5C32A

Constitutively active sin recombinase cataltyic domain - i100t
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
118
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPNPLLDKFMKDLIIQILAMVSEQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Putative transposon Tn552 DNA-invertase bin3
total genus 36
structure length 118
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c32A00
5C34B 3GUVA 3BVPA 3PKZA 2R0QC 5C35A 2MHCA 3G13A 3UJ3X 3ILXA 1GHTA 2GM4A 1ZR2A 2GM5A 1GDTA 3LHKA 5C32A 2RSLA 1HX7A 1ZR4A 4BQQA 5C31A 3LHFA
chains in the Genus database with same CATH superfamily
3LQFA 2BKUA 2P1RA 4NU0A 4G9EA 4BFLA 2JW5A 3UMMA 3SPXA 1K27A 2Z3WA 4YI5A 1W36B 3EASA 4MV8A 3V2IA 2HK9A 2C03A 3OECA 2HV9A 2ZB3A 3DPIA 5KOJA 3VJRA 5GGYA 1RWNA 2KJQA 1U0FA 3OOEA 3TOVA 3G2JA 2VT6A 2X15A 1I2AA 4RUKA 2QM8A 1YE8A 5FNVB 1R0ZA 1K6XA 2GYWA 1H4TA 3O6VA 3O8QA 3K9HA 4FD2A 3BQMB 3RHTA 4PS0A 3WKDA 2BFWA 2WABA 4EMSA 1OV4A 4TVBA 3NR2A 4WK0B 3N1UA 4YRGA 4EB6A 1J09A 4G0NA 1UXOA 1F0YA 4I46A 1CEQA 4NMXB 2WRZA 3H75A 4X8LA 1OF1A 2XT9A 3ED5A 4KTVE 4TWAA 4RMJA 1OXTA 3T7AA 4A73A 1BDHA 1WKCA 1FFBA 1Z73A 3ETNA 4F38A 4GDFA 5U4QA 1R0YA 4X20A 2WNIA 4ZZ3A 1HC7A 3ZU5A 1AD2A 2ZT6A 1ECJA 2VWGA 1YRYE 4JB0A 4I81A 5CGQB 5IUNC 2CNWA 2FQ1A 3PFNA 3VPAA 4BP9A 2DXIA 2XVAA 1E8MA 3FSRA 2QK4A 1F38A 2A88A 3SJUA 3RJ9A 3GO4A 3IIEA 1J8VA 4PBTA 3V42A 4JLMA 3QEMA 4FWBA 4CQNA 1QC5B 5DCYA 2ZRKA 1JHYA 2GCEA 3K53A 3N87A 4PZYA 1XJWA 2VNHA 2Z8YA 1JB9A 1K6JA 3SSAA 2Q2VA 2I4OA 4BE4A 4EKNB 2X9NA 5IHPA 4W5NA 1TB4A 3L43A 4Y2RA 3ZI0A 1JDSA 5AJTA 4DLSA 3KSAC 2J33A 3F7TA 3OAAD 4RK7A 1IY8A 5BN4B 5BW8A 1EI9A 3SKXA 4OL0A 3U39A 4S35A 1NJ1A 2GZ2A 4NAHA 2R6ZA 2NPOA 1CJSA 3GJZA 3S7TA 4RZUA 3FPBA 1DHRA 4Z4EA 4L9WA 3ASZA 3KL4A 3EWSA 3GUYA 5BN5A 1OXSC 2XE7A 1XA0A 4GPZA 4M49A 1FLAA 4GBJA 3ZD7A 2VHCA 2W2KB 4UUNA 3SJ7A 4BMVA 4D4MA 1K8QA 2EYUA 4R0VA 5CITA 1SHTX 1W19A 3KPJA 2HU2A 3ZBPA 2BN4A 3KVOA 5IH3A 3KXDA 1P0IA 3SD7A 2AUNA 2Q4EA 3R4CA 4MW1A 3OT4A 3SXJA 3HDGA 4YLGA 1U6JA 1AGYA 1I7LA 