5C31A

Constitutively active sin recombinase catalytic domain reveals two rotational intermediates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLVIQILAMVSEQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sin, putative plasmid resolvase dimer
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 34
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c31A00
1ZR4A 2GM5A 3UJ3X 3PKZA 1ZR2A 2MHCA 1HX7A 5C32A 2GM4A 3ILXA 3LHFA 5C34B 1GDTA 3GUVA 5C35A 1GHTA 3BVPA 3G13A 2R0QC 5C31A 2RSLA 3LHKA 4BQQA
chains in the Genus database with same CATH superfamily
1UH5A 5IN5A 1LX7A 1SUAA 2EG5A 1Z7EA 2WU0A 3PQDA 3PX3A 4IOLA 1AQNA 1YULA 2C3PA 1BROA 1TGYA 2HSDA 3A7EA 3B2NA 2YNMC 3ESAA 3WV4A 4MKZA 2TSYB 3EW7A 2ZUVA 3BILA 1RS0A 2VL7A 4Y6SA 3VR4A 1WCXA 1NP3A 3KLBA 3EFEA 4PQFA 3NEYA 4V38A 5ADUS 3L9XA 4B3RB 2AEEA 2ZQZA 5A3VA 1AK2A 4YRTA 3I8OA 3A6LA 4FLMA 5AIAA 2C59A 3VR5A 5L7WA 1U0HC 4BWYA 4C7VA 1WPQA 2H51A 2UZ3A 4E5SA 5FRDA 1GTZA 5K8TA 4H3VA 5ED4A 2C3MA 2Q5LA 4ZT3A 1MQSA 1U2RA 1UP7A 4KITB 3WLMA 2ZUEA 5DN9A 3N0TA 1DCKA 3NC0C 4M9RA 4MW0A 3ZE7A 3KQKA 3U44B 4U7GA 5JNVA 2PKRA 3MTDA 3QKRB 3BWCA 2WJZB 4JKOA 5D5HA 4Q15A 4NMLA 2WSMA 4K88A 4OATA 4BNGA 3G8AA 3T4UA 4DCSA 4GKAA 3P97A 3DJFA 3QEBZ 1UANA 1ZLYA 2XIJA 3FOCA 3NWOA 3P94A 3G6KA 2IYPA 2D8AA 4BEWA 3AOEA 4EYSA 5JHGB 1G8HA 1JPNA 2BR5A 2OCGA 3D7MA 1NW5A 4KPYA 2B61A 2YS7A 3VSBA 1XZIA 1Q0TA 3WYEA 4CIYA 1SXHA 2GJ8A 4Z7OB 4PBRA 1MF7A 1Y37A 4MLZA 4QOFA 4S1TA 4N1AA 2PNFA 1TA4A 2Q50A 1EGMB 1YQEA 3M6MD 3TUJC 1E9EA 4CL0A 4Q03A 5KJ6A 1P1IA 2GWHA 3HVKA 5CD1A 1XEWX 3ZV5A 4BLVA 3IL2A 1SA0B 3GLRA 2DQSA 3HVIA 1OKKA 4FWTA 1VMEA 2B83A 3MMSA 3GJTA 2CFSA 4D3SA 2R2GA 1KI3A 1U2PA 2ZKIA 4M0KA 4A1OA 4BUCA 3GOQA 4Q3DA 3OIWA 10MHA 2G88A 1RAGA 2DBRA 2WTEA 1RHRA 3M5CA 1QHFA 4JLKA 4BO3A 1S2IA 1T3HA 4UVDA 1TCCA 1VB5A 1XZGA 3HBMA 4CT5A 2D2FA 2PX0A 1V11A 3RRBA 3T1NA 4DLAA 4KXNA 4X44A 2YY5A 1ZESA 3TGLA 3ISJA 3F98A 3H04A 3HSKA 1SUWA 2DWUA 4FOOA 3QOWA 5D2CA 1FP6A 1T5SA 1W5FA 3L02A 1AQJA 3Q9NA 3GGDA 1TCBA 3GEDA 2ZXUA 1PW7A 3HPRA 2VP6A 2V0NA 2JPDA 4EARA 1L8OA 2VPWA 3KD3A 4K9PA 1QVAA 2XNKA 5A4IS 3H1FA 3DE4X 5BQ5A 1RWPA 4ZJYA 5CA0F 1C1DA 3F1KA 3ZOZA 1M34A 1DWUA 2WHQA 4EB6B 4EK9A 5JI2E 2FW0A 2ZEJA 1LDEA 1QOPB 1U8UA 5CCDA 3N0WA 4ETMA 4H6WA 2FWRA 3LTEA 1RP1A 1X7GA 3CZPA 3HP4A 3IESA 3PQEA 1KEVA 2KYRA 1Z16A 3D5EA 3GJQA 1IN4A 4UOEA 1JA9A 1X0XA 4YWHA 2PMKA 4BEBA 5GINE 4A0SA 3F2IA 1ZC4A 4RQAA 2FXIA 2G6TA 1BTOA 2KLHA 1ODIA 4N39A 1CUSA 4KQ9A 3B20A 1AKVA 1HNZB 1H4VB 4AUMA 3I8SA 4LS3A 1NFQA 1OIVA 2HMAA 2UVQA 1KGDA 3F4KA 3ZU5A 2IYYA 3QU4A 1CE8B 3EA4A 3TQSA 1A4IA 1B2LA 1HTWA 1U8YA 1LTQA 3RVPA 1SD5A 3RRXA 3O1JC 5CD9A 2CJWB 5JD3A 4QQ8A 1NF2A 2WT8A 2KWIA 5EIBC 2GYYA 4PHGA 1OIWA 3Q85A 5E6UB 2QMZA 3RK4A 3D6MA 4CQMD 5JAUA 2Y9PB 3SLGA 3ONEA 2AVNA 4BQIA 1NC3A 2QUBA 2CLKB 1ZWKA 3OZRA 2BGMA 2F3SA 1IBSA 2H1IA 3O7WA 5EQTA 3VZRA 5C31A 4IJ6A 4AJHA 1MAVA 2G06A 3IIEA 2ET6A 3K1YA 1WB9A 2PL3A 2NO4A 5KNDH 1CYEA 3L0ZA 3N0XA 4PX2A 1AN0A 3T38A 3ZIAD 1N7GA 4KMRA 2NTYC 1I3KA 1SG9A 1U90A 1KVRA 1TF2A 3IR6A 5HPYB 1XHFA 1N1MA 3P8ZA 1JEYA 3TTVA 3PNBA 4TVSA 3MFYA 4YRMA 4F4HA 1RI4A 3SEQA 2XZOA 3P9YA 2QIOA 2VJCA 4DGSA 1IEXA 4CQMA 4CEJA 4ZGWA 1GRNA 2PV7A 3EPRA 1Z6YA 2VTEA 2X0JA 3W8DA 2OD2A 4HEA6 2BKXA 1H3EA 4QU0A 1P2BA 2YZGA 4DCPA 2YFQA 1U3WA 2QNIA 3RFFA 2ZRBA 2NNWB 2C1ZA 2QRVA 4FFBA 4V24A 1PTKA 3WLIA 1EIWA 3RRYA 1IVSA 1YE3A 2W0SA 1G291 4K1XA 5I3CA 221PA 3KKEA 4K81B 5HIMA 3ZIAA 4LNAA 2C29D 5LP6C 3UWOA 3UK7A 1I24A 1M2GA 1MAAA 3VPDA 2BRUC 3GNTA 1OVMA 3T9AA 3ZDEA 4HG2A 1E7MA 1QHEA 3HY4A 3G5UA 2BR3A 3KHKA 1YIDA 4MJLA 2X42A 3GJ7A 4MVJM 1DUSA 2XOEA 3DZCA 5JSKA 1KZ1A 1SD2A 1Z8NA 1FBTA 2WKSA 3QPBA 3GJ3A 4I9FA 4B7UA 2B4YA 4ER5A 1QZTA 2AMFA 4WZAA 1G59A 2X9LA 4JUFA 5H9WA 3GG9A 1U7HA 2HZ7A 4BGDA 2GCPA 4GWKA 2IXEA 3D7LA 3I04M 4Q7LA 5K3AA 1R0WA 2H9IA 2QGFA 4FB5A 3WRYA 1JWLA 3C14C 1BGXT 3NDIA 1W5SA 2DPHA 1NR1A 3PPYA 1LSOA 1PR5A 2VJDA 3OZSA 5E1MA 4KCGA 3VR6H 3WNZA 2PKWA 1D7OA 3IAM6 2V7GA 3FOZA 2DECA 1G21A 1QDEA 1X9HA 2OLEA 3AOGA 4GL4A 1I2CA 3WB2A 3ZHUA 2W4MA 4E08A 4TSKA 3ZE8A 2QXYA 3SZUA 2ZWPA 3X1KA 5TX7A 4DLZA 1APBA 4YRBA 3C8DA 3GLGE 3IQZA 1RC8A 3AX6A 3JWEA 1P7PA 1DX4A 5AI4A 2F1RA 4GI1A 1E7YA 1DJMA 3C5CA 821PA 1HQDA 3BTSA 4HTFA 1XCMA 1SC1A 4MW4A 4QD3A 3VYUB 2R0QC 1YZQA 1THZA 2KHZA 2P91A 3L6OO 4JT4A 3RR2A 2HSJA 3FWHA 4UEWA 2QRQA 5TMPA 4KN5A 4IJUA 2AD5A 1OIXA 5EJFA 4JOQA 1UKAA 4RH1A 3B12A 2NUAB 2DUWA 2OB2A 1J2TA 1HT2E 1KI7A 2Z8ZA 5K0ZA 2PBLA 4RQUA 3OQNA 5LQRA 2ZXFA 4MS1A 5EE9A 3E35A 1Y3CE 4UBJA 2LCQA 3G8BA 3MCZA 1JHVA 1X92A 2ZRQA 3OG9A 3P7MA 4HUQB 2UKDA 3SYKA 4UAVA 2XVMA 1VSBA 3M5WA 4NOKA 2HBQA 4UVHA 5MGBA 1UMBA 1L4BA 2P7IA 4PINA 2GNAA 2BEWA 2L69A 2Z56A 1EQUA 3VTAA 2G6BA 3HA5A 4CMJA 2WILA 1TYCA 3AGPA 3JASA 4CM5A 3DV9A 5C3MA 3LECA 3WGYA 2NYAA 3CJTA 4Q7JB 3KYCA 1ULBA 3NIWA 2QN9A 3U49A 5BN5A 2J33A 2YC2C 4MVJH 3WGZA 3NTLA 3AFNA 4ZO6A 1G7CA 4K9LA 2AR7A 3ONDA 5AKZA 4RSMA 2UZAA 3IUBA 4JJFA 4BX0A 2YY7A 1GEEA 4IIYA 3OE5A 1M6HA 3D8SA 3Q7QA 1CLUA 2JIPA 2YIVX 1SEPA 5DYGA 4DNXA 5HF5A 2EFGA 3ZS8A 