5C31A

Constitutively active sin recombinase catalytic domain reveals two rotational intermediates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLVIQILAMVSEQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Sin, putative plasmid resolvase dimer
total genus 34
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c31A00
3BVPA 3PKZA 3G13A 5C32A 1ZR4A 2RSLA 3LHFA 1GHTA 1HX7A 4BQQA 5C35A 2R0QC 2GM4A 3LHKA 1GDTA 1ZR2A 3ILXA 2GM5A 5C34B 2MHCA 3UJ3X 5C31A 3GUVA
chains in the Genus database with same CATH superfamily
2XUZA 3SC2B 5CVJA 2XWQA 7YASA 1U02A 2QROA 4A2WA 2XF8A 4DY4A 1K9SA 2WM9B 4MQBA 4IIJA 1Q77A 2FW0A 4CWAA 1WEHA 4GR4A 1QHGA 1WEKA 3BM5A 3SSMA 1XVLA 2H29A 5AOBA 5K99A 4IGFA 4HQ6A 3AMVA 4F3RA 5IVPA 2GZ2A 3KZNA 3NZEA 2FPRA 1G21A 2DLCX 1N6HA 4ZCQA 3T7IA 2OCLA 1IVNA 3CWZA 1T9AA 4B73A 3KPWA 1BFDA 1JSCA 3BERA 4Y9UA 4HGYA 1OXMA 4BBPA 1JNXX 3H2HA 1OGIA 2ZB8A 5FIUA 4ARIA 3EG9B 3GU3A 3H5NA 2HH9A 3FHJA 3NIFB 1SURA 2TMGA 3UH0A 3MAJA 1ZITA 3H2SA 1J49A 1O3YA 3TIVA 4LWZA 3V1MA 5E0OA 3VAAA 4QLBA 3KSBC 4AJHA 3VBEA 4CDMA 1JDVA 1FLDA 2VH5R 4NY1A 2PZAA 4CQLA 3DFMA 4NH4A 3WLRA 3BFXA 1VYTA 3RHSA 4DC0A 2JDIA 1ZQ9A 4X44A 1P60A 5IXSA 3K6RA 4AU1A 4ABTA 2XRFA 2BGMA 3EE6A 3IEVA 5DBEX 2BD0A 4ZGGA 2AZMA 2VHWA 4R8VA 1Q0QA 4TZKA 3OX1A 5HA5A 3ZHBA 4D81A 1V2HE 3DV2A 5FKJA 1HNZB 1JXOA 4FSHA 3FYTA 4BY9E 5TS3A 3PR2B 5EWJA 4JDPA 2O57A 1Y4UA 2Y1GA 1XRQA 5MFPA 1XK7A 5BSEA 3JQAD 3ILXA 1XIVA 4KQHA 1N2ZA 5LA6F 1LBEA 1PJRA 4E09A 3DBOB 3QVMA 4X20A 1ZRNA 3HJAA 2O8DB 3B5IA 1KP2A 4CKBB 4TMVA 3PIDA 2FGJA 2FW8A 1M2KA 4S05A 2QM8A 1OAOC 2ZJ7A 1I6LA 4NE2A 4YB8A 1E6EA 4J3NA 3L7IA 3HXLA 1DAKA 4D0NA 5FOVA 5E7JA 2AOVA 4GZ5A 1SXGA 3LK6A 4W5NA 5B3JC 3CG4A 1ZJ4A 2V3CC 4ACBA 1JLLB 4JJ4A 3UOAB 2VHVA 3CQ9A 3VNSA 1POWA 2YCBA 5IDXA 3V1LA 2GF2A 3DZ8A 4UBKA 8AT1A 4NCNA 2P6RA 1NUPA 1SM4A 1VP3A 4BZWA 3EF3A 1KA9H 4UXIA 1PV2A 3DHNA 2EU8A 3C4VA 3IAUA 3GZNB 5K6AC 1BG6A 4AY3A 1NV8A 4EELA 4CV2A 2INGX 5E9JA 3JZIA 4FK8A 3JQGA 4RVSA 1DRJA 3CVJA 4KUHA 3T1OA 2AQ8A 4MUEA 5B2EA 5JECA 4BMDA 3OFND 5BW5A 4RTNA 2VWPA 3Q9LA 1J6UA 3D8HA 2I3GA 2XA9A 1UPCA 4TL9A 3R7SA 3UQYS 2FWJA 2M1XA 1ZU5A 1FQKA 1YC2A 2Q28A 2WAOA 4G0NA 3CEAA 4M49A 1PG0A 3DFUA 1Z33A 4W4TA 1BZYA 1ZKMA 4IF6A 4KOEC 1IOWA 4KPGA 1UJ4A 1E2PA 4WY5A 1VIVA 1QP4A 5IYZA 2WPDD 4A0QA 2NU6B 4UD6A 3EEIA 4LXIA 2UZ1A 1DBWA 4MDHA 3WBFA 5FFFA 1GDTA 3HUFA 3GLQA 2ILVA 2NZ2A 1AGPA 2EKPA 3L7CA 1AXRA 3MPUA 3OFKA 4JJZA 1Q1AA 5JS1A 1H5QA 4L73A 3ADOA 2WD9A 3K20A 1L7PA 4MRRA 2D2EA 3SK0A 2KBFA 2Q50A 2O2ZA 5BWLA 2WA1A 2PCJA 3Q7PA 4GPD1 2BZGA 4IWNA 5DI9A 1VZ3A 3WRYC 4PBTA 2IQ5A 1PQYA 4UBLA 2WHEA 4HDNA 2Z56A 2JAWA 1QSGA 2BRUA 2ZKIA 3OEED 3TTWA 4TPKA 4DDTA 10MHA 1GZVA 2OILA 1T5BA 5T3YA 1ZEMA 1ZW6A 4LGCA 3QG1A 5DNAA 2Y9MB 1FJGB 1U3TA 4YAJA 3GLHA 3LLCA 1L7VC 1BOOA 3RG2A 5AFSA 2HYDA 3KVRA 4HGZA 2XJ9A 1QIKA 4LWPA 5DMXA 5KYYA 3ZD7A 5ERXA 3MK31 4OM8A 5K2MA 3HWRA 2BFEB 1WZUA 1LI7A 2GCGA 3OKCA 1USVA 4FHGA 5ALNA 2IZ6A 2R97A 2Z5FA 3N8KA 1KEWA 1BH6A 4W9NA 5AVZA 1RW4A 3GQVA 4HB4A 4PYOA 5BV0A 3R75A 5I7WA 1G3MA 2XYGA 4GGPA 2YXBA 5ENZA 4ZT6A 1VDMA 1ULBA 3DL0A 3CNQS 2E5FA 1LDEA 4MA0A 4E21A 4P4LA 5CFMA 1UJBA 3I2JA 2GN8A 3CGWA 1VE9A 4W5HA 5TEWA 5EXSA 1QVZA 1J4AA 1NLZA 2C4VA 2X9LA 2XQVA 4D6PA 4CTJA 4YMVA 2WT9A 4ZJYA 1OILA 5FUYA 1TO1E 1NN0A 2ONKA 3R77A 4KGDA 3VKFA 2XNCA 3VFDA 4CLXA 1KEKA 3KL4A 1UWCA 2YV3A 2VDWA 3WLNA 3P9PA 1SOWA 2IXTA 5CNKA 3ZDYB 3NOVA 4E6PA 3CURA 1G5PA 3NHRA 1T2EA 3PKJA 4TQUS 3T3MB 3L8MA 3CLUD 4RNCA 5JOQA 1IWOA 4DIFA 4GQIA 2C7PA 1NW5A 2GD2A 2P2DA 5EZ6B 5DYIA 4BFCA 5BNTA 3C3BA 4QGSA 2YYYA 1A8HA 2QL9A 4BO1A 4CMCA 3O4HA 1DC7A 2FE4A 3HYLA 2GERA 2QYTA 3ICOA 4GX5A 2MSWA 1U0HC 4U3JA 3AM5A 3PQDA 4C7JA 4DLSA 3SYRA 4XARA 4FZ3A 2ZB4A 4QJBA 4DXAA 4DXHA 5HXAA 5INTA 4Z9FA 2AN9A 1AKQA 2F2TA 4H7DA 3BRSA 2FU5C 4RF5A 3NETA 4YJ2A 3AP2A 5K3OA 1K6EA 1XTRA 2R8XA 4LXTA 1IN6A 1HYGA 3OQIB 3B36A 1NYTA 4FI3C 3VDXA 3KQLA 2I1LA 3HWWA 4P38A 3WXBA 1UMDA 1OHHD 4C14A 4QUAA 4A0RA 4TWZA 3C15C 1PHPA 2GK7A 5F33A 4DG8A 2WWIA 4TLAA 2DCMA 4UARA 4EG6A 1GUYA 1P7VA 3ABQB 3O90A 4GI2A 4M6WB 3IIJA 2H1WA 5CURA 4HBZA 5NLLA 3VO9A 3K8OE 5F12A 2YOFA 1KNXA 2IIPA 4ZALA 1D09A 4JBLA 4FBMA 1L5QA 4KOAA 4J75A 5DM4A 1BCRA 3L9WA 1EFTA 3VGPA 4L74A 2V7PA 5FEMA 5EVJA 4EF4A 3QFTA 3VSBA 3WHLA 1MEOA 4AAYA 4DMCA 2YICA 3IUNA 2JL1A 2GCOB 1B14A 5BO5A 2BPOA 1U3WA 2O5VA 2QD3A 3ZDXB 1KJZA 1Z0SA 3R8XA 2I91A 2C1EA 4NV0A 3T7KA 4WZAB 3QUQA 3KHTA 4JJ7A 1NN5A 4TROA 4LSGA 4X7PA 3ESZA 4BS9A 3UB4A 1I6KA 4CBVA 3WAGA 5KC9A 3IURA 4R3WA 1EX7A 3EZ9A 3JTMA 4OI1A 4KXUA 5L45A 4UQPA 2FEWB 3AJEA 3BIFA 3H9JA 3IS3A 5EJGA 1DG3A 2REBA 1E1NA 3ML1A 3CEJA 4BVJA 5IXYA 5JY1A 5DDIP 1CR0A 1D2HA 2M2IA 1ECJA 4DCMA 1TZKA 1BQ4A 2YH2A 2ZYAA 3F4KA 3AG6A 3GBSA 3OZRA 3Q5DA 1CUAA 4FKBA 4IXMA 1R8SA 3VR5A 1AHIA 4C06A 5IUKC 5CG2A 3H9UA 4BEJA 2WJJA 1CJVC 1TAUA 3II6X 1LY1A 5IF9A 3G7NA 3MJCA 3S5UA 2FPWA 2OQ2A 4KZKA 3CC8A 4Q19A 1KS9A 4ZOLF 1E3WB 1NHGA 3N6VA 3LT1A 4MRSA 4CR6A 2I6QA 3G0OA 1LBQA 2IYYA 4RD0A 3STUA 3MM4A 4E12A 3DVLA 4E6EA 3SSNA 3CKMA 4BFTA 4MS3B 2NNLD 4O4JA 