5C31A

Constitutively active sin recombinase catalytic domain reveals two rotational intermediates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLVIQILAMVSEQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Sin, putative plasmid resolvase dimer
total genus 34
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c31A00
1HX7A 5C34B 2GM4A 3UJ3X 1ZR4A 3PKZA 1GDTA 5C35A 1GHTA 2GM5A 3ILXA 3LHFA 3GUVA 4BQQA 5C32A 1ZR2A 2RSLA 2R0QC 3G13A 3LHKA 5C31A 2MHCA 3BVPA
chains in the Genus database with same CATH superfamily
3FBWA 4H16A 1Z6QA 2BEKA 4D0NA 4O0LA 4Q4AA 1GLGA 1VI6A 2V3WA 3GJYA 4A7PA 3GJ5A 2AWNA 3AFMA 4AURA 3DDOA 3JVVA 1XYGA 1OF1A 1WSDA 1DC8A 2CEAA 3E18A 4MR8B 4ZOLF 3UAZA 5KX5F 4PG6A 3RNOA 2IYPA 2R6CA 4CCYB 3R23A 5JNVA 3QUTA 1QQAA 2QGNA 1R37A 4QXQA 3TDNA 1YL5A 3M81A 4BNDA 5EJGA 4RETA 3T3DA 1MJFA 3QBJA 1XNQB 3IURA 1E3LA 1M2WA 2X8LA 3K94A 4FE4A 4QRIA 2FMFA 3U0VA 3ZX4A 3L8HA 1X1SA 1Z2PX 1P6QA 3VKGA 5GZ3A 1O03A 1YZUA 2QAIA 4JP3A 4YLEA 5I7UA 4G09A 5DCYA 5G3YA 3UYKA 5I7WA 3MJVA 5MN5A 1P33A 1ID8A 1UINA 3V6LA 2I6SA 3GJSA 4WMLA 3B1KA 4DJJA 4YAFA 3QU9A 3P9QA 3N8IA 1EQUA 2YS7A 3FGPA 3OIUA 3PHGA 4D98A 3DHWC 2CSUA 4ZQGA 4NHEA 1UPUA 1M34E 1U2DC 3ZDDA 2Z3WA 4RMJA 4OY3A 1QLWA 3I5UA 2VHUA 4QECA 3D5TA 3NG1A 1SCAA 3C5EA 3M0EA 1GRCA 3A05A 2HLDD 3ETCA 2PH7A 1A7AA 5BOVA 4PCAA 5CIWA 5B1EA 2FX2A 2FPSA 4YPVA 1ARZA 4OP1A 1D2GA 1MC8A 3T3HA 1QFYA 1Y3DE 3ESDA 3DJFA 2J6CA 3TXAA 1D4AA 2JCGA 2C3UA 1NWCA 5DHRA 4OLHA 3ABOB 2IDZA 2QLMA 1SCQA 4M1QA 3FXAA 1T91A 3A7EA 1JQLB 3IAHA 1T10A 2PD4A 3OX3A 4Z8XA 4CLRA 4B6GA 4G0UA 4DB4A 4BV8A 8OHMA 4EYQA 5IDWA 1IEVA 2IBMA 4RXMA 4UM9D 1GZDA 4Q1BA 1DFIA 5GWXA 3N3BC 1KP2A 4HGPA 4QYMA 5FL7D 1U3VA 1W4ZA 1LFDB 1DIGA 3K0AA 5GJBA 2CJXA 2Z4RA 1KXJA 1OASA 4HH0A 4ZV4A 5LN1A 3W34A 1BE1A 2ZM5A 2V7QA 3WHKA 1F2TA 2X5XA 5JAUA 1GUYA 3BRSA 3PVSA 1EYZA 4X94A 4KR9A 4POAA 2YC2C 2BV3A 1CUIA 4OQMA 5AHWA 3TOXA 4BATA 5TARA 2YVUA 1UFVA 1DAEA 1P60A 3P4YA 4HGOA 4DYDA 3EE6A 2ODPA 1LDBA 2IPLA 2WNSA 1N8SA 4LYFA 5ISMA 2DY0A 3OF5A 3SQDA 4BWVA 4G5FA 4BQEA 4XYLA 3HRHA 4UEWA 1C1DB 4L95C 1EFVA 2MSEB 3HSKA 1FRVA 2VDKB 1JKXA 1L3IA 1XZHA 5DX8A 1P3JA 1L9XA 1RZUA 4Z0TA 1LRJA 3C48A 2NSJA 2C3PA 3KOWA 4XM2A 4B4OA 2WD7B 1DKRA 3IPXA 2JLXA 1P77A 1C50A 3DV0B 4NU0A 5I9SA 5CGZA 1T6YA 3EXFA 1BH6A 1KMHB 1EK0A 1F9AA 1U2GC 1YAJA 4DJAA 4CT0A 1M3SA 3K5PA 5BVHA 1RWMA 2UUBB 1WCIB 2AG0A 1KSHA 3EHDA 1IG3A 3PFGA 3U81A 1W93A 3W6PA 5HDBB 1DZ3A 3R0QA 1XZCA 1KAMA 1KU6A 3K6SA 3V4VB 1S6YA 4URZR 5KYUB 1OXBB 1RIFA 3BD7A 1E6EA 1ZCJA 4QIHA 3UMJA 1C1YA 4BWFB 2I2BA 2CMFA 5ERGB 4DM3A 2UZ4A 1AKQA 1XFDA 2G7MC 2OE2A 3F3SA 4FDUA 4G0VA 1N2BA 3TPZA 3C6KA 1V7CA 2EIXA 2PUJA 3IODA 5GVRA 1T5LA 1KK2A 3H9UA 2IKQA 4RTSA 1XEWX 1E3QA 1N3BA 3GLRA 2H7VA 3DH0A 3H19A 3GEEA 3L84A 1OLXB 1PR3A 5TRTA 3UOWA 5LKRA 1BJKA 3GD5A 1Y3AA 1PW7A 2ZB4A 3STWA 5DW0A 5FBWB 1PWXA 1NY5A 3F71A 2YH2A 4TXNA 1OIVA 4KQ1A 4U7FA 4BFCA 4DWOA 4QT4A 4CLEA 4Y1GA 1SHUX 2Q6TA 3PJFA 1QH9A 1R5NA 3BIOA 2IYOA 1K86A 4KQEA 1QC5A 1Z28A 3B12A 4J0DA 3R5JA 1H0HA 3WV4A 3IV7A 1L1QA 1RM5A 1Z29A 4GW3A 2PKYX 4RLFA 2VSQA 2QL9A 1U9YA 2VRBA 3FR8A 4DR5B 4CBVA 2BMFA 4Y2XA 1KDPA 1W1IA 2PXHA 4HB3A 5IJ9A 4AC9A 4K9MA 2XRZA 1QYDA 1QRUA 3LCJA 1GAEO 3NCTA 1BTOA 3QJ5A 1QAOA 2G5TA 3HB9A 4NZZA 1VHWA 2RGCA 1F17A 2D59A 3G17A 3Q7RA 1KYVA 4JBWA 1LEHA 4K03A 5BYBA 5AXDA 4OH7A 1U0HC 5EWMB 4EHIA 5F23A 3N87A 3BWBA 4F9TA 1RKXA 1Z25A 4ZYLA 1U0BB 1RJWA 5DF1A 2CXRA 2YXEA 2FZWA 3FGOA 1GNTA 1W96A 2ZWOA 5FTJA 5LZ5A 5CXSA 5AW9A 3QBEA 2IHZA 4MUJA 3UK6A 1CUEA 5J1SB 1T1EA 4DV0B 2VT2A 1YF3A 4MULA 1AHIA 4LV6A 3D4NA 4XARA 3RVSA 3W05A 2QTWB 3ZBPA 3OKFA 1Q17A 1UOQA 4PLVA 1FTYA 3BTOA 4JLOA 3I39X 2A2ZA 1RI4A 1WNTA 5KUTA 2VYCA 4DTCA 2C42A 2I3AA 3W2TA 3IFSA 1TQHA 3A4IA 3FHLA 1S1MA 3DF9A 4PF1A 1TKRA 1JVNA 1HE1C 1U5AA 1IVSA 2ZWIA 2ZRDA 5J4HA 2MYNA 4GUDA 1U8EA 5F1PA 3UWKA 3B5EA 3STYA 3AVWA 2W2LA 1CZUA 4MRRA 1FW6A 2Z1MA 3E23A 4G8CA 4Q3KA 5CT8A 4CF3A 2GXQA 1DPGA 2LVBA 4YDRA 3JQ8A 3NOVA 3SYLA 2CYBA 1I7QB 1G20A 2V0NA 2XW6A 4MUEA 4JJFA 3UTDA 5JJBA 3OICA 1VCHA 3OTOB 1E6UA 1SVIA 5D5QA 1N5JA 3KOMA 1J1ZA 4YLGA 3U3DA 1G42A 3IC5A 5H3CA 2CXHA 1NQOA 3WWZA 4DIEA 5CMLA 3CZ4A 3JQPA 3UBMA 1R9NA 3VHXB 3WNBA 3EPLA 1ESNA 4R71A 1YRLA 3T1VA 4WGGA 1T15A 1MA3A 4ZVRA 1M5RA 2FY8A 2IEYA 3AUKA 3FMOB 3R9XB 3RM3A 5BURA 1RMTA 3HI6A 3KQVA 4CGYA 3MWEA 5K3AA 1O6CA 1OVGA 3VOTA 1PWZA 2J87A 2WYOA 4IZHA 3K8OE 4BP9A 3W04A 5EWJA 3A0UA 2GYWA 3STXA 4NS1A 1HTBA 2I3ZA 1HE2A 4L8LA 3OOHA 1Q1AA 4Q6BA 3U19A 3CB4A 1XJ0A 4CDMA 3IUJA 4J2TA 1QYCA 4JJ4A 4HAIA 3EXHC 4HPXB 2GEDA 2JLQA 3AC0A 1YI8A 3KQMA 2KPOA 2QX6A 3JALB 4PZUA 2GCOB 3TDMA 3QVKA 2A1TR 1B7GO 3AP3A 4MTLA 2PTGA 1JBEA 1L7EA 3M6UA 3U39A 5IF9A 2BY4A 1PWEA 4II7A 1EJ0A 3TLMA 4AJ2A 2FSPA 2W11A 5DT9A 1XJCA 2FHPA 4BZWA 4EI9A 4FR0A 4R3WA 4TMVA 1CK4A 2AC2A 4OU4A 3WDSA 5DIFA 2DHQA 4UU0A 4KAJA 3FJ1A 2HNBA 3TOSA 3WLTA 1I2AA 3I2FA 1PNRA 3AVUA 4XPIA 3W0LB 1C4XA 2XQGA 1G21E 5K6AA 3Q0IA 1NX9A 2H5LA 2DP4E 1DADA 5AJVB 1WF6A 1U94A 1AGRA 2W43A 1HX7A 4F6LA 4R3UC 1Z68A 3B7GA 5T67A 4FE3A 1XCPA 1O6GA 