4V0MA 4R71A 3DDOA 1E9RA 3PUJA 2ZI3A 3PC8C 4IFEA 1LVHA 1Y3FE 4M99A 4OREX 1GT91 3WIOA 4KDCA 4DNPA 2OG2A 5ALPA 3VO2A 4KRYA 5C34B 1HLGA 3E22B 4J0CA 3LAWA 3QEJA 2AH5A 5EJAA 5DLEA 4US2R 3GLIA 3DVAB 3VOSA 3FPCA 3LY9A 2EXXA 2IIBA 4TS9A 2H2AA 4R40A 4EG0A 4F4UA 5J5VA 1H9AA 3OIUA 3T34A 1YI8A 3QM1A 4G63A 3MRTA 5JZSA 4G1MB 2XUIA 1ONOA 1CERA 1POXA 3R77A 5JC1A 1HORA 3ILHA 3AFGA 3BC1A 4XFKA 1NJ2A 3URKA 1A2KC 4KR2A 1JDBB 3N0VA 5CPFA 2WA1A 3Q5DA 5I7AA 4RXTA 4GFDA 5FOXA 2OPHA 1PWYE 1CULC 3C7KA 3CRRA 4YJ3A 4PRLA 2WNHA 4FS8A 1D9ZA 1OFUA 1V8OA 4IUDS 1C9JA 3EGEA 2FRDC 4ZT5A 2EGUA 4WERA 3T7CA 5SY4A 4MIYA 3HBJA 2IGBA 1Z12A 2H2DA 2VHCA 4HZIA 3ZHRA 4G0VA 1DAFA 4FOLA 3FTQA 2B20A 4CXMA 3VNUA 1DB3A 4OQXA 1GRRA 2QAJA 4Q3OA 1PWZA 4D0NA 1YKFA 1QZZA 5BR7A 5M7EA 5I4KA 1Y8ZA 2XAUA 1KDVA 4R0MA 1GUDA 5EIOA 2JLXA 3UJ3X 1QVRA 2PKYX 4TMYA 3CRMA 4YDSA 4ZI7B 4R1LA 2UUPA 3DUFB 3OLCX 2XUOA 4FPXA 1G8MA 1YVEI 1K27A 3LBIA 3NUZA 4J4HA 3WXBA 1UDWA 2REQB 1X9GA 4D41A 1E4EB 4NV1A 2Q4RA 1T25A 1X8JA 3K2BA 4R9VA 5CCEA 4A8JA 4TS4A 2B8EA 2C7VA 1YJQA 4KI0A 1LC3A 3I9FA 3RHFA 1NQAO 1YCDA 1YJ5A 1M8JA 2HGSA 1T1SA 2OD7A 1FQJA 1FFSA 1UPUA 1M34E 2YJ6A 2XNHA 3OFKA 5LB4A 4KXWA 3O4RA 4CUKA 3MHTA 1FVHA 1L7VC 3ZXYA 5AVVA 1VL5A 1K86A 1N8TA 1X77A 3I2FA 3ZTWA 1OZHA 2ZULA 3T3PB 2CEAA 2F9MA 5I9BA 4CMHA 5C3UA 4NCNA 3DJYA 1T8RA 4Q9AA 3LWZA 4IV8A 5KI6A 1HZJA 3PTLA 2DGDA 4YPOA 4YUXA 1N4DA 4PYRA 3IEKA 2FN9A 4KMOA 4EUHA 4J6FA 1W9HA 3FTPA 1V48A 2AZTA 1QYWA 2QSUA 3VUFA 5AK0A 1FP1D 4C6TB 2V7QD 1Q74A 1DJLA 2XE8A 2BN4A 4RVDA 1YTLA 1XL0A 2NNLD 3KLMX 4F5EA 3HXLA 4M3NA 5I01A 3P2JA 4KDEA 2IELA 1H2AS 4UM9D 5TXGA 4RKFA 3R5HA 2P3LA 3CR7A 3W2GA 2ZOSA 4EBBA 3OQJA 2QAGB 2VFAA 3IULA 4Q7KA 2NUPB 5E4FA 3RU2A 4XUDA 2VTVA 3S55A 3WBKA 4A10A 5I7OA 2J3KA 3CBGA 2XMZA 3RK1A 1G66A 3SYNA 2V5UA 1GN8A 4GMXA 3UWPA 3TVYA 4F3CA 5NULA 1OX4B 1YJ8A 3W2HA 4XJTA 3VTKA 2RGBA 1LB1B 3AB3A 3LX4A 2C9CA 4ER0A 5LZ9A 2WD7B 4OGLA 4TKMA 3TJMA 3ENZA 3UPTA 3ZHCA 3U9SA 4EKEA 1A8QA 1LTHR 3EZLA 4N3AA 4FP9A 4R1PA 1R6VA 4MPPA 1SY7A 2QD2A 4GUAA 4KQKA 1VLHA 3X1WA 3OIDA 3T4XA 3ICVA 3FOEC 3EQ9A 3QFCA 1E2LA 1IHOA 5AKLA 5FBZA 3RRFA 4G37A 4B82A 3C7DB 4BMPB 4TN1A 3MLAA 5ICGA 3DOFA 3DOJA 4WLNA 3RQSA 5BPHA 4GP7A 3KZNA 4RM2A 1V1MB 1XAHA 2ECFA 3RVBA 1QGUB 5FA5A 3WBBA 2IZ6A 2F43B 3D64A 3S40A 5JFTA 1U1DA 3OOSA 1NVUQ 2VWGA 3WWYA 1E0DA 2DCMA 3GT3A 4G2TA 2BGWA 5COQA 4ZOEA 1KDOA 2F8MA 2QLTA 4V3CA 3U3DA 4PFQA 4E4RA 1US8A 2I4NA 3M1AA 1UBKS 2E85A 4EJSB 2NO9A 2UYCA 1BH2A 3HA2A 3QELB 1GV0A 1F14A 2JFWA 3ZYZA 3LVFO 1KAHA 3E5HA 1EK2A 1NVTA 3V8RA 4JXJA 2ZTLA 4WZAE 2WWIA 4ZU3A 4LPKA 4P33A 4HDKA 1TQDA 1B74A 2AEJA 4DSUA 7AT1A 3AW8A 3HN6A 1AUXA 3EJWA 3H1AA 3MEQA 3V1KA 4LUCA 5BR8B 4OXXA 4XVUA 1QCZA 1ZVKA 4JXXA 5C8XA 3ZY6A 4C78A 1ISSA 1Y0BA 2CBZA 2P5YA 3DZFA 3AESA 4WUVA 4RIHA 1V95A 3C4JA 5CIWA 3LZCA 4TT8A 5K7SA 3C8UA 3F5SA 4P7BA 4CLRB 1I9CA 1GCAA 2H1HA 2P6NA 1G21E 2XXAB 1OLOA 4HNGA 1E0AA 1KRXA 1H69A 3OZAA 3CPEA 4GWLA 4YRKA 2P6MA 2JBWA 5GP1A 2Q41A 3DSRA 2I6FA 2BFBA 2EHJA 4Z4EA 4B8WA 3BCUA 3OX1A 4DEVA 3KZVA 5CG1A 4F45A 3H2GA 4V0KA 3EVTA 4PG7A 4DOMA 3LLCA 3VMFA 4J49A 1XNQB 3RSGA 2GGSA 2A9QA 3OPYI 2FJPA 4AMYA 4BV9A 2CN1A 3IQHX 1OFGA 3L7KA 4CQLB 3R9XB 1GG5A 1U0JA 2B1RA 2P9TA 3DT6A 4YCCA 3ZWDA 2GFHA 4OK6A 1QP0A 2WPDA 3TPFA 3KQTA 4LY9A 5CNJA 4BATA 1ISMA 5ALXA 1C30A 4FDAA 5EWLB 1OWOA 3CSDA 5IFLA 2LKDA 2R8PA 4HQLA 4M1QA 1OWLA 3FETA 4HGZA 3EBOA 4ALMA 4DT1B 2RHOA 2Q5QA 4EJ0A 4HADA 3OJOA 1IJFA 3KKLA 1F3OA 2FVYA 4NAHA 5BSUA 5TMBA 5IZ4A 1JAIA 4MS3B 4Z2AA 3U17A 1PDOA 2HUNA 2ZSJA 1KBZA 3K4PA 4YJ3F 3EDYA 4Z9YA 1SJ9A 1XTJA 2R65A 2OM2A 3RUDA 2UVPA 1T6XA 4IMIB 4BFXA 4BNXA 4YUWA 1OA0A 1Q6ZA 3BWDD 3OEWA 5DJ5A 5JROA 3SXJA 1XZNA 1JA0A 4WXRA 3F6EX 4IDPA 1P45A 3CKYA 2P2YA 3I3OA 3SF0A 5LXTB 1QFXA 1DJPA 3BD6A 1K7YA 3MGKA 3WA6A 2DWOA 3IP8A 4DDTA 2PK3A 3IBYA 4X95A 3FKSA 3NKFA 3JWJA 4KGXA 4RJ2A 4C76A 1F7VA 1ZPDA 3PXGA 4HDOB 2HMSA 2FPGB 2W2TA 2ZG6A 2PV0A 3CW2A 1MO2A 1BOOA 4MHOA 2E2WA 5ADHA 4YRQA 3DFKA 3R20A 1WUKS 4V0ME 2I91A 2A1IA 4W5QA 2PANA 3UK6A 3VR2D 4TWJA 4AJ2A 2DBZA 4RA9B 3OZBA 3PJGA 1IG3A 1JIJA 2Y99A 4FGZA 4YH1A 5KYUA 3K6KA 4CIWA 4GM0A 4KWHA 2Q3CA 1MXFA 3IKMB 3V46A 3GLIE 2VXBA 2OBBA 3AHDA 3WGTA 1NXXA 1Q95A 3K2EA 2ZIXA 3KPUA 3Q1KA 4H27A 4NZYA 5DM2A 3BK7A 1DEXA 1XCPA 2N1BA 1DAIA 2WOOA 4QJ5A 5P21A 1NQTA 3ORFA 5BQ3A 2JLUA 4LBYA 4MGKR 3TEMA 1OH6A 2YNMA 1QFJA 4W82A 1SKYE 3GROA 1S2GA 4B48A 4CF5A 3N7AA 4DLUA 1QIIA 1EXWA 1IDN1 1QE3A 2QZZA 2J09A 1BKDR 2ZT6A 4QYIA 2VQ3A 5LLDA 2R11A 3CE9A 3VR2A 1PIWA 3ZWWA 1O0BA 1CUBA 2O2EA 4TXLA 2ORED 4NDZA 4HDAA 1GGEA 1K2WA 2C9ZA 1PJTA 3HGQA 4M83A 4UREA 4EY7A 3MBIA 4LDZA 5DM70 2PWZA 1X38A 4TVBA 1CFJA 2HFJA 4DMUB 3H2JA 1N2JA 5AXBA 1W48A 1Y1QA 3S2YA 4IFIA 2H3HA 1COWA 2ZVPX 3KNZA 3OY7A 4MV3A 2CLIB 1D4FA 2HM7A 2YZMA 5LQSA 1X1QA 1EAMA 4YV2A 4X24A 1VKNA 2V65A 4G0ZA 2W4IA 1GU0A 4KGDA 4LJ5A 3UOAB 2PUWA 4NNPA 3VSEA 2UU9B 4B76A 4GLJA 1NOIA 1Z56C 4TZ0A 1UBLS 2YJZA 3ZD6A 1KMCA 4D9EA 1CUEA 1NL3A 2MR5A 4D9CA 1T10A 2HQ1A 1P7WA 4JT2A 3GA5A 1N2IA 1X7ZA 1KI1A 1P6QA 2D7JA 4ZO4A 2IDMA 2HT6A 3FIUA 