4EHFA 2OQRA 3H0KA 4LDNA 4WLOA 4TXMA 1W29A 5BSUA 2CNDA 4CETA 1LLQA 3EYWA 4AS1A 4MW5A 2KE5A 3EULA 2MSEB 1G20A 1X1SA 3TN7A 4DIOA 3D2BA 2W2KA 3DDNA 3WYAA 1OYVA 3ZCRA 2OO5C 3QFRA 2OGZA 4YXWA 2BYTA 2KHZA 5F7XA 5BWCA 2YVAA 2ZI6A 2DPMA 4BP3A 2ADFA 4OB6A 2VWQA 2H2AA 1QHIA 4CHTA 2GASA 4FYPA 5BYBA 3DL7A 2YR0A 4US1R 1E2NA 5CLQA 2NVUB 3G2QA 1QHSA 1RC8A 3TW0A 3QV2A 4HVTA 1ES9A 2OB2A 2QPAA 1DBSA 4LXGA 2XX3A 3TAHA 3UAGA 3AZOA 4XYBA 1OB5A 5T4HA 1SUPA 4YJ3F 1QBGA 1RKUA 2A9JA 4NG4A 1T6YA 1QZZA 3TOXA 1DI0A 4NZOA 5KNBH 5GP1A 4JLNA 3VV3A 3D6JA 4BGIA 4DSAA 4OA8A 1APBA 2N46A 1DDGA 2LR0A 3OICA 1F51E 1V11A 1U28C 1OZFA 4RKFA 4TX1A 1OC2A 2R60A 4UEQA 3VI3B 3TRIA 3S68A 3ZKWB 2FSIA 2VBIA 3LVBA 4MV4A 1BE0A 3MCZA 2HA0A 1WTAA 3WL4A 1DLJA 3P71T 4JT4A 5FBHA 3ASYA 1CVRA 1Z4JA 2W71A 1TB4A 4TTQA 2ZSUA 4QXQA 3VM6A 2I6SA 1MG5A 5ELLA 5BVHA 1OB2A 2OG2A 4G9BA 2EGUA 4GM0A 4UHHA 5B1SA 2DPXA 1FMLA 2C92A 1HYHA 3L0CA 1GTJ1 1Y98A 1XJQA 4G5FA 4ODIA 4ER5A 4IMIB 1ILWA 3KFVA 3LHSA 3Q7QA 4WV3A 3WRXC 5E6RB 5C32A 4AY4A 3PUXA 4H6WA 4NPAA 3PUJA 4L78A 2WYOA 3WGHA 2DPLA 3Q40A 3K0SA 2ZBRA 3U0BA 2P2SA 2ZI5A 1X42A 2RHJA 5IFKA 1NBWB 4YAGA 4LCJA 4UXHA 4DYDA 4LJ5A 3AC0A 3GYGA 1PT5A 3I4LA 3RU7A 4LMAA 3MIZA 2M98A 5HIIA 3QVSA 3FNHA 3RS7A 1LSJA 2CHVA 1Q7CA 2H1IA 4URHA 5D3KA 1KI1A 2IA5A 2KWIA 4OV6B 1PK9A 1XVUA 3FOWA 3ZWXA 2PT7A 5BP7A 4PZPA 1J8VA 3H2JA 1A2OA 1ORHA 1WCV1 4MKHA 3NYRA 5CR9A 4JGBA 4Z54A 2YUTA 3F7NA 3MUEA 4RXTA 5EE0A 3D2AA 3CWQA 3ES9A 4LYGA 3LCRA 4Z1OA 5IJ9A 3R6TA 1WKCA 3AI2A 3GCXA 5D1NA 4E13A 3HB0A 5B2FA 1NAHA 4PU0A 1SBHA 4N76A 1G16A 1MV5A 1EZ1A 1M0SA 4DSUA 1BWRA 1YQUA 1IEQA 3TVTA 2J9ZB 3GDWA 4XUDA 4UTNA 1JW9B 3RU9A 1RYBA 2AFHB 1DAEA 1V7QA 2EGGA 1DEOA 3BMOB 1N2HA 3CPHA 2HJRA 2P69A 3LP6A 4ZGBA 3HB4X 5IMSA 5JZSA 4RBNA 2DHDA 5CDSA 3ZZTA 2REQA 3RSSA 3FKJA 4G01B 1SXHA 1N1GA 1WMDA 4I9NA 3ZWDA 5KDDA 5LVAA 3EPKA 1U0LA 1Y4SA 3ZBTA 4DQ0A 3THXB 1L1FA 5BWOA 5E7QA 4YGXB 3ZLJA 3I9V6 3MJHA 5FUQA 4PVDA 2KJQA 2QU7A 4TS1A 3RBZA 4F86A 3BDIA 2QG4A 3ETHA 3COZA 1RCFA 1T13A 3O4RA 4FFDA 1T4BA 3FPLA 4LA4A 3LO5A 4M9SA 3KXPA 3BX1A 3WP1B 4ARAA 1WCWA 2RGNC 1HDCA 3DE5X 4ZCRA 1GQFA 1MGPA 2N9UA 4MV8A 4XLTA 3AFGA 3FFBA 4G4SP 1PKXA 1S5PA 1DKNA 3T7AA 2AXQA 4KFTA 2R1VA 4BLUA 3OUZA 1MQ8B 2IPAB 3QWFA 2SHKA 1BDBA 3R3SA 3QBEA 5EZYA 3OY7A 1JEYB 4L8GA 1EJ2A 3VTKA 1FF9A 4NATA 5JH7F 1EB8A 1P0FA 1NPTO 3RRZA 1VE5A 4Z9XA 4DNPA 2CV1A 2D8AA 3EY9A 1CUVA 1NVKA 5TDHA 3TL3A 4TLDA 4TSFD 4I81A 3JX9A 4BNUA 4EHNA 4WZZA 1OWNA 3OT4A 4QOJA 5EJ7A 5CCBA 1EXDA 4HZUB 5JJLA 5H3HA 2WTXA 1FYWA 2FR8A 1T8WA 5DNEA 5E6UA 4DANA 1VLJA 4PIMA 2C8LA 3NI2A 5B30A 5GGXA 1Y34E 5A4IS 1VG8A 3VR5H 1I30A 2ZAOA 5H3CA 1P2GA 1G6HA 4BLQA 2XTMA 3L7BA 4WBSA 3QPWA 4G5YA 2AMYA 1ODIA 1N9ZA 3PKIA 4TOIA 1ZK2A 3VC1A 3BRQA 2QN1A 4BVBA 5C81A 3E81A 1RHMA 2UVDA 2CYAA 3RG8A 5HKAA 4Q82A 1E58A 5IMBA 3OAAD 1Z0UA 4WLFA 1U2RA 2BISA 3HP7A 3SVZA 2G83A 4CPDA 4Q4LA 3QMMA 1OZ0A 4JC8A 1H1TA 2HT6A 2W2PA 3FAKA 2PU5A 1YBVA 3L8EA 3K0HA 3M89A 4B35A 3AW8A 2ZXEA 4JJIA 4TXJA 5TSDA 4I8IA 4RL4A 2VYQA 5DX0A 4C4XA 1CHNA 3R3YA 1KMNA 4ZVTA 1B2LA 4O0LA 5JAOA 1RI4A 1CV2A 3LC2O 4RSHA 4A4DA 1GQYA 1PFUA 4IIDA 3QNWA 1C4OA 1W4LA 4G8DA 1ONSA 1HGXA 2F8LA 4FEEA 1JR2A 1TCBA 1IYZA 4GSKA 3DAGA 4MAMA 4YREA 2GBLC 3M6XA 3U7QB 1Y8RA 1YTUA 2QVZX 2QJRA 4E7PA 2X9QA 3PFNA 1KDRA 3TIXB 1I01A 3O0DA 4UM8B 5KAMA 2R6CA 2FMXA 4FHZA 4QFDA 3EGXA 4R2KA 1ADCA 4RDXA 1WO8A 1XTKA 1HC7A 4MRAA 4QBIA 2ST1A 4ND8B 1WM1A 1ZICA 2SCUB 1YHYA 4JBYA 1CR4A 1TVCA 4RV9A 3L0SA 1E89A 3EDQA 4UQOA 3R6DA 4DPMA 5FTLA 1H85A 3Q2OA 4JROA 1LW7A 1Z45A 4PV7A 4X92A 3ZQUA 1HLPA 1KQOA 5HNKA 3KSAC 3WJAA 4DJEC 3CFYA 1YI1A 3FYSA 4KXFB 4HZUA 3QQ5A 3RJMA 5EVCA 1WPGA 3CEMA 4GX1A 4OLFA 2Q3JA 3P20A 1Q2UA 4PLVA 5EJFA 4AZVA 5JTTA 4ZU3A 2EQAA 5C35A 1FSSA 4ZJPA 2I71A 2GPJA 3TR5A 4K2HA 3DOJA 2FFAA 1YOVB 1N5DA 2I4MA 1GFZA 1CBUA 2WAAA 4GZLA 2VAPA 1TCVA 4OQEA 4C0KA 3RADC 1G18A 1VL8A 4NU8X 1GARA 5KHAA 4AJIA 4LY3A 1A5TA 4KQXA 2L82A 4B47A 5BT9A 5KKCA 1JHVA 1KJIA 3DE6X 4P1ZA 1UPBA 1QP0A 3KOXA 2QB5A 2ZJ5A 2I3DA 5BWMA 5C4IA 5K0FA 2YYZA 2OGTA 3IUEA 4GSYA 4JGGA 4K9KA 1C3LA 4JOBA 2C83A 4RH3A 4NABA 1K6XA 5KKNB 2WYHA 3VPDA 3O8CA 3BL8A 3K92A 1FRVA 1HMPA 3GCZA 4UXJA 4QU0A 4BBJA 3TLEA 5ALVA 1QP7A 5KPDA 1QM5A 3ZIAD 3L7JA 1MT0A 2OD2A 2R00A 1IUPA 1LK0A 4XB2A 4KTVE 5FP0A 3PNLA 4YQYA 2V1XA 2P1DA 3MJRA 2V6IA 3W2HA 2WFZA 1SCJA 4CF7A 5JDCA 1YC5A 2H9IA 3MB8A 1UDAA 4OH1A 3GLFA 2IYPA 2YXPX 4OJMX 4LHSA 5EXTA 1PSDA 1R6TA 1E7WA 2PS9A 2RMKA 3ASZA 3QVOA 4CM3A 3E53A 5C3UA 3FWZA 1XZGA 1TT5B 5G4KB 1Y7HA 3U13A 3PUIA 3FDJA 4BPBA 1M2HA 4ZREA 1IZZA 1WMSA 5JWHA 1ADGA 2JH8A 5K1ZA 2BFFB 4NBWA 4RK0A 2IXDA 3GRCA 1L2TA 3E5HA 4QYMA 4RD3A 5B7NA 1P0IA 5EHZA 2PS0A 3WB2A 1F9EA 2I4OA 3OZUA 2H17A 1X74A 2QD2A 4KVAA 3KYCA 3TKYA 4AF6A 5B7PA 3MCTA 1PDOA 3ENWA 5DHQA 3T5TA 3B60A 2A7QA 3FLEA 2EP7A 4HP8A 3W5UA 3ZLTA 4OAPA 5JEDA 5JPCA 2AKEA 3X2FA 4MCJA 4YCAA 4YCDA 3MWKA 2MJLA 1FVOA 3DZFA 2UZ3A 4N7BA 3L6RA 2WIDA 4UCFA 2VR1A 2NG1A 2GEJA 2JVJA 1M72A 1TA4A 1HY3A 2BFPA 3OZBA 3TOZA 3I01A 1SA0A 2MWMA 4CLDA 2CBZA 3BXPA 3NCTA 4RYLA 4BKQA 