA 4GX5A 2RMKA 3V8RA 3PR2B 3VGPA 2X4IA 4OYRA 4S1PA 1UP4A 3G0HA 3LBFA 2G77B 3RIYA 3KPVA 5GOZA 2OM6A 1G8YA 3DVQX 4BNHA 4M1EA 2PKEA 1O1YA 3RTAA 4A92A 1SZDA 3VX4A 1XD8A 4X1IB 4DMGA 2AV6A 1N5RA 1DMSA 2XDAA 4JX8A 5J2TF 3RS2A 3A4IA 1CB7A 2X8AA 2C61A 3C1UA 1ZN2A 4TKZA 3DOHA 4WESB 1IOLA 1Q7EA 1Q95A 1ZCJA 4MRAA 2JK0A 4F5DA 1K6EA 2WINI 2RGDA 5EAIA 5KKNB 4X91A 3ONNA 1PFUA 1VL2A 4OK5A 1PR2A 4KWHA 3OVMA 3URMA 3ENZA 2PXCA 1YTLA 1XMXA 2HRDA 4W8HA 4EA6A 3QH4A 1G8AA 1PZMA 3KJXA 3R5FA 5C7YA 2ZRQA 4EY8A 3HC7A 3TTWA 1H2YA 1YS9A 2R6FA 1KI4A 4NDNE 4DR1B 1W36D 2KBEA 1T13A 4BEBA 1ZRMA 5EP4A 1V95A 1MB9A 2HNKA 5JD6A 1HDGO 1KZ1A 2W0SA 3NRCA 3ACCA 2ZUTA 1V1JA 3HSYA 4ZGWA 4UCQA 2V7QD 2F9LA 3FM9A 4R0NA 1HRDA 4L75A 4DXAA 5CFPA 2Q1XA 8ADHA 4WOPA 3DZDA 2QUIA 4M7PA 4XIGS 5JCOA 1TUIA 3WRXA 5A6SA 1B43A 1LZLA 4NENB 3W6UA 3GLRA 1CHNA 3D59A 2E3JA 4XUGB 1EKXA 1EGQA 4D4GA 1DNPA 3RI3A 4W82A 3ROKA 1R0RE 3VR4H 1NXSA 1TD9A 1VBFA 3N2GA 2Y68A 2OM2A 2XCOA 3KQTA 5AIBA 3EVAA 5FLKA 3KQHA 1Z06A 1MAUA 1W4ZA 3EZ2A 3GZ4A 4P3YA 4X9XA 5EUBA 2XTNA 4BC1A 1N3YA 1FNNA 3PPIA 2VTEA 1TZ2A 4P7BA 3JCZA 5CFNA 1ULBA 4ZRDA 2I2FA 3AMVA 2V7EA 4ZDJA 2A5JA 1Y3BE 2D1TA 3NPAA 1OIXA 3W34A 4YX9A 2FG7C 3GFTA 4RNCA 3TWOA 2Z0MA 5JCJD 3BD9A 1BCRB 3L7BA 4L4YA 3ZHYA 5KTTA 4MGYR 4ZFNA 3C5EA 3GQVA 2IIVA 3U6KA 3MWLA 2GFHA 4E15A 5TEWA 1IN1A 4J0EA 4X6UA 4GX1A 3N2LA 1SEVA 3RV3A 3BCRA 4IGKA 2ISSD 2PXXA 3UMCA 5IFKA 3S1AA 1L5FA 2GCOB 1UEIA 2RKBA 3AG6A 3AIMA 4Q4CA 4US1R 4ESHA 2SKDA 5ELLA 2YJGA 4OXIA 4FP9A 1PQPA 3L8GA 2ICAA 2TS1A 4CLDA 2QD4A 1QFJA 1S8NA 3I01A 1MV5A 1V16A 2PS1A 1S01A 4R31A 1SPBS 2ESRA 5DISB 4PSCA 4DG5A 1ORDA 4O33A 2Z2XA 4Q6WA 3TB6A 5B3LA 3RKSA 3FR8A 1CQJB 2J31A 5JO9A 3PYXA 4B83A 3QEMA 2OD9A 2OCAA 1I3MA 1BEUB 1RHQA 3ACDA 5IANA 5L6LB 3FN4A 4PXAA 2GD0A 4DVJA 4P93A 1RI4A 4D6YA 2D4HA 4M1SA 4BC0A 4WH0A 1AB5A 2M6RA 3AVYA 4LMBA 2CB9A 5CX1B 3UOWA 1QM5A 2HBZA 4GZLA 1DI0A 4RELA 2ENWA 3EGWA 1OHHA 2P2GA 1G4HA 1EVJA 3K70D 4DZTA 4I9HA 4LV6A 4NCJA 1A97A 1EUCB 3FOBA 1H4SA 1NZFA 3DZ8A 3OUUA 3LQYA 1RQ7A 4C4XA 4KXUA 4MV0A 1F60A 1O03A 2GEFA 4Y6GB 4IDDA 3N0WA 3ROZA 4BO2A 1W5EA 5B3AA 3UCEA 2J0VA 3EARA 5BWNA 1XZLA 3OEED 3TLCA 2H18A 3I8SA 2PJUA 4F86A 2JFGA 4ZVQA 1HSZA 1T29A 4LN1A 4EF5A 1BX0A 1LW7A 4QSHA 4C4SA 5C8VA 1UMDB 1YDEA 1ADYA 3IE2A 3KLOA 4LZNA 8GPBA 5CPBA 4QHTA 4WN9B 1K7EB 2Q1UA 3NFRA 3HXLA 3SM3A 1E1RD 3L5KA 1DOZA 3RYIA 3TQCA 3WMGA 2VTDA 3EG9B 3H11B 2DRIA 3HV0A 5ALTA 2ZG6A 2JI4A 1GPBA 1EJ2A 3A6HA 4MLPA 5GJCA 2B0CA 1KY4A 2COEA 2J46A 1XNGA 2W7TA 3DE3X 3MCUA 4RPHA 4KIWA 2R8RA 1PV1A 3KR2A 1W5FA 4V38A 3K1YA 3ED1A 3WB2A 2XJ4A 4I1IA 1RRKA 1ENOA 4L4ZA 2C2BA 1SXJC 4YMGA 2ZWIA 1SVIA 4BP1A 2VHCA 1CR2A 3LY7A 5FUBA 1TO1E 2AR0A 4HI0E 4TTRA 4CQMD 1II0A 2WWFA 3DPUA 1XQWA 1LPAB 1LB1B 1THMA 3L0OA 4QPZA 1Q0ZA 4FINA 4PO3X 3RUEA 5AYVA 2RH4A 1F5NA 2UZAA 4FGLA 1KDTA 4ZQIA 2GDJA 3TOXA 2BEVB 5F5NA 2QBYA 2QN6A 3L0CA 4YHHB 4RJJA 1O6GA 5CLQA 2FOIA 3A6ZA 3HLYA 4RM2A 2FK7A 2HF8A 2NSDA 2GN2A 3QF7A 3COVA 2Q3HA 1E3DA 2JARA 1GAEO 4GBGA 2W58A 2NO0A 2AX3A 3BRWA 4Q9JA 2WQ6A 3HCCA 5J59A 4BUZA 2Y4OA 1O58A 4G6ZA 1FVFA 4GL2A 1VE6A 5A5VA 3EC7A 4Y3UA 5FBHA 3M1IA 4NV0A 1FQWA 1J00A 3ANTA 1F6WA 5C1DA 2YV1A 2G72A 2XQGA 1YC2A 2OKCA 5AKGA 2EQBA 1B4DA 1NNSA 1M6VA 2BTQA 2C20A 5G0SA 4GXNA 1VC2A 3WXBA 5DK4A 1U0GA 4RTPA 1USUA 3NHWA 5GONA 3PQDA 3SKXA 1PR4A 1PJBA 3R3XA 5JNSA 2HMAA 2I2CA 4NYMR 4OBXA 2XNJA 2NZJA 2ZSIA 4IP0A 4ZQBA 2WEKA 2ZBPA 3N3BC 5FBLB 4UUAA 2F8TA 1OTYA 2WYOA 4HZGA 3IUQA 1FRNA 1NMYA 2EHDA 3FSGA 1U3UA 1GKUB 2AE1A 1GGJA 1YQUA 4DR2B 1E3IA 1ZU4A 1TXGA 1JU9A 2QTCA 1FBTA 1QP0A 2G63A 5E7IA 3HY4A 5J4VA 1UAYA 1KI3A 3BWCA 1K2WA 2BFCA 3PJDA 2IIPA 1AO3A 3K2EA 3KTDA 4EMTA 5KREA 2V6BA 3RYHA 3AB7A 2Z57A 3AQIA 3GD7A 3OCWA 3PUYA 1B6TA 3ZGVA 1H4TA 1BVRA 2WJVA 3GGDA 5KDDA 3LT2A 4KG7A 4WWHA 4Z3OA 1EZZA 