2PY6A 3L7JA 4JBIA 3SD7A 5BMVB 4F9GA 9LDTA 1SHZA 3N2GA 3NXSA 3AKZA 2HLHA 1KAEA 3KU1A 3CV3A 2VK4A 2ADMA 4H4DA 4M0EA 2JGJA 4CKEA 4XYGA 2CBGA 4LC9A 2UZIR 3BHMA 3A4YA 3I58A 2R6GA 4G89A 4KFSA 1ND5A 4UEOA 4BECA 2RJ3A 2CVOA 1HDRA 2WF6A 2EWMA 2PEYA 3F8SA 3JZAA 4PO8A 3DT9A 1Z0AA 4LOLA 2GYVA 3KT0A 4WVFA 1GPJA 3WHIA 4BTVA 2G9QA 1A71A 2IEYA 1X7DA 2QTTA 3VVCA 4FCWA 1JWBB 4D82A 2O1EA 3ESDA 2X40A 3I1JA 3PNMA 4INZA 4J0QA 4UM5A 4ZCPA 2P9HA 2HH9A 4REOA 5MDHA 1VJTA 2YHAA 2JA1A 1G19A 3LCVB 4BPRA 2HV9A 2J46A 1KQPA 5BN4A 3VR1A 4CL8A 5JNUA 4DJTA 2P5TB 1UJ5A 5H82A 4M6WB 2GN1A 2Z8YM 1WA5A 1H2HA 1WMAA 3D8TA 4ALJA 1G18A 2QT0A 1LDNA 4LJ4A 3F9CA 3W5HA 3QLTA 2BD0A 3GVXA 1T9BA 4A7PA 1XTSA 1W85B 1NQOA 3FGZA 4HN9A 3AFMA 2IS6A 2XD9A 1F1BA 1EPUA 7GPBA 2J0QA 1CF2O 5BY2A 3QI2A 4TV9B 3KB8A 1UXKA 1N3BA 3PVZA 3EEOA 1XVTA 2HKIA 3GRRA 2J0UB 3CNNA 5JSYA 1OGJA 2BBOA 1ZW1A 2W6NA 4PSDA 2B9EA 4RVGA 1Y48E 2HWXA 3RFVA 3ND8A 3WJAA 3LKVA 5CB6A 2NO6A 4DR4B 4AS3A 4JLPA 1UOQA 4CV3A 1SZCA 4DSOA 1QRTA 2P0AA 4ZVUA 1ONPA 2CWWA 3GT0A 2I9PA 3SI7A 1Y89A 2CL5A 1FFDA 3VVMA 3WYDA 2I3BA 4ER7A 3C48A 3LT5A 2POQX 1U3TA 3KJFA 3R1IA 2XLBA 1U80A 2O1SA 2Z2XA 4PRKA 1D8AA 1NOJA 4S2EA 3ZU6A 2UYHA 1E5XA 4UFOA 3K9BA 1U94A 5TQ2A 1BWSA 1J8FA 2ZUTA 2J9FB 3MBKA 1E1MA 1P4JA 4JC8A 4MWZA 4ABYA 4N8SA 4J3JA 2IUTA 4JJ7A 5DXAA 3GPDG 3W3AH 2ZBDA 3VU9B 3WLLA 2PZ8A 3OT1A 3TZHA 4IXMA 4Y2TA 1U28C 3G13A 4X92A 2HA7A 4LA4A 4OI1A 1FFGA 4LE0A 3R8XA 4WOCA 3IV6A 1WO8A 3KXIA 5DSZA 1BMFA 1ZL2A 1JJVA 1J8YF 4L8FA 1O9BA 4JXZA 5ELXA 3EZNA 3H4MA 1WW2A 4MUJA 4AAYA 3GIWA 3VHXB 1JILA 4CM7A 1DQRA 1KEPA 5JO9A 1J9GA 4EJFA 2B1JA 3F5MA 3W1VA 2GZMA 4UHEA 4YFYA 5G0VA 5J2UA 5GZ6A 1UC5B 3ICPA 4PLFA 2GBIA 3H0EA 1LPSA 2VCYA 3SQDA 2XMDA 2R1VB 3ABIA 4E15A 4F85A 3AI1A 3BMXA 3O93A 4UE2A 1L5HA 3W2TA 3TBHA 3H6HA 4D4LA 2OZVA 1B8OA 1IBMB 2XW6A 1WRBA 3OD1A 3JATB 4ENWA 1RM3A 1E5QA 2QJWA 4Q37A 4UMDA 5AJWA 1P2DA 4FTWA 4BMYA 1M2KA 4X6XA 5EC8A 3ICEA 2C5BA 4FNGA 2ZUUA 1AZLA 5GZ1A 3HO1A 4FD3A 2CFRA 2PRSA 2VJMA 1YO6A 3H0CA 5IBRA 4BDTA 3FHLA 4QBHA 3P26A 4LDRA 3UANA 2EERA 2PO7A 1T3GA 4QFDA 1FYEA 4HFMA 5FFMA 4RD0A 3QVSA 5TY0A 5KYYA 5A02A 3HCEA 4NBTA 2VUIB 4YONB 4Q3BA 5EA2A 1KQGA 2DMRA 1MJGM 1T0PA 1C3EA 3AWIA 1SOAA 1N2CB 3NVDA 1IZYA 4F7DA 4BBJA 3OQMA 1VP3A 4KZKA 1F8GA 3IYLW 4DMHA 1MW8X 1UMKA 3NH6A 2FSUA 3B5EA 5F9FA 4TLAA 1EUZA 3MAJA 4DG9A 3L8CA 3DFIA 4YS6A 1FSGA 3WL7A 1HL7A 3H8WA 3MQ4A 8OHMA 5DNYB 3L4BC 4P34A 4YAWA 3ZZNA 1USWA 1YNSA 2WM2A 2X4IA 3PC7A 2IZ7A 1T4DA 3B3FA 4PYOA 4Y2RA 4ACAA 1J5EB 1TYBE 1S5PA 2RK3A 3M6WA 2TMKA 5PNTA 3WVNA 5LQMA 2BSXA 3CUVA 4D4HA 1GFSA 2Z09A 3VJLA 1L7DA 5KTKA 2O07A 2OENG 1W4RA 4FEGA 4IDEA 4UUPA 5CH5A 3ROPA 1O0SA 2OC9A 4ARBA 2H4WA 2YS6A 3TOZA 2X7XA 4D9HA 1Z9BA 2EL7A 2X8JA 3CZ9A 3NM4A 5DP2A 2YXLA 3ZX5A 4BJHB 4LF7B 2I2WA 3ELDA 3PNKA 5TDHA 4YCNA 2PL9A 2XB4A 3HA7A 4FOPA 3ZDZB 4ES6A 3MJDA 4MHTA 1DOAA 4ITUA 5JXGA 3ZDCA 3TLYA 3HEBA 5B7QA 1TLTA 1R3UA 3FW1A 2FZEA 4P08A 5HILA 2QLBA 4L4ZA 5J40A 2K87A 3QGMA 3SF8B 5AKYA 3OZTA 1SOWA 1Q19A 1XAIA 2FPPB 2PZFA 4UHJA 4X20B 5AO9A 1Z0SA 5CBPB 1UPCA 3KJHA 4LQ4A 2VDVE 3AVQA 1W0JA 4HVLA 4R8MA 1J20A 4NJEA 1OZ0A 2B25A 3EOZA 3MZ0A 3LP6A 2RGDA 5FAKA 4DUPA 1DS6A 2YXBA 2OQ2A 1W44A 2BEUB 1DC3A 4KXQA 3NYQA 2I34A 1UL1X 4J3FA 2GBCA 2PX2A 4N6NA 5KWJA 3LFUA 2IWHA 1P73A 4PX5A 4MI1A 2ZM6B 1PR4A 1FYWA 4LZOA 4DXAA 4JLWA 2ZVDA 4C2BA 3BAFA 1K97A 2CD7A 5B3JC 5JRJA 3DNMA 5BORA 3QUCA 3IR7A 1Q91A 4W5RA 3GZNA 3EQ8A 3IP7A 3NTRA 1Y1TA 3BL6A 3ORYA 4G0UA 2JGNA 4B3XA 4XGQA 3REFA 1JEDA 3EXG1 2H06A 3CH7A 5M29A 2CMDA 5CA1B 2O2SA 1XVUA 1I6KA 2AEFA 1G8GA 2UYQA 4FFDA 4IYRA 3V8BA 5IAOA 1BXGA 5CFZA 2ZRPA 1UOEA 5G0UA 3BD9A 1XCBA 1QDLB 4NX2A 1I5RA 1LNSA 1JDBC 3HWSA 4F06A 4XH9B 3GP8A 3HJFA 3RFCA 1TI7A 2WIBA 3QKTA 4KR0A 1U4OA 3DBIA 3NWJA 3G9XA 4TTTS 3SX0A 4JYZA 1V9CA 4CLOA 2V6GA 3KPWA 1E6MA 5JR3A 1J7KA 1BN7A 1JXOA 1A9XB 2C4TA 1VJ0A 3FR7A 3KQOA 3SDZA 2Z30A 4OQNA 1II8A 1K5DA 4IWXA 3REGA 3JVEA 3PRYA 2AFVA 1G5FA 6PFKA 5EMNA 4BX8A 1ZYUA 5AW4A 2F48A 4BMZA 3K9CA 4L72A 3GT4A 2Q9AA 1UJ2A 2RKOA 1OVGA 4JQSA 4XQ9A 1CY0A 1EB9A 4YDHB 1X7HA 5J9FA 1ISRA 2I6SA 3PJEA 4QDOA 1L6RA 1I94B 4YK7A 2H3EA 1ZK3A 1AA6A 2XNCA 2RKWA 4WACA 4E3ZA 3K0BA 1PBTA 2A5FA 3ABOB 3G5LA 4BAGA 5AVTA 4C6HA 2WKRA 2ZWIA 1DTSA 3AB8A 1TOAA 1G7RA 3OETA 4WN3A 5U1PA 1B8VA 1BFDA 3EYAA 4FYMA 4OAPA 4GXTA 3S6JA 4E3WA 4EAQA 3KUDA 1GZ3A 2EW8A 2EATA 2CYBA 1VCHA 4X84A 4UJ3A 3ROGA 2XUKA 3GDOA 1WXXA 3O6VA 3UHPA 3N3AC 1M33A 1M1YA 1RJWA 1SKUA 3FKQA 5TF4A 2KPOA 2ODNA 4ZAFA 4ZV9A 4B74A 2RGRA 4RX1A 1YQ9A 2D5CA 2YVAA 2RB4A 1QRAA 3MJCA 1JSRA 3ZPXA 1USUA 3G5AA 1GAJA 4LRWA 3U3MA 3I6YA 4E88A 1KI9A 5G53C 5FEMA 5JVDA 4N5DA 4D5EA 1CD5A 2L42A 3PGLA 4EPWA 1V3UA 4RSGA 5CJPA 1P2VA 2DTXA 3MRXA 2OP1A 4DJAA 3CZQA 3L92A 5C5IA 3GDHA 4ZICA 2SBTA 1R4NA 2YWGA 3CUYA 5MHTA 4II2A 5HX7A 1X6VA 4OV6B 4DA8A 2NSDA 1DU4A 1T2DA 2G5CA 3MPUA 3RKRA 1E6KA 3FPSA 1YQTA 4BO9A 3FCSB 2FEOA 4RC9A 1R8QA 1NYRA 4TSRA 4L2IB 2FRXA 5J2UF 1BG6A 2X1LA 1WB6A 3CURA 5AVRA 3TMKA 2ZIEA 4B2IA 4X5OA 4DIOA 1NPDA 1GNRA 2QAGC 3FCEA 3COJA 5IF3A 4HS4A 1CNFA 2HF9A 2MSDB 