1I4WA 5DBGA 2NZWA 4FLEA 1NVUQ 3BTUA 5TQVA 3DAYA 3VKVA 4MWDA 5EKUA 1V5FA 2X1LA 3OZ7A 4DDUA 2XODA 5HOEA 1NP6A 4TLMB 1KBZA 3AW9A 1E9FA 3OBIA 2P2GA 3NGLA 3OCZA 3HB9A 4QLOA 3WDKA 4DLTA 3BQMB 3V46A 5GZ6A 1E59A 1MENA 4NYMR 5ALJA 2GPSA 3GFFA 3U1TA 2QUAA 1GPDG 3FR8A 2R66A 5K3CA 3JAKB 4ZYLA 2WWTA 4R81A 2ZCJA 1ZO8A 4NCBA 1G98A 1HYBA 1W8IA 3D7KA 3G7UA 4I50A 1HR0B 4WY2A 3S2IA 3DB1A 2QEQA 3N8IA 2D4HA 1UXIA 1OT3A 4FMBB 5EA2A 3OZTA 1B8NA 2HK9A 4TLCA 2NWQA 2QVBA 2O4UX 2B4QA 2FPPB 4FT4A 1TJPB 1VL5A 4FMDF 1NF2A 1IXRC 1PE0A 2BFFA 5JU6A 2ID7A 3SIRA 2OSBA 2R5FA 1UQTA 1Y9AA 1A69A 2FXIA 2P91A 3N0XA 3C98A 4DC1A 1WZIA 1E7RA 1FFSA 3FPFA 1LBIA 4NU5A 2ZUBA 1J0BA 2G7MC 4MV0A 4RWEA 1GNLA 2QSUA 2W8BA 5DLYA 4MUYA 2HXYA 4ZAGA 4F11A 3L0BA 1PGQA 3J7AC 2QDXA 4MW0A 3S0JA 3MC1A 3WLHA 3BHJA 3FG9A 5AMXA 1BA3A 5FJJA 3NTOA 3RYFA 2V74B 4RW0A 3USZA 4HNUA 1XTTA 4JIMA 5THQA 1X7GA 2OESA 3D0KA 1ECCA 4P7FA 1PW7A 2BGLA 1M1UA 3FMOB 1EVEA 4YAUA 2HO5A 3DMRA 3AB8A 2DFLA 3FLAA 4TWBA 3UT5A 2E6KA 3H4TA 4DSTA 1PFYA 4V1CA 4J0FA 5ECWA 4MRNA 3R7NA 1W46A 3VAZA 1QO0D 1T8UA 4UHKA 4MVJH 3ZWOA 3DD1A 1G63A 2GLUA 6GPBA 1G42A 5CCXA 2E85A 3P0IA 3IQWA 3QEAZ 1VHQA 1RDFA 2JF0A 1X7XA 1DQSA 1YS7A 4NBTA 4FGLA 2H52A 1USGA 1JKFA 1KJ9A 1XAJA 2DHCA 2ZE5A 5EJ5A 3MWJA 2QAIA 3HWSA 4PYRA 4WNYA 5JR3A 2GNAA 3MHTA 5E6SA 3K09A 3RRYA 3VMMA 3BL5A 4BLVA 3PL5A 4GL2A 3NRCA 4QUHA 4M36A 3WK8A 3O95A 1HLGA 2QPOA 4GX0A 5ULLA 4ENSA 1PL0A 1J7KA 2C4UA 1E2GA 2FN9A 1WVIA 3HC7A 1JQEA 3RT7A 3E9CA 4U2GA 5E3JA 1EBUA 1ZVKA 1OLXB 2ENWA 1D2NA 5KUTA 4E5NA 1ORIA 4CQLB 4K0KB 4HGOA 3WP0A 4NBNA 1CUDA 2XWBF 1X9HA 5JXIA 4KYTA 1KIMA 1IHPA 2JAHA 3MNFA 4H18A 3W90A 2DR2A 3JTEA 2YOHA 4A5OA 1F14A 2C8JA 4QBTA 5DOZA 1CS4C 5J4VA 1YKGA 2Y66A 3LX5A 1GKLA 3WO0A 5B53A 2G0TA 5C2JB 2H1LA 5J2TA 2ZJ6A 1Y3HA 2WZDA 3AXSA 1GADO 1QH8B 3L6UA 1XCPA 3ZZMA 2FZVA 2JLRA 1L5LA 2IS1A 1YJ5A 5I9TA 5IAGA 1GAEO 3K70B 4GOKA 4JK3A 2X76A 4QQRA 1D6SA 5H70A 3VU1A 4OQYA 1T4CB 1W581 1UP6A 4O2AA 5TE9A 4Y6QA 2F6RA 3V8PA 2J3HA 3LWDA 4Z49A 4EA9A 1NMEA 5KWIA 4IG9A 2OC4A 1YACA 2P9CA 3D4PA 3JVVA 1DEAA 4V1CB 4LYDA 4LK2A 2CC2A 3WAJA 1UKZA 4LZLA 4DR3B 1AZWA 1L5GB 1CTQA 1SZCA 3CGGA 3AJDA 4LFAB 1BXRA 3FWYA 4MIKA 3MFYA 1C9EA 1QMPA 4MXDA 5ADUS 1DOHA 3SYTA 1GZ4A 2P9YA 4AY5A 3B7WA 6CHYA 2PUFA 3HZRA 1CY0A 1PD1A 2FN8A 1SVUA 3LXUX 4KR7A 2FZ5A 2HSZA 3E3MA 3FCSB 5AW3A 1UR5A 1J8YF 1JR3E 4JLJA 4BP9A 3A3OA 1JJVA 4BJ5A 1YRAA 7REQA 4M1MA 2K87A 3EFOA 5KTOA 4OXXA 3KJNA 4DA8A 2C2KA 4X1OA 4YRIA 2PKRA 2BE7A 4RZSA 2L17A 3IVAA 1Z6PA 2OM2A 5FUXA 4A0SA 5JZ9A 2AEFA 3UYKA 5HJ2A 3O38A 3W3AD 2XUKA 3QX3A 4RF4A 1EGVB 1M2OA 2ZBGA 3R5FA 2WM2A 4RV4A 4YV2A 5ADHA 4UHFA 5LOVF 5JCZA 4JEHA 4QBFA 3GL9A 4MLZA 4M0MA 3PYXA 1ULAA 4P84A 1S2DA 3FPHA 1HO3A 3VGJA 5A2GA 1I33A 2UZ1B 1CY4A 1PJLA 2C54A 1FTGA 2AE2A 2YJ4A 5AVXA 3A6HA 3F9IA 1I0ZA 1L5MA 3TLMA 4DWOA 5KSZA 4BMVA 1D6MA 4GVLA 4XPIB 5K3AA 2JJQA 1KK0A 1PJ2A 3M83A 1E6WA 3HYSA 4DADA 3LK7A 1Z22A 3GDGA 3RJZA 2M9MA 1P75A 4LI0A 4D9GA 3BXFA 1N2GA 1AO0A 2NO7A 2YV1A 1JTEA 1VC2A 4GHWA 5DEOA 1NI3A 5DHRA 3AVWA 3L7OA 4UFNA 4FFOA 3AU8A 3UMFA 3E9MA 2AK3A 2W2VA 3M6MD 3RVSA 1E3EA 3VTFA 3VV2A 4B3BA 2HHHB 4LCEA 4N3BA 1AF4A 4XUEA 4FFPA 4EUSA 3K32A 1CG6A 3EVTA 3UBTA 3PXGA 1H2ZA 2BGWA 1UP4A 4Q24A 4EVSA 5I6DA 2QUHA 2JAQA 4QGHA 4II3A 2D06A 5EJ9A 4ZVMA 3R8CA 3CWCA 1CUUA 2I8LA 2PMKA 3D4NA 2EC5A 3UVEA 3AL0C 5K2OA 4Z1MD 3DQZA 2Q45A 1UANA 2QRLA 1HLDA 3DEHA 5B7QA 1GCAA 3AEUA 4B6QA 4D8TA 5K3EA 1CQPA 1L4NA 4LHVA 4EM6A 4L57A 3KZVA 3OSUA 3C8UA 4YMSA 4ETNA 1ZXBA 1I1OA 4CEIA 4FQ8A 1BKYA 3NHWA 4RD2A 4ZCIA 5LNK6 2GEBA 2G9QA 3SEQA 2E21A 3DGFC 2CUNA 2O48X 1K8QA 4OXKA 1DXHA 2G1JA 3I9FA 4X3OA 5AJTA 1CDEA 3CH4B 1RZRA 2C59A 3CF6R 4Y1EA 1LJ8A 3RS5A 3X1JA 3S1SA 3PNKA 2F64A 2RIPA 3DW3X 3E0QA 3JQBC 1PQUA 3ZD8A 1TFUA 2ZT6A 4D6YA 2I33A 1SCAA 3BB4A 4H3SA 1Z4KA 3FNQA 1SPBS 1V8BA 3AUXA 1KEVA 3FZQA 3HFRA 3QSGA 2W37A 1UEIA 2RAVA 4IDDA 4Y7DA 4QM7A 1CUJA 4MJXA 3BMXA 4Z7OB 5EWJB 5AVKA 1HLFA 1QC5A 3QY0A 1MV8A 5EXDA 3GNQA 2NYVA 1FIUA 1I10A 1EMDA 4F9EA 5JS8A 4F1JA 4RETA 1BEEA 1Q3TA 1ZIDA 2JNWA 3BA6A 4FFVA 2OXTA 1YFJA 3HK2A 1A9XB 1J2JA 1M7HA 1QOZA 1H42A 2LTAA 3L8GA 2F1OA 2PWYA 2QT1A 3ZWBA 2V7XA 4J7UA 4URYR 1RWMA 2XHEA 1NDQA 4CKBA 5ESWA 3BWEA 3LGXA 1QIFA 4NMWA 5IDWA 2N1BA 3K9CA 4W1SA 3RABA 4EPWA 1KDPA 2FQYA 1QZTA 1J8MF 1F9AA 2QL5A 4GOND 2XMSA 1RMQA 3PX7A 4O2BF 3DV0A 3U9LA 2YFYA 4CKEB 1G9TA 4OM7A 3W7BA 2DZDA 4ML3A 5KCMA 3SQXA 1VFNA 1Z36A 3HBLA 2AC4A 3P4UA 4OX9B 4I8DA 4AULA 4WJZA 4GP7A 1MT3A 1KQPA 2WU8A 3NVMB 4QHTA 3D0RA 4Z7JA 5JAPA 3SZMA 3CN7A 2DQSA 2VXCA 3IPCA 3RIXA 1GKUB 4PM4A 3RKSA 2GLXA 4KFUA 4AKTA 5J1TB 3FOCA 3UV6A 3I9NA 3CNNA 4MQ5A 1P61B 2GZAA 3RF6A 4IVNA 3A05A 1YRQA 1CE8A 2HM7A 1NM5C 4HZGA 3KJXA 1SH7A 3M2TA 2JIDA 1ZI6A 2QN6A 3AO0B 2DHRA 2NVBA 4C3VA 4HADA 2B2XA 5FOUA 3PEVA 4H4EA 4Q01A 2B5OA 3BWCA 1W9MA 2RC6A 1XZMA 3PUVA 2YV4A 4RVHA 5JATA 3CMMA 4MQMA 1J22A 1E32A 4ISCA 4Z4GA 1WWKA 3ECAA 1Q0ZA 3FFAA 3N8DA 1EVQA 1QC5B 3GK3A 4I14A 4BLOA 4JELA 4F7DA 2FWAA 3MXTA 1C7ZA 4DQXA 1XKXA 5DHFA 3DAOA 4ZZ0A 1PK8A 4NEQA 2RGGA 3ROEA 4QVIA 