4HTFB 2ODNA 3FHCB 5TR9A 4LYGA 1KEZA 3O2NA 3P2OA 2WE8A 2PWPA 3GLRA 3NNDA 2GESA 5TDHA 3JAKB 3QBEA 4D6YA 1SUBA 4LCEA 2BGGA 4M9ZA 5JCJA 4UVGA 1GQ2A 4M2LA 2WAXA 3PNVA 3CVJA 3OIYA 5DM70 1YB5A 1EE1A 1IMOA 3IESA 4HLUA 2IYVA 1U3CA 1TF7A 1WU8A 1X7WA 3Q7PA 1DKNA 1CERA 4LPSA 3EBLA 1EX1A 2Y27A 2ETVA 1N32B 4RZSA 1D1PA 2G5TA 3TG2A 1E7RA 1GQQA 2GRAA 1N2CE 3N8KA 4NBSA 4CUZA 3I1YA 1DB3A 3HVHA 1NZDA 4IX1A 5AIBA 5LD2B 5D3QA 2M6SA 1IQPA 4LNAA 1OLXB 2F8SA 3IH5A 1X1DA 5K99A 3VH1A 2R5FA 3FOAA 4R6XA 1AF4A 621PA 2GRJA 2HJ9A 3ST7A 4DCMA 1UBLS 4NR0A 4WOPA 4HDKB 3OD5A 4P4SA 4KUHA 3ZIAD 2DU8A 2PAAA 2BGWA 1US8A 2VQDA 3FWNA 1LPBB 4GBGA 4EZIA 4IMRA 4BXOA 1IXYA 3L0DA 4FU0A 3DBVO 4JIGA 2RD2A 2EZ4A 2L69A 1TDJA 1ZU5A 3HSSA 3LO5A 5EZ5A 3TQSA 2ORWA 2AT1A 1J25A 5GWXA 3M49A 4YT2A 1HBJA 3I9FA 2XGSA 3H5VA 1YI8A 4JLKA 1VIVA 1EZZA 4UREA 4CEHA 3LQ1A 2G82A 1NBAA 4IV0A 2ZVPX 3I0NA 5LLDA 3U7QA 2BR5A 1BEEA 2FFHA 3TXAA 4FBGA 4G5GA 2QG6A 3RC3A 1ZD8A 5JVDB 4DUGD 1B3BA 2UZ0A 4G4JA 3VR3D 4LHWA 1KMIY 3T7KA 1OD6A 2E87A 5F21A 5GV8A 2OB2A 3P5SA 3VI3B 4D3XA 4DQVA 3T0IA 5FWNA 3IAXA 5FUBA 1CNEA 1T0JB 3TIFA 3L06A 4S1OA 4KXLA 5JANA 3KPUA 5FJJA 5IN4A 3B1WA 2DR0A 3PU6A 4X7MA 4ZAWA 3ZV6A 4ECAA 3BRCA 4YDQA 5ADVA 1C8LA 4OFBA 3D4IA 2JGEA 3IA7A 4PCAA 1T2FA 1O94A 3WIUA 4DCPA 3P4XA 3L6EA 5DLYA 3OFVA 1G20A 1KO7A 2H00A 2C92A 1C3OA 4L57A 4Q82A 5H59A 3PD7A 4G86A 1KAMA 4B7AA 2QTAA 2RI6A 1DJOA 1O97C 3OWXA 1SU6A 5AM2A 3UPUA 4WLOA 3G49A 2RC6A 3I4LA 2JI9A 2DTXA 1MOQA 1H93A 3A6ZA 3FYUC 3K96A 3NWPA 4JL8A 4Y2UA 5BP7A 3A9TA 1DWOA 1N2HA 1NLMA 1SUEA 3NAMA 3EGXA 3UY4A 1R9GA 4Y7CA 4M9UA 2LV8A 4RL6A 5A2QA 1B74A 4Y6GB 2ZB8A 5EZYF 4M0CA 4MO9A 1T0HB 1G4UR 2YJZA 1H8HD 2YC4C 3KR9A 4P53A 1VQ1A 4RSGA 2A2ZA 1E6EA 1VJ5A 4PC2A 2HBZA 2N3ZA 3HG7A 4RM2A 4X3PA 4QRIA 5AJZA 3E8XA 4ZCRA 3DE1X 4Y2JA 3MTGA 2CNWD 3QX8A 2DETA 4XW2A 2FAXA 5IT9A 2PO7A 1UEIA 2A9PA 8LDHA 4D2IA 2ODAA 4BVBA 2ZJZA 1RKXA 4KE8A 5FI5A 2B82A 4GZ5A 4PLVA 3AVPA 1IBSA 1Z0KA 3FYSA 4GI7A 4ROTA 3AEQA 3L6OO 3HCAA 1KZHA 3RAPR 2WE7A 1V3TA 3TPZA 