4I1OA 5LBIA 2RHBA 4EG6A 4YCLA 4F84A 2WZDA 4P7KA 3ZI0A 5DCWA 2QG9A 1MQ8B 5FLKA 4WGFA 2GPBA 1R5JA 4Q9KA 2CZCA 1OMOA 1U7OA 3IJEB 3NHJA 4O4IF 3H9BA 2VA9A 5A05A 3IS3A 1RABA 4QNRA 5LP6F 3BS4A 2ATIA 4F0JA 4RMGA 4H0NA 1ZCBA 4C5CA 4YRRA 3SNKA 2YHSA 1MW9X 4V2UA 3PTAA 2GN8A 1GHTA 1Q6YA 1N6KA 1NI5A 1UFRA 3U3KA 4BO0A 4Y6GB 3SHTA 2WWGA 2Q1YA 3AJ8A 3KWMA 2ERXA 5C1BA 1Q7BA 4MRPA 2X0DA 1E9BA 3L8MA 3DL2A 4LW8A 3EXIA 4EMSA 3F4LA 2HXGA 3QI7A 1KERA 3DH0A 2FWMX 2XTZA 2AG1A 3NX4A 1HDGO 1PFVA 4BCDA 1XYVA 3C97A 1FJHA 4F72A 4CETA 1GPYA 2IU4A 1PUIA 1QO0A 1NN1A 1AHIA 1AQUA 4CM8A 4WFKA 2XKBA 4QEDA 3GFBA 1IIRA 4EJSC 5AOCA 2Z2IA 1CVLA 1ZJ4A 2V0GA 3BSFA 3KAJA 4TQAA 4UCXA 2IV3A 2JH3A 4XB6B 3FHCB 3TB6A 3QU5A 4Y8VA 1CZHA 3WLFA 3DEJA 5IJ9A 3W05A 2ZBPA 2CL6X 2J7PD 2KB0A 2RBKA 2WC1A 3GGGA 1U2TA 2R751 3RYFA 4G1EB 4NENB 1NXTA 2FV8A 2WSYB 1OY1A 4NWIA 1QH1B 2ORYA 3O4IA 3DEIA 3AK4A 4FINA 1PJAA 1THGA 3V97A 2HSGA 1FFCA 1PZFA 2BHRA 3HABA 4QGFA 3HB0A 5IABA 3FCOA 3WDKA 5GJCA 2WIFA 1K08A 4EB3A 2ZIZA 4B4OA 4CG0A 4EVRA 4F4CA 1BXKA 1N1EA 1V4NA 1XJ0A 2A0WA 2O6HA 5KNCH 1N6IA 4N54A 4OBEA 5M3BA 1IXYA 4O2LA 1PT7A 3ITEA 3OIGA 3P96A 3B3JA 4F8YA 1EUDA 2QE6A 4RY9A 4W1PA 3VVBA 4MUBA 4DNFA 2WJVA 3OD5A 1IOWA 4XEUA 3NGMA 2J6CA 1VDMA 3K5HA 2FMHA 1H2XA 2I6GA 1AQIA 3C3JA 3Q8XB 4ZT4A 3RDPA 4OKNA 3EQ2A 4X7PA 4B3HA 4ND1A 2BP7A 1I0IA 2EZ4A 2OO3A 1Z7BA 3JYOA 1KJIA 4M38A 4D9NA 1WOMA 2YDXA 1T91A 2CE2X 1OWMA 5FADA 2GSWA 4K2AA 5TGDA 4NMWA 4AJ1A 2JIRA 1KY2A 3KU4A 4Q4DA 2A7XA 1R4AA 3SS7X 1JEQB 3ZK7A 3OU7A 1RMTA 3DAFA 2CXXA 3WYNA 5EXPA 2G04A 4XGNA 3ZK8A 1I6MA 4XD7D 1GAEO 3WO0A 3W9UA 3I76A 3KUUA 1D0VA 2NXJA 1JBKA 1RYFA 4HBGA 4JJEA 1DQSA 3P5SA 2IDZA 4M1WA 4DY4A 1Q1GA 4LVCA 2V4UA 2ZSKA 4U8HA 1Y81A 4PPGA 1QCYA 2FA9A 2HJVA 3CVOA 3B60A 3B85A 3HU1A 1XD8A 5HM6A 4RDXA 3GRKA 4H0FA 2A0UA 1P7VA 1W4ZA 4MQEA 4P98A 1PS8A 1P0FA 2Q4DA 3BPSA 1XVVA 1MX5A 3GEBA 4Z9BA 2XWSA 4LJAA 4OXRA 3LCJA 1KO5A 1T1GA 3E4CA 4YFVA 1LZLA 2ECPA 1J8VA 2QZPA 2RBGA 1P3Y1 4XD7A 1W4BA 2H1SA 2YQ4A 5IEBA 2RHDA 3JY6A 2JGRA 3MMZA 1YU6A 3I9V1 1EJ6A 5FOTA 4BNLA 4J0DA 4V0QA 4LSMA 1F2TB 3I73A 2AOVA 1JWAB 2DLDA 1DNPA 1T2UA 4FFPA 4GYYA 3RRZA 3CX8A 5KU1A 1HFJA 4U7JA 1KDYA 1N2HA 1XRNA 2QJFA 4X90A 3V4ZA 4GP6A 1RCFA 5BV2P 4GEGA 1DC7A 2OM6A 4PIVA 4ZHSA 3KZKA 2WSIA 5DF1A 2QUZA 2Z1NA 4ENSA 1QYVA 5HJEA 1SUEA 1UK9A 1PS0A 4MGEA 5D7BA 4U6SA 3TLBA 1LK7A 1GTJ1 2PRJA 5A4AA 4NBKA 5BURA 1FJXA 4QDTA 4RY0A 5HRAA 3GQVA 4NBNA 3RLIA 4Z1OA 1HDIA 2GKGA 4UNIA 5SYNA 1FJGB 2CXUA 3L06A 1R4MB 1EK5A 3OLYA 3DQPA 3C24A 4G6ZA 3DZDA 5JC8A 1Y6QA 3MJEA 3G5MA 3PEUA 5BWOA 1P62B 1WLYA 1EDEA 3NEAA 5F2KA 4C1BA 1X1RA 3U44A 3I12A 1FU8A 4Z3KA 3QKRA 2FUNB 1WXHA 3EVDA 3OP1A 4N3GA 3LQ4A 4QXRA 2AG0A 2ID7A 4G01B 2X5OA 3GARA 3H11B 3G6WA 6NULA 4CVNA 3RBXA 2YHUA 4IDBA 2QTBA 1VE6A 3EDRA 2CDBA 3RGGA 2P0EA 3CF2A 4GKVA 5ADVA 4WBNB 3ZI7A 1FDTA 1Z2EA 4Z9FA 4F3TA 2G5GX 2QENA 3IPCA 3KDPA 4LXHA 2FR8C 3DGEC 4WESB 4ROSA 2VPYA 4DBVO 1XJQA 5LFAA 3UBTA 4GVLA 2RGEA 3QPAA 2GN6A 4B3BA 3FTCA 5G0WA 2RH5A 4S35A 2E4ZA 3BFXA 1U2EA 3DE6X 3R75A 4B71A 3G59A 1DX9A 1F48A 1M1YE 4FQ7A 3RVNA 1SK8A 3R3XA 2A0KA 2AF3C 4YAIA 5B3KA 3N74A 2CXPA 2WABA 2PAFA 4PHTA 4W9NA 4W5WA 1HT1E 1A27A 1F8YA 1SA0A 3JQDA 2MJLA 3NIGB 1ILEA 3V1TC 3HC7A 2AVDA 2DWQA 1IEWA 1V3TA 3D6UA 3E9DA 1ECPA 3BZWA 5K51A 4LJ8A 2OA0A 2Q45A 3HZOA 1W29A 1WXWA 2D1SA 2G08A 4YR9A 1P33A 1VKOA 1CKEA 1WJGA 1Q83A 2FCRA 2Y0PA 2HNKA 5T67A 2H4YA 4XDZA 2E21A 2IX9A 4XLZA 2H1FA 2OVBA 2W8ZA 2R7NA 3K0HA 1NVGA 3MD9A 3TLKA 3E27A 1T0UA 3KXPA 1B00A 3HV0A 4AIRA 1T8TA 3P2MA 4WCVA 1UT6A 2G1KA 3HJGA 4Y1GA 3JQPA 2IYTA 3KPYA 1UWVA 4OQFA 4D46A 2HWYA 1PJLA 3KR1A 4MKGA 5EUCA 4GEKA 3V3KA 3DAPA 4IVNA 3VHRA 4KKXB 1D2RA 5FR1A 3N2KB 3FN4A 3UATA 1HR0B 1ZXXA 3PEWA 2XGJA 2CDCA 3NJ4A 1MVOA 2CNOA 2F6RA 5BV0A 3EZ6A 4UHDA 4U2CA 4WK6A 4Z4QA 3X2SA 4KPUB 4ZEOA 3V34A 5TGZA 1YFLA 1PI3A 4UZSA 4I9GA 4P53A 3MWDB 4QDZA 4EB6A 4JI0B 5IJAA 3GWZA 4EHIA 5FPQA 3G3EA 4M0CA 1GPWB 1XMPA 1ESZA 1XK6A 3MTAA 1AG9A 4EABA 1SCUB 1UAYA 3NC1C 4J1TA 5JMWA 2VK1A 1H4SA 4ILKA 1SC9A 4Y9UA 3ZCSA 4UAJA 1IYZA 2O5RA 3A25A 3BH6A 4F2WA 3IKVA 1XJCA 1ZK2A 2WRZA 4DV6B 3I2YX 4JKYA 3QKIA 2B1GA 3BCSA 2WTAA 5IJWA 4OX9Y 1LSJA 4M4SA 3UV3A 4NEHB 1RT9A 1LBSA 2AI1A 2ECQA 3E8SA 4DCTA 4R41A 1GNVA 2ZRJA 2OILA 4GSLA 3EUAA 1V8ZA 5CT8A 1CE8A 1RPJA 1FYDA 3KOZA 4I1SA 4N0QA 5TIIA 2PMDA 3L49A 4MQMA 1KYYA 1TJPB 4EI2A 5IJ0A 1WZNA 5KINB 2CJWA 4G26A 2HV8A 3MF4A 4M37A 2JEZA 5C7OO 5E6UA 4KQGA 1N3LA 1RVV1 4MUNA 1AUVA 5EKXA 1P4HA 5IWAB 1KMNA 1YASA 5F7ZA 5DMHA 3U39A 1I1QB 2E4WA 2R25B 3QG5A 4C7MA 5LWQA 1UPXA 2JATA 2Q21A 4QL3A 4NL4H 1O3YA 4WIAA 3WZLA 4Q1VA 1UM8A 4KAJA 5AJHA 3VDQA 2GM3A 3WWZA 2W2NA 2VJOA 3B36A 2IH5A 1LBHA 1Z8DA 4DMRA 3FFTA 5KYKA 2AOTB 2BBWA 2WU1A 4PAQA 4RV5A 4QTXA 5AVZA 3LA8A 1IONA 3HZZA 5ALRA 2RBEA 3EASA 1M0TA 4DQDA 1JDSA 2GSDA 1UJBA 1CUZA 3CKKA 4MEBA 4UPDA 5I5EA 4TYYA 4KGZA 4UHCA 1UJMA 2IKSA 2YMPA 4ILEA 3RS2A 1E9FA 4OLBA 3LQRA 2P35A 4B3TB 3GDGA 5JD4A 4KQ2A 2PQ2A 3ZR4B 4QU9A 1NW3A 3VV2A 1Q20A 5JCXA 1XWWA 1CUFA 3IKTA 1PQ4A 1W4LA 1U28A 3AG5A 1GPLA 1NV8A 3FB1A 