2GHQA 3LYAA 2GEFA 1A88A 3IEXA 1VGVA 4OQPA 4JEUA 2O8FA 2BFBA 4ZVQA 5JUWA 2HZBA 3I04M 4BNMA 5KPJA 1KK3A 3A14A 4F46A 4UU7A 2QTGA 1DXOA 4JC5A 3OIUA 4Z53A 2P65A 4HGPA 1AX9A 3K1YA 1I5RA 2BI7A 4B2LA 3H05A 4R8LA 4YRMA 5THXA 1BS9A 2OFPA 3H2YA 3OPMA 2PGOA 5CNMA 4ZVVA 3IMGA 1XVVA 3AH8A 4OI2A 3MBOA 1RADA 3P2JA 2RHTA 1R0KA 4DR5B 4OFZA 4BNJA 1GHTA 1E2FA 2WMOB 3PP8A 3ZW9A 2NSYA 2GD1O 4MYCA 4QQFA 2OV2A 3C41J 4A6DA 1NNI1 1XTPA 2BEKA 1Z73A 4IHJA 1U5BB 3FCYA 1BWPA 3O92A 3ROPA 5C80A 1CIJA 3GFTA 3UY4A 5LZ4A 5IT4A 5BY2A 1CEXA 1GSOA 1JIIA 1KGDA 2C88A 1RJ9A 5TY0A 3FZEA 1NM5A 5CM9C 2OENG 5EHGA 5KYWA 3FH0A 4K81B 2PR7A 4NDNE 3COVA 1B1AA 2B0JA 2WKSA 5C8VA 1R0YA 1NXTA 1Y1QA 4R1TA 5C7IO 3M9WA 5IM5A 3U7HB 1SU8A 4GICA 3REQB 3EYAA 4Q34A 4TMTA 4F5EA 1M5TA 2O2SA 3P2EA 3KB8A 3TK1A 1GPAA 4NECA 2O7VA 2GGSA 2C2HA 2IYLD 3BWXA 3CB4A 4QO8A 1Y3AA 1ID8A 1I8TA 2WF8A 2O3JA 5KC8A 3V6LA 4OBBA 5DMHA 1UT8A 1CVLA 1LDGA 1MRNA 2Q6LA 3FWKA 4H4CA 4ZC1A 4EMUA 2RAFA 1LRJA 5KTYA 1U6KA 4C2TA 3O75A 1MA3A 4RMIA 2BSQA 3WRVA 5F64A 1F0YA 4F9TA 3WSWA 1T6ZA 3IPYA 5B3LA 1ISJA 4AWBA 1J2TA 3B6EA 3HBFA 4CTMA 1FFDA 2CVQA 2BTQA 3PJDA 5DGIA 1NG1A 2YIVX 4JQCA 5TPZD 3A6KA 1FZTA 1C4KA 4X9XA 3I4CA 4GRAA 3LOQA 1B6RA 1R5NA 2WY2D 3HEBA 2NMVA 3H8VA 4M6WA 5KOYA 3RK0A 1S2MA 2R47A 4ZVRA 1ACMA 1Z39A 2C9CA 2UUOA 3HKCA 1LX6A 3NU1A 4Q6WA 1ZGCA 2QUIA 1JB1A 3KYIB 3CTPA 4CM7A 4X65B 4TSKA 4D9IA 2WSYB 4CFYA 1SQGA 4GPEA 3MOSA 3TAXA 4PHHA 3TTUA 1XP8A 3ZVMA 2JCYA 1KBQA 3O4JA 4KXQA 5H7XA 4HAOA 1KEUA 3BF8A 2BMVA 3MA0A 2OCKA 3AFHA 3VU0A 1VL6A 1XV5A 4Z3OA 3CEPB 5TQ0B 3W4IA 2X19A 3W9SA 2CKMA 2AS0A 3GVIA 3LVFO 4FDLA 4E22A 9ABPA 4YAKA 1R0WA 4D8YA 1NNEA 2BL4A 3HYTA 1PT6A 1TTPB 4OATA 4UVEA 4F4HA 3K4HA 2OYSA 3HA7A 1IC6A 4U7WA 1I80A 4B43A 2W42A 1XRLA 5B5SA 2J87A 1EH5A 5LU9A 4A16A 5LPNA 3REQA 4JLMA 5IPFA 5BYAA 1UMCA 4NKRA 4Q39A 2R6JA 4Y2GA 1NN3A 4DWJA 1YZKA 1UXHA 3D8TA 3SX2A 3TLKA 4A7PA 2WB2A 5JFOA 3BA1A 3VNRA 2ZZNA 2O0JA 2WNIA 3M3PA 3AEZA 2GA8A 2B35A 4PO1A 4PQRA 2Q3LA 4ZXFA 1V9CA 2FF5A 2P9JA 4PW0A 3B1KA 3MMXA 1Y9ZA 4U6SA 5CH8A 5EL0A 2QGZA 2H1FA 4JH0A 1ZHFA 4LECA 4PNEA 1NX6A 4JP3A 2FSUA 3TCXB 4YT8A 1ZRMA 3HBNA 4BMOB 5IKPA 5ALPA 4GMXA 3KELA 1RPZA 1VI5A 3AU9A 5JWRA 4AP9A 3WIDA 4QT0A 3WQRA 4Q1AA 4DDVA 2XVZA 3VQTA 3THWA 4CEHB 5U1PA 3SS7X 1U8CB 2CL0X 3P8ZA 4FMCF 2XVXA 3MCUA 4I08A 4I50B 4RQAA 1YVUA 2RGAA 2CK3A 4LCBA 4GPBA 1GGVA 3C6MA 3H1PA 4LNHA 4Q9KA 4B7XA 1XZIA 3ET4A 4RMGA 1EESA 1J2EA 1G8AA 5BV8A 5A3VA 1ZSVA 2XMQA 3AFOA 3EG5A 4BV8A 3IAM1 1RPAA 1GZ3A 3PD7A 4B3JA 3PDJA 3I9LA 3M5PA 2FPPA 2PM8A 3VTAA 2GI4A 1NMQA 2D2XA 2VP2A 3KKNA 3MHPA 4PYMA 3FTFA 4YA6A 1J9EA 1VP9A 1ADFA 2XYVA 4A5SA 2OFXA 2Q5EA 4Q3NA 5KU1A 4MUFA 1GRCA 4R9NA 3U5TA 1MOSA 1PZNA 2XUPA 3C87A 4HYTA 4RWZA 3CLKA 1ZS9A 2CUZA 3ASVA 4K6HA 2VRWA 3IP3A 4C07A 5BW8A 1Z6TA 1OV4A 1X8XA 4OSPA 3A11A 3R9IA 1QFJA 5CCDA 1PJZA 1A9ZA 1OFUA 3P2IA 3W3ZB 3WJ7A 4W7SA 1JB9A 1WXIA 4GBGA 5CDFE 2G1AA 1XT6A 1JKXA 2JJMA 1H2EA 1W4BA 2QY9A 3LRXA 3UK0A 1I3LA 4PC3A 4XLZA 4OX9Y 1UODA 3P5SA 1Z2OX 1O95D 2CDCA 4J0GA 1SK8A 2X4LA 3T1VA 2C5SA 1FYDA 3L8FA 1FX1A 4J1NA 4A23A 4DOMA 5K8LA 2BFCB 4Y3UA 4DLVA 1TEXA 3CUWA 5J47A 4G4GA 1Y7LA 5KVSA 2IITA 2O20A 2JFGA 4IXDA 4X41A 2X5JO 4G84A 3IEPA 4G1VA 2GBGA 2YY6A 3KQMA 1SXQA 2QXUA 2XSZD 2ORED 4ND5A 2WABA 2NU7B 3QA9A 4KVFA 4DT1B 1NYRA 3PXAA 3A1UA 1AGNA 4JY7A 4QDUA 1QGDA 3A2MA 4XGRA 3E35A 3SJZA 3TINA 3BSYA 5TNXA 1KDVA 1X1RA 1L7DA 1MJNA 2Z3WA 3H16A 4LGVA 1UADA 1DTSA 4X6XA 4ZP1A 2BFEA 2L2QA 3FFTA 5E9AA 1LVHA 2J5XA 1AD2A 4AKGA 2A6PA 2Q5HA 2ZUTA 1IMOA 2I67A 4BV2A 4DZZA 3Q8MA 1IPEA 3SHQA 4ARBA 5IK2A 3NHFA 2Y1WA 1OZAA 2LWIA 3GJTA 1B93A 5FRDA 3I61A 4HBGA 1A9RA 2G5CA 3DBRB 2C29D 2OCDA 4QUGA 5CLHA 2G9UA 2OBMA 2WWGA 5K9ZA 2BGIA 1RQGA 3IVXA 3LHIA 1U1FA 3DFKA 2W11A 4QQNA 3ZWKA 4DPKA 3EOAI 2FWIA 4OOFA 3OLXA 1N6NA 1IZYA 3FETA 1YBMA 3WZLA 4QT4A 1RPTA 4MVYA 2YWEA 4V2UA 1XYGA 1C9KA 1GG5A 5HKKD 4JB8A 3F6EX 3D8BA 1QUEA 4WCFB 4MCAA 5HFAA 2JCXA 1T4MA 4R3UC 5U4QA 4LZZA 1VIYA 2PGAA 5EJEA 1ZGBA 2ZYTX 1DBRA 1EDEA 4GXRA 4PBRA 4YR7A 1W52X 1T4CA 1E2LA 2HEIA 2REQB 2QF7A 1LK5A 1Z13A 1T8RA 3JWIA 3KWFA 3GOHA 4G5QA 4OJYA 1C9YA 4IUCS 1ODJA 5JHHB 1NLMA 1NWCA 3KNZA 4NS4A 4Y2UA 2KM1A 2VF5X 1W4RA 4WADA 2A88A 1H2XA 1WV0A 5JSQA 1EWVA 2PMFA 3O1JC 4Q9IA 3WGJA 2HCJB 3LGSA 3O8RA 4O4LF 5EQJB 3VO8A 2Y1EA 1SVNA 4L0QA 1QANA 4L9RA 4M9XA 4UNPA 1JBQA 2X23A 5KX5F 1AC5A 2RH8A 3BZUA 3F8SA 3OPNA 4FDTA 4D9FA 2VZEA 1CRWG 1SVWA 1M6HA 4ILKA 1YE3A 4PO3X 4WZ6A 1C50A 3QK7A 1MBZA 5CA0A 2GO7A 4TL6A 3G1WA 1OSNA 4V0NA 2QJFA 1NKSA 3T5AA 1C0IA 4MR8B 4COKA 5ENDA 1GNRA 4Z99A 1B43A 4YRFA 5EKDA 1QRSA 2CZQA 3INNA 4WLEA 5EC8A 5C46F 4IG4A 4PZ0A 3E7XA 1BVYF 4J7CA 2KPOA 4LAFA 1RCUA 2B8JA 2W93A 3UK6A 1WXQA 2FE1A 2I2XB 4O02B 2V7VA 1KYTA 1ENOA 3U17A 4B17A 4FB5A 5BWBA 4PGFA 5EAIA 2NXWA 2GF0A 3M4NA 1GG2A 1G1AA 5D5HA 4ZAFA 3WADA 3FOZA 1IK4A 3GFSA 4AM8A 3I62A 2O1SA 4MEJA 4O8ZA 3WNCA 3R9KA 4OJQA 5JD3A 5KYWB 3K9GA 2X14A 5JJIA 1XZNA 4FFBB 4GXNA 4F4JA 5BR4A 2IELA 7MDHA 4Z0PA 1EX6A 4R7ZA 4XPIA 5BR8B 4HDOB 5ER6A 3G0BA 2D2VA 2OD7A 2BBSA 3TBKA 4BVAA 