1XDWA 4MVJF 5BWMA 3T5PA 3O8QB 2I2DA 3UGKA 4JJIA 2VYVD 1DC7A 3I9LA 3NKLA 1JHAA 3SKXA 4ES6A 1WTCA 3N9IA 1MH1A 2DKNA 1W0JD 3C3YA 2XDYA 4RD4A 4LYYA 2PWBA 4PG4A 5TQ0B 3PQCA 2C7GA 2I66A 3OX1A 4C5AA 5EEGA 5BN5A 1NUAA 4HYYA 2H4WA 1LGYA 3H9GA 3NHBA 5IAGA 3JRWA 5EESA 2IF2A 5EJ2A 1X39A 3HUTA 4JROA 1T3TA 1ONBA 1P72A 1ZD9A 3L05A 4PEVA 2KQUA 5AKHA 1SVOA 3ELUA 2AIRA 3R4VA 3U1BA 2PU5A 2C1ZA 2KW5A 2NYAA 3LQ4A 3R41A 1E1MA 3W5VA 1G5HA 3TR6A 3ZUGA 1LLFA 2BFDB 3WX0A 2CHEA 3WMRA 1P4RA 4QHSA 4Y0NA 1JXQA 1RQGA 2HMUA 4HAOA 3IXMA 3U26A 4MVJE 5TPWA 3GJ8A 3ISVA 2FYTA 3W7VA 2HK9A 3L7CA 1ZI9A 4FB4A 2O3RA 2B7LA 4CM7A 5A2QA 3BOSA 4TV8B 3VPBA 1I6WA 4K46A 2MR6A 4NBUA 2W2KB 3MJHA 1RAHA 2ZVPX 4XRGA 1MG0A 2PX4A 4YJGB 2PQ6A 5L3RA 1NF3A 3DTVD 3R6GA 4G86A 4P92A 3ZBUA 5LDHA 2IBSA 2XYGA 3C1OA 4R4JA 3Q5GA 1XWIA 4W1QA 5FAKA 1BG6A 4L85A 2NUTA 2FUNB 3MHPA 1GGNA 4RM2A 2AQIA 5FOTA 2XCRB 3VZDA 1SO8A 2JFHA 1ZY2A 2AOTB 2ZUSA 1LDGA 3FTNA 1G7TA 4G9BA 4YP5A 2JZCA 3R0ZA 3TK1A 2GF2A 3IMFA 3HO6A 4GL2A 3KNZA 2NLOA 4RM3A 4P93A 1WZNA 4DBLC 3S99A 4GOXA 2F00A 1I9CA 1FYXA 3A9UA 4C0SA 1DJMA 2FLVA 3NC4A 3PDJA 3D3EA 4MB2A 1YDWA 4N0DA 4PTYA 1FUYB 4DR4B 5C4IA 2ECPA 4LUCA 5JXGA 3DE5X 5JSQA 4WAUA 3S5JA 2RI6A 3I2HA 3OIVA 1J25A 2GZ3A 3WXMA 5M04A 1H9CA 3BGVA 4UVIA 2ZVJA 3EGDA 2EC5A 1AK1A 1M5TA 3U7IA 1LQTA 3C5WP 3CH6A 5EC8A 2I67A 3ZGXA 2GD2A 3ZDYB 2F62A 1U7PA 1TM1E 2HBZA 1KYQA 1LSOA 3TB6A 3AHHA 3P19A 5FULA 2QLBA 3PR2B 4DNXA 3EGXB 3CFYA 3HU1A 1XZKA 4LG1A 4TTIA 4TTRA 1I32A 1UM9B 2A58A 4KPEC 1VHTA 2ORIA 4X44A 3T34A 3MWJA 3NHJA 2G77B 3CKLA 2PMBA 4L9RA 4XIFA 1OXTA 3A3OA 5AK0A 2JKZA 4X45A 4ZU1X 4I1VA 1RS0A 3GIWA 3ZZUA 5ADWA 1OLSB 3AY6A 4O4JF 3FKQA 5KWEA 4YUYA 4KHPB 2XXJA 2X2OA 2ZIGA 4QBKA 2WFZA 3C70A 2Z98A 3P71T 1RBYA 2ZBQA 5IJAA 2QTMA 3FNHA 4ZRDA 3TLYA 1TIKA 1ECPA 1T9CA 3C3XA 3CF6R 2FG6C 3KRTA 1KIAA 2OQ2A 1KDRA 3QPVA 4GFDA 1RE0A 4TWZA 1YJ8A 5ECYA 2Z8ZA 1B43A 3RS3A 1CHDA 5KQLA 3A2KA 3I3SR 2FR0A 4QUBA 4B81A 4PS0A 1C9YA 3ZNQA 5AK3A 3MOIA 3QUSA 4LMPA 5EINA 1YFLA 1G8KA 3C7TA 5CFNA 3P97A 3WBBA 4BNXA 5ITZB 1ZWLA 4C0LA 5I01A 4AKSA 1C8KA 2J6HA 3IVAA 2FJUA 3G6WA 3QEKA 4CI0B 1Y4UA 2EWVA 1L5ZA 2OCLA 3AR6A 4DC1A 5A4MS 4LEIA 1CSEE 3UT5B 2HY7A 5P21A 4BZQA 4WINA 1TZCA 5L45A 3T3OA 2AN3A 2CFCA 3UB4A 4CPDA 4TVSA 1CYEA 5KC8A 3D3JA 2W37A 4QOFA 3AL0C 4LJ7A 1H9AA 1LPSA 2CZCA 3D1JA 4UNQA 1OI7A 4AZTA 4DCSA 4EA8A 1PQPA 5FORA 1VJ5A 4HI0E 1RWXA 3DHYA 4QJBA 4DAOA 3HN2A 4R8VA 3URKA 2A5DA 2MU1A 4XZ3A 5FBKA 4RA6A 3ZUPA 3BGOS 1M8PA 3DVLA 4V0NA 4O2AF 3ZGVA 2JJMA 4DLWA 4FT2A 3RYFB 4GLLA 2DERA 3PPIA 2EU8A 1TMOA 1O97D 2OILA 5CPFA 1AA9A 2PAFA 3JZMA 2HTEA 3NTOA 1KR5A 3AF1A 4GX1A 2AI3A 4JOQA 5KSZA 3ITKA 3PYMA 4M7PA 1A4XA 2H52A 3PR3A 4WVFA 4WZBB 1VL8A 5F52A 3THRA 3HWX1 5JJ5A 3ZCPA 1DELA 1TE2A 3C3PA 1QNLA 3CLRD 1G98A 1LBEA 4L4ZA 4KJXA 3F8SA 4OHUA 5TC4A 4HVAA 3DBHB 4BVLA 4DCOA 1YRYE 2NZYA 1Y5RA 3NP7A 3NEPX 3FIJA 3RC3A 5DBIA 3QW2A 2QE6A 4QBIA 3ZBQA 1B8NA 1QDLB 1QHYA 5H68A 5TF4A 2PGIA 1VE1A 3I01A 3L7YA 3QPWA 2JK1A 2QJRA 4NRDA 4XVRA 3K70B 1Z15A 2C3OA 1NUSA 2XGSA 4F84A 1Q0RA 1P4SA 3C14C 2C88A 4X24A 1NYQA 4U7TB 3BZBA 1EFRA 3B52X 4I6JA 4R9UC 2QQEA 1R8YA 3K5HA 3T15A 3LPMA 1K9SA 3OA2A 1TKCA 1E9DA 3DVAA 4QPZA 4KIWA 5EQFA 4B75A 4EUFA 5CDUA 2Z83A 2AI1A 4ZOAA 4MGYR 3GGGA 4P7BA 1SC6A 4ZMRA 2WKPA 2HZBA 4HGQA 4CL2A 3NANA 3DZHA 4J0GA 4HUQB 2QMYA 2XNHA 1HYBA 5DYGA 2BBSA 2HCBA 2RAVA 4GF5A 3M6VA 4XCQA 1OT3A 1A2KC 2CV1A 1RLMA 1N6KA 3CVJA 3OTGA 4P86A 4DR1B 2V0GA 4BDSA 4V1CA 1VLVA 3QYFA 4NOJA 3NUQA 2J33A 2FR1A 2QU7A 4EJSA 2QBYB 1RWVA 4AULA 3P9YA 1DE0A 2LDBA 5TVGA 4DMFA 3VR6D 1CW2B 3AEYA 4EW6A 1KSFX 1XNHA 1W4BA 2PMCA 2ECFA 2ZROA 3ECAA 4E6PA 4EBBA 3ZCVA 1GO2A 1W88B 2AW5A 2PBFA 3MJTA 5JWRA 4WXYB 1WU8A 3BFKA 3UWDA 1HLFA 1D6MA 2N0SA 3Q3HA 4QXOA 2JBWA 2AR7A 4F45A 4LQDA 3RASA 4D3DA 4N5IX 2XI4A 2WJVA 1WWKA 3L7BA 1P7CA 1NYTA 3WKCA 3IP7A 3A2NA 3D6NB 2VPTA 3WSVA 1EFPB 1H2XA 1IEWA 1RCUA 2WHEA 3B36A 4MUNA 4FXPA 1MJNA 3F7TA 3FHJA 1JAIA 2GNPA 2DKFA 1GSOA 2QTVA 3T3MB 3EFOA 4HH1A 4W7IA 4ALNA 4DV2B 3LD9A 1WUHS 1SU4A 2ZGVA 4Q16A 5IKMA 1X86B 2PS1A 2IIQA 1YHNA 2AOTA 2F3QA 1XEXB 3HCEA 4KL8S 3V8QA 1IC6A 1I1HA 3N7AA 4QODA 2JI9A 1CD5A 2A9KA 4IIFA 3HB4X 4GZLA 3CUTA 4IQGA 4EVIA 3I5AA 3DDHA 4DQ0A 3TQIA 5CVJA 3GMIA 2I03A 1NVEA 3UUGA 3FPLA 2PSJA 1RHUA 4AYWA 2JCYA 1KH1A 2ZYIA 4WUVA 3I34X 2ZYHA 3Q6IA 4FK8A 2XWPA 5FA5A 3FDZB 3FSRA 2WU8A 5ALHA 4X6LA 3UXHA 1UBCA 2QRJA 4DLBA 1JALA 3T41A 1P7WA 1D2RA 1YA4A 3LPNA 1L4MA 4P36A 2YN4A 4OJYA 3UWPA 3ZDQA 2FR8C 4AROA 3ET4A 4IV5A 2X1VA 4MAFA 1N5OX 2V74B 4M8NE 1UDAA 4JLKA 3C8UA 1VE9A 2EX4A 2F1KA 3RHTA 1WOYA 4AJOA 2D5AA 1YVUA 4KK4A 2A59A 2PNFA 4PAMA 5HQ3B 1V37A 1MEEA 4DRYA 1XJWA 4QDTA 3OFND 3IAXA 1YCGA 4G84A 4TMFA 4XYBA 3T3PB 5A1TA 2KB0A 2QRKA 3QG1A 4GWKA 1R88A 2JGJA 4HP8A 4MKHA 4HQRA 3UQYS 5E3HA 1K3UB 3ZJYA 1Z7GA 5FLYA 2JEOA 3G85A 1N2CB 1N8TA 4IDCA 4WD3A 4EJ6A 3THSA 3LC0A 4E5SA 1ZR4A 4OFZA 5JPCA 5CLFA 2ID4A 2V7GA 1V3UA 4WI1A 1XNJA 3WLIA 1SVUA 1C7QA 1GPYA 2EJVA 1XTQA 3A3KA 3L6RA 4I8DA 4JMPA 4KFUA 2J4DA 4L5YA 1Z0SA 5A04A 1GVHA 2O8CA 2ZTMA 3CSDA 4I9GA 