2JCBA 3HA2A 2PGLA 3INNA 1KQGA 1NBEA 1H69A 1N5JA 5CNJA 3V4LA 3FGNA 1T5DX 3HDTA 1QOQB 4QUEA 4Z7OB 4L0DA 1Y63A 5A6SB 2JZOA 1BGXT 3FW1A 3PXEA 5HYVA 3G23A 2ZSUA 3DVSX 5LOVF 2FEWB 2WSSA 4LZAA 1OAOC 1PT6A 3CX7A 3KWMA 4Q9DA 3RBVA 1J1ZA 4NR0A 3RF6A 4ETNA 5IABA 2FN7A 4Q3NA 3PNMA 3TSCA 1EINA 3N2GB 4DMMA 5G1PA 2X0KA 1QRRA 3QU5A 4MYHA 1RQGA 1AUQA 2JI6A 1LRJA 2B37A 3BD6A 1ZIPA 2K6GA 2WB4A 3G0DA 4DBVO 4R71A 1W94A 4IVNA 3THOA 1V41E 2GLXA 2B34A 3FVWA 4WBNA 2UYQA 5B7PA 4FN4A 1CRPA 3FE2A 3P0IA 1K7FB 4UCFA 3SIWA 1FFBA 4P4SA 1NM5A 4QGGA 3V46A 5EJ8A 1Q84A 4HPWA 4DV3B 1FW6A 3QVOA 3ZVRA 2ZDHA 3A9UA 2IEYA 5J63A 1DUVG 4IKOA 3DO6A 4PZLA 4DQDA 4O02B 1G8GA 2YNMA 3T3GA 1LV7A 3JPWA 1W85A 4KPGA 5A4DA 2JAXA 1DFGA 1W2GA 3FUWA 4IF6A 2CF6A 1J24A 1C3LA 3VNQA 1OFHA 1E32A 4B81A 4FQ7A 2P68A 1IULA 2UDPA 5DBIA 3S1AB 2FZKA 4MVJG 2JZCA 3B9PA 4D80A 1N6OA 4N5NA 5EGNA 3TIXB 3SSOA 2AF4C 1SIOA 4FPXA 4YJ2F 1PJRA 4FE7A 1KJ8A 1KAOA 1EJBA 1BVHA 4EHBA 2B0JA 3OZSA 1GT91 1VA5A 1CYEA 1V16B 2IHTA 4CU2A 2R1VA 5LQNA 2QPLA 4G2TA 4EY6A 1OTXA 3ZHZA 4O4IA 1GFZA 2JHGA 3I64A 2H57A 1J8DA 4KC0A 2RAUA 4ZVSA 1KVUA 3QEMB 3WC4A 4XX0A 3KJEA 4BNXA 1OXBB 4JJIA 4MDFA 4OREX 1UC8A 1BHSA 1E2FA 1GV1A 3VKFA 1OR8A 2WTXA 4R7GA 3UENA 4ARVA 1WZIA 3CLRC 3PGLA 4INPA 3VVCA 2WTBA 1SWVA 4MYRA 1JEDA 4P33A 1HYHA 1WBDA 2ACKA 4DDVA 1DJLA 2I3GA 1GRVA 4ZGGA 4BWGA 1IDN1 3DD5A 2HIHA 4ZOCA 5EHGA 3ZI4A 3I6BA 2HKIA 3DMNA 5E95A 4AMBA 2DETA 1NW6A 2OZVA 4HH0A 2QTFA 3C7KA 3M8KA 5ICSA 1UBFA 1STOA 3TD2A 3VHXA 4URYR 4BE4A 2C7RA 2PAAA 4K86A 5ALSA 4TS1A 4DDKA 4ZYXA 1G1AA 4FYIA 1DX4A 4O2BF 1KA9H 3F7NA 3EC2A 5IJ9A 4QQ8A 3IDOA 4DADA 1RD4A 3SFVA 2W0MA 4BECA 4EF4A 3FUXA 2WJWA 1XALA 3OTIA 4QM6A 4HB0A 1Z17A 4B3XA 1ESEA 3IO5A 1HQCA 3SF8A 1BW9A 1KK2A 4GXTA 1GFWA 3GWZA 4HOYA 1UOQA 3H99A 1NAIA 1OWMA 1YJQA 3DMTA 4EIWA 1KFBB 1NTOA 4NY1A 1L5GB 3KHUA 3RYIB 2C9CA 4A26A 5L3SB 4K0RA 5LB4A 2PKYX 4BLRA 3K5WA 1RRVA 1E7SA 2GM5A 4HEA6 5JSZA 1EFHA 4HH4A 1O3YA 1LEHA 1RKXA 2IE0A 2IPXA 5CDYA 2YWJA 4FNOA 3L6DA 3INYA 2V3WA 4HWGA 3N1UA 5TF0A 1QUEA 2ZWOA 2JFZA 3ZU2A 1E9CA 1WDMA 2WG0A 4YVFA 3WWPA 3E5NA 3ICOA 4NBNA 4WACA 2WPNA 3ZI0A 3D6AA 1NMXA 4TTJA 1LU9A 1SCAA 4IMIB 5CCDA 3RRXA 3UT0A 1GKKA 3OF2A 2NZYA 3FJOA 4BVAA 5DXFA 1IB6A 2VJBA 4LC9A 4XKJA 3H19A 3QXHA 2ZRMA 4O3FA 5J1SB 2EBUA 4W1SA 3HSSA 3AJAA 4OFWA 2Z9BA 2O23A 3LGSA 4MW9A 3SYTA 4EUEA 1VPEA 1PUXA 2QBYB 1RIFA 1NBAA 1WU8A 1R4MA 1JHVA 2B5WA 3F3SA 3T1HB 1VCNA 2FLVA 1FLAA 3CJRA 3KC2A 4L9RA 2H65A 4LOLA 5EIEA 4LY3A 1P1HA 1JR2A 4G63A 3E27A 3TLMA 1QHYA 3GAZA 3ZX4A 4XYLA 4G1EB 8ABPA 1Q50A 3VR4A 3KAQA 3WIEA 2XIQA 1NN0A 4NQRA 4YAUA 2QJOA 5IKEA 4LDRA 1WQ3A 4RHCA 2ERCA 3HCFA 3I72A 3N75A 1K6JA 4N0DA 4Z1OA 2AEJA 1Z5NA 2DX7A 2PSEA 1NRJB 5CFZA 1UOOA 1TYEB 3BB4A 5IXYA 1Q3HA 4FGWA 2ORWA 2HU2A 1R8JA 1GYRA 1M6VB 2BTQB 3KL4A 4OK3A 5AW6A 1SHTX 1IM5A 3MELA 4D96A 2V7QA 4PSVA 5ARCA 1JGTA 3UJNA 1O89A 3NHAA 4OMCA 5AM5A 2HXGA 2NUTA 2EP5A 2N46A 2Y0DA 4OMDA 5GONB 5BPFA 1E0AA 1WU7A 4FZRA 1VMAA 3GD5A 2OVBA 3EF1A 1PYDA 2R4QA 3CJTA 4A10A 3IP9A 3DB2A 4INJA 1BS1A 2XVMA 4K6FA 1HEYA 2PKQO 4AT1A 5K01A 1MJGM 4GBED 2C7PA 3AR8A 2O0KA 2QTAA 1XAGA 3LFUA 2POCA 1AY0A 1PFWA 1JAIA 2B3TA 2AFHA 3T7CA 1NBHA 2K2WA 2YOGA 2TSYB 2BFCB 3VH1A 2A86A 3AC0A 2DFPA 3FPBA 1PHPA 4UDYX 1Y6GA 4QPPA 4F4DA 1ZRSA 3CH4B 3RYHB 5LKAA 1O6CA 4A27A 3PQCA 4B17A 4BX0A 1USIA 5AKJA 1QK3A 2PEYA 2YVUA 2VYCA 1MVNA 3FH0A 2NGRA 3T12A 3ULKA 3O1IC 4A8JA 5GIPE 1SD5A 3E70C 3LPLA 3T3NA 4YRMA 4UHEA 5BNZA 1XEFA 2YUTA 3TI9A 5BYJA 1IQRA 2HHHB 3OKPA 1POWA 4ZO9A 3IESA 1IE3A 2I7TA 2IY9A 2PFSA 4CV2A 1HDOA 4QEDA 2J9ZB 4BKUA 3C0KA 3QPCA 2HDHA 4G5OA 2AQ8A 2GPYA 4KU4A 1XV5A 4WA8A 3TQTA 3VH3A 2W2LD 3RRNA 1G20E 1NR1A 5KVVA 3HL0A 3PG5A 3WWZA 1U90A 4KK3A 2ZIEA 1BIFA 2QM0A 3HWRA 3K6SB 3BXOA 3DDWA 3GJRA 2C57A 2ID8A 1K92A 3PR3A 1FVHA 1I14A 