3OETA 4OQMA 3EDMA 4GOJA 5AM0A 4DRYA 1ZA2A 1NBAA 1NVVR 1QZ3A 1YR1A 2OTCA 2AW3A 4QXMA 4RY2A 5ESDA 3U3OA 4ZO8A 4EP1A 1D2CA 1YQQA 2YXLA 2Z1NA 3A1TA 3O3NB 1XKTA 1GNVA 2A2ZA 2PQMA 2WU1A 4WFQA 1TZ2A 3LLSA 2DLNA 4BEBA 5A9SA 2X13A 4PG7A 4WMLA 4IJQA 4HWKA 1DKRA 5F76A 2V3WA 1P5JA 1QIMA 3HKDA 3SE0A 4AJJA 4HNAB 4YAOA 4WK6A 2J0QA 2ZM5A 3C3DA 3FPJA 2XCOA 4DQUA 1Y5MA 3NHUA 1NZFA 5ALTA 1NULA 1JFTA 4JZKA 4MR7B 3QXCA 4EO9A 1H0SA 1HOXA 4C1NA 1ULTA 3VU9B 3WMXA 1X1EA 3M6WA 1G8MA 2C4HA 2J3IA 4IQ0A 1J90A 4HNSA 5A03A 3RAEC 3ZEIA 2YTZA 3C7CB 3E9ZA 2B1JA 3B20A 4NYMQ 4KAXA 1JJ7A 1I2AA 2J3LA 2R6R1 4C4OA 4TZ6A 2H4YA 1WJGA 2JBWA 2VSNA 4NNJA 1WW8A 3ZGVA 5K8TA 1AJEA 4LMPA 1E6CA 5KINB 1JFVA 1YKSA 2DBRA 5AW8A 1AA9A 3TQFA 2G9RA 4AQYB 2WM3A 2NVUA 2HGSA 4M83A 1K1EA 2PO7A 3LSTA 1XRRA 2BHNA 4OFBA 4O4HA 4E5DA 3CLUC 3OO0A 3D54D 1YB6A 2F1JA 3GN2A 3PR1A 4UZSA 5IYZB 2XIQA 2AEMA 2IIBA 3QTTA 4CLOB 2C7BA 1WZNA 3A0UA 1SOAA 1ZJYA 4CM6A 2DFTA 1DOZA 3NPAA 2B7BA 3MYRA 3DTVA 1PVOA 3RTBA 3S8MA 2P30A 5L3SB 5IBPA 1UMBA 1ULUA 2A0KA 1Y3DE 3JYOA 4FJ0A 4TWIA 5TJHA 4EMBA 5I51A 4I4IA 4QXRA 1DQNA 5TMDA 4ZIRA 3VUFA 2AR0A 1MU0A 3GEIA 1GR1A 1FW8A 2WU0A 2WBLC 3TB6A 2ATXA 1LRKA 3EY4A 3KZMA 5JANA 1E94E 2I3ZA 2ZE8A 1MX1A 3G2PA 3OIGA 3H75A 4MI6A 4B3GA 4OMDA 3U3RA 1NBMD 5EJ2A 2EBHX 4QAQA 1T43A 5DCLA 4G1UC 2JHFA 4C29A 2OFWA 3IUMA 3F49S 4E5YA 3D81A 3QUAA 2Q5IA 4HQKA 5E6RA 2XZDA 3SIXA 2WWVD 1IUOA 1UF9A 3Q11A 1NBEA 3NIGB 3L93A 1O94C 1P0PA 4OHRA 2HHAA 2JAOA 3OCUA 1TQ8A 4N3AA 4EZIA 2B5WA 1OW3B 1JYSA 2VQDA 2ISSD 2ZIXA 3GJSA 1DAMA 2NVWA 3CUUA 3L02A 3LQ4A 2VHYA 4WKGA 1QYRA 1MX9A 4ND4A 4HEA1 5G0VA 1I4OA 4D6XA 5BRAA 4WTOA 3ZD6A 3CCFA 2X4GA 3UAZA 3WLQA 1DBIA 4UUOA 2H00A 4OUDB 3A4LA 2PH5A 4QJ5A 4C04A 4XVCA 621PA 4DAOA 1Y3FE 1C9JA 3G2KA 3LY7A 1KXZA 3L4BA 4ZCMA 1YS4A 3G6KA 5FBZA 2CCGA 3EFEA 2IHNA 1CFZA 4O5AA 1YA8A 3SC4A 3HVJA 4P3PA 3C6KA 3UO8B 2O8VA 5B6JA 2B9EA 1T25A 3BVPA 3LL4A 1PV4A 2VN8A 2X5XA 4B31A 4QBGB 3GFOA 2W6IA 1NBOA 2QD5A 2XXJA 3G7SA 2C98A 4KZPA 2M6LA 4PHGA 2XB4A 1U9JA 5H5JA 1WSDA 3R7FA 3T54A 3FPGA 1DNPA 4B4OA 4U3JB 3NBYC 1EXVA 5DXJA 1OLUA 4IJUA 4D98A 2Q46A 1CS0B 1KAGA 1X7YA 2ODEA 1BDHA 1V8ZA 3KE9A 1QB7A 1RWKA 1QH1B 4CMIA 4YRPA 1PNRA 3I2GA 4P53A 4U5XA 2NTVA 4ASUD 4XYGA 1M2WA 2FN4A 3OT1B 4YPFA 2IS4A 5K4AA 1BHSA 4L3OA 1NVAA 2PRYA 4F3YA 5I9SA 2P9QA 1JTFA 3EODA 3M1YA 4KLZA 1SG9A 3LKVA 3V2GA 3TJMA 2I99A 2IHJA 4EB3A 3DEYX 1FMCA 4L76A 1JG6A 3ZE1B 1LKZA 4CLEA 4X1KB 4B9EA 3QA3E 5REQA 5AHKA 4BRSA 1WDKA 2R6DA 4QSHA 3L82B 5KAPA 2FPUA 5D1HA 3NNDA 4L5CA 4WESA 5AXCA 3QGMA 2X6QA 5FI0B 1KOLA 1N5RA 5FTKA 4O59O 4X0EA 1YHNA 2D5LA 4IHAA 1O94D 4M3NA 3KD2A 4B48A 1GGEA 4IO0A 2X8WA 2QSJA 1U5BA 1QK5A 3AUAA 1M2OB 3V3TA 5BSHA 1H66A 2E4WA 2X7JA 5EHXA 1IVSA 4NZ9A 5EMNA 1NP7A 3GFBA 4ZDIA 5AIBA 1SC9A 3BICA 4G6ZA 3H6KA 5GIOE 3WBJA 5IT9A 1Y8AA 4DG9A 1LDBA 1LPMA 2WDPA 3ILHA 2PXXA 4GWLA 1KZYC 2BHSA 2SECE 2G8LA 2J0UA 2PRJA 3ZV4A 2XLCA 2IH5A 1Y82A 3CEHA 2BDEA 4R2JA 2AN1A 1Q50A 3PYLA 3T9BA 2YDYA 2CLFB 2HEGA 1Q84A 3JATA 3GT4A 4N5IX 4Q3KA 2EKZA 3E8SA 3GVPA 1QFXA 4LBWA 4TS4A 4TT3D 2P6PA 5HQTA 4M8KA 4C2UA 1ECFA 2AOWA 3H9BA 4J9UE 4LE1A 2GRJA 2MR5A 1N9GB 3NGMA 4IZOA 4ZHSA 3B1XA 3D1LA 3LYLA 5HSGA 2JLCA 1AHHA 2W6JD 2B3DA 3RGWS 1IY8A 3ZV7A 5LP6F 2P77A 2CT8A 3IBTA 3L6OO 4GFDA 4L2IB 3KD3A 4BC1A 4UC0A 3JQBA 1LK7A 2AMJA 1Y9JA 2YBEA 3GRYA 3E9RA 2BTQB 1B8OA 3QXJA 5LQUA 2V55B 3JARB 1Z26A 1Z5OA 1PWHA 2G9ZA 3WA7A 3HV2A 3H4IA 3QU2A 4CIXA 4CM5A 5BUQA 4HH3C 3R7DA 4O8CA 3T7CA 4CMEA 4KE6A 1WF6A 3DBVO 4FUTA 5E6SB 4NX2A 1B0PA 3V1YA 2DETA 2QZ4A 1DAIA 3H6GA 5JCOA 4CF4A 1RLMA 3C8HA 4JI5B 1QE0A 4I1SA 1YRYE 4U7FA 4D9NA 1XTIA 2OL4A 2VA8A 3CN9A 3EVCA 1LNZA 1HE5A 2J32A 3KEQA 4LBZA 4GMKA 1S96A 3VYSB 2EFEB 1JAZA 2IOFA 4J1TA 1JR6A 1P2UA 1KZ9A 1T5OA 3A4TA 3ROFA 3L4BC 4PIVA 1G19A 4IIJF 2HA4A 2XRZA 4ZU6X 3PF8A 3PPIA 3MMZA 3OFJA 4RK4A 5JWOA 2WPNA 3FCAA 4L16A 4ZT3A 4KJXA 4DKJA 4BUZA 2LW7A 3LFUA 3A3NA 3DEKA 3CISA 1Y8CA 3GRVA 3IB3A 1VLHA 4K9NA 1SHLA 4MRMB 2ZSBA 4R6XA 1EI9A 2VCYA 3TLGA 2VDLB 2RKWA 2LCIA 1Q7RA 4BQEA 1UJMA 4QDTA 5B12A 1UMCB 5KOIA 1OWOA 3HN2A 4DMMA 1T1RA 2YN0A 4LRWA 1TM4E 2G77B 5EMMA 2OBBA 1IRXA 1RACA 1WLYA 4JASB 5AW1A 4B7AA 3AL3A 4ZK6A 4GOLD 3LLMA 2VJYA 5A71A 3SX4A 4C0JA 1NL3A 1U6JA 2IOYA 2J30A 3OG9A 2XNDA 4IJWA 3N2EA 1JQJC 5EN4A 3WGKA 3CF0A 5CDHA 3UC9A 1HNNA 2O1WA 3AUYA 1MDFA 2BFDA 1TW3A 1MF7A 2QP9X 3AR3A 1U7OA 3SIWA 3L1IA 1TA0A 5A9SB 5LWHA 4R7GA 3VXKA 3WK5A 2IUYA 1OH6A 1G291 2YV5A 3MFQA 5K3BA 5CDFA 4NXNB 5FWXB 4CEJA 5F3RA 4EECA 1ISMA 3V8MA 3K94A 4ECAA 2QRMA 2WIJA 4MV1A 2ZJFA 4GI7A 3DVAB 3HU5A 4R0NA 3TSYA 3FYDA 3Q6IA 4S1NA 1MVNA 2YWXA 1ZDMA 4FKZA 5JAZA 3HM9A 4P54A 1NUSA 1RYFA 5ALGA 1LGYA 1II0A 2PX0A 3LWZA 3MQ2A 3NHKA 4NOLA 5DLDA 1CZHA 1U5AA 5EP4A 5JYEA 2D4AA 3SS8A 3PYMA 2B37A 1UQRA 3QPUA 2C5BA 4P82A 2WJPA 2WUWE 4LJ8A 2PS1A 4H35A 4DNFA 1RM3A 6LDHA 1QAMA 3L0DA 4J4HA 3EVFA 1C3OA 3HUEA 4QGFA 3WYFA 5F2KA 3TDNA 4QATA 5JNUA 2O8EA 3ACDA 4R8SA 5K3DA 1JEJA 2GYVA 2X2PA 3G8CA 3FROA 2JLUA 3GP5A 1H69A 1ML3A 3O3CA 4RPHA 4V0OA 3DMYA 5JADA 3DC7A 1W76A 2CZCA 1ZBDA 2QE7A 