4WZBE 3PGA1 3CRW1 4LJAA 4LPSA 4PGAA 1G3UA 4NJEB 5MHTA 4LY3A 3K4QA 3O3NB 5DB4A 4BBJA 4D92A 4V1CB 3OQ1A 2AOUA 3QEMB 1PEAA 3BA6A 4PINA 2CDAA 5BV8A 3GGPA 4ZQEA 2XCQA 1EX1A 4MGKR 5GAJA 421PA 3DKRA 3OCZA 5C8YB 4TYWA 2ZTLA 4LMRA 4Z9AA 4R05A 4BO5A 2V96A 4CEJB 4C3VA 1R6UA 1PVDA 1KK3A 2QORA 1MNAA 1XD2B 4KOAA 4GOND 3ZWXA 5CT6A 3ICEA 4MI6A 2F4NA 4Q1EA 1FCJA 3DL4A 3JQFA 1T2VA 2GPBA 4WHMA 1E2HA 2QZSA 1J2JA 2OORA 4EI8A 5EYPA 1S89A 1T4CB 3HYNA 4KGDA 3FWZA 4TOIA 2O5VA 1NBWB 1ONOA 4LXIA 4BXOB 4I1YA 4Q00A 1KI7A 4NCJA 1R74A 5CDTA 1OH5A 2NYRA 2QZZA 3OJ0A 2H9AA 2OLEA 3QPUA 3NQ41 2BFWA 3BJMA 1N9GA 4LC1A 2MINA 3WK4A 3PGXA 2JHCA 2GA9A 4GVPA 3HRKA 1QOQB 4YP9A 3E9RA 5L95A 2WV9A 3CH5A 2E5FA 2H11A 3GCZA 4CV2A 3CUVA 5B2EA 2VNIA 1K0UA 1Y5MA 1MB3A 1VIMA 2TYSB 4B2PA 4ESOA 3D6UA 2QG9A 4IOJA 2Q2WA 4YGXB 3TLGA 1X9HA 1HG1A 3H5NA 3HHPA 4RPHA 1NLFA 2H07A 4JS0A 4IV0A 1VL0A 3QHQA 1CS4C 2RHCA 4PIVA 2PUTA 3AEXA 3OO1A 4HNQA 5CA1B 2XUIA 1NLMA 2EQBA 4HPWA 4JLAA 2HXSA 3I8SA 4HSEA 4JL6A 4ER5A 4TV8A 1RD4A 2H2IA 4EELA 4YCNA 4JJ6A 5K03A 1R27A 4TS4A 3CLSC 3UAOA 1QHXA 1UKZA 1V9LA 2JFGA 3PD1A 4P5EA 2ZQYA 1AS3A 4J16C 2OHJA 1USVA 3IP1A 4UW9A 1U6KA 4TRJA 3LA8A 4UCQA 5DHQA 1FVOA 1Q1ZA 5DN9A 5ILOA 3JAWB 3G5MA 1HKUA 3SHVA 3TG2A 1PNVA 1VCMA 1FSGA 2JD1A 4XTRA 4MQFB 4RPCA 5DTEA 1IN8A 4MR9B 3WRVA 4AJKA 2ZDGA 4P53A 4Q3EA 1MOSA 2VUIB 2XIQA 1QGOA 3GEIA 1KJJA 5CYFA 3EW7A 1C9EA 3KUKA 3KYIB 1USIA 3T35A 1Y4AE 2V5VA 1BWSA 5MGBA 3W5JA 3ZWCA 2YHIA 5TSDA 1ECBA 3OC6A 1Z8DA 3T8YA 1ENOA 4XIGS 3F9RA 1NXXA 1XZDA 3I5MA 2PYZA 4XJVA 1M1NB 2BZGA 3OURA 5JBIA 4YVFA 1DAKA 1UC5B 4NL4H 3S70A 1E3WB 1DL5A 3OQVA 4EG5A 2XVMA 3LT4A 1L5FA 1ZLXA 3NTLA 3H5TA 3U3RA 3IVMA 2LCQA 2ODTX 8ADHA 2EEZA 1TW3A 2IZ0A 5TMPA 1PI3A 2OXCA 2R751 4XD7A 2MSNA 4YBZA 2OCXA 4NZ9A 4E11A 5LQKA 2YBEA 2R6R1 2VWQA 3W8DA 1XXHB 1BU8A 1VPLA 2DOKA 2BISA 1XRLA 1UP4A 2JBAB 4DGQA 1RAFA 4TV8F 2AUNA 2R6FA 2HLHA 3RTCA 2VAMA 2V6IA 1K6JA 3GRCA 2OQIA 1X13A 3O4GA 1PJ8A 3PX2A 1HNZB 1TTTA 5DNCA 1I4WA 3B1ZA 2YZNA 4AX8A 1M6VB 1N2CE 2JLSA 4GMGA 1NF8A 2FEPA 3O8NA 4M1ZA 4X8OA 4CFYA 4DT1B 3W5BA 1RPJA 5J5CA 1V96A 3IQWA 5K4AA 3QVVA 3W4IA 4KLAA 1DIAA 5CA1F 3ED1A 1J07A 3GZJA 3HA3A 8AT1A 3TI9A 1JZTA 1T8WA 2VJPA 2GETA 4HH3C 5K0JA 1FNDA 4ZAZA 5JY1A 1TJ4A 4QDJA 1GQYA 4RULA 1SZPA 2PX6A 3A9RA 3WNDA 4B4VA 1YACA 2YWGA 4XUDA 5E1MA 1DX4A 4ZAXA 2HO4A 1DT3A 3BIWA 2EKLA 2SCUB 4C01A 3UMFA 1U6IA 4BQIA 4DWWA 4Q93A 1SM4A 2COKA 4M8LA 4CNQA 1UL1X 1GFWA 2WA2A 5CD9A 4HUQA 4EAQA 5JALA 4N6OA 2R8ZA 1JDZA 4C1BA 5CTAA 1KMMA 4IGKA 4X8LA 4JR2A 1BHQ1 5DV9A 1C0LA 1NT4A 2B9VA 4KKXB 3AQIA 2CNWD 3EVEA 4MRAA 3U3JA 1NMXA 3ICCA 3VGPA 1KGSA 1X70A 5HQTA 4LV5B 2QHXA 1YKSA 1CJMA 4W5NA 1R3DA 4KXQA 4ZQIA 3QRWA 3Q3EA 1NMQA 1OAKA 2ZZNA 1ZGZA 2PLRA 2PM8A 4B2LA 2EFHB 4LSZA 4EIWA 4LI3X 4FGKA 5CLGA 2FGJA 2PG3A 2QJFA 3L01A 1CLEA 1ZDMA 4X66B 1QKJA 1M75A 2EKBA 2YWCA 3LO8A 1UAYA 4W63A 3RTEA 3TINA 5LFAA 3MGKA 1PV4A 4M9CA 2XPCA 2VK8A 3LDFA 1FQOA 1RABA 3ZU2A 1ABEA 2C4UA 1L5YA 1QC5B 2JLCA 2P1RA 4YCAA 4G4JA 5F5XA 3N28A 4HX2A 1MF7A 4NFYA 4EO4A 1KS2A 1AGPA 3DMHA 4MQMA 3EZXA 2GHRA 4PHTA 1H0SA 3UXEA 2OHGA 4CFSA 1QGDA 2YV4A 3K9CA 5AHRA 5C8YF 2Z6UA 4TZ0A 3I4FA 2XUAA 3IT0A 1US8B 4JP5A 3AUUA 2Y0PA 3C85A 4OA5A 3D64A 1P80A 2CKDA 1GZ6A 1V71A 2QX7A 2ZB2A 3FF4A 3FUCA 3QXGA 4QYWA 3VU0A 5JNRA 1R8XA 1VRVA 3U1VA 3EPRA 4H31A 1L8XA 1Z6AA 1UK7A 3KKNA 1FBNA 5IXJA 1BCRA 2GAIA 1QHNA 2H7YA 3B60A 5KHLB 1ECGA 1Q6YA 5FADA 3KBBA 4CG1A 2Q1WA 2DF8A 4HNGA 1ZI8A 2L18A 3F96A 2NU6B 1XAHA 3JSXA 1P5HA 2WWYA 1QZ3A 1QHHA 2M9MA 3GO4A 3RUIA 1M6NA 1X2EA 2J0UB 3QVJA 3BYZA 5LD2B 3U0BA 4BWYA 1IN1A 1NJ1A 3DDWA 5T41A 1SG6A 1ST3A 1QF7A 1WMFA 3IBTA 2Q0XA 1SCUA 3DDNA 3QPAA 3S6JA 1PJAA 2JBAA 4IJVA 2IY8A 1HFEL 1NZJA 1GU7A 4MV8A 4US0R 5G40A 5BVGB 5TDHA 3WMWA 1DOAA 1X8XA 3ZW9A 3V8BA 1XC7A 1VFPA 4BLSA 4ZN6A 1ZM9A 5JS7A 1A4IA 1EFVB 1K8QA 1RXCA 1Z5PA 3OSZA 3QV1A 3U4IA 4KXNA 5AM0A 4LV8B 3ROZA 3CRNA 1IOWA 2CFTA 1RI1A 1ACMA 4KE6A 3ODGA 4HRXA 4REOA 4EEZA 1ZITA 1B14A 4NCAA 2X8BA 1N1EA 3D6MA 2YDYA 1JSRA 1LC3A 4V0ME 4P5DA 4PG7A 5DYIA 4EO7A 5A3RA 1L7OA 4PHFA 4R5HA 4GIBA 1DTSA 4NTZA 3H4IA 4TTTS 2OY0A 3QX8A 3S3TA 2B1GA 3LXXA 2SKDA 4ZEMA 4JVMA 2G6TA 4TWJA 3UJ3X 1C5KA 3H4MA 1AU9A 3I1YA 2HWUA 2X5NA 5JG7A 1WU7A 2ZYDA 3SBEA 3R40A 3KWLA 5BR1A 2QBYA 4K0KB 3D7SA 1U0JA 2FUCA 2WWGA 1M76A 3A4VA 1T5BA 2GZHA 3DBOB 3WGLA 5B3LA 2BD0A 2E87A 4HO1X 1QS0A 3ZGLA 3FOEC 3JD3A 1VLJA 1Y98A 3HA2A 4JVSB 3GF4A 1XF9A 3ZNNA 1E92A 2UYGA 1DB3A 1ZXBA 3RG8A 5BMOA 3OOWA 1CJTC 3P9NA 5FF9A 1DZIA 1S7GA 1ND6A 3L8MA 3KHTA 1UC4B 2B0JA 5F4BA 5AICA 3SYRA 1LK5A 1YL6A 3GUHA 1C3EA 1VIAA 3JVIA 4P2BA 1BVUA 2QTTA 3O47A 4G67A 1VG1A 1YO6A 3B1FA 3K31A 3AJRA 4LS3A 3VDQA 1OROA 3PNPA 4URYR 2BYTA 2WTAA 3ML1A 2RB5A 3OA0A 1QLJA 1WB5A 5ESRA 4HGRA 4HS9A 1TM3E 5FPHA 1CS0B 1AUXA 1WHTA 2AFIE 1Y48E 2DSTA 2X2EA 4XJXA 3BTSA 5IJ0A 3DC2A 1SHJA 1UP6A 3HCCA 2I6UA 3TPCA 1ODFA 2WMYA 3JSAA 1Y3CE 3DAGA 1NXSA 2O7NA 1XRNA 5IDQA 2P4QA 3U7QA 2C04A 2REQA 4PX9A 3V7WA 4C22A 4KN6A 5CB6A 4Q37A 2IHUA 1QG2A 2F9MA 4LWZA 2Z1DA 3BG5A 4R5MA 5EMMA 3V48A 3S1LA 