2L0XA 3BJMA 5KAMA 3CUVA 1SG0A 1ZUIA 3LWZA 1H94A 1P4GA 1JHRA 4RIGA 1XK6A 3LLCA 4WBNB 4PONA 1O96A 5GZ3A 2NU7A 2WJYA 5HIJA 3KEQA 4P4SB 4CGYA 4II7A 4ENVA 2VQEB 3PC2A 3O8QA 3BG5A 3WYNA 1MEEA 3KJNA 2WUWE 4J0HA 4XVCA 1IQ0A 1V1MA 3GOQA 1WLYA 4REQA 2NV0A 1A8SA 3SNHA 1W85B 5EIOA 2JLUA 3FHLA 4KB5A 3EULA 3JSAA 3NDIA 2XRZA 4EUNA 1QANA 4RHUA 1FLDA 2I6UA 2VZEA 2ID7A 2VQSA 4U63A 1S3GA 1JJFA 3RODA 3HKCA 3FNHA 1L1EA 4A5SA 4QEZA 4UZEA 1A9TA 4KXNA 4WFQA 3IMEA 4LZZA 2X0EA 3U4AA 4D45A 3NTLA 4HSGA 1E9FA 4JROA 3LOPA 3N28A 1DAEA 2R1VB 3OEEA 5HDBB 1QDEA 4JBNA 2WTAA 2F8MA 4O4IB 4Q1DA 3A9SA 1U0TA 5TMDA 1YCFA 2QGFA 2Y71A 1EM8A 2WMNB 4FK8A 2QROA 4XX0B 2NSYA 3AR9A 2WUDA 1SCDA 3BRCA 4JB2A 1Z38A 3GN2A 4JENA 1DTWA 3HZRA 3PF9A 2HK7A 4DR7B 3DBOB 4H4DA 5FXMA 3U5TA 1X9GA 2WW8A 3L3BA 4W9MC 4F8JA 5KYWA 1XEWX 1K5DA 5F98A 5DJ5A 3BBLA 4LY9A 4QLAA 5JWRA 4UEJA 3FFBA 4P0QB 1MX9A 1YO6A 1HNXB 3JWHA 1F4PA 3FF1A 4DY6A 3A6EA 4HXYA 4MWZA 4A16A 1HYBA 3FJ1A 4JASB 1V3TA 2V45A 3VHXB 2AHOA 4L51A 4OFXA 3WL7A 4CKYA 4CQMA 5B7NA 4KPFC 2WZDA 5IJ9B 3EVGA 1ZIXA 3T5DA 1DRUA 4AKEA 2XLBA 2PPLA 1VI5A 2HJRA 4EI7A 3GLFA 1LX6A 2ZB3A 3BAZA 3LW8A 2AQKA 2Z5LA 5CNKA 4HDSA 5AO9A 3WIVA 3OTQA 1B41A 3OZAA 3SF8B 4AKSA 1HQYE 1BW9B 4F1WA 3LP6A 4F5WA 4QLOA 4HVLA 1JB9A 3OKCA 4LF7B 4MPJA 2QN2A 4IJQA 4JNKA 1YMVA 1KZ9A 1GCGA 3NX4A 2WFZA 1VOTA 3F7TA 4Q3EA 4RL6A 3WYFA 4NU5A 5JQGB 4PHFA 1C4OA 3U39A 2AB0A 1KQNA 3W9YA 3H5IA 3PPVA 1YQDA 5EP2A 4B3JA 4M89A 3NHMA 2GF9A 4D56A 1AQIA 1KVRA 4OY3A 5JSZB 3CT4A 4MVJD 2GM4A 1LBSA 5ADVA 1D0VA 2IJGX 5JPDA 5FIUA 1N3IA 3ICQB 2VAMA 1RYDA 3CC8A 1UKBA 5A7FA 1PYGA 4W6ZA 2XUHA 3RNOA 2O57A 3EA4A 3ONVA 4IEIA 2Q4TA 4AZVA 4D9HA 3ROQA 2MSKA 1HQDA 4LPSA 2A8YA 4C4OA 1A5AB 1XHLA 4BLPA 4EHNA 5JXWA 2EC5A 4XQ0A 4OHPA 4CIXA 5B2FA 1IN7A 1Q12A 2J6BA 3BIWA 4N1AA 3JD1A 1X39A 3QEKA 1R4MB 1X19A 2PIAA 3ZV5A 1GSOA 1VRCA 4OIFA 4YP0A 3CVYA 4WAUA 4UUQA 4FHFA 2CBGA 4S1NA 1UXKA 1ST2A 1W88A 1X1EA 2HIMA 4KQ2A 4OB6A 4MXDA 5AJYA 2EFCB 4GKKB 3U7RA 4B7UA 3DOJA 2IK8A 4UJ3A 3ZHOA 2GBIA 5HCUA 4IGIA 2BZ1A 4BMVA 5BNTA 2J32A 1JV2B 1Q77A 3VZSA 2Q3DA 1OBHA 1RXVA 5IUNC 2JIZD 3NATA 1T8WA 4TL9A 5EJFA 4P58A 1CB0A 4QQKA 16PKA 4PZZA 1DMRA 1II8B 4RVDA 2VPTA 4Q03A 4D82A 1K8QA 3KUXA 5ALDA 2NUTB 1OZGA 2H7VA 2XZDA 3T35A 5JS1A 2CL6X 3LBIA 1P5JA 3NNDA 3OU7A 6ABPA 4K9SA 3H42B 2FFAA 1F2VA 1HTBA 1CS0A 2PWPA 3F6SA 4Q1CA 3NHJA 4YDHB 5ALMA 2FAXA 4NBWA 3C8HA 2OYRA 4N8DA 3U2QA 2CKMA 3RSFA 2V7TA 2RAFA 3BFVA 1RQPA 1MF7A 3S3TA 3VKVA 1WE2A 2AFHB 3DFFA 1OC2A 1MLDA 1GQ2A 3KHTA 1ZSNA 2P2DA 3UWDA 5JI2E 1AGYA 3THSA 1IBRA 2Q41A 3PC8C 4M36A 1AK1A 4UHJA 2EFJA 1ZGBA 2IYFA 3B9BA 3M4XA 5KYWB 1KEVA 4TVSA 7YASA 2YS6A 4PF1A 3PGVA 3IAUA 4H27A 4MUJA 2BEUB 3K9NA 3B82A 5F3DA 4A8JB 4CMCA 2QRLA 4DIFA 2ZYVX 4QDTA 1GGVA 1Y34E 3VA7A 2B2CA 1WMEA 3AUYA 2G5PA 3GJYA 4J1TC 5LLSA 3ZQUA 4CHTA 1E0SA 2IHJA 4AL4A 4XYEA 3QYFA 2FCAA 1K8RA 1D5CA 3TM4A 5BQPA 2BM1A 3JY6A 1IJBA 1C7QA 4ITVA 5CH3A 3MAGA 1PGJA 4OB8A 1QBKC 2VWPA 1FNBA 1ZD2P 3G9XA 2YY7A 3ZJVA 4KAFA 1KK3A 4MTCA 2R68A 4TQUS 3KQNA 3KD3A 4D9IA 3LNCA 2OCDA 3WK6A 1A9ZA 4RDIA 3M6VA 1G6HA 3FNQA 4YCBA 2JAPA 1HOTA 1VXOA 2WABA 5KB3A 2YXEA 3PFWO 2HQSA 1I13A 4UU0A 2A67A 1O96B 5HK9A 2NU7B 2O8EA 5AVJA 1KBOA 1T2DA 4N6GA 1X87A 2CXNA 2D2XA 3N9IA 4ZDIA 4JQOA 5F23A 2VA9A 3I8OA 4M9QA 1GR1A 2R8ZA 2OXTA 1JI0A 3M70A 3O8QB 4OCZA 3JYPA 1PZFA 4ZV7A 3DE2X 2NYRA 1V1MB 2Q3MA 1WP9A 4REQB 3VC2A 3BE8A 1LRLA 1MCZA 4GQAA 4EB0A 1RYZA 4BNZA 1MT0A 1YJAA 4DLAA 2OQ2A 1QG4A 5ELMA 1XEWY 1L7DA 2QQGA 4MQBA 5K0FA 3L18A 3EA5A 4RJIA 2GZAA 2P2LA 3HKCB 3EW9A 3HACA 3UPTA 3EQ8A 2FQQA 1X8LA 1NBME 3MGGA 3K70B 4BB9A 5BORA 1CUEA 3G1UA 3RTEA 3D2AA 3UW1A 1UP7A 1KZ7B 4DS3A 4DR5B 1DUIA 4YRZA 1SCKA 2WF5A 4WERA 2VK2A 4EB3A 2EKDA 3W2IA 4J9UE 3G89A 4B3MB 1GZVA 3M1AA 1MQ8B 3M81A 3HA3A 4P82A 4KXLA 2BF7A 5J5VA 