4DQUA 3C6QA 5C5DA 4S05A 4KFRA 1PL7A 4WWHA 5K8LA 1ORIA 2OBYA 3WNBA 1K68A 2I7VA 1YK0A 1A9RA 1GL7A 1X15A 1FYVA 1DJOA 2LWIA 3FWNA 2DY1A 4QOIA 2HQRA 3WGGA 4YJFB 3NPMA 3H2KA 3RCBA 4MW5A 2AOWA 2GS9A 4L4UA 5BNTA 2JZCA 1KO7A 1LBIA 4KZPA 2R68A 4DS3A 3G0HA 1XVIA 1KRWA 3AKCA 2H31A 2JB9A 4ZJUA 1TEHA 2ZQ5A 3LX8A 3BJIC 2EKQA 3AUFA 4BLUA 4IDAA 3ANLA 3DS8A 3MOGA 5TJHA 1OROA 2P7HA 4WZBA 1Z5VA 3NFRA 4XFDA 4FMCB 4CTNA 2YKGA 2XYHA 5G2OA 2JL1A 3OM1A 4OIMA 3RVKA 1WSBA 4BZWA 3IELA 4HQKA 3M6LA 4OXNA 3MGAA 3V8MA 2VNSA 4DLBA 3P0IA 2QRPA 1I4WA 1DLIA 3BG5A 2X0RA 3OTIA 4P84A 3SC2B 3V8QA 2DUMA 4CPDA 2WAMA 3NJ8A 2H85A 3BD8A 4EUKA 4YC7A 1PT8A 1KKMA 2QORA 1NSTA 4HRYA 4R8SA 4ANFA 1DKMA 1T36B 2WUEA 4P54A 4YDQA 1QOQB 2FSHA 2GO1A 2VP2A 1FCJA 2AV6A 2YV1A 1GCIA 1R0ZA 4I4TF 4YRJA 5K0JA 4LZNA 2VYVA 1M6WA 4B79A 1YJAA 1IJBA 1X0VA 4CEIB 3SQXA 2QUJA 1Z3CA 3OE7D 1H85A 3GPBA 4YRSA 3BM5A 3DMDA 4IDHA 3V2UA 1Z74A 3UGQA 3NHUA 1DRWA 3WQHA 1AKTA 1NSFA 1YZHA 2HPHA 3PQ5A 4YYEA 1U0FA 4IHQA 1RXVA 4CV2A 4RKQA 1OBOA 1CUAA 3C74A 2OGUA 5AFSA 2VEOA 1KSGA 1IWPB 1NZJA 3E9YA 3CEHA 4RIGA 4R1MA 2RDMA 3D43A 1QO9A 3KT8A 4FFLA 4IRUB 4UUMA 5AOBA 3LJKA 3UHFA 5KMGB 2ZJ7A 3PHLA 3JQGB 1VG1A 2NUAA 3IALA 4H1TA 5CLIA 5FWYB 1ADBA 4AIIA 4JNCA 1XCJA 1PQYA 2R6R1 2XEDA 4DHWA 3K8YA 1U8TA 4HUQA 4IJ5A 5CB4F 2BM8A 4IPTA 2BW0A 3JZMA 1V41E 2F3PA 3ETEA 4YTEA 4OP3A 2P9FA 4Q82A 5DH9A 3C8ZA 4YRCA 2QGZA 1RAHA 4MB2A 4R3WA 5EZYB 3I72A 1G8SA 3IA2A 4IFBA 1JR6A 1I7LA 1A8PA 1D1QA 2ZUWA 5F3DA 4INAA 2Z4RA 4QOJA 1R8SA 1HOXA 2QSJA 4C3ZA 1N0VC 1NYLA 2BELA 1IHUA 4G9BA 1IK6A 4XXHA 1I2AA 3GLFB 4GLFA 4H7PA 4TV8A 3ESRA 2BJWA 3LQFA 4CFSA 4W5TA 2WMYA 1YDWA 4C0AC 3PRHA 5HS4A 1QXSA 2WFLA 4X8LA 1QU2A 5F52A 3VPBA 3OWXA 2MHCA 1ADYA 5JV5A 3AETB 1S8AA 5ITSA 4RTJA 1E2QA 2PUVA 4G9GA 4K3UA 4KR7A 1RW4A 2H7VA 3E22A 2XMSA 3R7DA 2WM3A 4BMXA 3DVAA 5A5FA 5DNUA 5FBHA 1ML4A 3K72B 1LC0A 3K94A 5DOZA 4I5FA 3M4YA 3LFTA 4WZ6A 4BKQA 3NCHA 4BO7A 4A15A 3F6YA 4LWOA 5K8UA 2YRWA 4U4AA 2I6QA 4OUKX 3GHHA 2J6BA 4WAUA 1PJCA 3HUUA 4B2PA 5B7PA 3EMVA 2KBFA 3Q11A 2AD1A 3ENNA 2WTXA 3IP3A 4KSCA 3RU9A 4A9AA 4BN0A 1OYWA 3NOXA 1JHOA 2X0EA 1EVLA 4OCZA 2DSTA 4YRIA 4JB0A 4D6PA 1O5IA 2X22A 3CR3C 3IHLA 4OXYA 4IO1A 4KP7A 2XF2A 1EMDA 5BW4A 3KSAC 1Y9EA 4GM1A 3T5GA 3MOSA 2WVHA 3UMRA 3FYCA 3TNJA 5HRCA 3WKDA 1EB8A 1XELA 2GZ2A 1IAQA 3PVCA 4RY2A 1NLUA 4NEGA 1XD9A 3IKJA 4JIMA 5E7QA 3NBZC 3NOOA 3ZDFA 2GVZC 1X70A 2WYOA 3Q6NA 3ECSA 4LTNA 4JJIA 4UNNA 5TS3A 4P0TA 1NFRA 3FPJA 2D5LA 4AQYB 2GEFA 1QWSA 2IYAA 3H2YA 4ZI7A 4DLLA 2WU3A 2DERA 3DUFA 1FL9A 5KQGA 3LBNA 3OUUA 4C08A 4JLJA 4GS5A 5FBRB 1TM7E 2ZATA 2VVTA 2REQA 1TYZA 1EP9A 3BWVA 4U0JA 3V7NA 1E4EA 1T8SA 3L3BA 2CXSA 5IMSA 1EUYA 2V7VA 1EFVB 1P77A 2C5GA 2Q99A 4DXDA 1E5LA 1GGJA 3UGJA 1FTGA 2IHZA 3OCUA 4R54A 3OCZA 3SVTA 4YVFA 2W37A 4N5LA 2YVKA 3EVZA 1I9GA 2PO5A 4IIVA 3K70D 4N47A 3VBEA 4DV4B 1HYQA 4WLFA 1Q44A 3EIOA 2ZRFA 4EZEA 5K6TA 1JFTA 3ODPA 1C4KA 2FPXA 2B3TA 3COPA 4GR4A 4JX8A 1RBMA 1H2BA 4W7IA 4WFJA 1OTHA 3FHTA 4DHEA 4X63A 2H11A 4IEFB 4O33A 2QL6A 3EEIA 3G0IA 3L77A 4MUGA 4C88A 2ORVA 1SQSA 3EEFA 2Y1DA 3GVIA 5EXTA 3WO1A 5AW3A 4WMLA 1K8YB 3BDAA 1YKSA 3A04A 1FB5A 4K9SA 4A23A 4C6TA 3DR5A 1ZJYA 5K0SA 3FIJA 5CXSA 2WSLA 1NJSA 3QF4B 2BKLA 2O0HA 4L6IA 1JA1A 2ZUDA 3PXBA 3EPJA 2WDPA 2DR2A 5DB4A 3PCRB 3U80A 2ON6A 4PNPA 2PUBA 2QV7A 5EI5A 1V8FA 3D02A 5HEKA 1H2WA 1SWWA 2NUPA 4UXHA 5EJ9A 3UJNA 1QIGA 3DHNA 1WS6A 1Y5RA 1XAGA 5TMEA 4MWCA 4G97A 1L5ZA 3ZIDA 2IUFA 4FNAA 4F9FA 1OX4A 1XQ6A 5C8YF 3BGDA 1Q11A 4BB0A 3ZWQA 2C88A 2Y92A 1Q5PA 2WD7A 2H1WA 2XOXA 4JH0A 5BQPA 3D6NB 3VPXA 3OVMA 4BS9A 4EA6A 5LZ5A 1CVIA 2BGTA 3DVLA 1KH1A 5EQJB 4WJZA 5F1YA 2M6KA 1H94A 4DR3B 3G2OA 3ERCA 5FTMA 1VSTA 2Z3ZA 4Q1AA 4TMTA 4XUEA 3ZBPA 4AF7A 5GJBA 5AOVA 3VZSA 4M54A 1ULUA 1OLXB 2QSYA 3O2SB 1NY6A 3RVMA 5KTNA 1F7UA 2EJTA 1U2DA 4WD3A 3D7SA 4CF3A 3JWHA 4E11A 1E2FA 1FQWA 1ZVJA 4PZPA 2OKGA 3WDMA 1V1MA 3L7BA 5H9VA 1SIUA 2ZYUX 2QKYA 3JSXA 2I2FA 4Q9DA 1QGUA 1N4AA 2F43A 3BZBA 4RF3A 2RI0A 1GGNA 1DP4A 4OXKA 5E2IA 1GTG1 2NU7B 5IXSA 3D5TA 5H81A 4B6QA 4PZ9A 1MB9A 4GE3A 4BVLA 3JAWB 1R0CA 2GUWA 4EKNB 1OFHA 3L04A 4JL5A 1NUAA 3VSDA 3QELA 3WMRA 4WKBA 4C4RA 1QIMA 2UUAB 1PJ3A 5AR1A 4AKEA 3TGWA 1T43A 5DWQA 5FFFA 1KY4A 1QOZA 2QQGA 3AF5A 2XUDA 3VI3B 3C85A 5TT0A 3Q8MA 2O2CA 5DBHX 4AI6A 5FUYA 2BJHA 3OPXA 4NSNA 4PEVA 3B6JA 4C89A 5AW6A 1B76A 2PR2A 3MJRA 3EVBA 2Z5VA 1NWCA 4KVZA 2M6SA 1QAOA 2OK8A 1DTEA 4ZN6A 2QLNA 2Y1KA 3B2QA 4BVHA 2FGKA 1CCWA 3OOEA 3M4XA 4GBMA 2SHKA 1AK9A 1GZSA 4MQ5A 4OHZA 3RSLA 3WOVA 4CLRA 3T9FA 4L95C 4NYJQ 1EA7A 5F77A 3S2UA 4G5GA 3P2OA 2XXAA 3GRPA 2I87A 1ISPA 4F8EA 3IT1A 3V6MA 1AHNA 1Q50A 1ACLA 1ADGA 3BSWA 4KC0A 3IUNA 1CJBA 2FZGA 3DWEX 1YL6A 1II0A 1O5OA 1F4PA 3IKLA 1XJWA 5K45A 3RNLA 2PH7A 1UBHS 2YJNA 1P7CA 3DAHA 4G1VA 3BWYA 1OJ7A 3R9XA 4CQLA 1I7PA 1BRTA 1STOA 3CNEA 4IG4A 4EMBA 4QG3A 5K6RA 4OB8A 4QO8A 3L7CA 3WK8A 3ZLJA 1G8AA 5EWLA 2ZTUA 3HBFA 4R9RA 4PN3A 3H7IA 2XYGA 2LUOA 1JI0A 3H1TA 3UB3A 3OESA 3PNPA 1GG8A 4M1YA 4TSFD 4CCAA 4DT1A 3DWIA 2MSEB 1OXUA 1CZUA 4L08A 3TQTA 1OI7A 2F9LA 3C8MA 4MS3A 1L1RA 