5TY0A 4Z9XA 2IPNA 3FRHA 4DDHA 3ANYB 4YUYA 1UH5A 1V7QA 2I4IA 1JECA 4LZWA 4X0EA 5C8ZA 1HLDA 4RTRA 4DUZB 4EARA 3D3WB 1N2IA 1QLJA 2JGAA 1I4OA 1V11B 2ATVA 5LMZA 1CVRA 3FVQA 3PTLA 2QVYX 4PRKA 2IXEA 5HFAA 1G8FA 4GQIA 1KOGA 4PO8A 1GTG1 4LKRA 3KWMA 4KQIA 1WSDA 3M6AA 5GM2A 4W99A 1H42A 1PFVA 1XLUA 2O2IA 3GCDA 5LIPA 2HCRA 3SZRA 4XJVA 4R8SA 3EDQA 9MHTA 5DI3A 4HWSA 1N78A 5LZ7A 4R8MA 3SHTA 5F2KA 4U2GA 3QVUA 5EJIA 2XEXA 4QSHA 4E2ZA 5J2UF 1CUBA 3K70C 2A67A 2C07A 3K1YA 1RKBA 3DE0X 3CF6R 5AM5A 4XTRA 3CEJA 3PXXA 3VAYA 1RC0A 1YHNA 1HDXA 2R8OA 4Q6WA 3RVBA 3GDFA 1LKZA 3ZGYA 4BBAA 4JWKA 1FNMA 1L5WA 3LYUA 3VZPA 1QGUB 1A9RA 2ISSD 4TL8A 2VFAA 3STVA 3ZGXA 5JMOA 2VP9A 4Q37A 4AMVA 1SQGA 3D4OA 4X41A 2BHSA 3DPUA 2PSJA 2JK0A 4CPDA 1Z8FA 2PA3A 1V1JA 3CZQA 1K8XB 3LPCA 4LRQA 4AG5A 5I7SA 3QI2A 1LDYA 3OQPA 4HK4A 4B7UA 5CLQA 5EXDA 3WL5A 1ZM3A 5EESA 5TF0A 3LPLA 3NTQA 3W2EA 4XYBA 4Y1FA 3AEKA 3IUEA 1GZDA 4JX8A 2V7GA 4YJGB 1YOVA 4GC9A 1LDNA 2ECOA 1JHQA 1KU0A 4H4DA 4YWHA 1DKOA 2AWNA 2GEKA 1NFQA 5BNFA 3WZLA 1RI4A 3KQLA 3GRZA 1PR5A 4P3PA 4ZQIA 4YTEA 3LGAA 1DOZA 4G5FA 4PSAA 4F5YA 1XLTA 2PRYA 3B12A 1LI4A 4OYYA 1DAIA 4AVYA 4LBYA 2NUAA 5DYGA 4R2MA 3NIFB 3PZBA 4B8WA 3K6RA 4BO2A 4Z3OA 2LBPA 4R1QA 1NRWA 3B1FA 1E89A 1NULA 4MP3A 1C2TA 1UBHS 2Q07A 2IF2A 1UEJA 2C3YA 5CA0B 1E66A 5E6UB 3FPFA 2BC9A 4XEHA 4WNAB 4C0AC 4CCAA 1PHPA 2AFRA 3OF3A 4DV1B 1ZNZA 4A6PA 1P31A 3N2NA 3ZI7A 1HWYA 2I4TA 1Q16A 4V0RA 5LMCA 3SDSA 1SA0B 3L7YA 7REQB 3HL0A 2CDNA 1Y6GA 3QE0A 2BR3A 4TQUS 1FW8A 4R4JA 2VKQA 3KSUA 4UM9D 5AHRA 1UPUA 4A9AA 1VLQA 3SZLA 5I4KA 2D5IA 4P58A 5KWVA 4JXXA 2H2FA 2X6RA 3DWIA 3VZRA 4UQOA 3GV0A 2AN4A 2BW0A 1DXHA 4RCVA 4C0LA 3A6JA 1M9NA 2HBYA 2GD6A 1WQ3A 3C4JA 4FYKA 2XNCA 2G5PA 3A3KA 4HFJA 3TG8A 5EHIA 3EGVA 3OIFA 5EMNA 4KSCA 5KNDD 2HSZA 2SKEA 1FRZA 3E81A 4TMVA 5L4SA 2C9MA 3SX0A 3CEAA 3O7WA 4H35A 4Y6OA 4BKUA 1U8UA 2DWQA 2ZFUA 1D5CA 4R2KA 4TYQA 5F33A 4D9MA 4HTFA 4OXYA 4O2RA 2C84A 4DBVO 3W2TA 4HR7A 3TQCA 2J5KA 2IYWA 1EQUA 3OZXA 3LT4A 3TAUA 5FWXA 2XNHA 3PSHA 1C9EA 5I8ZA 