4DNPA 4QM7A 1EM8B 1P4HA 2X8JA 3BE4A 3OMXA 4MW1A 1ADJA 4BX9A 4K9NA 2EKQA 1OGJA 3CW9A 1DTWB 2REQA 2G70A 1DFHA 2NU6A 2ZVQX 5AHWA 1SVNA 3WIBA 1KZYC 4TYYA 1BD3A 2VDNB 2XLCA 2Y1FA 3DE7X 4JT9A 2VP9A 3ZWCA 3UXMA 5DGXA 5I7AA 4DANA 3C3XA 3IAHA 3GHYA 4LVOA 4RHXA 3SHTA 4DKJA 1ODIA 2FWBA 2DPMA 1PU2A 5IS2A 4PRYA 1OXXK 1Z6ZA 4JP5A 4ZAGA 3DMDA 3I5XA 2O8DA 3GY0A 1HE3A 4V2UA 2IEDA 4X7RA 1E2GA 1MQAA 1ECJA 1YRWA 3HL4A 1XJ0A 2HBYA 4C06A 1RC1A 4IHAA 4CQMB 2VNAA 4RK6A 4BX8A 5FOQA 2UYHA 4BIIA 1E2NA 1IN4A 3FHCB 4IIEA 2PBZA 1NKVA 2QSZA 1D09A 1LVGA 2Q8QA 3A1FA 3ELWA 4RWEA 4W9NC 5CW2A 3JXEA 5IJ0A 3X1MA 4D9FA 1WCYA 3P9PA 4BFWA 4HDSB 3SLRA 3E7DA 4Q9LA 1JIQA 2CFOA 1XIVA 5AT1A 4J2TA 4X95A 4DUGD 1H93A 4C3ZA 2Q8NA 4KVAA 1AQJA 5CLIA 2V98A 3DUFB 3IV7A 5HRUA 2ZANA 1YVDA 5BSMA 1QFYA 4N6OA 3TSAA 1KAEA 1YZNA 1CUIA 3WBFA 4N54A 2GEDA 2NAPA 3L1UA 3IUSA 4LVUA 4BVGA 5HKOA 4D26A 4E6PA 1I4TD 1N92A 3GJ5A 4GKVA 4H08A 1SUAA 4V0LA 3H1BA 4MMYB 2ECKA 3IHTA 3QLJA 4COKA 4B6EA 2J5QA 3A14A 2N3ZA 2GJ8A 3L8DA 2PRKA 1IWOA 2ZRBA 2ZPTX 1ZIYA 2ZWVA 5FD8A 1LDGA 5ALNA 3ZHUA 4JQCA 1SC9A 1L3BA 3WV5A 4NEHB 3B5JA 3GXBA 4H1VA 2PLNA 4MR9A 2GX6A 1L7PA 3CUYA 3GROA 3ZH9B 4QYWA 1I4EB 2GA8A 3WAGA 1NUPA 3PV0A 5A5DA 2ZBVA 1IHXA 1OZAA 2B98A 4Z53A 3OHPA 1HR0B 3I6ZA 1KORA 2GD6A 1WXEA 3GJ6A 3AUAA 5IM5A 3T9CA 1YIAA 4S05A 1ULUA 4OH1A 2C8VA 1LNZA 3LTNC 2C2GA 4XUDA 1W88B 3NQ41 5FUWA 2ZIAA 3IEUA 1OLXA 1U81A 2WJ6A 3HWX1 3VV2A 4AF6A 3BBPA 3DFKA 3Q9SA 2WWIA 4WUTA 3WLKX 2XTZA 3FD8A 4MW5A 4EGSA 4R9UC 2WWXA 1RFGE 1UFOA 1X13A 1U8CB 1RAFA 4FBLA 3WDMA 3AJEA 1E0KA 4LYFA 4YHBA 1U65A 3RDPA 5ECYA 1F4LA 4TTSA 3UFBA 4H4EA 5DLQC 2C9MA 3AJ9A 3R9KA 1B0PA 3WB0A 2FH5B 5DXJA 3IIJA 1B23P 1WXGA 4HUTA 1I7NA 3IBCA 1SH7A 2GI4A 4QA9A 5CVEA 2CE2X 3OFKA 5DU2A 3GEEA 5K0NA 4CODB 3D3EA 1DJOA 2PE5A 5AWFC 5F7OA 2QRMA 4UBIA 5ALIA 1FP4A 1PVDA 2ZBEA 1CS0B 2W2LA 4W7HA 3AP1A 2ZTVA 4Y9UA 4WRRA 4US2R 4EZEA 4L76A 3DBRA 1ORTA 3MWKA 1PJ4A 3ZG6A 4RULA 3QBJA 4JOBA 2ZP1A 1DRWA 4OAOA 1TJ4A 5EXPA 3R7FA 4B2LA 1UODA 2QQEA 1U7TA 3M89A 5H59A 1DL5A 5HIMA 4F5YA 1XZBA 2CHUA 2QIPA 4OATA 2GO1A 1E0JA 1EQUA 1JPNA 3K0CA 3SXUA 3V42A 2JD0A 2WICA 3D2CA 3HDVA 3ST7A 1HDCA 4K9KA 4NZOA 4FYWA 4ER7A 5AVXA 1SXJD 4EYSA 3ZOKA 4X97A 1ZP6A 2AFVA 1QGOA 2HYDA 4L16A 4ILKA 2HRRA 1XRQA 1Y1RA 2FQYA 1XTUA 4HGRA 5JTTA 3LWBA 1SCQA 4E46A 1X1AA 5LXTA 3EUEA 2A0YA 2RBKA 3MUFA 4B6FA 1BFDA 1GDTA 1IZ9A 2J33A 5F51A 3MS7A 5JARA 1P5ZB 3R40A 1D04A 2XOKD 4EFNA 3JZFA 4BMNA 1D6SA 3PEEA 4RSMA 1IPFA 3GF4A 2YYAA 1ZI6A 2Y27A 1O0CA 4HRAA 1BGWA 4PPQA 2DBYA 4NOMA 5HA5A 3O9ZA 5BQXA 5AW1A 2C8KA 3HI4A 1PJ3A 1VLQA 1K8ZB 2EKZA 3CZQA 2VJPA 3K1AA 3PHBE 4JKYA 4KVGA 2F67A 5E1BA 3L8FA 3X43A 2CVOA 1DV2A 2R751 4H7JA 4I55A 5CT4A 2IV2X 2O8EB 3KTFA 3QE4A 2NNWB 2BMAA 4XCXA 5JC8A 4KN8A 3OZVA 5E8RA 3N58A 4QUBA 3WRWA 3DT6A 4CF6A 5KO2A 1V6CA 1O9GA 1UC5B 3FR7A 1Z4MA 1L4YA 1YWGO 2JBAA 3M82A 5CIWA 3UT5A 4A0QA 2IS1A 5HS4A 4DUYB 1SIBE 2H4WA 4RE5A 1Z7YA 1Y1KE 5HQTA 3WLFA 2X0DA 1H1TA 3W3ZB 2AYYA 2GZDA 5ITSA 4DM3A 1VQ1A 1ZXXA 2HIAA 3VAZA 2E18A 3PZBA 4W1RA 3GGJA 3PGMA 4UU7A 4A5OA 2VCEA 5T4FA 5IZ4A 2RJ3A 3VDMA 3C6ZA 4J16A 3QX3A 2EW8A 4B32A 4R7TA 1CT9A 3DC2A 3NTVA 1PN3A 4UZFA 4PZ9A 4P3KA 1TQ8A 1LCIA 3CIFA 4CTOA 3ZHXA 1PT9A 4E88A 3BZBA 1E77A 3VV3A 3NANA 5K9ZA 4FOTA 2QORA 3FUVA 3LX5A 4BFXA 1IOWA 3DMFA 4K81B 1ZM4A 1E1CA 3OX3A 2BELA 1MO5A 3GNTA 2X8JB 3AYZB 2D2IA 3NOQA 3U7QA 4YXWD 4BV9A 2REQB 3DDSA 5A5GA 3Q3VA 1T34A 2NU6B 1LTHR 4LDPA 5BYKA 2PKXA 3RSSA 4PZAA 2A94A 4D8TA 2Z1MA 5T67A 2B8TA 3WYEA 1L4LA 4EHIA 1LLQA 3RS4A 4M7WA 4O5OA 2CLOB 2GFQA 2NO5A 4TL8A 1NNUA 2ERXA 2Z5GA 2EEPA 2CEKA 1MU0A 2YWHA 3CX8A 2O8DB 2A0FA 1LPPA 4LTNA 1WR8A 2WYIA 2Y99A 4X8MA 3SQOA 4CI0B 4F3NA 4IR7A 1H1LA 3TKAA 1ECBA 1WNFA 3EXAA 4L15A 3VX3A 4F4CA 4ENSA 1ORHA 3SDBA 1ATIA 2PMDA 5IWAB 2RCNA 4IYRA 1G9TA 