5LOVB 5ELXA 1OAOC 2VNSA 4X6UA 1K5DA 4UNSA 1T2NA 4DMMA 2PJRA 1JLRA 2VP2A 3AXTA 4B43A 1PR0A 2NU7A 2VDUE 3E8MA 1E1CB 4NBTA 3WYDA 1NHWA 1OB5A 2FE1A 5A6SA 2FSGA 2BBTA 3I64A 1J7JA 2IOFA 4HLUA 1D2EA 2FWNA 2Z2YA 2ILVA 4E12A 4UD6A 3MEQA 4X61A 4K9LA 3NHFA 3EQ2A 3AHGA 5GIPE 2QZPA 1GL9B 3ICPA 1IE3A 3R3HA 3FNFA 1HA3A 1O6ZA 2BLLA 2OV2A 2J3DA 2A57A 3CO5A 4J6FA 2ATEA 3LQ1A 1VCNA 1JHUA 2XZOA 2RGWA 1JNYA 3L7MA 5G0SA 4BASA 3AM5A 1W36D 2F8TA 4DDHA 1CXZA 2IXGA 1NBEA 3Q8XB 2CNLA 4Y9SA 1G63A 2ZWAA 2VDVE 5ALNA 3NYRA 1QGAA 3GJ3A 3P2YA 2OD2A 1HDRA 3KB1A 2Y67A 4D42A 3OPNA 1Y1KE 4ZOBA 1H5NA 1PJTA 4JI1B 4GO1A 4INJA 1D5WA 4K5QA 1MJHA 2PQ2A 4I08A 1NVWQ 1TM4E 4JB3A 4GVXA 3D2LA 4IUCS 3V7UA 2QQ5A 4AKIA 4OQPA 3K1ZA 2V9CA 1C9DB 3TLJA 1V8DA 1MNQA 4H6XA 1JZQA 2QPLA 3OTIA 2V7XA 3OQMA 5HUHA 2XQIA 2V0CA 1MR3F 2X0RA 3I6BA 5F2EA 1JU9A 5FI1B 5SICE 1NUUA 1I2CA 1Z74A 3ETDA 2TMKA 3PUWA 3SJBA 2O0JA 5FWXA 3KZ1E 2WWVD 1A9TA 1K8XB 2BGLA 2GPJA 3HYLA 4RWZA 5KNDA 1F4LA 4OLBA 3FPFA 4RNCA 1XEFA 3VO8A 3E9ZA 4AAYA 1DSSG 4YT5A 2O3SA 4UE3S 3OT1B 4BNZA 3RRFA 3CT4A 1D0SA 4AICA 5JZ9A 3ZU3A 4JX8A 2QSJA 2ZPAA 1K88A 3N2YA 4GL4A 2OCBA 2XBMA 4H17A 2QRNA 3D3WA 3M4XA 3ZXUB 2ZCUA 4OQLA 1H66A 2QRMA 4UBLA 2ACEA 1CYDA 4MRVA 3SJZA 3T7IA 2HPAA 4DCUA 2BZSA 3JYNA 3W8NA 5L40A 4ZARA 2OO5A 1AXRA 2J67A 1OKKD 4WOPA 3RNLA 1K9VF 2DETA 2IEDA 1FUIA 4F60A 3VV3A 1EK5A 4EVRA 5KZMB 2WHXA 5JHGB 4AQYB 1HC7A 2NADA 1II8A 4GMFA 4LZPA 3RSOA 2WD8A 3Q7IA 4TSFD 5HCUA 3PVCA 3H04A 1B76A 1E6MA 3JR7A 4OHKA 4YP6A 1EEHA 1GGMA 3NASA 3TZHA 3I0NA 3WADA 1PJ3A 1D0IA 2X14A 4X5OA 2ODBA 3EGOA 4FJ2A 3OJWA 2BFNA 1GSHA 3FZYA 3HYTA 4Q4HB 3PX3A 4DCVA 2ZIEA 4TL8A 5J4KA 3IULA 3UPTA 3BSWA 1E4YA 2RE8A 4E31A 5HTOA 4AY2A 3CV3A 1MTZA 2GBCA 2OMKA 2IYFA 3FKSD 3GB9A 1D2NA 2OXEA 4B2IA 3N6RA 2FPRA 3PGMA 3T0GA 3W9SA 2ZVDA 4Y30A 2D3WA 3KB6A 4FC7A 3AINA 1A7UA 2H63A 4S2EA 2YZKA 5FNZA 4CV1A 4EARA 2ZUVA 1COWD 1FTGA 1PNQA 3HU2A 3TEFA 3UCFA 1ZUD1 3JZAA 4MGEA 4PIMA 4WZZA 4XLZA 5CA0A 1KWKA 1MC1A 4D5GA 3JWEA 2J9GA 1VSQA 2GN6A 5D84A 1NVUQ 3P94A 4C0QC 2HPHA 4UATA 5BUCA 4XUGB 3SZOA 1R64A 5AH0A 4ARBA 2KYRA 4JP1A 4QELA 2C31A 4MHTA 1XVUA 3S2ZA 3TR5A 2DBRA 3DL7A 1PR9A 3T7RA 5AM5A 3K8ZA 4C0XA 4R7TA 3CUUA 4MINA 4YJFB 3KR1A 4MXDA 4EYGA 4IILA 6GPBA 2HGZA 3RKRA 5JPDA 3FB4A 4LVUA 2O2IA 3L7AA 3GDGA 4GE0A 2BE7A 2P91A 3B9PA 2WILA 1ZN9A 3UWOA 4AK9A 5I7EA 2XTNA 4F4FA 1SULA 1UJ2A 3LCCA 5I4CA 2J7PA 2P7IA 3HVJA 3HO1A 1J9EA 5BV0A 2EDCA 1NN1A 1YE3A 3L8FA 4LE0A 4BQFA 3IBCA 3UJDA 4F06A 2ZSDA 1FS6A 3QGMA 1KPHA 1V11B 1ONNA 5E1BA 2CHUA 3VZRA 2V03A 2BM0A 3HB0A 1HT1E 1TIPA 2BMEA 2JCBA 1U7HA 2D4AA 2PA0A 4EUKA 1KVQA 1P0PA 2L17A 1FMLA 5KNLA 5ULLA 3EF3A 5KQRA 2RI0A 1SIUA 3EPJA 3CF2A 4LHYA 4B82A 5IHXA 2IU6A 1J2YA 1Z7BA 3AZQA 5HW0A 3QVLA 2R1ZA 4LZJA 3S55A 3L92A 3NBAA 1JYFA 4OHPA 4TUYA 4DUGD 3PEVA 4FNGA 3RJ9A 3PX7A 1BX0A 1DKUA 2PNJA 1FDUA 4EP1A 3CJQA 4HRVA 4YUZA 2O3QA 3L6CA 2PZJA 1OTHA 2YOHA 4BU1A 4PANA 1MN6A 2ZKIA 3IQZA 5BO5A 1XCJA 3AIOA 3QKSB 3PC2A 1VBKA 3WJ2A 4OH1A 2GTHA 4IVQA 3OPMA 3RYCB 4HNUA 4LRYA 1CWUA 5A4JA 1VL6A 3ZLTA 2IXAA 4IIJB 4WXHA 3F4LA 3EEYA 1H3FA 2FX3A 1D4OA 3HXLA 3CZAA 2WJPA 1GVNB 3LKVA 3DUWA 4NE2A 3TKAA 4B8WA 3UMMA 4L3OA 3A6JA 3PGJA 4JNCA 3H7IA 3SSOA 3RU7A 5DLQC 2AE1A 2Y92A 3PQDA 1YR6A 3W5HA 1E7MA 1DKQA 1WCV1 1UKAA 2OECA 2Q50A 1K89A 1NFQA 3OY7A 4NEHB 5D1NA 3R1IA 5AKJA 2OYSA 3TSYA 3VVLA 4YRPA 1G2OA 3CYFA 2OKCA 1M8FA 3LQYA 2DYKA 5JSZA 2XGGA 4JKIA 4M8IA 4ZO4A 4E94A 1TCUA 1WPXA 2D1FA 2GRJA 3EF1A 4IIBA 1RAIA 4UEJA 3DEFA 1TD9A 3FTCA 3PXXA 4GD3Q 4PCLA 3GEBA 4TX1A 4DLZA 2ASEA 1NVAA 2P5YA 3F78A 2BONA 2Y4OA 1PLKA 2WMDA 1N5KA 1WW8A 3JD2A 3KFXA 2C20A 2JFPA 2QN9A 1PG0A 2XT9A 1R4ZA 5CJ2A 4JQYA 3GT7A 4UDNA 1UT5A 1U3DA 4YRTA 3MGCA 1I7SB 1ML4A 2DMRA 2VAVA 5DDIP 2ZRCA 5J43A 1QP8A 1ZN2A 3LBHA 3HPQA 3MYRA 3D0RA 4OGFA 2JKVA 1V26A 5IUNC 5JV5A 3LT5A 4KFCA 1EE9A 4Q48A 2VHWA 1F2TB 1UZUA 3FROA 2Z8XA 3JASB 1R7RA 1S2MA 3F6SA 4QM7A 3KHKA 1JB9A 3C1AA 5H3HA 4EMTA 1UF9A 4NG5A 2IC5A 3RFUA 5IAOA 2E7ZA 1FYEA 1P2FA 4HMOA 4MPDA 4MW6A 1VMDA 4TLAA 4BVBA 5BN3B 5HZMA 4OQDA 2X6TA 1ZZGA 2FEKA 3OPQA 4NXMB 3ZWMA 2PSSA 1MRNA 2VAPA 3G2KA 3IMEA 3AUJB 3HN6A 4YCMA 5I7SA 3T5BA 1IXRC 1WP4A 1R9MA 2ECOA 5ARDA 1TOAA 3RYHA 2CT8A 4E1BA 1E7SA 1G3QA 2FDXA 3KL2A 1AN0A 3EH1A 1K7EB 4O4LA 1GUDA 3L49A 3MAAC 4TS1A 4CIVA 4PYLA 2ZBGA 3X2EA 4ZGGA 1Z6XA 2Q9UA 1QF6A 4TTPA 1D2MA 2J0VA 4GOMD 4JC0A 1RQLA 4J76A 4O63O 5DLPA 4DG9A 1RFGE 1OYYA 2XKAA 3HNOA 2QTCA 4Y6LA 3SM9A 1WCYA 1JKIA 2ESRA 3I2YX 4D9HA 3GC6A 2IE8A 4H1VA 2ZITA 4R2MA 5BUZA 5AKXA 2AFHB 1C14A 1BW9B 1GEGA 2K2WA 3CEHA 4CKEA 1GGJA 1T6XA 2EXXA 1AD2A 2IODA 4E0BA 5CB8A 1IJFA 1V2HE 2GEJA 4HNRA 8MHTA 2WAMA 4IJWA 1E5XA 3OUUA 2QD4A 1RYHA 3AIMA 1EZZA 1LC0A 3EGCA 4DAEA 1A2QA 1L4EA 1G8SA 1OSNA 4G81A 3RWBA 5JYEA 2JL1A 3B6KA 4HATA 5K0SA 3EXHB 1V3VA 4G1CA 4QGAA 5HF9A 4AU1A 3BCHA 4Z4IA 1JLKA 2JLVA 4JSTA 1OXVA 4P7JA 1DJQA 1LS1A 4RHXA 3ZZ1A 2BFPA 5F76A 4EL0A 3M5PA 3EX7C 2J3IA 5KWVA 2FN7A 3QKRA 3CR8A 1PK8A 2FLWA 1IBMB 1DBVO 4WZAB 1FK8A 3IBGA 2IH4A 2DPHA 2NSHA 5CURA 3GELA 2XNDA 2WKQA 4KW7A 4OQZA 