3ZWYA 2AHOA 1IAQA 1L3CA 2PV0A 4W5OA 4N8EA 1BX1A 3WGUA 3FOZA 3JYLA 2LNDA 4K26A 3LG2A 3C8DA 4JU9A 1NVMB 4JKIA 2Z2KA 2EL9A 3E4CA 2GFHA 3KYDA 4FZ5A 3NHZA 4RLFA 1Z0SA 1BROA 2I6GA 2ZBDA 4D46A 2YMMA 1TJNA 4G2NA 4OMUA 5CLFA 3LQRA 3GRPA 3H0KA 2NXWA 1JMYA 4UARA 4GS5A 3U0BA 1DCKA 2ZPTX 1PLJA 2BJWA 3N2GA 4YQYA 5EINA 4RWEA 3RBZA 2A1UA 3E23A 2IV7A 1E6WA 2WSSD 1H8HA 3TX2A 4HAYA 4BKQA 3WWCA 4MUNA 2Z6VA 4OGKA 4EG7A 3FNFA 2I2FA 1WR8A 2PGDA 2KS6A 1II8B 4QU0A 1F0NA 2QRHA 3H5RA 4MKZA 2GVZC 3G2NA 2IXFA 2NSHA 4MO2A 5HGJA 4NYIR 3ZLBA 1WUKS 1S2MA 4NBRA 3WLIA 4DIFA 1FBTA 1IEVA 1Z7WA 2O1XA 2JFOA 5CFRA 2ZRPA 5ICMA 4II2A 1T5HX 2D5AA 5JAQA 5E38A 1FX0B 1Z0DA 1P3JA 2ORIA 4B79A 4OQPA 4DSTA 3ECCA 5AR1A 4E88A 5EE3A 1N57A 3MUNA 1U2PA 2Q6TA 3ODGA 4ZVVA 1ZY2A 2C1XA 3RK4A 1R5OA 5BV7A 2W6ZA 2ZBEA 3KD3A 5DV9A 3U56A 2NTVA 1W5AA 1DTSA 1R6XA 2XOKA 4EPYA 2OXCA 2Y6VA 4G1MB 3ZV3A 1MB0A 3BZWA 4OJYA 3ZHVA 2QTTA 5KQSA 4LXXA 3WRVA 2X0NA 4BQFA 3HDTA 3GIDA 3A11A 3B9QA 4RKEA 1PKXA 3MLAA 2DWOA 1AUPA 4BLPA 1V25A 5A4KA 3CGWA 5JLJA 3DFMA 5EHZA 4N1AA 2IHUA 3C5EA 3NFRA 2PUEA 3VVBA 3FVRA 3HBMA 1L8OA 4N7RA 1RQXA 4MCAA 1NBMA 4GYJA 3GEGA 5SZJA 4R54A 4HQ0A 4KDEA 5AK0A 1SBCA 3OBIA 4B0PA 1LGYA 2WM2A 4YALA 4ZJYA 3UICA 3VPBA 3ZS9A 4O4HB 2VHTA 5FWDA 4G5XA 2HMVA 1CQZA 2J3JA 4N18A 4BNUA 5JNTA 3AUTA 3QLEA 2WZBA 3TZKA 4BLTA 1MQAA 2WB2A 5BYBA 3OLCX 1YRWA 4Q4AB 4M0EA 4OGGA 8ABPA 1X1RA 1RJ9B 3HNRA 1D1TA 3CWCA 2X6QA 1OKKD 4ZKEA 1Y8ZA 5BRJA 5WRFA 1T0BA 4CM4B 1TVKA 2W6ID 2MSWA 3O5AA 1HV8A 4EQZA 5I7FA 4QC2A 5KYUB 1GTMA 3QBTA 5FL3A 4JOCA 3A8TA 2VNIA 3JCZA 1EK1A 1SOWA 1TQ4A 1L1FA 1J5EB 1XEAA 4RF4A 3BILA 2HLDA 3D0OA 1DV1A 2AH5A 4ER3A 1E2LA 1UK9A 3O8OA 1YDWA 1QYXA 1VRWA 1YRAA 3ED1A 4FCTA 2RHGB 1LB1B 3B38A 3H2IA 2QTMA 4GNKA 4F3RA 3CKKA 3L8GA 3BJEA 5FQOA 3GLGB 1DDGA 3FETA 3OTIA 4IV5A 3WK9A 4KR3A 1NNSA 1M2VA 1JS1X 4RGQA 3HY3A 5BSRA 4B5KA 3GMIA 2O19A 5ALDA 4XARA 4JC0A 3DHYA 4Q19A 4M0UA 5A02A 4LMPA 1GSAA 5DNAA 2F43B 2QY9A 4WNCA 3I4FA 3NPMA 9ATCA 4R1UA 2WYIA 7GPBA 3NM5A 1KYTA 4ZU6X 2HDNB 