5EXXA 3ZBQA 1WCV1 1C7IA 1NUTA 1P2VA 3O0TA 3Q2OA 4L22A 4NMWA 2Y3IA 1CRZA 4EABA 5IJ0B 5K0TA 3X2SA 3EUAA 1R37A 3KSUA 4ARSA 1Y6JA 2REBA 2VSFA 4G8BA 2PKQP 2IIQA 2V5AA 1K7XB 3OOHA 1CS4C 4MVJF 4QFDA 4QGHA 4HNTA 4BVLA 1DEAA 2W4QA 1TKAA 3BE5A 3KEFA 5I7EA 1XZQA 1GVHA 1JP7A 1ZKMA 1ODTC 3F5SA 3IAAA 3WMRA 1C3OA 1YMUA 7REQA 3NUGA 2EBHX 1OWPA 3O8OA 2P40A 1YDMA 4Z0NA 1Z2CA 1QR2A 3LRXA 4NBUA 3NCTA 1MB3A 3WYAA 2H9AA 2JDID 4GW3A 4Y67A 1OZ0A 1DCFA 4F7DA 2YUIA 4EKYA 3ZUPA 3O73A 4C04A 4MR9B 1C7JA 2ZB4A 4WLVA 1KJQA 4J7XA 1U8XX 5TJ9A 2FUEA 4BO7A 1UBEA 3K6JA 2D2VA 3NYQA 4WVFA 4G0ZA 3L04A 1QMPA 2VPXA 5HTKA 3SR0A 2I62A 1NKTA 4QGAA 4QUHA 3KXIA 3ZCUA 1E6LA 1S3IA 3ND5A 3P0EA 2QD2A 3ENWA 3RUIA 1GVNB 3LF2A 4BO4A 1XXHA 2TMDA 3HTXA 4DWJA 2ZWPA 5CP8A 4ZQEA 2YFQA 1DC3A 2CNWD 4W8OA 5EQFA 3FDZA 1NRWA 3H83A 1XJQA 3MOGA 1TZJA 3ZZTA 2BMFA 1IN6A 1JN0A 5KUTA 4UAJA 1VLZA 4RH3A 3V80A 1Y5LA 1PFQA 3O26A 3OFND 3P1JA 1WCIA 5UKDA 1FUKA 1UAGA 3RS9A 4UPEA 2P62A 4CN9A 1NFRA 4RU1A 5GTDA 5JMWA 3IV6A 1SPXA 1CDEA 2XYHA 4IHQA 3GVHA 1NWHA 1F3OA 4KUEA 4TWAA 1BA3A 2FWRA 3X1DA 2IITA 4MUAA 4KXXA 1TRKA 1AXEA 4XGKA 4RMHA 1IXRC 4FJ2A 4WKBA 3PKIA 2BLLA 1Z0IA 4AB1A 1OYVA 1LDBA 1RJ9A 1YRAA 3NHRA 5ADUS 5LDGA 4LMAA 4YRAA 1QHIA 2CYCA 3Q2KA 1X7XA 1UMKA 3T7IA 3GP8A 1JEEA 3AL0C 4ZCRA 1FP4B 4UCXA 5JS2A 4ESVA 2D7CA 4J0CA 4JXJA 4RD3A 1QE3A 2HAEA 3KQWA 3RVPA 3DBRB 1RT9A 3LBNA 1Y3IA 2V59A 3NBFA 3NWBA 5D51S 2AL7A 4F2PA 4YAGA 3SIPA 5LP6A 1ZRHA 3QELA 1P6UA 2ERYA 3U6BA 1YC5A 3GUZA 2LWIA 3IVRA 2PSFA 2PKWA 3O8DA 3CBGA 1ZO8A 2W6ID 5BNIA 3WOHA 4IG4A 1YCHA 3SXUB 1OYOA 5IVHA 1B3RA 4P35A 4JLDA 2R8BA 3TSOA 4P3PA 1EUYA 2IYZA 3BHIA 3G1WA 2NZUG 3TOCA 5CFMA 3SYKA 2NADA 1F17A 2G9QA 3F74A 3GJ8A 3WFIA 1RI3A 5IM4A 2XD9A 2YHSA 3FWKA 4R84A 3W6ZA 3ZCTA 1ZD5A 3FYTA 1WSBA 4YCSA 1J49A 1VG8A 2C5FA 5LXTB 1ZHHA 3O3NB 1N2GA 2HA6A 1Y7IA 2I22A 3W2EA 4J94A 2DC1A 4AMYA 4ROSA 4WK2B 1HX7A 3DLHA 4C0AC 4X6YA 2QW0X 3UK0A 1YRHA 2F3UA 3JS5A 3LDFA 4I8DA 2P5UA 1H5QA 3QG1A 3AI1A 2HOQA 3G6KA 2UZIR 1NU6A 4XB2A 3W6OA 1QFSA 3C8DA 2CUZA 1YH3A 3O91A 2F9FA 4AXXA 3BWBA 2O2EA 1NE2A 2XNDD 3K1AB 4JODA 2BEWB 1URPA 4GMHA 4YXFA 1O6ZA 2YWDA 1XZDA 3C8UA 4I55B 2GRJA 1HSOA 1RKBA 2IU4A 2YJ3A 2AFIE 3CNQS 3FTQA 4JLWA 3RSQA 3S2GA 2PG3A 2VT6A 3TE7A 2HI0A 4NCKA 3F2VA 4ZXFA 4HDKA 3UT5B 5IDXA 2JBAB 2XJ9A 4BN0A 4JC0A 1VLVA 4Y9TA 1VIDA 3BXGA 3ASVA 3HY3A 4IVRA 3OHSX 4QBFA 2I9KA 4YCMA 1VGVA 2DWQA 3G8AA 4U5QA 4I6JA 3WZLA 4FT2A 4IS3A 1E61A 4B75A 2IGBA 3NJ8A 2FWNA 4KX5A 4EELA 1ZN7A 3EWSA 2XGOA 5CIQA 3OPMA 4LXQA 9MHTA 3MTIA 2PWAA 1L7EA 1WZNA 1EHCA 3QJGA 4JR2A 5J1TB 2H1RA 4RC9A 2KSQA 1JTVA 2E4YA 3N8KA 2WF6A 2JG3A 4B47A 1XN4A 1ZJ6A 2VXOA 1E1CB 3T7RA 2NQ8A 3CRNA 4C78A 3KQYA 2XGGA 3FCXA 3EXFB 3U7QB 5AJWA 3ETNA 2QM8A 4UBKA 3UWSA 3MRXA 2AVDA 5DK6A 1ZQ1A 3UHOA 5BXYA 5EJ9A 2REOA 5FH9A 2AMYA 1PJAA 2JW5A 3EFOA 3HG7A 3KSRA 5CA1A 2Y6UA 3KLMX 2OK8A 3AG5A 4PLTA 2H2IA 2XYRA 3H4MA 4WK6A 4DLVA 3QVLA 6LDHA 5C31A 5H9WA 1T6NA 1ZRNA 4Q3AA 4EFKA 1N4DA 3MQFA 1JDNA 4YJFA 5AW0A 4IWYA 1P1FA 4JKOA 1H1LB 4HX5A 4B84A 3G88A 4XIYA 4AZ3A 3NZEA 1JF8A 4QU9A 1YQGA 5FO0A 3PFFA 2GDZA 4LYYA 1FDSA 1ENYA 4WNCA 3OLZA 3GRKA 3IAS6 1YRQA 4KO3S 1LPSA 1TQ4A 1XU7A 1Z2OX 3DOIA 4YLGA 5ALYA 5THKA 1R0YA 3OX1A 3T9FA 3A4MA 3ZU5A 1E5LA 1I4DD 1GNSA 2H06A 1TQDA 3IIMA 4NAVA 5TLSA 2QPOA 4IJKA 3KZKA 3TZQA 4LC1A 3A06A 4OYYA 4Q5IA 5CA1F 1C7EA 4F4FA 3ZI7A 3JQ9C 1K7YA 2PS0A 5F4ZA 3AVVA 1J0EA 1S2MA 3RT1A 1GV0A 1XZPA 1J8QA 2PYZA 1ELOA 4HS9A 4IOJA 4P2GA 2COUA 5FNVA 4JU8A 4F72A 1ULZA 3BWMA 4J7CA 3OC6A 3ZE0B 4E07A 4ER5A 4NDAA 4C30A 1C3OB 1FEZA 5AW4A 3X0DA 4H6WA 7REQB 3EVBA 4LQCA 4CCYA 3EGOA 1T0UA 3VNSA 3O8OB 4IIJF 3B6EA 3IKVA 3CT6A 1U4SA 3GFBA 3L7JA 4N65A 4AKTA 1GD1O 3GA7A 3LSYA 1LXCA 2HWUA 3FNGA 5M34A 4QYSA 2ZUVA 1X70A 4YA6A 1SBQA 1UP6A 1TFRA 1SVWA 1UOEA 3LPMA 4U7DA 