1OLSA 2JJYA 4N3AA 4RD1A 5F77A 4Z51A 5C5IA 5I5EA 5BUSA 5LP6A 3L4KA 4CQLB 1BFUA 2YDXA 3UHPA 3KU1A 3GJ4A 3DZBA 3OZRA 4QFMA 1V5FA 2VPYA 3B1YA 1X1DA 1Q1NA 2ST1A 2EKQA 4QU9A 4MYRA 4WCFA 5ALEA 4B83A 4DMKA 2QTGA 2QYHA 3ZD7A 1XMVA 2XHZA 4Y6PA 5BT9A 3VR5H 3FMPB 4MW2A 4OOFA 4R1LA 1L8OA 2YWRA 4L5AA 5LQMA 1SCIA 3G2LA 1JU4A 5DPMA 1OZHA 4ZI7A 3QY0A 1EX6A 1DIRA 2SKCA 4ZVQA 5L4NA 2HWXA 2Y1DA 3NUGA 1HM5A 1GTG1 2IQIA 3HVUA 2N1MA 3M1LA 1QKIA 3IV6A 1IHPA 2C2GA 2WIGA 3AMVA 1AQJA 4FBLA 2DUUA 8GPBA 3WWEA 1NUHA 1U1DA 2EFCB 4R8MA 4CM1A 2QN1A 4MB0A 5AJZA 5ITSA 1BHJA 5IAEA 4HDKB 4ZAGA 4XQ9A 3JWIA 2IPNA 3ABQB 2G9NA 3G0DA 2B37A 4EEKA 2JHGA 1W0CA 2PA3A 1JG7A 1Z0KA 3D8SA 3GFOA 4PQYA 3ADBA 3H9EO 4PYKA 5JXJA 3F6CA 1JIVA 4B4UA 3DR3A 2ZBFA 4FW8A 1V3TA 1CUWA 2E4YA 2EX0A 3IOBA 1YONA 4TXJA 4R9SA 4PXSA 1B3BA 2XRFA 3I9FA 3RLIA 3PJDA 4E5UA 4EHAA 2BSQA 2XLCA 1LTHR 5JC8A 1S4QA 2EZ4A 4DLVA 4F5ZA 1R16A 3B6MA 4WXEA 4QKQA 3UHAA 2Q3MA 2FMUA 4BO1A 5KJCA 3WIOA 3DE6X 2XX3A 2GD1O 4C4TA 1T9DA 4URVR 1QV7A 1RJ9B 2IRWA 3IOMA 2P3QA 3U44B 3RU2A 1TA4A 1Y6RA 3I76A 3LLVA 4ALKA 4GKBA 1EWKA 2FB9A 3D2BA 4RSHA 5CDFA 3OOSA 4D9FA 1ML3A 1YJBA 3IPYA 4G4GA 5HIMA 2OFFA 4HTFA 5H70A 3U3OA 1I2BA 4JB0A 1MW8X 3ASUA 4Z3OA 3LBFA 3Q0TA 4DUYB 2OB1A 3QPBA 4ND6A 2VJNA 2UUAB 2FW0A 2JDID 2YOGA 1WDMA 3S2GA 3V33A 3ZKAA 1NG9A 3P1JA 4CEIA 1GU1A 4OM7A 4ZK6A 2QL5A 1CZHA 2DH5A 3M83A 2W4IA 4BNYA 3SOZA 5TX7A 4ZYYA 5A02A 2VKTA 1XE3A 1ICEA 3U40A 3UAYA 5CEFA 1L7QA 4YRNA 2O8DB 1P19A 2HREA 5AYVA 4EKDA 3ZLJA 1RFLA 2FZLA 2Y99A 3U7JA 3NLLA 3N8DA 3UK7A 3GDHA 1CRPA 1GNVA 3ONWA 1T2UA 2P30A 4C6SA 3A4TA 2VT6A 3LWNA 5AW5A 3OCXA 1AA6A 3NT4A 1LVUA 2V7QD 4AVYA 4YMGA 1JG6A 2ZDQA 4M8KA 4BKMA 4K6CA 2QP3A 1MD9A 2MDTA 4N0EA 4Y6RA 1G7RA 3NJ8A 3VR4H 1Q7RA 1REQB 1E2NA 2VTEA 2PDAA 1KFBB 4K3UA 4WY5A 4R7ZA 5KS2A 3NXSA 1W44A 2FPKA 4RGYA 4JXJA 4F04A 2D1QA 2NZJA 1XU4A 4LZWA 1MTOA 4QT0A 1N32B 4LZNA 1U7XA 2FLKA 5B58T 1RZVA 4P1ZA 2I2FA 1TEVA 2J9YB 3OWXA 1WV0A 4ZXPA 2OUKA 4PFJA 4IQ8A 1E3JA 3KQTA 3OZDA 4QVKA 1PKEA 1JEQB 1E9VA 4ALMA 4Z7OB 3LZ6A 3DBIA 2QT1A 3BK2A 2IIVA 3RWOA 3CKMA 3L7DA 2AF3C 3WL4A 1KO1A 2DSNA 4BUCA 4D46A 5C0OE 1SPXA 4GI2A 3GJZA 4OJTA 2GM4A 3ORRA 2OCKA 5IKPA 4JV5B 1KI9A 1DO8A 4NCIA 2R79A 5C3MA 4H1TA 2IZOA 5KOIA 4X91A 4WPGA 3WNQA 3RS0A 3WMEA 1DX9A 4FW9A 3NNDA 3W2IA 4UTPA 4ZZ0A 2SBTA 3N0TA 3WB2A 1BMFD 2CXUA 2XE4A 3H6GA 4U2BA 1YOVB 2RGYA 3SQNA 3AKCA 1G8AA 2QNRA 5LXTA 1NNI1 3NOXA 4BYMA 2YVAA 5L3ZA 3V1MA 1PAUA 1W6RA 1DQNA 3CNNA 4IJQA 1B8VA 3B3FA 1AXGA 1JSXA 2EBUA 4YAWA 2A9QA 3VX4A 2RAUA 3DLIA 1EA5A 1NQUA 3M49A 4KFTA 4M49A 2AOXA 4PPGA 5AIAA 4OQQA 1AUOA 3QLUC 4PLCA 3ZS9A 3BTVA 1SB8A 5JROA 5KNBH 2VJCA 3BF7A 4QFBA 1MEJA 3FSGA 4DEVA 4LF4B 3COJA 3MRTA 2IYXA 3PDIB 1DCMA 1JBKA 4BLWA 2W2KA 1I5EA 1U8YA 3FVVA 2DJ5A 2N9UA 2BDTA 1P7PA 3ZJ4A 3ZWYA 5C1BA 2CJWB 4NV3A 4ZC8A 5B7PA 5CNKA 1SZCA 3FCCA 3V4PB 2DUJA 2ZB3A 4P4SB 1TKAA 4EABA 2G4CA 3O2QB 4D4LA 4B71A 2HHLA 3N8GA 2BM1A 1Z56C 3KD3A 2BGNA 2HJRA 1K3TA 4AXXA 3D8TA 3P96A 3HLTA 1SD5A 4L15A 5AHKA 4TV9A 3O74A 4ARSA 1B3RA 2FWMX 4PC6A 4B3MB 1JR6A 1CZLA 2WIFA 2WT8A 5TJHA 4RIHA 5ANRB 2P9CA 2JH3A 1RPAA 4HQOA 5CXUA 2YRWA 3AEQA 2HWWA 3ORHA 1QV9A 3O9MA 4Y2PA 4BKPA 3NTVA 1UJMA 3R5XA 1K7SN 1QIFA 2JVIA 5FTMA 2ZIZA 1M73E 4KR7A 1A72A 4B0OA 3EARA 1H4QA 3UA4A 2ZSFA 1K75A 5K05A 1O5TA 3TE6A 2FWPA 4CE6A 3D0OA 4NFLA 1ZNWA 1CE8A 3BMOB 1WX1A 1Q50A 2WZQA 3B3AA 2JBHA 3RRMA 2CYAA 2GYYA 2W22A 4XSGA 4ZVLA 4YONB 2Q5EA 1E6KA 3TR0A 1JDBB 2Q8PA 1C9NA 2O6LA 4DIUA 3THWA 4K88A 5BOSA 1Y89A 4CV3A 5FWNA 4HX5A 1MCZA 2M1XA 2ATVA 5KQMA 2GBPA 1LWNA 3WWDA 2EGUA 1TZKA 1OWLA 2WJIA 3ZDAA 4AZVA 5JJIA 2C4TA 3BWEA 3NNSA 4KWCA 3FX2A 4GXNA 2NUTB 4HVCA 3QYJA 1QONA 2Q4RA 3AUXA 2H8KA 1ZQ9A 4H3HB 4DDTA 2OGZA 3IEIA 3P9RA 4LY0A 4HYQA 2OSBA 1QX3A 3II6X 2IOFK 1J23A 3EVFA 3DO6A 1NC1A 3P8ZA 1L5GB 5EE3A 4Z4CA 4R16A 4DILA 2F59A 1ATZA 3K15A 2L69A 1S02A 1Z2NX 5ALKA 4F5DA 5A3QA 5T6MA 4BO6A 4P38A 3E22A 2BGKA 1IM5A 1QYXA 2J30A 1KQOA 3ACCA 4TMYA 3S2SA 2PZFA 4GI5A 2CV0A 1AS0A 5K45A 3T7TA 4KR2A 2WIAA 3AZPA 1T0PA 3ABSB 1J33A 4QBFA 1RNLA 3F5SA 2FPIB 1N34B 3FPJA 3KUCA 5JHHB 4TMZA 2ZI5A 2HMTA 1CIJA 4HMPA 4F93B 3R3JA 1V43A 4L7VA 3UJNA 4H4CA 4H1WA 4ZTZB 4B33A 5LVAA 3CF0A 1OAAA 4QYIA 1NYRA 1D1PA 1J21A 4MWOA 1EWRA 1BXGB 2OBMA 3BFPA 3I8XA 3QWBA 3S68A 3E3MA 5I7RA 3ZQKA 1FPMA 1O94D 1INLA 1UQTA 2N75A 3M1AA 3MLBA 5EP1A 4O8CA 4YO7A 1HF3A 3NVDA 3RAPR 3QQ5A 3OUTA 2OWDA 1MT3A 5IFKA 2W2QA 3UC9A 3OX2A 4ESHA 3L7OA 4E07A 3PFWO 1QRSA 5FBQB 5DOZA 4YV2A 4N5LA 4EG6A 3AR3A 1Q83A 3KTFA 3B2EA 4LJ5A 2VP3A 3KE8A 1YB1A 2J0QA 1U5BB 4V38A 3M9XA 2BMDA 2RBEA 4ZQFA 4CHGA 2VSXA 3LQKA 3QE0A 4IG4A 4UD2A 1J6UA 3F5DA 4DLLA 4KN5A 2XJ9A 4MWTA 5ADUS 1CULC 2VBFA 3IP5A 4IGFA 4PO8A 1GDDA 2JJ1D 4NXNB 2QG4A 2GXSA 3C3EA 5C4GB 4BL5A 4EZIA 1XVLA 1ODIA 1QJCA 1QUFA 3QE2A 4PWZA 1MMFB 1VM6A 5KKNB 1IXYA 2CLEB 3AI7A 2QU8A 5DM2A 1D7AA 2CVPA 3ZWDA 3DM9B 1WDLA 2OM2A 2W2PA 1QCYA 5JUWA 1ZAYA 3D8UA 4U2GA 5DHFA 3U4GA 1TMGE 3L5KA 3PUIA 3MFYA 2VJMB 3EWSA 4NONA 3GGCA 4YMSA 1RAGA 2B83A 2Y0DA 2GPYA 1T1RA 4LTDA 2YXDA 3EIEA 4Y3UA 1SA0A 