4OJNA 1ZD2P 3J81A 1PZMA 3DO5A 2O2ZA 3DVSX 3HU2A 3KTDA 1ZM7A 2H5IA 4WESA 4IDFA 3ZBQA 1BFKA 3CLRC 4LYYA 3QA9A 4UU7A 3EQ9A 2XCTB 4UKDA 5LKRA 3I2YX 1LLDA 2JIMA 3CH7A 1ZH4A 3EOAI 1T5SA 5FB3A 4CM5A 2HAEA 1V1RB 3N8NA 4MUAA 4AD8A 1FSFA 3W5UA 3DDNA 5HIAA 3PRYA 2X5JO 3P9RA 1E1CA 5K8CA 3VU1A 3OUZA 4A36A 1LPOA 1X19A 3CX7A 2VBGA 4I50F 3S4YA 2O6HA 5K0GA 4DVGA 4PU0A 1XA3A 4X63A 1G6OA 1SXPA 3H1TA 4GEKA 1Q50A 1F7VA 3GPLA 5TPZD 3UJCA 1XNJA 4UC0A 4BVLA 2FMUA 1Y9DA 2YJNA 4TUYF 1U2ZA 3WBBA 4EG4A 5FEUA 3UW1A 2VPQA 2HJHA 3EIOA 2AOTA 2DLDA 3LUCA 4JLUA 5BW6B 3PITA 3HXPA 5AUOB 1JSZA 3OZTA 4JLSA 2ZXUA 2MHCA 4LHSA 3SU8A 3R0IA 5F35A 1I2CA 1T1JA 5ER6A 4KI0A 2WHRA 1RJFA 4GD3Q 3GDWA 1AA6A 3DFKA 4PO1A 5KDOA 1H2HA 3S0JA 5KU1A 1G66A 2PWBA 4OU5A 2O5CA 4KK3A 1SD5A 3P45A 1U65A 1NVEA 2AQ8A 5DMHA 5I7RA 3GELA 3RK1A 2DAPA 2Z9DA 3M6IA 5D3ZA 3SC4A 5KPJA 1XUOA 1Z07A 2VIIA 2DJIA 4BIMA 4BLVA 3SZUA 2R2AA 1ZNQO 2I7VA 1Z38A 1T2CA 2BE7A 3CNNA 3ONWA 2I29A 2XZPA 5E9WA 2AEEA 2QSJA 3D7KA 2C96A 5H83A 4HDMB 1KF0A 3I0MA 3PUJA 4CKEB 2IH5A 4RGBA 1ZJ6A 2J6BA 3GRAA 4D57A 2YV3A 1WG8A 3K30A 4TYWA 2BDUA 3U3KA 1EUDB 3NWBA 3R7SA 4D8TA 6CHYA 4M9SA 2UZ4A 2GAAA 5CLHA 2RKOA 2HK6A 5AW6A 4OXKA 5CXSA 2HO5A 2DECA 4JD5A 1DKMA 5SY6A 1T4GA 4AUNA 1XDUA 1YL7A 3F4BA 1BJKA 3ZS8A 5KC8A 2ZTSA 4M86A 5I7OA 1TJYA 4PYMA 2ARKA 3F2IA 3MJHA 1F06A 3D3WA 3V6MA 4C7KA 4DYHA 1ZEMA 2GBLA 3EPKA 1OMOA 2E5LB 2AD5A 3A6PC 4NE2A 2W6OA 5DHTA 2VJDA 1BQEA 1FTQA 2B1RA 1P73A 4BNDB 3N2KB 3MWGA 5MFZA 2FE4A 3FH0A 4GMHA 3GNLA 4CEHB 7ABPA 1YL5A 1U8CB 1KAEA 1O9BA 1X92A 1XQWA 2PX6A 1NVWQ 5FFNA 4U8GA 3THRA 5CFPA 1L9KA 2I1QA 3BA1A 3HV0A 1MGOA 4U9UA 4AY6A 4J43A 5ESWA 2B6NA 5JDIC 5JYDA 3DDUA 1EK2A 3OOYA 1Q11A 2NV6A 2ZYSA 4UNSA 3DDCA 3EVTA 3EE6A 3Q9LA 4U63A 3DNFA 2HHLA 3L4BA 3E61A 3PQ2A 1ZU4A 5EERA 5LQRA 3RRNA 5AUNB 2BFBA 3GLHE 3RM3A 1N2SA 1PG5A 4KAXA 4M8NE 5LDDC 1QK5A 2JLYA 1B6SA 3C3XA 4YEDA 2H65A 3HA7A 4KP7A 1S5PA 1T9HA 2P5YA 1T3SA 3KQUA 3K9FC 3WKBA 1CQIB 3BS4A 4S0XA 5DHUA 9GPBA 1A8IA 2G3YA 2C4WA 3JWEA 3RVRA 1JYEA 2QT1A 