1XP8A 4H3SA 2G0NA 2J0EA 4P1ZA 1L7QA 1EHCA 1ZC3A 2J8ZA 3W6UA 2DUNA 2OO5A 3TCKA 1MB3A 2ZJ4A 1VGVA 4WI1A 1IWOA 4B2YA 2CJXA 1YZGA 5A06A 1WU8A 1RAIA 4U9HS 4WADA 2IWRA 3RUPA 3ML1A 4UBOA 3EBPA 1NY5A 2FOIA 1M10A 1UBSB 2FXVA 2XQGA 3KP1A 3QE4A 2AX3A 5DHQA 5LXTA 4N6GA 1LLCA 3K9LA 4E2WA 5LOVB 3OZDA 2UXDB 2NZWA 1E2DA 5EL0A 1CB7A 1Z7WA 5HWSA 1AQ6A 1CUWA 2FPGA 1UMDB 3S1LA 4Z6KA 1UK7A 2QUKA 3QRWA 1QPZA 3I9V6 3SE7A 3B53X 1X94A 1VYVA 3B1ZA 4AZWA 2IYNA 3NJRA 3TBKA 4ARAA 5BQXA 5ABPA 2RGYA 5I5GA 2ZTVA 1KPGA 2CEKA 2Z2YA 3BQMB 4O63O 4RA9A 5TVKA 1YHNA 3SAJA 3K09C 2Q7DA 4ZA2A 2APJA 4RF5A 1L1FA 4WA8A 1HNXB 1LEHA 2QB5A 3DBOB 3JYLA 5KNDD 4BV8A 1L9KA 1U63A 3W1EA 4UUAA 3S81A 2VBFA 1Z0UA 2DH5A 2Z3WA 4TL7A 5I4IA 4JVSB 3L4KA 4RPLA 1ZIDA 3DOOA 1MMFB 1Y98A 4GX1A 2PJZA 1Y5NA 4UQPA 1ZJJA 3MWEB 4B3CA 4TQ9A 1WZ2A 2OHJA 1A5ZA 2P1DA 3IDSA 3M82A 2IOFA 2OL4A 2OQVA 1G42A 2Q1XA 3FZGA 2FHPA 5AW2A 3STHA 2EYQA 2E5LB 4C7BA 4GD3Q 1KRHA 4MW6A 3LF2A 3HFSA 1VG9B 3R9IA 1RWVA 1JPUA 2OCAA 3OA0A 4MMXB 2JCYA 1JAYA 1EDOA 4F4IA 4LJLA 5WRFA 2OORC 3PLAE 4TZTA 4DB2A 3TO5A 1ESDA 4QARA 2QX9A 3ESBA 4WOPA 1O94C 2ZB4A 3CF0A 4NMMA 5BW6B 4A5OA 1U2GC 2F3QA 4MVCA 1GD1O 1X2BA 3EH2A 1NVDA 1FPMA 1CRZA 2PA3A 2R1ZA 1W59A 2J3JA 2ZSEA 3KUCA 4IHJF 5DP1A 1KY3A 3K05A 3FPGA 4PG4A 4AU1A 5IDWA 4WPGA 4J1QA 4JK3A 3EUEA 4MP6A 1YS7A 2R6FA 3Q72A 1C0EA 2RH8A 5BMVA 1ESNA 1NRIA 3OZIA 1E9AA 3VDNB 4PGGA 2EW2A 3D2LA 3SJUA 1XV5A 2X5JO 3GMTA 1SXQA 4UBIA 3VR6D 2R6JA 3UC5A 1A97A 1P9NA 5BYAA 2OAGA 1OT5A 2DG2A 1Y6JA 1SVUA 1L8QA 2PGAA 2R6AA 3E7DA 4BB5A 5KQLA 3K5PA 4XSGA 4BNTA 1VPEA 5BNFA 2E3JA 3DHYA 3NNDA 3OFJA 3Q7IA 1AMUA 1WCIB 3HADA 2VWPA 2OFPA 5JLAA 4PC6A 1ECCA 2EWWA 3KKOA 4RTNA 4LNHA 1JE1A 4RPJA 2R96A 4A0GA 5LL6P 3A32A 4OU5A 4BV3A 1P91A 4Q4AB 4PYJA 1QQ6A 2VHQA 2FYTA 5AKKA 2O2DA 2C31A 2K5UA 1E94E 1H4TA 1KO4A 1UBGA 2VNAA 4HWKA 2Z0MA 4RHTA 1NF9A 2NSHA 3WFZA 1YMVA 2IT1A 2F1KA 3ANMA 3GJRA 1E3JA 4M6WA 4XQCA 3VR6A 2G5TA 3MB5A 3JRNA 1ZA1A 1QIKA 4NS4A 1W85A 2NM0A 4PU0A 5AM0A 5MN5A 2OV8A 2RIPA 1IQRA 1K6MA 4X97A 5EJGA 1VDZA 1ETHA 2J41A 2L19A 4ZT6A 5GWXA 1UC8A 4PW0A 2I4LA 4QUGA 4TV9A 4AY6A 4C7KA 5LD2B 1S9HA 2W0MA 1L4LA 2Y93A 2J0UA 4HLDA 1Y7IA 2N47A 3H4VA 2XDQB 4O0MA 4UTXA 1FMCA 2C5HA 3FFAA 4ND4A 4BJ1A 1L7MA 3HUFA 3T7IA 4YJKA 1K5HA 1V9LA 4OP2A 1E96A 4J3NA 3RK0A 1ZVVA 1ZSVA 1LX6A 2I8CA 3QVGB 4ME6A 3OQBA 4LVNA 5DOVA 3VDMA 5B6IA 2FWIA 3ICWA 1A2OA 4HUJA 4MVJD 3U3ZA 4DILA 5IF9A 2ZU6A 1B6GA 1XKXA 2GF2A 3M9LA 4OJNA 2NVBA 4QFMA 2V6JA 1CYDA 5D5PA 1FRVA 1PT5A 4V02A 1NGSA 5FUVA 3GN2A 3LG2A 4RL6A 3SNHA 5CCBA 1ICIA 4NOJA 1D2MA 2J9FA 3A6PC 1VIYA 3T54A 2C57A 4UHKA 4GMHA 2JLWA 2HX1A 4JELA 3VU9A 3NUQA 3COZA 3M2TA 1JKJB 3BB1A 5GJVC 4DNQA 1Z8FA 4L02A 5U4XA 3NYIA 4RJTA 3I52A 2IXTA 5D7NA 4OG2A 1EGAA 2C78A 2VLIA 4Y6RA 4DPKA 3B1FA 3AR2A 1W1WA 1NHWA 4KQIA 1HYHA 4KRXA 4O0LA 4EUEA 1UXHA 4G1UC 4U1RA 5GZ3A 1NE7A 3QLVC 2UUBB 2IHKA 3L46A 4YP7A 2CE7A 1WWKA 3M9WA 2BPOA 2R8BA 4F3NA 5IVPA 4GZ5A 3RQIA 3FCYA 2VH2A 3ZU3A 1TAQA 2B4TO 2R1VA 1EDDA 3KTOA 4L78A 4DLRA 5CLJA 2P8SA 4NOLA 3EUWA 2F1JA 1J90A 2AMJA 1SCDA 2EEPA 2I2DA 1GKIA 3TZCA 3UWMA 3JATA 2WMDA 1C9EA 3AL3A 2I33A 3RVOA 2G3YA 5EWMB 3SYRA 1FNBA 1FS6A 2BHLA 4JD5A 4B3FX 2QM3A 4ERNA 3BT7A 2OBFA 4FYWA 2H59A 4Q4LA 4RGYA 5FHQA 3PU6A 3SS8A 5AUOB 4XA8A 3LLMA 4KQFA 1MA3A 4MKRA 3BGIA 3B8EA 1ZD3A 2FETA 1X1AA 1JR3D 3AY3A 4LYHA 1WHTB 3ZV4A 4S2UA 3H5IA 5CYFA 5FD8A 1A72A 1HNWB 3FJYA 4JCCA 1N2CA 2BF7A 2YWDA 1C3LA 1EWKA 1XTKA 3ESZA 5I9TA 4EECA 2AMLA 1L4EA 2ES4A 5KJFA 2IA5A 3FNGA 2O8FB 5JAZA 4ZRMA 3OI7A 4B9EA 2R48A 4I99A 5H16A 3PEVA 4BDSA 3DLTA 4D3ZA 4PM4A 5ITVA 1OYVA 1T2FA 4MK4A 4IKPA 1EQAA 2YYSA 3HB9A 1RXWA 1ZH0A 2Q1WA 1YL5A 3CZCA 5KTRA 5ALMA 2GM5A 3FSRA 2RHJA 4HB0A 4MWDA 3ZU2A 3NALA 1R9GA 1ORVA 4URWR 1U7PA 3LOQA 1M0EA 4FEEA 4UQOA 1JR3A 4F2PA 1U0TA 3HO6A 3LQKA 4C5BA 1VJCA 3VU3A 4EDHA 1GAWA 5B4VA 1DRVA 5A62A 2WP0A 3VKFA 3VO9A 5DLDA 2IODA 3MWLA 1H8HD 4V0SA 1G8KA 1XZFA 3KM0A 5E3JA 4DTCA 5EMJA 5DKFA 4XPIB 3T7KA 5BSVA 4PCVA 1JJIA 3F6BX 5KKAA 3SF8A 5BWMA 2C2OA 3PVSA 2FPPA 1LTKA 4NYIQ 3HEAA 4X20A 5LA6B 5CBPA 3LYLA 3T0IA 2D2EA 2QZJA 4F11A 1VIMA 1ZOPA 4FHDA 1S0UA 2V7PA 3ZGNA 3ORHA 2J9ZB 3GLHB 4Z4GA 3MFQA 2EJVA 5DNCA 1V8PA 1HDCA 4CGYA 4QQKA 5J4KA 4YT5A 1BVRA 3OEHA 5BMVF 2BEUA 5A03A 3BRSA 4DV3B 3AV3A 3FVWA 1UJ4A 1R6DA 4HWPA 1CUUA 1YOBA 4V0RA 4EP1A 3P4YA 4Z4IA 3EIFA 3LDUA 1TLLA 2J08A 6ABPA 3AKEA 2VHVA 4JEUA 4LJ9A 2IBSA 4E2YA 2E5WA 1W7AA 2IHYA 5TC4A 2X58A 1JTEA 1YS2X 5K3CA 1KXZA 3OT4A 4OMDA 3DBVO 1DVRA 3CNLA 2FSVC 1Y5IA 3HBNA 4Q48A 1C1XB 1NXVA 2W6ZA 5HJ5A 1RC1A 2EQAA 3F9IA 2A7QA 1RXEA 5C1OA 3IFSA 2PM8A 4GOKA 5CA1A 5IFKA 5F51A 2GILA 2YV2A 1AHPA 1AGYA 2Q7XA 3BIXA 3SWWA 2FSGA 3ECAA 3CISA 2G9ZA 3I9KA 4NPAA 3MTEA 4MKFA 1DG9A 2P2GA 3VX4A 1JFFB 4MUFA 4LDNA 4JUIA 2IJGX 2OHFA 3KUKA 1DKOA 3IE1A 3DE1X 4C5AA 2H6EA 4NBLA 2VIIA 1A9XA 1WVIA 2IHBA 4Z9AA 5FF9A 5D3MB 3Q3CA 2DCUA 3UMYA 6REQB 1SVOA 4QUHA 1M2WA 3QH4A 3WNDA 1X7XB 1YAJA 3KALA 2Q49A 3KO8A 4TV9F 3ZUGA 2WWXA 2AS0A 1JDJA 2LV8A 3ASVA 3O8NA 5TQJA 3CF4A 3MILA 1P31A 2C83A 3GRVA 2Q6LA 5AM3A 1C1HA 