1YR7A 5FTNA 2NO0A 1W0CA 3QG5A 4H7FA 4PINA 5LDDC 1PNVA 4G5SA 4KGZA 3VH1A 3ZK8A 1R3UA 2WSSD 1D1TA 2G4CA 2QRKA 1FX0A 2X86A 3G0CA 3FB4A 4EY5A 1MC4A 2P6OA 2VBGA 5IC5A 5BYJA 1FPQA 2ZYSA 2D3WA 2Q0HA 1QH9A 1OTXA 1BGVA 3I04A 2HD4A 3ZD9A 3RV4A 3JRNA 4JT8A 4HJRA 2Y1LA 4EFKA 3NWPA 2CXQA 2JBHA 1V5GA 2NT4A 3C6XA 4MCIA 4XI9A 5A3JA 5F9MA 3PNMA 3KQQA 1RLOA 1WX1A 4JC0A 4KSYA 5KDLA 4DUGA 3ND8A 1MEJA 3R6WA 2IBTA 5EY5B 4KFSA 4DT1A 2PHZA 1LFDB 1P7CA 4EFDA 3JQAA 3I1JA 4YMGA 1Y6RA 4F97A 1C4XA 1DX4A 3WRWA 4OIMA 1TJ3A 1EVYA 2GQ0A 4F6RA 5HRCA 3OUTA 2IYRA 2YHBA 2X2FA 4FXPA 1DIGA 2ZRBA 2CLSA 3KOYA 1UINA 2FN3A 3FMPB 2BI4A 1R50A 3KKKA 1AZSC 3LOUA 1EK5A 4IGIA 2BONA 3U60B 4C76A 4D2IA 1EM8A 3UEOA 4L5IA 4B2IA 3BGOS 1WCIB 1NXVA 3FIUA 2NN3C 3CE6A 1T91A 4MMZB 3L41A 1SD5A 5FAXA 4F0JA 1R6VA 5FA6A 1YQWA 4FC7A 3VKWA 1JIVA 1BH2A 2FR0A 3R44A 2R2AA 1JA1A 2O2GA 2O2YA 4U7TB 2RHCA 4PE5B 3RUAA 2IHTA 2I2WA 1SRRA 4J0QA 2C97A 2H11A 5F77A 2C7QA 1J70A 3MEQA 1E2HA 2ESRA 4KMMA 3QMVA 1KDOA 1R2QA 4HQOA 1E3WA 3GJQA 3REOA 1UPTA 4FDUA 4H0NA 4HEHA 5KO2A 1UZUA 2AN3A 2E7ZA 3GN1A 5FOTA 4G0OA 3UN1A 1H0RA 2CLHB 2DFPA 2Y1OA 2H48A 3FVWA 3M7IA 1A7AA 2D13A 3AUKA 5J1SB 4C7OB 1D4FA 2PZJA 1O6BA 3L0PA 4QDJA 1ICEA 2B8NA 2IXBA 3OT1A 4WT7A 3VHXA 5FT9A 4EG1A 2P1RA 4A03A 3GOQA 2ZBVA 3DT9A 1X7XB 1FSGA 4PLPA 2BGTA 4F60A 5KNBA 3RSCA 1IXYA 2HA3A 1J21A 3JRWA 1Z5WA 1NFQA 4ZFNA 1ZL0A 3R7LA 3GCDA 4UU0A 2XYRA 3KOUA 3WNZA 5IXJA 1NNLA 1QGZA 3GT0A 5BR7A 3LAWA 4DZRA 4DUYB 3CNLA 1JAYA 4G0YA 1IATA 1Q17A 1LJUA 3OKFA 1NVBA 2PXCA 2XBMA 4KFCA 1GU0A 1KVRA 3ZXYA 3T3HA 1E2JA 1RWQA 1ZU4A 3A27A 3IUYA 5JAHA 1KEEA 4Q4JB 1KZ7B 4WOCA 3T0IA 3F97A 4LIPD 5LC1A 1G8YA 1ULSA 3IRUA 1K08A 1UJNA 5LUAA 4ZQEA 2ON6A 4BWGA 1DJOA 4C0AC 4NI5A 3MELA 2X6RA 4C5BA 4FNGA 5A06A 1PWXA 2CXUA 1RVV1 3BREA 3STWA 1XEFA 2IDKA 1Z2AA 4IAOA 4JSYA 1Z4NA 1B3RA 1MKYA 4Y0VA 1T1JA 1NQTA 1EFUA 2R6GA 3DR3A 1JEOA 3T7RA 3H97A 1U2QA 3Q5EA 4IYRA 2EZTA 3W5JA 1JPUA 2GM4A 3OFVA 1UJ6A 5BMVF 2BKVA 4NP6A 3JAMA 4EHIA 1TAHA 2ZTLA 2OBNA 1NJ5A 3WBBA 1NR1A 1CUFA 1SU7A 1OXXK 1Y1RA 2VJNA 3EGIA 2HLDA 3NMUF 2EFHB 2X41A 4GWKA 4P81A 3UPTA 5J63A 3DMPA 1DJLA 3RS3A 4E2ZA 5L51A 3DEFA 3O8OA 3IKVA 4I9UA 1BXRB 1A7KA 1ZESA 3ZQ4A 5KMGB 4D82A 4P3YA 5CAEA 3QLUC 3A31A 3EK2A 3L07A 3MUOA 3NS7A 3IQFA 3GIWA 2OPBA 2XUGA 3O4FA 4ZOQI 2GKGA 3P4YA 4B79A 1MTOA 1N75A 3BD8A 3OIWA 4AJ4A 4PLYA 3VR6A 1LF5A 2R6ZA 1C7EA 1QH0A 1TKBA 2OAEA 4OA5A 4UJ5A 3THRA 1WXWA 1ZCFA 1FU4A 1FEZA 2CCKA 2NYUA 1H4TA 2O0MA 4L5BA 3ZWVA 5JSFA 3OKAA 4BMSA 4COOA 3JS5A 4WSOA 1FLVA 4O4HB 2HBQA 3Q6NA 3LUDA 1P9WA 1W5AA 1YDGA 4AB1A 2PTGA 1IY2A 3EZNA 3QEJA 3ZCUA 1KAMA 4HRAA 2Z95A 2JW5A 3TZQA 2XTAA 5LJLA 1PR1A 1S8NA 3LMKA 4MUJA 4NRDA 1YOBA 2ECPA 3PFIA 4LF5B 3BWMA 1FTQA 1VRCA 2AD5A 2Q3FA 2XQKA 1KDTA 4FI3F 4A8PA 2NPIA 3P7MA 4ND2A 1AKEA 1EUCB 3EGCA 1NOKA 1YJXA 3NAGA 4RH0A 5AJXA 3G5AA 1RYDA 5J4HA 4JLWA 4BIMA 3SXPA 3TUZC 4N47A 1TUIA 1RRMA 1H6AA 1XDBA 3K9QO 2FSPA 3W8EA 2CYBA 4XM1A 3ZNQA 5LSAA 5LXTA 2RK4A 4MULA 2M32A 5JNVA 1J1UA 4OQ4A 3RUFA 5LQJA 1F2VA 5B1EA 4H60A 1WS6A 1M0WA 2BFDB 1MB2A 4KHPB 3EISA 1NW7A 3BXOA 1CUZA 2ATIA 2YHUA 4Q4AA 3RD5A 1D0VA 2ERCA 1YD7A 3GMSA 2A33A 1KRHA 3IHTA 1GNPA 3KKQA 3KZ1E 4P7BA 4FJ1A 5JHGB 5LFAA 3H2ZA 4D4GA 5M7EA 2EEPA 4N12A 1ML4A 3Q41A 4LDJA 3V3KA 1WW2A 1ISFA 2KW5A 3B9QA 5DW3A 3VZBA 3A6FA 1JT2A 2R44A 4QDKA 4RIEA 1BYIA 1EFDN 1O58A 3TTTA 3TXYA 3QJYA 1W2HA 2EEZA 1AMNA 4M53A 1O8BA 1EAYA 1T9ZA 3FPBA 4MCHA 4DR4B 3IO5A 4ZQGA 1Q21A 2BJWA 3O91A 4OSEA 5ELMA 1DX6A 2YL2A 3WAKA 4L4XA 3PPXA 3QELB 4WCFC 1NW4A 1EQ2A 4FE3A 1VA5A 3HR7A 1U9YA 4GNKA 4CGZA 2I87A 3ZU6A 4KWHA 2JATA 4J76A 1SD2A 4KIGA 2CMKA 4RU1A 1JIXA 4C4PA 1HDXA 3CUYA 1SXJB 2RHRA 1HI9A 4DIDA 4EA7A 4EENA 1NXQA 3AF5A 3BQ9A 3V4PB 4MGEA 5CB0A 3FTCA 2WTEA 3F3SA 2BAGA 1J5XA 5EINA 1AKWA 1YGPA 4MO2A 1BO6A 1TTHA 4BECA 5CXQA 1QXSA 3H8WA 1GIAA 1DELA 3QJGA 5ABPA 1VJGA 3PUHA 4EEXA 4YECA 4POOA 1A9YA 5KJFA 3F7MA 2W0SA 3TD6A 3TMAA 2FLVA 2PD3A 3QP9A 1G41A 2ZI9A 2FDRA 3HN7A 1RHQA 1QGOA 4IDGA 4EUNA 4YS6A 2QBYA 1Z6YA 2XOEA 2GNOA 3WYEA 1V6AA 1X1QA 2CXXA 1ACLA 3AEQA 3NEAA 3IO3A 2FW1A 3VYTB 1NJFA 4H1WA 3QKSB 5AIAA 3RS4A 2ATVA 5JS7A 2B78A 3ZH2A 4WOBA 4XGIA 5K8CA 1EUYA 4QTUB 2A35A 1U2EA 3QPBA 3FHTA 2QL6A 4E07A 5KHLB 2J9RA 1P0CA 4LY0A 4MMYB 3LVRE 4CKEA 1W0JA 3R7AA 2QRJA 4HXGA 5CT8A 4UUAA 4OP2A 2Y1FA 3GRAA 2LD4A 1OKKA 1ZD5A 1RKBA 3MF4A 3W4JA 1OLXA 5IJXA 2M6SA 2JFPA 2Z04A 4PQEA 1TC2A 4WNCA 5DYNA 1P4RA 1U4OA 3U9SA 4E2WA 3PXBA 3GIDA 3IDOA 2H59A 4UBMA 1PDVA 4HATA 4FZRA 4N1AA 3FVQA 4DY6A 1CD5A 3CT4A 2RAPA 2PWZA 3HDQA 3PE3A 1PT8A 1WCIA 2HRCA 4P5DA 5IDYA 1A8QA 1MB3A 5G41A 1AY0A 4XTCS 1X7ZB 1MLDA 3CUKA 2QRNA 1K8ZB 3X44A 2AB0A 1PG5A 3GNLA 4QUEA 5C8ZA 5F3WB 4Y2QA 1Q2XA 2E1RA 3ESQA 2DM6A 4ER0A 1GYRA 1NW9B 1JTVA 4LV5B 4BAUA 3R7WA 2RARA 5LZ2A 4EQ6B 3TNLA 5T7BA 3ZLVA 2X42A 1DAGA 4H7IA 4MQEB 1YB1A 4CV0A 4Q00A 3NQ41 4C01A 2DUMA 2B98A 2FW6A 3FKQA 4IZHA 4X1IB 4BNKA 2O1XA 2BFCA 4KQKA 5AW6A 1Y3IA 3U6BA 3PA8A 1OLSA 2J3QA 1TLFA 1WUIS 2V8BA 3P5BA 2IUUA 2PQ6A 5I7VA 3FCCA 3PF9A 3IAAA 3CRVA 4DM4A 3VC7A 3GY0A 3U1VA 