4BUJA 2B99A 2C2GA 3HJNA 2CN1A 2O0JA 1XAJA 3QKWA 4RE5A 5I9NA 1XZIA 3IXMA 2WKWA 4KRGA 5A06A 3VDXA 4ZT6A 3IQEA 2W2QA 5FP0A 4IIVA 3WGQA 2BEVA 4YAUA 1GPJA 1EXWA 3GD5A 3R4VA 1M0SA 1VSVA 4S1NA 4OQEA 2VUUA 2AJBA 3EIWA 1TM7E 3H7IA 1C4KA 1V1MA 2OO5C 3EN0A 5ALLA 3RYHB 3A4YA 2QXTA 1CYEA 1K1EA 4ACAA 5F9FA 3DE7X 3P0FA 4Z7OB 1MC8A 1FRQA 1PJTA 4P2GA 4RESA 1JG3A 2E5FA 5K6RA 1RCUA 1Y9AA 1R66A 5IEJA 3PXEA 1QQTA 4QUBA 4NAVA 2CT8A 2FR1A 3R75A 2JIZA 3C6ZA 3L49A 5FWAA 1AJEA 2NQTA 2QPAA 5EQJB 4I1PA 1PWYE 3A7EA 4J94A 4CM8A 1N0UA 2HGSA 4ZQBA 2G76A 5M7EA 2DWCA 2OMEA 2R7LA 2F1JA 3OQ1A 4Y18A 2IZOA 1DEOA 2LXNA 2QE7D 3X3HA 4CL8A 4FLEA 4OLFA 3DL4A 2Q7OE 2B0CA 4EGSA 2V03A 3HLTA 2CUKA 1RZUA 1X2EA 3HMQA 4PIVA 2XMDA 3OZWA 2I8AA 5FYQA 3V2HA 3V8BA 4FGKA 3ESBA 4MIYA 1IEXA 1MEOA 2EJUA 3VOAA 1UOEA 4O2BB 1GEEA 3TCXB 4ADSG 2P69A 3V9AA 5JNRA 3FUWA 3U4CA 4DTIA 1FTWA 4IG9A 3B53X 2DVMA 4TWZA 1BVHA 2FSIA 1FJGB 4L2IB 4TOIA 4QWWA 1DIAA 3FPKA 5AICA 1ZR2A 3P8ZA 1QP0A 1FDIA 1G7CA 4Q9DA 3KXPA 1JKFA 5IXJA 3GLHB 4QYXA 4KXVA 5G0VA 3HHEA 1YACA 3P2YA 1NP6A 1L4EA 3Q7RA 5AXBA 3HBLA 3F78A 5BMVA 3AHHA 2QROA 1BW9B 1I2BA 1XTQA 2YZ2A 1AHPA 1FBNA 5JH7A 3CXRA 1XYVA 3DLBA 2Y4OA 1DC3A 4FHFA 3R7WA 4AICA 2D2XA 1XCOA 4UVDA 1G60A 1GZ3A 4KQFA 3RVDA 3R6LA 5CHYA 5ARDA 1J5XA 1TVEA 2REXB 4U2CA 2JFGA 2R85A 1BE8A 1ONBA 5E6RB 3QKTA 1OGIA 5JNLA 2BHRA 4LBWA 4DC0A 3JQPA 1CC1S 4PO9A 1ETHA 5BT8A 4ZU1X 3AW8A 1RXVA 3OZGA 3B1YA 4QQRA 3OM9A 3T3PB 3FG9A 2WVJA 4M1YA 5F7ZA 1CS0A 1CY7A 3QH4A 3SSOA 2WPDD 4D02A 4ZZ1A 2JKVA 1ENOA 3OZDA 1T9AA 5D1HA 3K2BA 4IH9A 5ELLA 3RROA 1NV9A 1VYHA 4AF7A 2I6XA 1E9CA 4S1PA 2F9FA 1SHZA 1VRCA 3AF0A 3BXOA 3DLTA 4GP9A 2CDBA 3BJZA 3TLGA 1WX1A 3C7TA 3TLEA 1I7QB 2WTNA 4I1YA 1E2NA 2VOEA 2P6UA 3B7GA 4GYYA 3VKUA 2HU5A 5BPFA 3TQRA 1IONA 2AS0A 4M9CA 4TN1A 4R0NA 1HE1C 4N7MA 3O38A 1XZDA 5A6VA 4JT4A 1KRWA 4WEQA 1R8YA 3EUAA 3HCPA 3OMWA 4ZXPA 5JD5A 5CG1A 2O8NA 2YQ5A 1M8PA 4FR0A 4RNDB 4YIKA 4ND7A 2B8EA 5T7BA 4DCTA 1JI3A 3NGLA 1DBWA 1QIHA 4L08A 5M34A 2GPJA 4EGAA 1ORVA 3C6YA 3MINB 