2FX5A 2FZ4A 3GJZA 2JF0A 3KOMA 3NAMA 3D3KA 1CQXA 1O6CA 2QW1A 4NBUA 1H8EA 4RENA 1IC6A 3T95A 3WZ2A 3IDFA 4CJXA 1IEQA 2ZIFA 3M0EA 4XVHA 3EQ6A 1MBZA 3T9BA 2DPLA 2ZT7A 3R3YA 1VB3A 4LXGA 2PLFA 4NV0A 5J5AA 3ZE1B 1E3SA 1F2VA 3QVTA 3HR7A 1NULA 3E9MA 4O8ZA 4URFA 3ILYA 3A6KA 1CETA 2QUAA 3G2NA 4UUNA 2QMHA 4W9RA 4B9AA 5L3SB 3AFHA 5AK6A 4GHWA 1ZSNA 1FW6A 2CHVA 1RMYA 3WB9A 2QHXA 1X1DA 2J0VA 1N3YA 2W83A 4GGOA 3OC6A 1SKQA 1ZNXA 3C7AA 3D4BA 4S0XA 4HB2A 1RI5A 1E6WA 1M1XB 3HN7A 4PGHA 5FPKA 1M3SA 7MHTA 1GZ6A 3IXLA 3JU3A 4RFVA 1DPGA 1G38A 1NNI1 5IKPA 1Y4ZA 3MUEA 1RAFA 3UJ9A 5EE0A 5DBFA 1QYDA 3TZLA 4EEXA 3TW4A 3CF4G 3E0XA 4DGQA 3JXEA 2I1QA 2QJRA 2VDKB 3JVVA 4OQZA 2JFZA 5ER9A 4WNYA 4BE9A 2PS0A 3LY7A 3WFIA 2ZTHA 1GNLA 4L2IA 3ZE9A 4C6SA 1GOTA 1JJFA 1Q21A 4MV8A 1R0LA 4IV0A 4Y2HA 5AKGA 5ITWA 4GVPA 4DR6B 2CF6A 4EHDA 3FOAA 1CR2A 1JB9A 1VGRA 4RFSB 3I1YA 3NTXA 5IHPA 3JYHA 3SBEA 1WDWB 2V0CA 4HDQB 3HCNA 4M98A 4PGMA 3NWEA 4EHHA 1JKMA 4AJJA 5A9RA 2JAWA 1T4MA 3GYGA 5ELLA 3A1CA 3BGSA 4MYSA 1KC1A 2IYSA 1QQTA 2V74B 5EHXA 1Y1SA 5D6NA 4ATNA 1YBAA 4JU8A 5FCDA 4DIEA 4EG7A 1U04A 4FE4A 5EGNA 3R74A 3EK2A 1KZ7B 3HKBB 3QPDA 1USVA 2YW2A 3GPIA 4BN5A 4DJFC 4ECEA 3R5XA 2FW1A 5AJXA 3IBGA 2JIMA 3LHFA 4ZARA 3P4XA 3SJBA 1ANKA 4M9UA 3RSQA 4D0RA 4Q24A 4YMUA 4PPNA 4NCBA 5E1DA 1EFLA 2FZ5A 3CLRC 3F46A 3U1VA 1DQNA 3D3WB 5LLSA 1SCQA 2CYAA 3E9EA 1KDRA 2OHVA 4GE0A 3M6IA 2WE8A 2D74A 4OMCA 3TX2A 2XQKA 4D2IA 3EQZA 1R88A 5E8JA 3ABRB 1SBZA 4HAUA 4F1JA 1V4BA 4GKBA 1AGXA 2BEJA 1IFXA 2H0RA 3QA9A 1C3XA 3EG9B 3ZVRA 3BB4A 1DJQA 2C00A 4GMGA 4IO0A 5T4BA 1ZNQO 3GCXA 3RUCA 3HGMA 4DR1B 3GEGA 1R5NA 1MABB 2BGRA 2HK9A 2PBFA 3O92A 2Q7OE 3ZI4A 3L7LA 2PUCA 1GAQA 2EKLA 2QVZX 3FSGA 1SXGA 3G1TA 2R00C 3I0ZA 3OKAA 2HCRA 4L8GA 3ZLBA 4KACA 3TZBA 1LV8A 3O74A 4P80A 5LKAA 4L7QA 3BH7A 3TAHA 2OZLB 1GUAA 1CSEE 4MWBA 4NENA 1ZMRA 2ZIAA 4GGPA 3ZGVA 1QH1A 1CZKA 1WW3A 2YXNA 3ZU4A 5KX5B 1PBNA 2CUKA 1NYTA 2X6RA 1J56A 4AX4A 1RFGE 4BFUA 5K09A 3ZQ4A 2AGVA 2W98A 2I99A 3AXSA 3O4VA 3ONFA 1P5FA 4EHKA 1O6FA 4DJDC 4EHBA 4MW1A 4GNRA 4O4HB 3WGQA 4LX0A 1IQ0A 2AXQA 3T12A 3WI7A 3TZQA 3HYLA 2VBIA 3WLQA 2ZUCA 4IZOA 1EAYA 3AC0A 2VQSA 1MTZA 1NXWA 1YR9A 3HSYA 3HXTA 3RRMA 1LK5A 1N2CE 4WXPA 3CNHA 4ND5A 4M8LA 5FHRA 4FN4A 2BFPA 5TGTA 4HDSB 4HUTA 4ND6A 3UMBA 5AUQA 4C4YA 4ZMSA 2WJWA 3PFHA 5KPDA 3LCCA 3NMUF 4X91A 4RPGA 4XJSA 4C0XA 1L5QA 4CG1A 1MC5A 2YCLA 4HQNA 2GCOB 4A26A 4YRLA 2J3IA 4O02B 2F1HA 4KLRA 3OQOA 2MYTA 2OOKA 3GGPA 3NFYA 5FOVA 1YRHA 4L0DA 4OLHA 3TIFA 4EY3A 1U2ZA 5F5NA 4F71A 1UJ6A 1DCTA 3ANSA 1LPBB 4C43A 4AMVA 4HQ0A 2WTBA 1JEQA 2ZRCA 4P4UA 3ZWPA 1A3CA 2DXIA 2G76A 1NJ6A 3AQIA 3FGOA 4ETIA 4XIFA 2MYNA 1YRLA 4TROA 2WB2A 4LF4B 1XSEA 5I9NA 4GRDA 5ITZB 1WTCA 4JJKA 4FGWA 2AFIB 1XZHA 1UWKA 2KE5A 4HAVA 3NTQA 2JFNA 3KWJA 5EHNA 1WEKA 3Q40A 3W5AA 2DULA 1XNRB 1EVQA 1PKXA 1QG4A 1T0IA 1XTTA 4DMFA 3W8RA 5A9SB 5REQB 5JS8A 3EZXA 1KQ3A 2I2BA 5B12A 4FDMA 1SUBA 2JIBA 3ANTA 4QICA 1Q7CA 5JPCA 4LOHA 2TRSB 3QTLA 2W7TA 3D1LA 3T41A 1OHHD 2EC5A 4INPA 3QBDA 2B4RO 1VBNA 3TXYA 1WX1A 2QRLA 3CQ9A 4KX5A 4LGMA 5ALDA 2R84A 3GY0A 1SQ0A 1GZ7A 1ESCA 3NH9A 3W2IA 2OHHA 3RG2A 4B6FA 1N2GA 2F1OA 3C7TA 3GLTA 4FXOA 3HUDA 3TL6A 2DJIA 4JS0A 3K35A 2XCUA 4I3HA 2EZ9A 3KQQA 1OYOA 1F6BA 3QXXA 5IAJA 2ZZMA 2Q5CA 4E14A 3RC8A 5CBKA 1XA4A 3BTVA 1F2TA 4DMMA 3QFRA 1P9OA 2VTDA 1FVFA 1SXPA 1CLEA 4FWBA 2V6BA 3EWNA 2BFOA 4MP3A 4RQTA 1Z15A 3UJAA 5BSEA 1RZRD 2ZGVA 5L4LA 1JHPA 1OHHA 4KLZA 4WFIA 2WINI 2BHNA 4FZJA 4HFRA 5EESA 1E1LA 3TX6A 1MA0A 4A5SA 4DMLA 1GG2A 4IG9A 2EIXA 2QW8A 5DO9A 3UEOA 2D5BA 1BQ3A 2DQKA 1J97A 5ERXA 1W0KA 1FNSA 1IBKB 3LKZA 1KWKA 1QF9A 1PK8A 3KYJB 3UN1A 1L4MA 3VKUA 1H6BA 2WW8A 3H65A 1EBFA 4MH0R 3W3AD 1RTKA 4U00A 3KE8A 4TLLB 9LDBA 4BASA 1R4MA 3HV2A 2GQ0A 2W2QA 5HOEA 1V37A 3WAKA 1VIVA 2Z2JA 3TUIC 4PN7A 3U0VA 1XPJA 3MIIA 2JW5A 3ZNNA 1RKBA 2DRIA 1RCTE 1TJ4A 5E3HA 4AN1A 4OQQA 2FG5A 2ERCA 3R5FA 1O4VA 3H11A 1E3WB 3H87A 3NNNA 4BP8A 4MEJA 2PS1A 3EN0A 3KOXA 4MULA 2WJHA 3RW9A 5ER6A 4DLYA 3FNIA 3J81A 4WBNA 1P2TA 1FFAA 1N1DA 1QS0B 3VHQA 3A1EA 2EP5A 2WD9A 1DV2A 4H7KA 4HSGA 4WESA 4HQ6A 1F1JA 2AX4A 3I64A 1DO0A 1SBQA 3DBRA 4LI3X 4MCAA 3DCJA 5BRNA 4DKJA 2AKAB 2B2NA 3PD7A 4EFLA 4LAFA 4KTTE 4PNZA 1U8FO 4NE9A 4OQDA 3A7DA 4KXYA 3ZHYA 3CVVA 4K1LA 3AQ4A 3QMWA 2YBEA 3TZKA 2QD5A 4AMBA 4ZZ1A 5JNRA 1IVYA 1WD5A 4TYPA 3V4VB 4QIHA 4PXSA 3OQIB 2ANCA 4GGMX 1JG3A 4G9EA 4R9UC 1T5HX 1AS0A 4DUGD 2C84A 1WV1A 4RS3A 5KTSA 2OMEA 4RK6A 1O94A 4UNQA 3O8LA 3IR5A 4ER3A 2B69A 4MR7B 4LZWA 4COOA 1AGRA 1UZMA 3BREA 5P8WA 2FZLA 2IYRA 2X2EA 3RIMA 1Z83A 4EW6A 2B99A 1T1EA 1PG0A 3IUJA 4NAUA 5ESXA 4BTEA 3UICA 4RTQA 1TUBA 1A4UA 5LIRA 2GH1A 2C8LA 1R66A 4FWIB 1T1JA 2NGRA 4B0PA 3S99A 2I78A 2RK4A 1EDBA 1BE0A 3W5CA 4L3VA 3E3MA 3I9LA 2ENUA 2J48A 1ZD1A 4C29A 1DXYA 3N53A 3V33A 2NQTA 4X8HA 2PH1A 4L28A 5LZ7A 4HS9A 1U3UA 3FROA 3K92A 3N2KA 3R3VA 3ME5A 2QVLA 3FBGA 3PFCA 1G6KA 4G8JA 1XP5A 4RZSA 5EIWA 5AQ1A 4H77A 4EX7A 2C4MA 2I2AA 3R7WB 4DG5A 1HYBA 1S7CA 4KPUA 1IQUA 2HK7A 5E2BA 2VYCA 2D0IA 3WIVA 1EFAA 2WAOA 3ZHBA 3MWDA 3TK1A 4RK7A 5HQTA 4LGCA 5HIIA 3TD9A 1PJ4A 