4I2VA 4BGUA 3HKBB 4LF8B 4QSMA 2CMDA 2BGNA 2VDNB 4QFBA 1IFXA 1ODSA 3CLTC 1HEIA 3V42A 2OQIA 2X2EA 4CQMD 4LZWA 4DWWA 3JWPA 1T4GA 3DFIA 2CWDA 2O2EA 4AKSA 1IHUA 5DTEA 4KQFA 4MQ6A 4QDXA 3V4LA 3FJOA 4G5RA 5JNLA 2C99A 1XXHA 1V6SA 1FXWA 2IPNA 3KYDB 2ZXUA 3QEOA 4BNNA 1JHQA 4KIFA 2JHCA 2ZXFA 2DUUA 3ELYA 3NWBA 2BCGY 4IHJB 3SJUA 5H0IA 1C81A 3B3AA 2EBFX 2NUPB 2YYSA 3ZKAA 1RS0A 2P7IA 3GFVA 3Q3HA 5J59A 3DFZA 2VPWA 4N5MA 5I7OA 5JJBA 4TUYA 3ZHTA 2W00A 1F4LA 1MVOA 1S1CA 2IKSA 4QPJC 5ETJA 4Z4CA 1A9QA 2XZOA 3SICE 5LZ8A 5JI3E 4A8HA 2OEPA 3DPIA 2NUAB 1XFAA 5ERYA 1OI4A 2NZVG 4Z7QB 1J5EB 1ATIA 1HF3A 1R1DA 4M55A 1DZIA 1TKRA 3AETA 2A9PA 1X13A 3TM5A 3CUSA 3OWHA 2JEYA 2HW8A 5JAIA 4D9KA 1J06A 1GSHA 2XB6A 4PGHA 1Z17A 2H7YA 4CXMA 3KZCA 5JSUA 1CY2A 3ZS9A 5JDIA 2ZIZA 4YO7A 4ARCA 5BSFA 3OCJA 3U4QB 5FNZA 3RRMA 4ZYTA 3O74A 1I3CA 2BKXA 3GZ4A 2YWJA 4RJLA 3CY6A 1UFQA 1YHZA 4TLBA 3RT1A 4PAOA 5JARA 5DV9A 4WBXC 3R9XB 4V1CI 1QKIA 1RFLA 3T3EA 1EX1A 1Q3HA 4BNXA 1VCIA 2W90A 3IE0A 4H7JA 1NT2A 4YCNA 4H59A 5CM8B 4MP6A 4B87A 5JS6A 2CXNA 3WRXA 3OAAA 4EY6A 4QFMA 4AUKA 2IF0A 3BHNA 4UTPA 2X9GA 3DUWA 3ZI0A 2XH8A 4FN4A 2QVYX 1J09A 2V3VA 5CAEB 5HCUA 3RUCA 1JDBC 1SUCA 1PHRA 3TZLA 3EN0A 3FY4A 1IWPB 1Z6GA 1D1PA 1K4MA 2IX9A 4Q05A 1O6GA 1YZLA 1JDUA 2SICE 4OAQA 3L92A 4JOCA 4U6QA 5DSXA 3JSXA 3P1JA 4Q37A 2XNSA 3FB1A 5TVGA 1OIWA 1DCTA 1SFRA 5UKDA 2EL9A 2NUBA 4FU0A 5AK5A 1I7PA 2ZPAA 4RTLA 3M3DA 1THZA 3LKZA 4KDEA 5E1OA 3RIYA 1GNTA 3PVCA 5IAEA 3SYLA 4IPTA 3OM9A 3S1LA 4P0QB 1G2OA 2FUG6 4BTLA 2FWMX 3EUWA 3GJ6A 3T12A 2PSHA 4NJOA 2WM8A 4E5UA 1XKLA 3EEQA 1JMYA 1NSTA 4CLHA 2WF9A 2N0SA 3PENA 1L3IA 3RTDA 2H07A 2QVCA 2YRXA 5A5GA 1NX9A 2FG7C 3PWSA 3F9RA 4OBXA 4JB0A 4Q1BA 1W47A 4R2IA 3TGWA 4FMCB 1X2EA 2JKYA 2WJ6A 1SAYA 5ECYA 1C7JA 1KZ6A 4QOEA 1E96A 3JRXA 3T1HB 1WCXA 4MB6A 4BQSA 3IKTA 1PR6A 3DMDA 1O96B 3OPYA 1GZ7A 3B70A 1EG7A 3KZOA 3QLUA 5EERA 4PX3A 5HQJA 3BXGA 2CXSA 3EGWA 1E9EA 4RQTA 2QW8A 2PG3A 3E23A 3EARA 3A6LA 2CF6A 3RFVA 5JNWA 3GFQA 1ORRA 1SBTA 1UK9A 3MT0A 2V98A 4G9GA 4YX9A 1I7DA 2JHGA 1E98A 1F3LA 1I7QB 1BU8A 5BVGA 2JIQA 1F8UA 3PEFA 1KI9A 3HY3A 1T9GR 4AMGA 4PR0A 2GN4A 1SC1A 1U9IC 3E9NA 5B55A 2VDQB 2PVSA 3EC1A 2QMHA 4AKIA 1N8TA 2PUWA 2X0IA 3TEJA 2EJBA 2C00A 3V4RA 2V9CA 1ZD1A 5TLSA 5FI3A 2BSXA 1GFWA 4RFSA 5KOHA 3UC5A 2C9BA 3ZIAA 3N5CA 2N42A 2C42A 3SM3A 1LPNA 1QPZA 3NBAA 2WTUA 1NLUA 3ZDZB 1D2AA 1D9XA 2Z5LA 4L4UA 3KAJA 1ELOA 1N2BA 4FZVA 4LF4B 2D0OB 1HT2E 1FS6A 2D7CA 2C31A 4TZTA 4H6VA 3B6JA 5LA6A 3HHEA 4KQCA 4PC7A 3V9PA 5FPQA 4ZYYA 2HQ1A 1A1VA 3EXIB 4Z9YA 3OPYI 2ZVDA 3HO6A 2ZETA 3PQEA 4BMNA 5JYBA 1E2UA 1KP3A 2LBPA 3H65A 4EVRA 4RLHA 3H99A 3D0QA 1N9GA 1U8FO 2Z57A 3DOHA 1YDHA 4JVLA 4P80A 1QORA 4M7PA 1HETA 1V16B 2WD7A 4PZLA 5KB3A 1IAVA 3DKRA 1ZKDA 3H0EA 2IBSA 5WRFA 5H9VA 2R25B 3NWJA 1ZH6A 3AJRA 3KTFA 2HN9A 1ONPA 3EHDA 1U11A 3A70A 4ZYUA 3BGIA 4JJAA 3V1KA 3LW7A 2ECFA 2B8TA 1ND6A 1ZGZA 2HJWA 1YAHA 4FR5A 4KQ2A 3MAGA 3HR4A 2PZMA 1O89A 1REQB 4F4DA 1JP7A 1XQ9A 2JANA 5AKZA 2PUBA 3GRKA 4IUYA 1RBYA 3T06B 1KI2A 1DFIA 4B85A 3DEIA 1RAIA 1K63A 3VZRA 1HDEA 4D3SA 4YMHA 5FLYA 4KQ1A 3ZCPA 1PJ8A 4QGAA 1ZL2A 3I30X 2A67A 3UJDA 4EY4A 1V0JA 2CMHA 1NTRA 3KB6A 4JL5A 4YI3A 4ZOBA 2PVPA 2BI8A 3BMNA 3LP5A 4GSLA 4WACA 3T5MA 1U0BB 3LFHA 5I3ZA 1CP3A 5EIHA 4WOKA 3AERB 3P2KA 4O3MA 1ZX1A 2Q1YA 3BMQB 2A9RA 3OZDA 4WUTA 2Q3DA 2J08A 3UTDA 3CLSD 3HQ4O 2G3YA 3RVQA 2II6A 1YIOA 1MVLA 1LV7A 1U90A 2BGUA 2JB9A 3IDQA 4LV8B 3SQNA 3TLGB 3HZZA 1SHUX 4XYLA 4LPSA 2C07A 2E4VA 2G76A 4WXYB 4KYVA 3DKVA 2WNHA 2ZTHA 1H1DA 3AR8A 3L7AA 4KW7A 3UNXA 4CTOA 1XP5A 2WG1A 1VB3A 3L8HA 2YWBA 4QO7A 1LJLA 2EF0A 2ORWA 3GFRA 1PQ4A 2H2FA 3NTLA 1I2CA 4U2CA 5T4BA 2DJ5A 5B7GA 5H4GA 3EH2A 2V4MA 4KB5A 5C1IA 4NENB 3D43A 4GKKB 1ZH2A 3IDZA 5CIYA 3TLAA 2YHIB 1ZM3A 1CW2B 1FFCA 4NYIR 4YIHA 4L8FA 3QU7A 1PBNA 4BASA 4MS3A 1V16A 2CUKA 3EMBA 4BKOA 1T9KA 5B36A 1X2BA 1JDJA 3O8QA 4B32A 2CVHA 1E3IA 2GEUA 3P0FA 3TQIA 4GBJA 5ADWA 5SZJA 3K4QA 4RELA 1U28A 4CMEC 5LOVB 1HOTA 4GLBA 3E7FA 3HDVA 1HSOA 4JLPA 1M2VA 3AFIA 3TQRA 3ZNNA 3ENNA 1U9IA 3HKBA 2ZSKA 2VF2A 1HORA 1E2IA 4J0JA 4LXHA 4YH1A 5IDVA 4F7WA 4O2AF 2O0KA 1HBJA 2AQHA 1TA9A 3A25A 2C4TA 3FJ1A 1XPJA 1MC8A 3N05A 4IIXA 4Q1CA 3CX8A 3ZXSA 3E58A 5EJ6A 1NPYA 4JJFA 3ZR4B 2PGJA 2WTNA 5D5PA 4F04A 2GPAA 5BUCA 4WESB 3WGLA 3CZRA 1XXHB 3H2GA 1FFEA 2GK4A 3HCFA 3IR6A 3DZIA 3OJEA 2P4SA 4NV1A 3ET5A 3R5HA 4OMCA 4Y7CA 4XJSA 2I1QA 3TFWA 2IE8A 3WHPA 4DFDA 2LDBA 1AZLA 3RS2A 4G0XA 5CP8A 5KWVA 3HDJA 5CX1A 2NX2A 2ZIFA 1L5YA 4HKTA 4KTTE 1K2VN 3KEOA 3HLKA 5C7YA 3A6JA 2HUPA 3F46A 1A8IA 4H1TA 2ZBFA 1YOVA 2HJHA 4IUDS 2GZSA 3GJRA 4HAWA 1ZIXA 1HL3A 4XW2A 4Z0NA 1MO5A 5ALOA 3JQ6A 1QRDA 1BX0A 4MR9B 3WLOA 3AJ8A 3DW1X 3OU7A 3H1TA 3NNSA 3OT5A 2JFWA 2WQ6A 1JALA 2GRAA 1XLWA 2RK3A 1Q44A 4YVFA 4Y1FA 3PXUA 1FFGA 2F1IA 1VG9B 2IUTA 3B82A 3KSUA 2VQFB 4HFMA 1D4ZA 3ZHOA 1BIFA 1U8ZA 2HK8A 4FBGA 4D46A 5DNUA 1NF9A 5A4AA 5FBRB 3GR6A 5BSGA 3K73O 4RMJA 2NTYC 1SUIA 4EPTA 3VDMA 2QTNA 4YRKA 1H23A 3PQ4A 4EJ0A 2ORVA 1YMUA 1YRLA 3Q3VA 4A10A 4R7TA 4BO8A 2CD9A 4RJJA 1E6UA 1FTYA 3B9BA 2YRWA 3W77A 