3PQ7A 4K28A 5G53C 5IT9A 2CHQA 1YE5A 2IX9A 3NBYC 4R0VA 4X3CA 3GFFA 3MIIA 3KCQA 4ZKEA 4LHSA 3ZE1B 3O2NA 5JWOA 1L5WA 1U0SY 3MA0A 3DEIA 2HIAA 2YASA 4RKRA 4MPPA 3JQ6A 3DMFA 2AK2A 5IC5A 2C7OA 4YV7A 1JILA 2RBGA 4OX9Y 2P3OA 1WPRA 1SUFA 1VMKA 4L2IB 3V4LA 1EM6A 4C7BA 1VKOA 4IIGA 4EHNA 2F17A 5A0TA 3N2IA 3AF3A 3P32A 3FG9A 5D7NA 3VZBA 2HEGA 5KOHA 3LHDA 4JUFA 2QVCA 2W8BA 4XPZA 1R5JA 3K9NA 3R3ZA 2DT5A 3OWOA 4GMHA 5CJJA 4PX2A 5IYZF 3ULKA 1SUSA 1NF2A 4CMJA 4DCJA 4E21A 3AVOA 3AM1A 1EX7A 3RS5A 1CV2A 4PCVA 1QX4A 5FOQA 4D9MA 2J9RA 4KWTA 1TUBA 3EBLA 4D96A 4U9IS 2HZ7A 2ZR8A 4DLKA 1W5EA 1Z17A 4F91B 3Q9SA 4GRDA 3UF0A 3L46A 3GN1A 4HWTA 3VR4A 1ZBDA 1FJHA 2QAGB 3I6YA 5CVTA 1N2OA 1G2IA 2WUEA 5DGHA 2DH6A 2RHWA 4FFNA 2PHZA 4TKUA 3DNFA 2EF0A 3Q85A 3QNUA 3JXEA 2RGXA 3GRZA 3K9HA 2J3LA 4HXGA 4J9VA 5IKEA 4OEHA 1L5KA 4ZDKA 2R47A 4B44A 1U1EA 2PSHA 4G5YA 3RUFA 4DQUA 2UU9B 5BRAA 5DXJA 4EZEA 3IPRA 2R2AA 4I9UA 4B79A 3HL0A 3QTLA 1LX6A 4RIFA 3F7OA 4DEXA 3R3VA 5K3FB 3DP7A 2VR1A 5IJ9B 4H6WA 4IR7A 1OXUA 5CNMA 4MQ4A 4KTVE 4TQGA 2PD3A 4ML3A 1CB7A 3JQDA 4F5WA 3G2PA 1JHMA 5J2UA 1IZ7A 5G0WA 3OEED 3OJEA 5JVDB 5BXYA 2H1OA 2W6IA 1ODCA 3C7DB 4MV3A 1BN7A 1LPNA 1R0WA 1TKBA 4MR7B 4EGCB 2E85A 3EJ6A 1BZYA 4GEGA 4I1UA 5FWYB 4N3NA 3WL7A 1AKTA 1RYDA 2ZS8A 1P1IA 3DWEX 5I9BA 3DLTA 4KITB 4G0OA 2C8LA 4L9AA 4UM7A 1SQFA 3RAGA 1I5RA 3IS3A 4U7HA 4YA6A 4YV1A 1CDDA 4F4HA 3V1TC 1GPUA 2OHIA 3T9DA 1ODTC 3ACBA 3GLVA 2G08A 3F90A 1N9ZA 2QGFA 3MELA 3N8NA 4GBGA 4KO2S 5CYPA 4BZPA 1U3WA 3I6MA 3S8MA 4ZT4A 1PSWA 2Z3ZA 5BN4B 1EWVA 2GN2A 1U9ZA 5FOVA 3BE5A 4LVNA 2EYUA 4JB8A 3MCWA 3LL4A 2JANA 1ZL0A 5EOVA 1JDVA 3IELA 4GPEA 4QHTA 2XQKA 5ELLA 3VZCA 5ENVA 4BN4A 1Y9ZA 3G0BA 4NDZA 4KSYA 4HX9A 2VUUA 3DEJA 3OKPA 1U2DA 5BSRA 1UEIA 2NV6A 3O1HB 4TLBA 4NP6A 1Y3IA 2A94A 1QHGA 4X7MA 4OJMX 3TEJA 1RBQA 2J9FB 1U2PA 2JIZD 2XD4A 5E6RB 4C4PA 1T0JB 3H1GA 4V3BA 4U0KA 5BORA 3HR8A 2C96A 2RGAA 1OKKA 2Z8YM 2CWDA 1NNEA 2V98A 1KC1A 5LJLA 1BQ4A 5FPKA 4O2BF 4ZVVA 4B3JA 5HKOA 1V6SA 1M7BA 1SVNA 2FUEA 3OG9A 2AW3A 5FKJA 3Q8WA 4JYPA 5AW8A 4E70A 2X22A 4QDZA 5C1PA 1E69A 2PX8A 4HB4A 3WRYA 2ZS7A 3ENQA 4JJ7A 4D4IA 4QOEA 3CW9A 1MORA 3C2QA 3L0SA 3SNHA 5EZ6B 1Z73A 5L3SB 4OM8A 3AKEA 1XMJA 4GZ5A 2O8VA 1TIBA 5DNAA 4P7GA 1F0NA 3VVCA 4DY4A 1A9YA 2PJUA 3VU3A 4DCMA 3VKVA 1ZQ1A 2W0MA 5KSPA 4HQKA 1OFIA 4DRXB 3G1WA 2F43A 2ZI3A 4K87A 3OESA 1C3LA 1UQUA 4H0NA 2Q4DA 5BOSB 4MUAA 3JZFA 5IYZB 3IXQA 1UMKA 2CLFB 2WG0A 4J4HA 4E30A 3UJCA 4JQSA 4V2UA 4Q4HA 4KBYA 3SFZA 1YAHA 4KZKA 1PJZA 1AS2A 1ZD5A 1YNSA 5A0VA 4KK3A 2VF8A 3ENNA 4GQBA 1T2DA 3IP9A 4BBZA 1J06A 2F3PA 4R84A 1ODKA 3FPSA 4WFQA 1WQ3A 4X6XA 3GVXA 4NAHA 5JCJD 2MSLA 2FZEA 4J1TC 1AZLA 2R4TA 1N5LA 4U63A 3QUAA 4XGIA 5DYNA 3UATA 4EB6A 3SQXA 1OC4A 4PPFA 4TPKA 4EKNB 2FG7C 1KORA 3EXEA 3G49A 4RDCA 4YP0A 3WE7A 3U5ZB 1IM2A 3PWZA 4EFKA 5BUQA 1YKFA 3QQPA 4MV6A 3R5FA 3RVNA 1U81A 3W4KA 1G6Q1 3R3YA 4H1HA 5K3CA 3R4CA 5B1SA 4U7PB 4BAZA 5F21A 4IUDS 4ZOLA 5KTYA 1BQEA 4BLPA 3WGIA 1I7NA 1QBGA 3F5FA 2H2FA 2A1UB 3HVIA 3EDCA 3P5BA 1E58A 4CTJA 4JEIA 2ZYWX 3PIDA 3FSJX 2Q27A 1KQGA 3HXOA 2FUKA 1XVTA 2CJWA 1XDZA 4RTKA 3K4PA 4X20B 3DAPA 1EFHA 2Q3HA 4RMGA 5DI3A 1UXOA 1Q2XA 4RTNA 1JQBA 1DC4A 5CXQA 1X15A 2NUPA 1HLPA 1T36B 4OQ4A 4BKUA 1LV7A 2EG9A 5BNWA 4Q9KA 5HWSA 2D4HA 4UTRA 1M2OA 1S2DA 3KQWA 2GF9A 4C5BA 5C7IO 1E3MA 1QWSA 3I2JA 4ZD6A 4D9GA 2YV1A 3KT3A 3C74A 3PQ4A 1N9KA 4ND1A 3AY3A 3AEZA 2H4HA 2VTVA 1GUZA 5KTKA 2OAGA 4ZWNA 2YNMD 5EP3A 4CCYA 5LIPA 2PUCA 1JEOA 4JUCA 1U2ZA 1DWPA 1A9PA 3K0FA 3PT9A 2P4UA 3Q87B 4OG2A 1JWBB 4H6VA 4L28A 3VM6A 2E4XA 2I1QA 3IBYA 3I6QA 4XDZA 3GZTB 3EOZA 1YVRA 3L6DA 4FEYA 2Q3DA 4I9NA 4CKWB 4CEHA 1JP7A 4V03A 3PEYA 1RKUA 2JH9A 2BELA 4KUHA 2D7JA 3DW1X 1U7DA 1UJCA 1XTRA 2YZ2A 1PKXA 2VP9A 1B42A 3JVDA 4OBXA 1QZZA 3QY9A 1AHHA 2G67A 3HJRA 3PFKA 3U4QB 4DADA 3F1LA 1T8PA 3H8SA 4MV1A 1R0RE 4R2LA 2I4NA 2Z30A 4OCZA 5K0NA 5A6VA 4F6RB 2P9JA 4JI3B 1Z45A 4FM9A 2HT6A 1NRXA 4HTAA 2A35A 1NVMB 1GZ4A 1TU0A 2R48A 3UTCA 1Q19A 3UXMA 4LF8B 4ZK2A 2W9XA 3HHEA 3PA8A 1RXWA 3HZOA 1YHYA 2XE7A 3NGLA 1Q21A 1U9IC 2IF0A 4I4IA 4OXQA 4I5GA 2NU7B 3Q9UA 3Q98A 4XWGA 4DM4A 5J5AA 1QYRA 4O2AA 4XE5A 1EUZA 3KPYA 1QDUA 2PR7A 4O02B 3ETJA 4PYOA 1AQIA 1FFCA 1G2PA 5D5HA 5DVZA 3E5RA 3ZWPA 3M4YA 2W93A 3ELWA 3N39C 3P0JA 2FZVA 2Q3CA 1PLLA 3AF5A 2P62A 2QXYA 1JEEA 1OX5A 3AH8A 3T9AA 3V9AA 3AF0A 3WJ1A 2GJAA 3F1KA 2HF8A 4MPRA 1PZXA 2JFXA 3G02A 3G2IA 3KSZO 3PWSA 4QYIB 4CR7A 4ZOQI 4H7KA 4J3JA 4RHFA 5C1OA 5DNYB 1PHRA 3V2HA 1Z4QA 1L4FA 2IDKA 3T4XA 1Q3HA 1QP4A 1XLWA 2OKGA 5SZKB 3FW1A 1CR6A 1QTIA 3GARA 4QE3A 4KE9A 3HEMA 3UKJA 1E4EA 4ZALA 3WDMA 4WGFA 4CWAA 3JQ9C 1DAIA 1XWWA 3CNOA 1W2HA 2CXQA 4L0MA 2SKEA 4CU5A 1NW6A 4LBVA 4CMIB 5LNK1 1ZD4A 1QIDA 4NZPA 3ME5A 1PT6A 1NZFA 1PQUA 3H1EA 4JQZA 1LLQA 3NH9A 2IKSA 2B69A 5DNDA 2AFVA 3EYAA 1OXMA 1CVIA 1IQUA 3MSXA 4WESA 5CR9A 4RACA 3TUZC 3SVTA 4ZI5A 3FWHA 3X43A 1LBHA 4AI6A 2EFDB 1Z2CA 4UHKA 1X1QA 3RHFA 4DJEC 5L3QB 3VJMA 1XP5A 1B4DA 2HWYA 3E35A 5L3VA 1YZQA 4YALA 1L4YA 3TLBA 2FPUA 2WUGA 3WNVA 3FYDA 3JAKA 4JP8A 2PFKA 4MS4A 5JRDS 4TSKA 16PKA 4RLQA 