1N33B 1N2GA 1ZHOA 1YD7A 4MS4B 5K3OA 4WXHA 1BAPA 1ESZA 4DMMA 1CS4C 1XKXA 5LYJF 3T7IA 1YSCA 2DHQA 5G3ZA 2QVLA 1LRJA 1S2DA 3IMGA 4K9LA 3C3PA 1FA9A 5J1TB 3UT0A 2GKGA 4OYRA 3WRYA 5P21A 5BOSB 1QIKA 5C52B 5HS6A 4XQCA 3DKIA 3AI7A 2HA5A 4IF6A 1I4DD 4V0SA 4EDFA 2ZIFA 2IZ5A 1EKXA 4H4EA 3CC8A 4QHYA 3MIZA 5FV7A 4TLBA 2CMFA 1WULS 1G63A 2B98A 2GNAA 4BX8A 3RNOA 1W8IA 2X22A 4P82A 4FK8A 2TSYB 3AH8A 4S04A 2W4IA 3LOPA 3FNEA 5IYZA 4F6CA 4KFRA 4EA9A 1TK2A 1UPAA 3KXLA 5KVCA 2WHYA 2P30A 1IVNA 3FKSA 4LZNA 1FB5A 2ZIEA 4IRMA 5DXFA 3THWB 3ILXA 1CIJA 1Q0UA 3WMWA 1ITZA 1XCLA 4OYLA 1M34A 1REQB 4LBZA 3ERCA 1MFPA 3GFPA 3OTQA 4LDAA 1ECLA 2DPHA 2ZCVA 4TKZA 1LBSA 4HRXA 4WOCA 1E79D 1JLKA 2ACEA 2QSYA 4OHXA 5E2IA 1EZ1A 1JG1A 2FUNB 2ZBQA 2XUGA 3BXXA 2PCJA 1UBTS 5IC4A 3WXMA 1SK8A 5JALA 1EXVA 1Q17A 2GYYA 3ZDBA 3FVVA 1E9EA 3SBDA 1ZMTA 2VHXA 3KHUA 1L4MA 4BNDA 3NCTA 5DJ5A 1TYAE 1JQEA 1VLHA 1KKMA 3SVTA 1JWAB 2Y1KA 2YWHA 5AHOA 4ZOAA 3CISA 4KE6A 2DT5A 5ICCA 2DQKA 3CU5A 3WG9A 2VCHA 4IQ0A 1PS9A 4JXZA 3GU3A 2ZULA 1XP8A 5E7JA 3ZQ4A 1EJ0A 3JQFA 3S2ZA 3ADDA 2PHZA 1C3VA 1UK8A 1XG5A 3BBLA 4NMMA 2DPYA 5KYUA 3RRBA 2VTBA 3WWYA 2QORA 1HTBA 3GFBA 5G0UA 3ZJTA 3ZHUA 3H0EA 3RADC 2FZLA 4F85A 1AKNA 3MYYA 3SMVA 4ZV7A 3ZUPA 1DG1G 1SN7A 3HV2A 5B2ZA 3UENA 4IZOA 1RJEA 2V5AA 1TZ2A 3VOSA 4EBFA 1GPKA 4UOEA 5JBIA 4B32A 1X94A 2HO4A 1V5FA 1RABA 2B1IA 3JS5A 1FFDA 1S01A 1P75A 1U5BB 3OOSA 1K8RA 3GEMA 1RPJA 4H27A 4O4HA 4HEJA 3W2FA 1BCSB 4RV9A 1OFIA 1IFXA 1IXZA 2A3RA 1M2EA 1V5IA 2PGOA 1FDUA 4GGMX 5EE0A 3TD2A 4CLHA 5HK9A 2WFLA 2JANA 4RLHA 1YZQA 1NYRA 3WYDA 4GRDA 1KJJA 2AI3A 2H2DA 3MMPA 3PYMA 1R8QA 4Y2XA 4INJA 4PYIA 3N2ZB 3L6CA 5TQ2A 4DQXA 3F3SA 3E2PA 4TUYB 1TZMA 2OEPA 3FUVA 4A23A 2JASA 4CNBA 1HYBA 3F73A 4UXIA 1EA7A 2GJ8A 4R7TA 3UCEA 4PXYA 3B1ZA 2WAAA 4IGFA 3PEYA 2ZAIA 3OZVA 4V0LA 3U61B 4WERA 2RHBA 4IO1A 1QYWA 4GZ3A 1PBTA 2FRVA 3DMPA 3QF7A 4MW5A 2HNAA 1GZUA 3IULA 1R16A 1V7ZA 3BQ9A 4JMPA 1CR1A 1LV7A 4H7HA 1SXJA 3SMQA 1JAZA 1L7OA 1U28A 1YUNA 2YVKA 2W2NA 4CW7A 4DA8A 4QULA 1KXZA 3SQNA 