2WLSA 2XI4A 3MCTA 3CX7A 5D6OA 3TZEA 3UKDA 1SCUA 3TUZC 1OE0A 5FUXA 4P9NA 1P0QA 1C8BA 2QTZA 1RZ3A 2O20A 3PGVA 1W2HA 1TKBA 3OLXA 3OUTA 4OAQA 2AQ8A 5LU8A 1R2QA 1H1LB 4JC5A 4DMCA 1S2OA 3ZEIA 3ZOKA 3OHSX 1MDBA 4TL6A 4TWIA 3QBJA 1KARA 1TC2A 4KQEA 1O9HA 2P67A 2VJLA 4D92A 1N2XA 2IX3A 2EOAA 1FUIA 1NQXA 2RHWA 2V5VA 3Q9LA 5E4JA 5G0SA 1R6BX 2AYXA 4IIUA 5J5CA 4IIJF 4QJIA 1MQAA 3AVYA 2QTNA 1RYYA 3H86A 4DCNA 1TPYA 3VPFA 3EHDA 4M7OA 2PFSA 2VS1A 4PLHA 1MX9A 3T3NA 1BW9B 2XH8A 2XADA 2OBMA 2R97A 3RRNA 5K4GA 3D0OA 2B5VA 3BXGA 1BFUA 1O87A 1PX2A 1P81A 2FPIB 3L8EA 3A2MA 1FDUA 4ZQIA 5G40A 4OIFA 1TCUA 2B2XA 3HL0A 3H16A 3NW9A 1SUCA 2P4UA 2VKQA 5D00A 5H68A 4HNRA 1H6DA 5TS2A 4AT1A 3ND7A 4BRWA 5T41A 3OTWA 2FLKA 1VA5A 4KLCA 2Z04A 4H7IA 4XI9A 2AOTA 5IC5A 2ZR8A 5CFNA 4EFNA 5SZJA 5JYCA 4ENQA 3WWEA 4BX2A 4EDFA 2JAUA 2WUWE 5LJIA 4EG4A 4PZUA 2ZDQA 4BFZA 4PQYA 5DPMA 3WDLA 5EERA 3PT9A 5EIAA 4YRFA 1XLTC 4CDRA 3Q9UA 4ZPXA 4G4IA 3OCCA 4ADSG 4BBPA 1J7JA 1XMXA 2UXBB 4WH0A 1RHKA 2QTFA 4URVR 1QGYA 2DWPA 3UT5B 5DHFA 4ZK6A 1Z5OA 5FV4A 2BFMA 1VFPA 2XXJA 2VBGA 8ATCA 4BQNA 1WZIA 4B35A 5JI3E 4CV0A 2EZUA 3KZOA 5DGXA 5U9CA 1IY9A 1RRMA 1MJGA 4YJFA 5DHUA 1I2DA 2C3UA 2ZB7A 1GTMA 2WAYA 3IBTA 3QLVA 1ENPA 4QHYA 4Y6PA 5ALKA 4IDNA 1BDHA 3KDSE 1NJ1A 2EEZA 2HRQA 3FF4A 3R9WA 1T9ZA 1KF0A 3PKIA 2WJJA 3ENVA 3R7NA 2XZLA 4OHCA 3ELUA 4ARCA 4CG2A 1MN6A 2FP3A 2IS2A 8GPBA 2I9KA 5HZMA 1SBYA 1JKFA 4MX8A 3NGLA 3LUDA 3L0DA 3LX6A 3OJWA 4PFKA 4D4GA 1EFDN 3HRHA 4BC1A 1W46A 1T0HB 4UDYX 2XCSB 4KGVA 3B38A 3DEHA 4H59A 4WSOA 2HRRA 1KYTA 2BCGY 1KJ8A 1Y6ZA 1E92A 2EVWX 2NYRA 3DWGA 3GNLA 1EEHA 2JLRA 4ZVSA 3SC2A 4C7JA 2BTEA 4DREA 4H9GA 1TTHA 1E0SA 4P7GA 1X74A 4TMKA 2EF0A 4YA6A 1DRJA 1P2SA 3PC3A 3VNQA 4TVOA 2OC4A 1T36A 2BGLA 2XVXA 5CFPA 5JISA 5I7EA 1JRLA 1HT0A 5KHAA 1R27A 3PEYA 2R4QA 2PQ6A 1VC2A 2D0PB 2AXNA 2IL1A 2O3JA 2CHEA 3OOJA 1JYSA 4LHYA 4DSNA 2VR1A 4LWQA 4KQXA 4CEIA 1JDPA 1SQFA 1HEUA 2R86A 4RCZA 3PL1A 4HQFA 1O6BA 1SEVA 1XUOA 2CUTA 1QLWA 5FPSA 2Y76A 3HVRA 5EKSA 3CKMA 1X1SA 3OQHA 3OUZA 5HGJA 3ZXIA 4JJ6A 4W9MC 1OF1A 1FX1A 1SCAA 1XT6A 2QRNA 1LXCA 2OSBA 4ZEMA 5CITA 5LQUA 1HRDA 2OWEA 1U0RA 4P58A 2OK7A 2XCTB 2RHRA 4ICIA 3TAUA 3MUOA 3PF9A 4GDFA 4IXWA 2G72A 4GAEA 5KMGA 1V2HE 1XCLA 1MC4A 3JQGA 2WWTA 2YYZA 3KL2A 5AMXA 5FWYA 3VU8A 3INNA 3BMNB 2GHRA 1D2GA 1NMEA 4JA2A 1HG0A 1KYQA 3HTXA 5HOQA 2RMKA 4RZ3A 1IMOA 3VFDA 3S2IA 1SHTX 3A27A 3G1UA 2O23A 5GV8A 1JLLB 4KIWA 1Z2AA 5B53A 3EZFA 2IITA 2TS1A 4EFKA 1K3UB 4RZUA 3P9SA 1KP2A 5EPOA 3A14A 4EGCB 1A5SB 3VYVA 5EZYA 3RVRA 1XDZA 4G5HA 4L5BA 5BUQA 2P79A 1KJQA 1PJSA 3BHNA 3ZQUA 2VLBA 4YMVA 3P9QA 3L8ZA 4A03A 1PEKE 3QHAA 4IEEA 3GLFA 4FR5A 4JQOA 3TTWA 5DXJA 4ZEVA 4YNBA 3CLSC 1IULA 4UZEA 4XQGA 1KOLA 1CDOA 2PWPA 4ML3A 3GMIA 3QWBA 4CIBA 3RO7A 1JMKC 3TE6A 1JDUA 3U4MA 2A3NA 4ZAWA 2XKAA 5G1NA 3AETA 4ZCMA 1N7HA 1OC2A 3FDZB 4ZOBA 5IDQA 2F55A 5A4MS 2I3ZA 1X3SA 4QGBA 2QRHA 3ROXA 2A92A 3KCQA 2B8NA 4B2LA 4WKCA 2AA3A 4Z99A 3U81A 2YHIB 1WXDA 2FSVA 1V6AA 1JHYA 1YB6A 3LYHA 4L07A 3D3QA 5K3SA 1ZS9A 3QSGA 1W2WB 3K1TA 5A0VA 4L1KA 1L1EA 4B4WA 4DKXA 1TL7C 4LCJA 4P5EA 3LPDA 1VIDA 2Q3JA 1B2RA 2V3VA 3GCZA 1VOTA 3W5IA 3ACDA 4LCEA 3IAEA 2ZTMA 3K9NA 4ZZ2A 2EF1A 4B75A 4QHSA 5C7IO 1X1EA 2QIPA 1E5VA 4CL2A 4O5AA 2KSQA 4I7EA 4FHGA 1QIDA 2GTIA 3L7OA 2DYKA 2Q5OA 4AVYA 3A6FA 3M6FA 4KVFA 2CLSA 1TMYA 3NHLA 5KNCD 2WUDA 4CQNA 1NUPA 3RVSA 3OTOB 2GM4A 2HRCA 2VQ6A 5YASA 1JLMA 2HT1A 4B6SA 2XSZD 2ZPAA 1CU1A 4Q21A 5EEHA 5LU9A 1U4SA 3R24A 2GX6A 3KSBC 4X1KB 3EXHC 3LUKA 2HMTA 3HQ4O 3LVQE 1SRRA 3NASA 4IDOA 5CHEA 1F2DA 3V7WA 1OXTA 2PLNA 5J23A 1UUFA 1BJKA 2F2TA 3R3WA 3MHPA 1J21A 1L5SA 1RJFA 2Q29A 3ZCRA 3HJTA 4II3A 4RD4A 4BMOB 5F23A 3AO0B 3NBKA 4G0WA 2PWBA 3DDNA 3H84A 2QTWB 1UBFA 1BDJA 1N2EA 4QECA 4I55B 4Y9RA 2OWDA 3F6PA 4KO3S 5ALJA 3D4OA 4BTLA 5A5VA 5GIPE 2HAEA 4TX1A 4X94A 1HQCA 4ZEWA 4JLMA 4F93B 3GPLA 2DBYA 3BMCB 1JH8A 3EDCA 3F3MA 4MS4B 1IPEA 1EFVA 2NPFA 2NZJA 3BXEA 2VAXA 1W35A 1OX5A 2ZSDA 1S1MA 2NZ2A 4WCFB 3FOBA 1T8UA 5A7FA 1CG6A 3KQNA 2MINB 2JKYA 3R0ZA 4FSHA 1D2AA 2PSFA 4MSUA 2VO1A 5TQ0B 2OQIA 2RGUA 4MPDA 3VYRB 4E32A 3GRAA 2FZCA 1AMNA 1JDVA 1XVLA 2GPJA 5LIPA 2E82A 4JZYA 5J3JA 3EGIA 3OPNA 3CRW1 1CDDA 2XQFA 3MSCA 1GZHB 3ZNQA 4YT2A 1YMUA 1VCNA 1DAHA 1WZCA 4RTSA 3JQQA 4MMYB 3ZY3A 1YJCA 4EIWA 5KYTA 1G9XA 3TM5A 4TMFA 4KAAA 3OOYA 1U0OC 2Q9UA 3LQ2A 3WYGA 1XZ8A 3CE6A 3CNBA 2YN0A 3KFLA 3N05A 2CY0A 1C9MA 1JQEA 4GI5A 2CB9A 4J76A 2R6HA 4C9BA 5KOIA 2J3DA 5KVSA 1YBFA 3LT0A 4HGQA 4P2BA 3QF4A 5DTEA 3RIHA 4CKBB 2JFYA 4P3YA 1F9EA 1BDIA 4P32A 2QZ9A 3CJQA 4NDAA 5FIUA 1OPRA 5GGYA 1N8SA 4UXJA 4MGZR 3CLUD 4L9RA 4AMUA 1N5JA 1NE2A 1J06A 2LRHA 2VYND 4IIFA 5DNEA 2F62A 3EC1A 4P3PA 3LZDA 4L5YA 4FMCF 4N8EA 1SUIA 4MCIA 5I7HA 3E03A 5JYBA 3UYKA 4MPJA 1NKSA 4HC4A 1RLOA 2IRWA 3NBUA 1T9AA 2XXBA 3H9GA 1RZVA 4K9NA 1SC4A 1PWXA 3M89A 1Z7YA 1HFEL 4GYWA 1FTWA 2IVFA 2P6OA 3QWHA 4YQFA 1TK3A 1XRJA 1DC5A 2PZGA 4JMPA 4H7FA 1OB5A 1J9EA 4B4UA 4DRYA 1MIOB 1QJCA 1NONA 2OKCA 2YTZA 3D0QA 4RE6A 2OV4A 2BI7A 3MXTA 1E2JA 1X2EA 1Y8CA 3H4TA 3EGDB 1O2DA 3G9QA 1E60A 2JCGA 4M0PA 5HW0A