1DU4A 5LYYA 1YU9A 1FVFA 3IAM6 2Z58A 4WESB 1ZPDA 4RADA 1N0UA 4IQ0A 1NI4B 2C07A 2Q5OA 2BTQB 3SG0A 1FFDA 3AL3A 4BMVA 1UQRA 2RGNA 3PFFA 4OV6B 5E9WA 3OQHA 2F9FA 1D5CA 2Z9DA 4MLPA 4BNTA 4WDRA 1N6LA 2ZSJA 5G0TA 2ANCA 5HFJA 5DCWA 2VTKA 5COAA 1PJBA 4NH0A 1PW5A 2XB6A 2C57A 3MB8A 1P2DA 1VIYA 3R77A 2XITA 4R54A 3RJZA 3RSSA 3TRHA 3EMKA 1JZSA 1NBAA 3PQ8A 1AF4A 3ZU4A 1OZFA 3U2QA 5DX1A 3W6NA 3WL8A 2B61A 4ATNA 3PQ6A 3NCHA 2ZIFA 1P4AA 2EJBA 4B8YA 1QFJA 5ALOA 2TSYB 3I62A 1GA6A 2CWWA 5FFFA 3SBOA 1XLTA 1MIOA 1QVZA 2C4KA 1E3SA 1P1BA 1UJ4A 1Y4ZA 3CPHA 3IDFA 4PLYA 4AP6A 1P4GA 2B5VA 2ISQA 2FP3A 5EXSA 5FXMA 4Y1RA 2HPZA 5BMVB 3KT8A 5CFLA 4K9DA 3WRYC 3UOGA 2QDKA 4PLFA 4C6TA 4HCJA 1WB9A 4C4ZA 4N6NA 4IVPA 1R6BX 3EISA 3MUFA 3QM1A 4J2OA 3SR3A 4YR7A 4M60A 4Q15A 2ANBA 3RREA 1L5QA 3TL2A 1CB0A 1JI3A 5AMXA 2HA4A 4AIIA 5KTNA 1ECCA 1F9EA 1RWQA 4N5DA 3W79A 1XLVA 1FYWA 1M2KA 3D2AA 1OPRA 1J09A 3LGAA 4YJ3F 5FTKA 1O2DA 1GIAA 2MYUA 3DTVA 1YCDA 2XDQA 7YASA 3Q10A 1AO0A 4TMTA 1QPZA 2M98A 3RB8A 1LI4A 3ZE6A 2JGEA 3V55A 2P6MA 5LB4A 3RSZA 1PVOA 2HBQA 5WRFA 3ZLVA 3PC7A 3OBBA 5SZHB 4Q1FA 4YRMA 2PANA 4PBTA 4QDOA 4UPVA 1X7ZA 4M1TA 2BH2A 4QFCA 1QVRA 2B1QA 3GEGA 4WE3A 2Q99A 5C7YA 3ZIDA 1P2BA 3HJGA 3CN9A 5C34B 4MOWA 3KUDA 3ESCA 5H8WA 4X1KA 4Z5XA 2GHIA 1O08A 1YK0A 4G63A 3BMCA 4M38A 4F7WA 1T8YA 1JFLA 1K0FA 1YR1A 1E89A 4WOKA 4G37A 4BECA 4DGSA 1WZ2A 4ZYUA 4ZZ1A 4LBWA 1BROA 4EG0A 1E2GA 3A9VA 4DQDA 1KI2A 2BMAA 3MINB 2GBIA 4UUQA 5ILGA 3MRVA 3SBDA 4F3CA 1IDN1 2VRCA 1S8AA 2UYOA 2WLTA 2XOEA 1Z2OX 4IUYA 3N5CA 2QZ4A 1EP2B 1Y7TA 1VHJA 3E0XA 4CM6A 1VBNA 3G8AA 5FP0A 3GAZA 1CQJA 3E53A 4JOCA 2B7BA 2IW3A 4TT3D 3C4JA 4KQGA 4DA0A 4QATA 3GCGA 4BFWA 3ANTA 3B1JA 1S0UA 5AJTA 1TGVA 4RQAA 5GOTA 1ENZA 5JLAA 5DJ5A 4OF4A 3CS3A 3LUBA 1YDEA 1VA5A 2QSYA 3MW8A 4NMWA 4TUYB 1YGYA 1Y1TA 3L7KA 1UWVA 4OTZA 4DDVA 1CFZA 4M83A 4DW8A 3F46A 4X97A 4YT8A 2P0YA 1RVDA 2I29A 5LWQA 4TN1A 2NVUB 3J81k 1FNSA 1QE5A 1MO6A 1RRPA 4N82A 2QLFA 3BT7A 2O3JA 5B2FA 3GJXC 1QQ6A 3GHHA 2XKBA 2C3YA 4OAPA 2ODAA 3NJRA 1NXPA 1WF3A 5BQ5A 1AGNA 3WLOA 3PDUA 1AM4D 2ONCA 5FR2A 1A9RA 4LOHA 1X74A 4BMOB 4NK5A 4Q1DA 5TLSA 1OR8A 4GR4A 3G2HA 4UJ3A 1N2IA 4WBXC 1JIXA 1R18A 2H00A 5E7IA 4EUNA 3IVCA 2I7TA 1DRJA 3CLKA 4NFSA 2OV1A 2VIIA 3VXKA 2RK3A 5DTIA 3K4HA 1PZFA 4O0MA 3TX6A 4BP8A 2AF4C 4X1YB 1L7BA 4HYEA 3WKAA 3NALA 4QXPA 1AV6A 3BZWA 3ELDA 4YQYA 3SEAA 4DIDA 3KJNA 4YQEA 3M8KA 1P0MA 2NZ2A 2PWZA 3FY4A 3QVUA 1PS8A 1SH7A 3V4RA 5IC4A 5INTA 3SC2B 1QP0A 1QFMA 1RQXA 1ZVMA 2OO5C 4IEIA 5IJXA 2PXCA 5EHQA 1C29B 4UPDA 3MT0A 4DSZA 1H2EA 1OYVA 1U0LA 3WGNA 1Q0LA 2AE2A 1U11A 4P7FA 4YUVA 2ZZMA 3B1VA 5FD8A 1KERA 2MT9A 4JJGA 1NNSA 5E2BA 3RH0A 1K97A 4RIEA 3GY0A 4FZVA 4D3YA 1QTQA 3A6PC 4UVEA 1FTWA 3NTRA 1X7DA 5C37A 2CKMA 4C0AC 3DTVB 1U99A 2YYSA 4MIYA 1SN7A 4OP2A 4M89A 3JZIA 4QG7A 2VF4X 4PZYA 3V8NA 2JJ8A 2OR3A 4FOTA 4IWYA 1A5AB 2P9ZA 3GAFA 2AJCA 3M4ZA 1P91A 2L82A 3PU6A 4MV5A 5EE9A 2C9YA 3WO1A 4HAUA 4Z7QB 3DMGA 3A1VA 3B3QA 3H87A 3L0PA 4I66A 2A4KA 4WASA 1E3DA 4D80A 4RUKA 4DPKA 4WV3A 1JR3A 2DWUA 3NEYA 3WLKX 4RY0A 9ATCA 4MW7A 4DKJA 4S1VA 3NI2A 2QNIA 1P7VA 3A6LA 4UTNA 3K9FC 3HPRA 1XA3A 3NHLA 1XK7A 5F7OA 1EFAA 1GPLA 1A1VA 3DTTA 4Y98A 3ZDEA 1N7GA 4G1MB 1ZD1A 1Q0SA 3GJ0A 4CIYA 4YAUA 4ZCQA 3ZEIA 2WAOA 5BYAA 2C4VA 3B20A 2CL7X 2QR2A 1V35A 5DO9A 1J8FA 1MO2A 4NBVA 2X9QA 4BRZA 1YRWA 3H9QA 1UMBB 3AW9A 5JQGB 2RHHA 3CLTC 3E5MA 5CEJA 1DNPA 1RQPA 1B26A 1NRIA 1AVTA 2B8JA 3CKKA 1I36A 2WFAA 2XDWA 1II9A 1A71A 3HXPA 2GEFA 4MMXB 3IUEA 2JRCA 2O2YA 3MTIA 4Y1EA 2WJAA 1KOLA 3VUFA 2CDCA 2VQSA 4JP2A 2I55A 1FRNA 4CODB 3X1WA 2Y4NA 4UAGA 2AMVA 1X8LA 1DIOB 4M3NA 3VFDA 5BNZA 1K4YA 5EP2A 2V54A 4UBKA 5KQSA 3LT1A 1KRHA 3EIOA 2XF2A 3NYWA 2ENUA 4EA9A 3VZPA 5JU6A 3BE4A 2HHJA 1IMJA 3BDIA 3MOGA 4X20A 5DN6A 5KSWB 4XYMA 3ESYA 1V6CA 1PO7A 4DXDA 3OE5A 1SR8A 4TVKA 2PUDA 1Q1GA 1ZXLA 1N2CA 2EW1A 3COYA 3U7GA 2JIMA 1SIWA 1U8AA 3V97A 5HZHA 3FVQA 1VHQA 2OB2A 3LF1A 4HTFB 4P3KA 2WD7A 3M6XA 3QU7A 4HXFB 2IYYA 5I9LA 3QSYA 4P0QB 4KYVA 1SU7A 5FOSA 5E4JA 3VHRA 4QQNA 1EHYA 1NY6A 3ZI4A 3ZGOA 1TU3A 3IIEA 5KDOA 1TUBB 1CQIB 2A0WA 2EERA 2GPWA 2UUPA 4F85A 2C9ZA 1OXKB 2FEMA 3IUYA 4G5QA 3UV3A 1ODJA 4BGEA 4WUTA 3R6DA 2PEZA 3OH8A 1EWYA 3L0ZA 2B35A 4M55A 4LRTB 3U4AA 3W8FA 3OJFA 5JZSA 2QMZA 3OPYI 1EVZA 2FSVC 3DCIA 3ZU6A 3ZWVA 3O5AA 4YGYA 5FBHA 1F2DA 3OJLA 5J3JA 3QLTA 1PZGA 4X85A 2HJGA 1T9ZA 2BEVB 2I65A 2ZIWB 3EF0A 1AT1A 4ODIA 2YW9A 3HCPA 3ZVLA 2I2XB 4B2YA 4EDHA 1RI5A 3AG6A 4BE4A 4RC9A 1TL7C 2HJSA 3AW8A 4LRXA 3O9ZA 3F5QA 2TECE 2ZUUA 5IYZA 1WIWA 2RONA 3HKEA 2QRHA 1VBMA 1WP9A 1FC0A 1XD8A 3BE8A 3IMKA 1UZMA 4BB0A 3DFMA 3TBHA 3A6FA 3IKLA 3OAAD 3UUWA 1ND5A 1Z5NA 3INTA 3LTEA 4KC0A 3U3XA 3SIPA 2CLMB 4QU8A 5H1YA 4CQMD 1MDBA 3EFOB 1QVAA 4LRWA 1V8FA 2IU4A 1Q92A 2J31A 1L1FA 4A0GA 4ZO9A 1H4SA 4M87A 5HUJA 1TT7A 4D2IA 4IICA 3MRSA 1MH9A 3QV2A 4F5EA 3IUBA 2GT1A 1QP7A 1GJRA 2FR8A 5BNTA 1Q2UA 3MUEA 3C8ZA 3TAUA 3TQCA 1Z2DA 1GNRA 2O2GA 3HSYA 4IY1A 3RJ5A 5G1OA 5B4VA 4UU7A 3E48A 1T25A 2PSEA 3HA7A 4CL8A 2MYTA 5M5BA 1ESDA 1D09A 3SJAA 4BZXA 5BV1A 3VR2A 1TT5A 1M66A 2OK7A 