1Z25A 1C2YA 3MFYA 3QMWA 1NF9A 1UDCA 3D4IA 3H9CA 3QPUA 4C08A 3DZCA 3ZTWA 3T3PB 3W1WA 1GGEA 4TT8A 5IHXA 1HC7A 3V2IA 2B7CA 1BMQA 2FPGA 2QLFA 1HXHA 1AUPA 4UTRA 4TMTA 5CHYA 2QR3A 2I67A 4WASA 3MINA 4DCUA 4KO2S 1XYYA 1BHO1 2CW5A 2JAWA 4RSHA 2Y77A 5H4HA 3PXGA 3AHCA 3KQVA 5FL7A 1IG3A 1XXHB 4CBVA 3ONFA 4KFTA 2WPDD 4Y7DA 3GUVA 1SBHA 5DTIA 5IBRA 4TM8A 1M1NA 1ODKA 1XK7A 3CLTC 5K3SA 3R7WA 1DKQA 3FDZB 2PT5A 1SKYE 2J8ZA 2XVYA 2ATIA 3PYLA 4PLCA 4URUR 3P97A 3E03A 3FY4A 1CJSA 3IBYA 3GRVA 2XT9A 3TXAA 4CNBA 3GJXC 1SAYA 1TZBA 4CETA 1WCIB 3BOSA 3WWOA 3EGEA 3RADC 1SM4A 1OLOA 4AP5A 1AHIA 1SXJA 3AB8A 3IRUA 1W46A 1IIBA 2ZAGA 1NXTA 1FMLA 5HRCA 4AY5A 2ZI4A 3ZJ5A 5D87A 1OASA 1WM1A 2H07A 3BIOA 2L82A 1RWOA 1MMFB 2PHZA 4R9VA 5BN5B 1RJ9B 2ZYWX 2X19A 3JQPA 5KYXA 3EDCA 3P9RA 3IQGX 3UMJA 5DHUA 4EG7A 1X7XB 4MWEA 1C3JA 1FVOA 1NQUA 2IYNA 2XOKA 1NTRA 1FFXA 1YE8A 2C8JA 2W00A 2X5KO 4BBAA 3NVMB 5FA8A 5FFMA 2UUAB 2ZREA 1GDHA 2HO5A 3M9XA 4KYTA 1Y42X 1CIVA 1EBBA 3TCKA 4H9GA 3WLTA 2OO3A 4C88A 3UB4A 5I7HA 5LP6B 3KLNA 4NBLA 2ARKA 3LZ6A 1O2DA 3QELB 2HZ7A 2XYQA 3KOOA 2KE5A 3KOUA 4H7DA 1G5TA 1UPXA 2I1LA 1Z3CA 4JQZA 5JOQA 2FETA 1T9HA 3ESAA 3KKMA 2FW0A 4IV5A 3CLHA 3ABRB 4M4SA 2FDRA 3OEHD 2VP4A 1R5BA 3OU6A 3FCEA 4KO8A 5CVCA 3FI9A 1KAQA 4NQZA 4E4YA 5CCBA 4FDAA 2JBHA 3P5BA 2I1VB 4ZD6A 2HCBA 4AY3A 4BTEA 5IT5A 3B51X 1NT4A 2BR5A 2FGKA 3M3HA 4MI1A 1B26A 2BCEA 4GC9A 4KPUA 1DX9A 3E82A 5TVKA 3RBXA 4QTTB 2X77A 1YXMA 4ALJA 5H5JA 3TDMA 4DLRA 2VBFA 3J7AC 1R0ZA 3KEMA 2ZYAA 3O8LA 4LV5B 5LC1A 5F7XA 4IJUA 3WLNA 3O2QB 4PO9A 4RY9A 2FMIA 3IKMB 3UF0A 3ZWYA 4AP6A 5CLFA 1QP4A 3Q3EA 4B82A 1KJZA 1MABA 2XWJI 2GUWA 1ABEA 1BQEA 3QEAZ 1OWNA 5DT2A 1CF9A 2WUGA 3NBAA 1YZTA 3PIRA 1Z39A 2GEKA 3N87A 2H2WA 1BRTA 3VPHA 4E5PA 2FDXA 4IJWA 2BGMA 1KZGB 3AETA 4G1BA 4OI4A 1C1DA 5F7JA 5JHGB 3JARA 4BNKA 4GOJA 1JAHA 2YJ5A 3KQUA 1L6IA 2WLSA 2XRYA 1Z2AA 4D5GA 4YGYA 4QWMA 4P1ZA 4G0UA 3IDAA 3PWSA 3SKVA 3VO8A 4WJZA 2DOKA 3HUDA 2A1IA 5BRAA 3GRFA 4HDKB 4X8LA 2KLHA 2P2SA 1U02A 3QP9A 2C4HA 1M8GA 1QH1A 2YWXA 3BTSA 4RLHA 4UOZA 3TGLA 3LQQA 4YI5A 4OQEA 3E84A 4RWZA 2EBWA 1A95A 5M3BA 1KBZA 4UTXA 5I9MA 3M9LA 5SICE 2GYVA 1E6EA 2YN4A 5GOTA 1ZUNA 1MC1A 3MHPA 1X6VA 3GUCA 4BGEA 2FUKA 1OAOA 1X1RA 1E9SA 2G0TA 3LUJA 3SZMA 5JD5A 3AFGA 1SCNE 5IT9A 2W6CX 3O74A 4K9OA 4XWYA 3EIWA 3TD9A 4AMZA 5L8VA 2GN8A 2HFJA 3PHLA 1YE5A 3WGNA 3WV4A 4DIDA 4EVRA 3VYVA 1HBJA 1EB9A 2XODA 1R50A 2Z04A 4NFYA 4LQ4A 3CLSC 2AN9A 3P7MA 5K6AC 3P9XA 1JFLA 1MJNA 1UQTA 1C4WA 4F8EA 2IKSA 3RW9A 1B3BA 3FCUB 4NFSA 3I5MA 3NV7A 2VQFB 3EFOB 1V8ZA 2AT1A 3TL2A 4K26A 3DM9B 5CA1B 1Q3TA 4ZU6X 1JAYA 3TN7A 4EYKA 1NUAA 1U3DA 4HNSA 3MQ4A 3SDZA 2ZJ1A 2VSOA 3NU1A 4OJNA 4YQFA 4FS3A 4YJFB 1MFZA 1SCJA 2QK4A 3D8RA 5F2KA 1H8ED 4PFJA 1LF5A 3CH7A 3WY9A 2JDIA 3X3HA 5KQMA 2ZU0C 1IBLB 4FD2A 1KE2A 2WVAA 1N0IA 2Z2YA 3LGXA 4XZ3A 4NBRA 1JSZA 2O8FA 3TUJC 3ODPA 1NUHA 2GD2A 3SGLA 2Q2OA 2B8JA 2DUUA 2OFXA 2BKVA 2ZPAA 1BU5A 1IYZA 1Q74A 1SBNE 2C7QA 2G80A 2WYWA 2H8GA 1BHQ1 4L72A 1BDHA 1FSFA 3MRVA 5JS6A 1KSHA 2Y8EA 5FNVB 3RCBA 3VKHA 4YBZA 4RANA 1P3JA 4Z8YA 2OD2A 3GW8A 3TW4A 4P98A 3T7TA 3RHFA 1PQWA 2CK3A 5E2BA 5ENDA 4PSKA 1XDGA 2NVWA 3FPFA 4MCIA 2PX5A 5DW3A 5BT9A 3T6KA 2R6ZA 2O2SA 4LBYA 4RNDB 3TSYA 4C14A 2XCTB 2IZOA 4PG4A 5HR5A 3F9RA 2ZULA 3JQQA 3HU5A 3ZE8A 2RI0A 2WM3A 4P5PA 1BDIA 4JJ6A 4A0SA 1WMDA 3L4SO 2NXCA 1OFUX 3OFNA 1VFPA 4G9GA 3Q5EA 5FBVB 3FMOB 3A7EA 2P6NA 3W8FA 4L1KA 3IXQA 1K88A 1RMTA 2FP4A 4YO8A 4BRWA 1R0CA 3E1GA 4HGZA 1G6Q1 2BISA 1P0IA 4IMPA 5CT8A 2ZJ3A 4TV8A 4ZVRA 3ANXA 4S2EA 2NU8A 2VH1A 5I9SA 4Q9IA 2WT8A 1TF2A 4JLPA 3TIFA 2EU8A 3AJDA 3B3QA 3H2GA 4O59O 3O4RA 3QMMA 3QWFA 4HNGA 1LTQA 2ZRAA 3MINB 3DB1A 3N5KA 3HDGA 4M88A 1PD0A 2AOWA 5K0ZA 1TMGE 3SC3A 1NPTO 4RGQA 4LSZA 2CE7A 2B3DA 2I29A 5EEGA 3WGGA 3HRKA 1HKHA 2XR1A 1BOOA 2P0EA 2ZSAA 4K9QA 