2J9XB 4H7PA 4MEBA 5AK4A 5HF8A 3HNOA 3SDBA 2YN2A 3DC2A 1N0VC 3C1AA 3I0MA 3U0VA 3WV5A 5DEIA 3RREA 4DIEA 3F9CA 4HB0A 1E0SA 3JR7A 4NNPA 3GNTA 4F6RB 3M4ZA 1J25A 1XTUA 4AIRA 3LNTA 3GLRA 2ZRLA 4FYHA 4YRLA 3RAJA 3TQCA 1C9DB 3IKLA 4FHFA 4M9ZA 3UG7A 3V4ZA 5CDTA 1A98A 4MAFA 2XDWA 1NU8A 2HB6A 1H8HD 1G2PA 1M1YA 4D1YA 5ALIA 1KE1A 2R9VA 3GMIA 4RZUA 5CG1A 1T2VA 1J1IA 2UVPB 3FBTA 1SXJE 2PO5A 2E1PA 2HTFA 4C7XA 3S1AB 3TTYA 2BFMA 4UU8A 3HJUA 5AJHA 3HR8A 1N5LA 2DTEA 2BM8A 3H5LA 3LBNA 3NWEA 3T3PB 5JXGA 3B78A 2VCEA 2YOGA 1B7GO 1B26A 2JAUA 4JJKA 4IDAA 2ZROA 4I6EA 1LC0A 2QOEA 3C85A 4YP9A 1RR6A 3BZWA 4CLOA 3W9BA 1QVWA 1VHJA 2QTHA 1DKUA 2OCBA 1R6XA 3BRWA 2P35A 1X8LA 4ALKA 4YRGA 2CNWD 5DHPA 5LU8A 3GDHA 2HMSA 4ZO4A 2CLOB 3E2PA 1LPPA 3DT8A 4AUNA 2W48A 3SEZA 4C6SA 1QRTA 2REOA 1HT3A 4ZIRB 2OVFA 2I8AA 3T3IA 2Q8QA 1J24A 3IV6A 1OIVA 1J1ZA 4GH5A 3BRCA 3D4IA 4IFBA 3BKWA 4TRJA 2BZSA 3U31A 4D4LA 5GM1A 4LKRA 4KR3A 3DE1X 1ZG3A 2YNMA 4WJKB 3DD5A 4BZPA 3O4IA 4PR3A 2OOKA 2JD0A 3IT0A 4ZCPA 4EX7A 1KIAA 1VKOA 5L3VA 5CVUA 2OFFA 1WXXA 3NT4A 5KWSA 1GUZA 5JRJA 1D1SA 2W83A 2VAWA 3HZOA 3RTCA 4K9LA 4G97A 1HE8B 3GD7A 4BP1A 1R66A 1C41A 3ZJ4A 3L46A 3I42A 4QL3A 3VR4D 5T4FA 1SKBA 3HB1A 1XR3A 3IHWA 3LF2A 3QU4A 4J0CA 4WN9B 3RB8A 4B4WA 2NYRA 3IAS6 4I1IA 3A6DA 3F67A 1YQTA 4AW9A 2J6CA 2CJXA 3EPJA 3JYHA 4E7OA 5E1BA 1M6VB 1OZHA 4Y2RA 3RJ9A 2DH6A 2GFQA 5COBA 4MUXA 1O1YA 2RHLA 3KTAA 3ZXIA 4N8DA 5AVWA 2VSFA 3GA5A 3ITEA 4HYYA 3G5TA 4EGJA 5HW0A 1I4DD 1KKMA 3RW9A 4LEIA 2NO4A 1LVUA 3F90A 1P73A 2DWPA 3GO4A 1PNOA 4MRPA 5IKMA 1AKVA 2C0CA 4KPUB 1CY1A 4WD3A 2IH4A 1XZHA 3CONA 3VC3A 3DWGA 4QJIA 4ZT7A 2O7SA 1GVHA 2YN4A 3B1ZA 3GJ8A 1FFBA 4QBHA 5IUJC 3HFGA 3R7WB 5M34A 1AXGA 3H1BA 1W34A 3CA8A 4IH9A 4DZTA 2BWJA 4BKRA 4G4JA 2V97A 2HU7A 2JZCA 3WNDA 4ECEA 1YF3A 2FMIA 4BQFA 4PNPA 1W35A 4URFA 4HWOA 1AB5A 2VHUA 5FPKA 3IPRA 3NDIA 4X8LA 5JSHA 1EK2A 1ZVQA 3KPVA 5DZSA 3HB5X 5EWMB 1GN8A 2ACKA 4X1IA 4MSUA 3TNJA 5GV8A 2XYQA 4C7BA 2VDRB 1VHDA 3LO8A 2IEYA 1F60A 4YBZA 1L6IA 5HOQA 4JOSA 1RXEA 2D1SA 3U3KA 3BE5A 5HG0A 3WGVA 2I2AA 1R9MA 1SRQA 3SQLA 4WBNB 1TEVA 4WFIA 5KMGA 3D6NB 3FX2A 2AEJA 1LRLA 2I2BA 2WFMA 1KJQA 4GLOA 3G5LA 1QTRA 4GYKA 4L0DA 4Z86A 4D57A 3JQ7A 4HMPA 3K4PA 4UVGA 1ATZA 5LD2B 4GLFA 1AUQA 2ZBDA 3PUKA 4BVFA 3P19A 5DH9A 2VATA 1E8NA 2VAXA 1E7SA 5FR1A 2GUWA 2JFZA 2AN5A 3ZQJA 1L7QA 2AFHE 1BN6A 2DC1A 4Q9DA 2PUGA 3PGA1 3W79A 4BRUA 4H1UA 1PZHA 3AGQA 3DDUA 3IAEA 3V1TC 4ON9A 2OPHA 4ISBA 4MQFA 5KQLA 1GGMA 2VZ8A 4GKAA 2EW1A 5ITWA 1B8UA 2GM5A 3FPCA 3WK9A 1AMUA 4N49A 2Q1UA 2GLTA 3G9XA 1D6NA 4G2NA 3HL4A 3GEMA 2A14A 4M21A 3PKZA 1ULHA 3ZKWA 5HQ3A 5JT1A 3AV3A 3RVKA 3JVDA 1PZEA 5K03A 4EW2A 3HCOA 4GEGA 2X0FA 2HLHA 1SMKA 1MD9A 2Q9CA 3DDWA 4LNAA 4PSVA 1QHHB 3EXFB 1WE2A 2Z5VA 4GZ3A 5AVOA 5FWXA 3M4XA 3TLXA 4KDCA 2A0UA 2J9FB 2P78A 4OHZA 1HSZA 1KMIY 2ABWA 2HCRA 3L4KA 3BB3A 4JBGA 1XQ1A 5IAAA 1F06A 3VNBA 3QWHA 2QXYA 1W4AA 3A6GA 4C0XA 4PG8A 1MPTA 3HMQA 4F5DA 4HNAA 5M5BA 2EDCA 5DNDA 3H5OA 1ZUNA 2PSFA 3BAFA 1ODKA 3GWZA 3GUZA 3I37X 5EJ8A 5ICEA 3THWB 4TYYA 1E60A 3VHXB 3CLTD 3WBKA 5I5GA 4CG2A 4EY8A 2NO1A 3R3WA 4RV5A 4DCOA 4FE4A 4LRSB 1R8QA 2F8SA 1XZ8A 1TAGA 3IR7A 5FBQB 4HLUA 4W9RA 3RS9A 3NIBA 1OWLA 4US2R 1QCCA 3ILVA 5AKJA 4EA6A 1NYQA 2C61A 5T57A 3LCMA 3MWYW 3WLIA 2A0FA 3R24A 4JHXA 3H04A 5FHQA 5AUNB 1FOEB 2OORC 1OYYA 3ZY3A 3A2NA 4IMRA 2EX0A 3IULA 4D4HA 1R4MA 3PSHA 3I0ZA 3SR3A 2W58A 3PNYA 3JQPA 4WXMA 1Z15A 3LPMA 2FLWA 1VJRA 2HRBA 2NGRA 3E15A 1KH3A 4EI8A 2ZSAA 4GI5A 4KAFA 5D7BA 1KH1A 4PIPA 2ZJZA 4HRVA 4MQFB 2IRWA 3DM9B 3CLHA 3OQ6A 3UOGA 3USCS 1MZVA 1G6Q1 2P6NA 2WIGA 3O3OB 3CH6A 4Z4FA 1IPFA 3EIEA 2GN9A 1F6DA 3ROZA 2P0YA 2B2CA 1KL7A 3DOCA 1GPYA 2BGKA 3U3MA 1JMVA 3I6BA 3WKDA 1XDWA 2ZKLA 3B8EA 3O82A 4LVNA 1X70A 2OMKA 2YJ5A 3HHPA 1P2BA 2DVMA 3D6UA 3LCJA 5CYPA 4PRLA 4TRMA 5FYQA 4CKZA 2E5LB 3OOJA 2D5AA 1UP7A 3KUCA 3EVGA 3WDMA 1QS0B 1R4NB 4G0MA 1KJWA 4II2A 2OUIA 1W9HA 2PA0A 3SQWA 2OZLA 2XQFA 1IAQA 3JZMA 1JJAA 1RTKA 1TJ5A 1ECLA 2I2CA 3G8BA 3HKEB 3M5CA 4I4TB 2I22A 4U5QA 2ORYA 3A06A 4XSHA 5FNVF 3UA3A 1P1HA 4HDSB 3SC6A 3CZMA 3DKPA 3TEMA 5JXJA 1KC1A 2RCYA 2H85A 4JVMA 2MSNA 3N86A 5AJVB 3PNOA 4DLXA 1FE8A 3I92A 4CUZA 5IASA 1JGTA 3D31A 4GVXA 4BFLA 1ZONA 1TECE 1MJGM 3OF2A 2DQZA 5C53B 2WAMA 1G8PA 1ORDA 3LC7O 2WWHA 2XDQA 3C7AA 1E0JA 1KAQA 3FNEA 4R71A 9ATCA 3PGXA 4Y6RA 3P0HA 2IZ0A 1QQTA 2G9VA 4RK5A 5AJYA 4ZEOA 1XFDA 4RVCA 4HZIA 4ROTA 1YL6A 5JMTA 2C95A 2O2HA 4YWHA 4YUVA 1TF7A 2QLNA 1PR5A 1KYXA 2GCEA 1BC5A 3TW8B 1PJSA 3I3OA 4HK4A 1K5PA 1EVIA 4JB2A 3W3AH 3VSEA 3T7JA 2UYQA 4O08A 1Z75A 4QECA 1NQOA 5DSZA 2Q41A 4FONA 4G81A 2OBYA 2WLTA 4EHBA 2W6MA 1D1QA 1G17A 4TL8A 3UCXA 5EIEA 1ZHOA 4M0CA 1L9XA 3RTGA 4YV7A 4K9SA 3CPSA 5EUCA 4RGYA 2CGEA 2O5EA 5DGXA 3UJ9A 3HFSA 4LI3X 3BL6A 5KKAA 4YUXA 2HJ9A 3QYPA 4JYZA 4IO1A 5I7AA 1GNSA 3TD9A 5P21A 2ATEA 3DXFA 3GZTB 4XIGS 1THGA 2VF4X 1TYCA 2B30A 3KQHA 2HC9A 3CKLA 4OHVA 1N8SA 5G3ZA 1J00A 3CX6A 4E30A 3ETNA 3LC1O 4BXOB 1JEDA 5AQEA 1TO6A 1AQLA 3ETEA 5AW9A 1B3BA 3WK6A 1XVIA 4OHFA 2VK4A 2F17A 3V7NA 1OLSB 2PLRA 2VNJA 3EMVA 2EJVA 3Q10A 2XEDA