2H1LA 3C3BA 3QXXA 1MPTA 2AUTA 621PA 4P31A 3FOFC 1GPAA 3L43A 2FPMA 5BP7A 3WA7A 3CVWA 4OYLA 5EHGA 3UN1A 1T9AA 4L16A 1CVLA 2EKDA 4FZ5A 4LDJA 4EJSB 4ZDWA 3DYBA 1IU9A 1A88A 1TFRA 5LIRA 2XUZA 4D8YA 4EF5A 1JQ5A 2C5EA 1G291 1LK7A 2ZSHA 3CVUA 1MOPA 3UGQA 5TPZA 3RYCA 1I2DA 5ECWA 4DMCA 1M2FA 1YCHA 3A31A 4QC2A 4JDPA 4NE7A 5CPBA 1WUJS 1WV1A 1E1LA 3OFJA 3KYJB 3GVIA 1L7MA 2FXVA 4FD3A 1H2FA 2I7CA 4KXLA 1T0BA 1T2CA 3GYBA 2EARA 4M86A 4QFDA 3RGGA 1Z88A 2B20A 1T1GA 3GOQA 3AG5A 4DT1A 2R0QC 4KQIA 3BJIC 4DIBA 1O94A 4DKXA 1QH0A 5KHAA 3F3MA 3MPOA 4H18A 3ZIAA 2W2OA 3BGSA 4W5TA 1GPH1 1HG0A 3JQBC 4JY7A 4LYJA 1KI4A 4XGNA 5JAIA 4J43A 4Q4AB 3TUJC 3A28A 3GP3A 1WZUA 2Q1XA 4BV9A 1MHPA 2WU0A 3JTEA 1UEXC 5H7XA 4PTLA 2A9PA 3KXIA 1XMPA 4WN9A 2ACVA 2CBXA 1YRQA 3HJAA 4Q1AA 4IHAA 5F5LA 1TTHA 5A5DA 4TL7A 3E27A 3AZOA 3H1PA 3LDAA 3N2NA 3NMUF 4A36A 2WM9B 3HA5A 1TUEA 2GS9A 2DWPA 1YULA 3L6EA 1XWFA 4LTNA 4QOHA 2GCOA 1O95D 2WTEA 2ZR9A 3PDCA 1K98A 3N74A 1GWNA 1U7TA 2R5WA 1DIHA 3JYQA 2BFFA 3MS7A 4YPOA 3BERA 4RTLA 3A25A 2PN1A 2AC4A 4P7KA 1ZJZA 4RZIA 1IB0A 2X0DA 2C5BA 2XTJA 4MSUA 5JY6A 2EDAA 3P27A 4FGSA 3EVTA 3ZGYA 5DMHA 2AD1A 4J4TA 4KRXA 3DXZA 2PX2A 3IQHX 2HCRA 1VLQA 1IUPA 5IARA 5I8WA 4CKXA 2MMGA 3QOXA 1Y5IA 3C39A 1AURA 4Q3LA 2CCJA 1PTKA 3AV3A 4JVNA 3E3OA 3ZR4B 1GG8A 2IEBA 4OJNA 4PIPA 1G8PA 1W30A 2BHSA 4FKZA 2YY7A 3TECE 3U7HB 4RA9A 2GZDA 1MABA 2R8BA 4ZHQB 2TMDA 1EE1A 5AI9A 3SC3A 4B6EA 1EGQA 4OAQA 1L7AA 1QAMA 2I1WA 4M9RA 2GWRA 3MJEA 4UHDA 3KC2A 1H1TA 2RFLA 4L3WA 5FX2A 2PKQO 1NNUA 3ECCA 4RZSA 2GAAA 2IV2X 4BRWA 1USKA 3IO5A 1NX6A 1SKUA 5CB4B 3TTTA 2W2MA 3M3HA 3UH0A 2ZRJA 3IPAA 1TVEA 1JEJA 4ZCSA 5C9ZA 2RKBA 3ND7A 2Y1LA 3SXPA 4TZKA 5F7XA 2GMWA 5EJAA 4PVCA 3FTEA 3NBUA 4N5HX 2Q3LA 2VXOA 1NVGA 4UTXA 4I19A 3M5DA 4N7MA 3UIEA 4B6SA 2ABWA 3MTGA 5BN1A 3Q3IA 4UDYX 4YC7A 4A73A 3EXG2 1S8NA 4G1EB 1NVBA 3DZIA 3HDHA 3C16C 3AEUA 4TYPA 5D3MB 3TIIA 4B3DA 3M4JA 4MKRA 3ZHRA 1R4NB 4XLLA 4CT4B 3U56A 3SDZA 3NHRA 2HQ1A 4M0LA 3Q2IA 1NRJB 3H2ZA 1WVGA 4KN9S 4Q3AA 1KRWA 2VA8A 4NS4A 4AZ0A 1C8BA 5AUOB 5BQXA 3L0CA 4BKOA 5HJ7A 4IXWA 3ZBTA 4OXXA 3TTWA 3R0IA 3UKDA 3R8CA 3U4QA 1QUEA 2O7RA 2B4AA 1BRMA 2QM3A 3NXKA 1F0PA 4YK7A 1UIRA 3A1CA 4I99A 2LD4A 1V9CA 2A33A 4YMTA 2F9LA 4WN9B 1NASA 2YR0A 3O73A 4QHYA 3BEDA 5B37A 5KI6A 2VLIA 3U4MA 1QOPB 1X80A 3D4PA 4KVFA 1DG1G 2FW7A 3ROEA 4D0SA 2NX2A 3WGHA 3RHSA 4A2PA 5B12A 3PE6A 4KDEA 2PYIA 4IXTA 2WHRA 3C41J 1A7KA 1FU4A 2D0PB 5CBKA 1XZQA 3P20A 4IS2A 3DOCA 3ORFA 4EHDA 1QHHB 1GPBA 4UPEA 3UAVA 2IOHA 5DE3A 3PJGA 1KF0A 1BJRE 1MB0A 2FOLA 3P7MA 1SXJE 4GGMX 1L8LA 2ZRAA 3HLYA 3E4CA 4QQRA 1OH7A 1Q3TA 3K0EA 3FCOA 3K6KA 4YRSA 1SOVA 4RVOA 3A36A 2GCEA 3BD6A 5CFMA 4WJZA 4C4YA 5HM8A 1Z5WA 1FP6A 2NSLA 2FPIA 4X00A 3WHLA 3F8WA 5L4SA 2AS0A 1NKVA 4BX8A 1JFRA 1SUPA 2R6DA 1SKYB 4TKVA 2CD7A 4FJ0A 1D07A 2A92A 4DS3A 5ECGC 4BFTA 4QA9A 4MZDA 4C4SA 3DL2A 2GK7A 2G8LA 4UXHA 1CZRA 2QDXA 2B4YA 3WRXA 2AV6A 2AHRA 2H8GA 2NAPA 1HYEA 4FDLA 2BKVA 2CMKA 1U8CB 2HAEA 5BR7A 3U9SA 4QVIA 3QVSA 1N0VC 2WU4A 3KALA 3LLUA 1X3SA 3ROTA 1SWWA 3DV0A 3OT5A 4D6PA 2R1VA 3GLIB 1O9GA 4TMXA 4JIMA 3DNMA 5JMWA 2CK3D 4D1YA 1JG2A 1V41E 5IBPA 1CUCA 1D6NA 3ZYZA 5AW0A 4QJ4A 5EJ8A 1EDBA 1E1CA 4JLJA 4KSCA 4WLVA 5D7BA 4BNLA 1LU9A 3KEGA 1KMQA 3QXSA 2ZT6A 4G9GA 3BVPA 1TTPB 4L07A 5FFMA 2PPLA 3D6JA 4YRGA 5AVQA 3PDHA 2Y68A 4CGZA 2VJDA 2YFYA 1OH6A 3HY6A 1QYWA 5G2OA 2QUKA 4K1XA 4KVGA 4ZCRA 3FNIA 3WGVA 3K9LA 1SQSA 4XRRA 2XMRA 2HN9A 2B78A 1IATA 3WJAA 2C7BA 2BZ1A 5CB4A 4KHZA 3VSAA 4KRGA 1M1NA 1F20A 2Q2VA 3O7MA 2C61A 1SELA 1E9BA 2G06A 4W99A 2JIQA 2KSQA 4LNUA 4MMYB 1ABFA 2F43B 4DMHA 1E8MA 3F47A 4EAAA 1PQWA 3I53A 2CVHA 5JCJA 1DXQA 4HXYA 3RODA 3RTGA 3O4FA 4AWBA 2HSEA 2X4DA 4RQUA 2I6XA 2H2GA 3KLNA 2QVGA 4ZJUA 3R6TA 5EIBC 4U1RA 1QK5A 3EY9A 2BL4A 3AVQA 1ISRA 1Y8QA 1E9EA 1PWHA 2WJZB 4MYDA 4CLRB 5LMUB 3ETGA 3I45A 1X1RA 4O2LA 4EY6A 4RCYA 1N7IA 5L7WA 2EX1A 4KXXA 1JYSA 1K3FA 1NVKA 2C8JA 1SCDA 1G59A 1VMAA 2ZJYA 2JGRA 1ODLA 3DO5A 1JHOA 1R0CA 4TV9B 2QWXA 3OZIA 4NNJA 1U8TA 4GYJA 4Z2YA 3KQKA 3VYSB 4YCDA 4EYKA 3F9CA 2O05A 4HDKA 1H3EA 1EB8A 3R2JA 4Y9TA 5F12A 3HKDB 5ER9A 2EZUA 3H6HA 3Q41A 4NARA 3WGMA 4D02A 3UT6A 1ZK4A 4K9OA 4MICA 3IHWA 1ITZA 3LKBA 2YRXA 1ZBQA 3PI7A 2XLBA 2AHOA 2NSDA 4P35A 1MENA 4QUGA 4WOJA 5FL3A 2Z2XA 4W5RA 4RVCA 1XKXA 3QNMA 4DDKA 3BMNA 4HN4B 4G1UC 3C5CA 1H94A 3TEMA 3PRHA 3L79A 4UFPA 5B3JA 4EQZA 2WWRA 4E5PA 1SWVA 3DWGA 4AKGA 5EIFA 4TLCA 5EHXA 4EG4A 1L2TA 4XB1A 4EUEA 3TZKA 4F3TA 1LKZA 4NENB 5FYDA 3B1XA 1X7GA 3CNBA 1Y8AA 3K6RA 1P0FA 2AOVA 3JW8A 4RZ2A 2C4WA 1BS1A 1QFXA 1RJGA 3SDSA 5CM2Z 1XA4A 4UTZA 4IIYA 4C20A 3MZ0A 1BMQA 2QLTA 1YD7A 2GFHA 2VHJA 3N2KB 4ME6A 1JWAB 4RDHA 5HOQA 3RUAA 3CGWA 2G9ZA 1GCUA 1OJLA 1XRRA 5T64A 3IJ5A 3LECA 4O1HA 2OGWA 1SMKA 3PC8A 3PKJA 1NRWA 4RESA 4DBVO 1Z6GA 2O2ZA 5G41A 3I01M 1NV8A 3HJBA 1TCAA 4FDVA 3VSCA 4CIWA 5I7AA 1NQWA 1ZOPA 2HRRA 3H65A 5C7LO 1X6VA 1O97C 2CEKA 2FN4A 3IVXA 3ONDA 3TTYA 2Z1NA 5DGDA 1P6UA 1WKBA 2IL1A 2X3FA 5DSTA 1H4VB 5F4ZA 3UCXA 2HEIA 4A2WA 1DKPA 2WA1A 5CLLA 4QD3A 2PLWA 4IIEA 1IBRA 1PG5A 3V42A 3L8GA 4OSPA 2F1RA