2BM0A 4MWSA 4W9RA 5CT5A 4BO5A 4YUZA 1YOBA 1RFLA 1WMFA 2I3AA 1M1NB 5E1MA 1Q7GA 3R7WB 1Y8AA 3A6LA 2ONCA 4BEJA 4EPTA 1ZR2A 3DNMA 1Z16A 3GPLA 1FL9A 1O94C 4MDYA 3IPXA 2W6IA 2LD4A 1N6KA 3CZRA 2XX3A 5HTOA 1G8KA 4YRFA 3P0HA 3KAJA 2XBUA 3ZY5A 4UDOA 2V7UA 3WOVA 4ZYVA 1I0IA 1VBNA 2ZRDA 4OHMA 1SXJB 3OLYA 4M98A 2Q9AA 2BDEA 1JHMA 3H2ZA 3V4RA 2Q6VA 2QUAA 3L6UA 4KYUA 3L7AA 5ARBA 3NAQA 1X3LA 2VFAA 3V4VB 4CFZA 4D42A 4NYJQ 4EA8A 2XKAA 5JTUA 1YCGA 4Q3OA 5KYXB 1VHWA 4O8ZA 5KOYA 4FGZA 1UOPA 3AJ8A 4BJ3A 1FFXB 4WCFC 1L9XA 1SVSA 2RJNA 3CF4G 4V24A 3H6KA 4ZMSA 4XOIA 3DVLA 4PGHA 3TAHA 1XCJA 2Q28A 5TY0A 4AFNA 2P2CA 4IRUB 1T0IA 3EXIA 1JI3A 3GJTA 3L4BC 4GG1A 4BQNA 1VE7A 4JJ4A 4OD0A 1I3LA 2WIGA 3I28A 5GGXA 1WEKA 4B6OA 1DKMA 2KLBA 3NC4A 4I19A 2XNDA 1DAPA 3H0CA 4FFLA 2D5CA 5FJIA 4HLDA 2XUAA 3NIWA 1V7CA 1ZLXA 1GNQA 1H6BA 3WLIA 4RMGA 1DCTA 4IFEA 2YHBA 3RVKA 3RU2A 4X64B 2IUFA 1DO2A 3E5HA 1T5HX 3WLJA 2A9PA 3M3DA 3ESRA 1P1BA 4KPUB 3SFTA 2AQHA 1JFTA 5FQNA 4R8KA 1FX0A 4N03A 2ILTA 4JP3A 2GKSA 3SVTA 4RTQA 3MJSA 4GNRA 1D2EA 4AMVA 1KOFA 3UWOA 1R0SA 4K1XA 3C3DA 1CJKC 2D0IA 5FNZA 4WOCA 3VM6A 5JIBA 3K71B 3HVRA 4PHCA 1D9XA 4UBMA 4QAQA 2IWHA 3RBZA 4UM7A 1VL6A 5C52B 5HSGA 1DU4A 1Y8RA 1GZ5A 2PD4A 3AETB 3M4ZA 2X9VA 1C1DB 2ZIWB 3PDHA 3AIKA 3QJYA 3JARB 4PLGA 5I8WA 3SX0A 1OREA 1M8KA 1BO6A 3FUUA 2NTNA 2YXNA 2BT4A 3HB0A 3QFCA 5SY6A 1UFVA 4MYDA 2WYHA 3PT9A 5IYZA 1CF2O 4DRYA 3TUZC 5E3JA 2DUMA 1BJRE 2NZWA 4FYVA 3WL8A 1P9NA 4Z4CA 2BHTA 1O4VA 1Q22A 2QVZX 4JBYA 4NC9A 2ID9A 4XWOA 3NIDB 4G09A 4CMKA 4ABYA 2NG1A 3O38A 3LCJA 2ATEA 5BNWA 5I45A 1QH1B 821PA 2HWKA 1BYUA 2Y2VA 2YQZA 5AI8A 4D2IA 4FX5A 2R0QC 4IZHA 3P9QA 2BGKA 2VPQA 3Q6MA 4R68A 3IOCA 1ITZA 5ALLA 4C22A 4BQIA 1NBMD 1X8JA 3GCGA 1X9HA 1ZUNB 3GCXA 4DCGA 1W4RA 3OJWA 2PZEA 4IX1A 4LTDA 5JYCA 2YY5A 1ZM2A 4TMXA 3P2IA 4JZYA 1W75A 4IZIA 4IDEA 3VTKA 1DWOA 1LNSA 3FNIA 1UJ2A 4FCCA 4LJAA 5DHRA 5EKDA 5DN6D 4UFOA 2OOKA 4ALKA 3C43A 2ANBA 1JG3A 2ZVDA 3MMXA 3ROFA 1CHDA 5JNRA 3ANNA 1CU1A 4X00A 5ISMA 2D1FA 1I30A 1JRLA 2IZ5A 4R41A 5AP9A 1U0SY 1T6ZA 2FFHA 2GEJA 3KE8A 3X2FA 4PR3A 2HLHA 5JLAA 1W6UA 2W4MA 4TWJA 4UBLA 3RTDA 4C0QC 4MZDA 1Y37A 5CK5A 4LOIA 4ZYZA 1PJZA 1FDOA 1MO4A 3R4CA 4ZAZA 2BFMA 4GGPA 2WTUA 3UMVA 3CRW1 3HNRA 2PRIA 3EPKA 1PX2A 3LWNA 1NN3A 3CY6A 4HRXA 4LS3A 1V5EA 1JAZA 4RMNA 2V9PA 2V7BA 2GXAA 4FHGA 2CXOA 2FMHA 4COOA 3WRYC 4BNYA 2WOOA 3WK7A 4UHBA 3QNUA 3VPFA 3EXG2 5CVVA 2JLYA 2JGDA 1ODLA 4YQYA 3A8TA 1TADA 1WUYA 5K2OA 3OJCA 2EQAA 3W5VA 3GU3A 4R2WA 4C7XA 2YFKA 3ODGA 3OZCA 5L3RA 4E5VA 4B3CA 2P79A 1GGMA 1U8UA 4LW8A 5KOHB 4CF3A 221PA 3L06A 1RMYA 2GYUA 2WMOB 3T3HA 4IUBS 1KSJA 1NT2A 3FB4A 1E2MA 3G2QA 2W6NA 3ECAA 3FETA 1XRSB 3ZNQA 1PP4A 4DLYA 1YZKA 2OFPA 3VSCA 4HDCA 2V0GA 4Y2PA 3ZDAA 4HMOA 2Z3WA 1XCMA 1VKJA 1XB2A 3A6KA 5JASA 4V02A 4DC1A 2CXPA 1NG9A 4KWEA 1AK9A 2RHLA 4EW2A 2Y0EA 6YASA 5KKCA 2XRMA 4MUKA 4EBBA 4BUJA 4IG9A 3N0VA 5DV9A 3V4FA 1GNTA 1Z83A 1ZOPA 3I0ZA 3ENKA 3UANA 3MWYW 2QXUA 4PO1A 4D02A 2WVJA 3SJUA 5HRAA 4RTNA 1U28C 5B53A 1T5IA 2OHIA 4HB3A 2R1UA 2GR9A 3QFHA 1DTEA 2FP4B 2H1HA 3PT5A 2Z2ZA 3NWEA 2V6GA 4PSAA 4ZO4A 4R0MA 1Q0LA 3HO8A 2ZXUA 4TV8B 4ENWA 3UTDA 2O59A 3BIFA 2NU8B 3OWHA 1IY1A 5E2AA 2ET6A 4G1FA 2LCIA 3GEBA 3TUIC 1ZD9A 4DDTA 5C7OO 3K2IA 1A88A 3STVA 3LK7A 5JAQA 4R9SA 4WKNA 3GNLA 3K0SA 5E9JA 5JADA 4CQLA 4IIDA 1PAUA 5CX4A 1WPXA 2P3QA 3IMGA 3QX7A 4ZT7A 3I5YA 3WKCA 1XVIA 4J7UA 3W0LB 4LCEA 5TARA 4ERXA 2PFGA 4PNPA 1JG6A 4JL8A 2IPMA 2QU7A 2C03A 1U7HA 3DP7A 3N86A 3PI7A 4LX8A 3WNZA 1L1FA 4XGIA 2GPJA 1LUAA 1HI9A 2J67A 3UIEA 4RTJA 4TROA 1TGVA 1HLDA 1K3TA 4WZAE 4BZZA 2A9JA 3MGAA 2GN1A 3TLXA 3K35A 1E2QA 3DDCA 2HLDD 3IDFA 3SFZA 3OEHA 2I4RA 4W5WA 5AKKA 3VYSB 4IH1A 4TMWA 1E2DA 2A92A 2PGXA 1R9GA 3MTEA 1M66A 3T34A 1IJKA 4KXQA 3CINA 2FW8A 3G5MA 1T2NA 1NIJA 4B3BA 3MRSA 1CWUA 5K8UA 5C8YF 3NM6B 1Q7RA 1E3EA 3CWQA 4F6LA 2KPOA 3LJKA 2OQIA 5AKIA 2FN9A 2WU3A 5JJCA 3IQDB 2XVZA 2DEUA 3EIQA 1G20A 2PWYA 4PYQA 1WDWB 3N39C 3EGVA 2ZYTX 3KJQA 4GYJA 2LZ0A 4W99A 3BA6A 3A32A 1NUQA 1D03A 4LECA 4U2FA 4CCSA 3M7IA 3PQ4A 1JEYA 1XEXA 5FOWA 3EXIB 3TMYA 4EJ2A 4BKMA 1KWGA 1ZH0A 1D07A 1MJGA 1NMSA 2FE4A 5CM2Z 2BKUA 5H0IA 1PWZA 1GGHA 2B4AA 2ZRKA 5DBOA 1U1EA 1M9NA 1NVEA 1Z33A 2QMOA 3P9KA 4M0KA 2B4RO 3K09A 2A5FA 3BL8A 3IDZA 4V0RA 3ZDFA 4F4JA 2HF2A 3R41A 2OLJA 4DC0A 4J0GA 1HNNA 4Q3DA 1WRBA 2OYSA 1LQTA 2Q6KA 2YHUA 5K3AA 3R3WA 3VVLA 5DHTA 1AA6A 2M1XA 2NTVA 3I04M 4LSMA 3TZKA 2QWXA 3B7WA 4W5NA 1DHRA 3ZQJA 1EWTA 4URFA 3Q2IA 3S44A 2PZGA 2A0WA 2XHZA 4JJEA 1CUJA 3JYQA 4YRDA 5LUBA 1P0CA 5LMCA 4W6QA 3B20A 1V5IA 2AOTB 4FTWA 4KMOA 5G4LA 1CUYA 5BSRA 3DS8A 1BROA 3GT7A 2VZ8A 3O94A 1Z2EA 2A88A 4HX2A 5IU6A 1UFRA 4EITA 1XROA 3C45A 3QVGB 2QP4A 4O1HA 5SZKB 2JFFA 4P8RA 3KUUA 3K9BA 1AHHA 4G0NA 4RE6A 1V5FA 3N74A 1Y8RB 4OFZA 2DWCA 3NC0C 4B7XA 4KJXA 5KINB 2GAOA 2IHUA 4BNLA 1H3NA 2RGCA 4DIMA 1PZEA 3PE6A 1G7SA 1HT0A 2H92A 2ZBRA 3F6BX 4MW7A 4PIMA 5E2IA 4LFCB 5BSEA 2W11A 3S8YA 3PC8A 5IYZB 4WT7A 2CC2A 2B4QA 1U11A 3CCFA 1A8UA 4V39A 3WNVA 4BEVA 1Z08A 1K63A 3NYWA 3AL2A 2HQ1A 2CDNA 4B6PA 3CX4A 3KUKA 3WFJA 2EVWX 3PUKA 4KLNA 4J1TA 1JA9A 4B9EA 2W43A 3OPVA 2Z4RA 2OXCA 3ASUA 3GCZA 3D6FA 3IPRA 1KMHA 1L7OA 4GI2A 3NOVA 4R01A 1MXHA 3I34X 1PX0A 4YMUA 2GPSA 2P5TB 4XWWA 1H8EA 3L6BA 3QVTA 1JG2A 2ZS9A 3UM9A 2JH8A 1GGNA 1X3SA 1A5TA 1H66A 1FQOA 3T3MB 3OZWA 3N0RA 4R6WA 1MVLA 3W05A 2ZLBA 4MKRA 5I7VA 3RG8A 1WQ1R 4NG4A 4PV7A 2I4NA 3QTLA 2Y6VA 5CA0A 2W37A 2C4WA 2C2MA 1SIWA 2XD4A 3F3MA 3QVWA 1SRRA 3DBLA 4LWZA 4MTLA 4ADSG 3L41A 1Z62A 5HF8A 5DIFA 1KHHA 4U2KA 4E09A 1RCFA 4Q9NA 3ER8A 3MILA 1V8FA 4JLMA 3S8MA 3KSDO 4HK4A 5DNUA 4GU5A 4UATA 2GSWA 3V2HA 1FBNA 5HIIA 3RU9A 3RRZA 4QBGB 2GETA 2JBWA 5LJLA 1R6AA 4BWFB 4DARA 5H70A 3PUZA 3PJFA 3COZA 5ALEA 1A2BA 1HE5A 3EIHA 3QOXA 3S2YA 1YS4A 1ZM7A 4AZWA 2PXHA 1EP2B 4JUIA 2VAXA 1QAOA 4PE5B 1CQWA 1S1MA 2HT6A 1MOQA 1RR6A 1Z4KA 1NNLA 3BIXA 2Q1TA 2JGDB 4PRLA 4GR4A 2QX6A 3PTLA 5DRYA 3DDOA 4F45A 1NVMB 4ZJZA 4J0IA 1AS0A 5IBQA 3ZS9A 3QUAA 1N6IA 3DZHA 4WZZA 2AZXA 2RGWA 2QS9A 1PZNA 5EGSA 1MC4A 1NVWQ 4LXGA 3ZYCA 2IXFA 2WM9B 4BE9A 4KR2A 5K2MA 4OM8A 5F33A 5F78A 1QG6A 2YJZA 4PFQA 1L7QA 1UK9A 2WKSA 4Y9SA 3NHLA 4KAXA 3GPDG 3BJEA 4KR9A 4KBGA 4DQLA 5A2QA 1AKNA 4NCBA 4KR3A 2DH6A 4R98A 1SKQA 3HHEA 4N48A 4CCWA 1OX4A 2WJJA 3K1TA 4IPTA 3GVCA 5JJIA 3VI3B 1ZX1A 3WLLA 4G0OA 5CTJA 1DO8A 8AT1A 3L93A 5HF6A 3MJDA 3MJVA 3FPEA 3TTYA 2C9DA 3DE0X 3CONA 1E4VA 2A58A 1HMPA 1N9KA 4KXFB 4GI3A 1VJGA 1UH5A 1XJCA 3INGA 4QPJC 4ZPXA 3HFRA 4HH1A 4DVGA 4I3FA 5TPWA 3BFPA 3TRHA 5I4IA 1XNRB 3SSAA 1CZHA 1VL8A 3I92A 4X41A 2C4TA 4RL4A 1WSAA 1N6NA 1MEOA 2CNBA 4W9NA 1S7CA 2B1QA 5F76A 5DB4A 4BGDA 4G8DA 4G0WA 4OBEA 4WOKA 3LBAA 4HDMA 3SY8A 3BSYA 4CQLB 4XQCA 5FYDA 4OM7A 4ACBA 3U4HA 3OIYA 5ALXA 2QNBA 3EF3A 3B6IA 3N70A 3T38A 1G8MA 1I33A 1LPNA 2H52A 1G64A 1KY3A 1UADA 4JP8A 4D74A 4JQYA 4QVIA 1BEEA 1WXQA 3HCPA 4G56A 4P6VF 1NDHA 1NW7A 2WP8J 4GPZA 3Q85A 3ZWAA 2YIJA 1NVGA 1SVUA 1TVMA 3HA5A 4IX9A 2ZW9A 4MI6A 1D5WA 2EJUA 4Y2YA 2RHBA 4ND6A 3L7IA 5AKXA 2PR2A 1CJBA 2QIOA 4CM5A 2V96A 2JJQA 1XD9A 3TS1A 5AR1A 5HQJA 1DARA 3R0ZA 2W2OA 3MRTA 2P2YA 4JC4A 5A4MS 5EJ6A 3PK0A 2J6CA 3AVXA 1UDBA 2BFEA 4FMPA 4JXXA 1M2OA 1S3FA 1PJ8A 3LBYA 1R66A 2BY4A 2J4FA 4G5QA 1XDDA 3OJFA 4PHTA 4YP1A 4BNNA 3A9RA 1CJMA 3OZUA 4UD6A 2G1PA 2HGSA 1G20B 5DM0A 1KSGA 4ZAYA 3VQTA 2KHZA 4XM1A 2QPTA 2Z98A 4YROA 3FYUC 1IJEA 3H5RA 3CEJA 1RAIA 4IHKA 4YV1A 2H9IA 5EHQA 1AIPA 1G7TA 3T4XA 4ZCIA 5PGMA 3ZE9A 3DVRX 2BI8A 1YA8A 2EDCA 3RH0A 4DNFA 1XEXB 1Z2NX 3TG2A 5BQ5A 3SOZA 1JEYB 2R7KA 1DKNA 4MI9A 4OXKA 5BSWA 2ZYGA 2O6LA 1QZZA 3B3AA 4OA5A 5FLXA 3AP3A 1GQRA 2V0NA 3GXOA 2V4MA 3V7FA 4ENPA 1WCXA 2ZR7A 2ZEJA