4Q3EA 4MB2A 3VU0A 1DBSA 4OBXA 4PZEA 4U0KA 1SG6A 4GOMD 4LJ5A 1EUYA 5I8PA 3NX4A 2GCOA 2IVZA 3QFTA 4HEQA 2XB2A 3ZV5A 2DFPA 3Q7EA 3QF4A 4P5EA 1PIWA 4RIHA 3JQEA 1T8RA 3RKRA 3KJFA 3SJCA 4RQTA 4ZYZA 4RH3A 3IHWA 3GBSA 4DIBA 1AVTA 2XCIA 3M6MD 4KL8S 2XUZA 1KH2A 1XMPA 4Z2AA 3TGLA 3UA3A 5K01A 4QRDA 2YHSA 2PGAA 3JWGA 3T1OA 1QF6A 1IH8A 1OLSA 1NJFA 2W22A 3IQHX 2X0KA 4O4JF 3O8QB 4TS9A 3TEFA 3ZGVA 3JPYA 4EKEA 1RC8A 3QVTA 3UYLA 2FPMA 2PIAA 1K3FA 2CXTA 1W52X 1PT5A 2HJGA 1A9XA 3KIPA 3HJCA 4KO3S 4L9SA 4X3CA 6LDHA 4RS4A 1AZTA 1P91A 4ABTA 2D13A 2H1HA 4YDRA 3LLUA 5K1ZA 4U2DA 1S2NA 5EFOA 3QG1A 3I52A 2V7EA 4AQYB 2AR7A 1CJKC 2D2FA 1OB2A 3RAFC 2OD9A 2VJNA 4RF3A 3P27A 4F2PA 1EFVA 1KR2A 3OOWA 1XPUA 4FFBA 2CYBA 1GG9A 2P79A 4EFMA 1O8CA 1DAOA 1E2PA 5AMXA 1E6UA 4KMOA 4MV4A 1HLFA 4BGIA 3OUUA 2D1QA 1VL0A 2VYVA 2OCDA 1GZVA 1I2MA 2WA1A 4RETA 3IOEA 4MQFA 4MRRA 3UOAB 3J81k 2BFBB 2DBQA 2RHMA 1V0JA 3JQ8B 4UVEA 5FO1A 2DTEA 2W11A 5HXAA 4MPPA 3ZX4A 3E58A 2I22A 2EDCA 2PK3A 2WJHA 3CS3A 3QXGA 4KU4A 1OWLA 1CT9A 4R1SA 5T41A 5KWSA 2HM7A 4X1KA 1KGDA 4EOGA 2NQ2C 2HCJB 4NTZA 4WXRA 4FXPA 2POCA 4RVOA 3FPSA 1W4BA 4PC3A 3MWEB 4JI7B 5EJGA 4Z86A 3K9GA 4OQDA 5BW5A 3H9BA 5JJKA 3KSDO 3HDJA 1DOHA 2ZIZA 3DOCA 3IR6A 5I9TA 5K0ZA 4MP8A 2C95A 3F6CA 2A59A 4ZI7A 3ZDFA 2EQ5A 2OUKA 2YX1A 5K0BA 4KITB 1U2GC 3NXSA 1YF3A 1I4WA 5JAPA 1A98A 1WA5A 4KB5A 3LPNA 3VSEA 1VB3A 1BS9A 2FX2A 4IHJB 4OXNA 3W6UA 1MVOA 4GP7A 1H2ZA 4XWYA 5L40A 1PL6A 2JBHA 3EPHA 5HOQA 4GE3A 4LX8A 1W1IA 3LAWA 5DI3B 5F5XA 2ZI9A 1KO4A 2C5EA 1J0DA 2NPFA 4NF2A 4R8RA 2REQA 1H3NA 5C2JB 5TVKA 1DC7A 2FFJA 3FZQA 2H1OA 4LOAA 4DRYA 3WGZA 3S1AB 3GRCA 4MWBA 5FYDA 3GT0A 1J07A 2ERXA 4L8GA 3BHJA 3TJRA 1FPMA 3V3KA 4INOA 1V2HE 3IXQA 3PHIA 4KXMA 3FFTA 4B4VA 4KREA 2O8FB 4EHKA 1PR6A 2QL7A 5JZ9A 3CX8A 4N01A 1GGJA 4F5WA 4GYKA 3UN1A 2VYFA 1HTWA 2GXQA 3ND8A 5LN1A 2D62A 3OZ7A 4R51A 4YJ3F 1PE0A 1QQ5A 3NGXA 3M5WA 1WXEA 2XADA 4ETIA 1NMEA 4ARVA 4N5MA 1LX6A 1PFYA 1L8LA 1J0XO 4J1QA 3SC3A 3SEZA 1E1QD 2P78A 4PHCA 3VYVA 1NXTA 1VHTA 2Z98A 5FRDA 3VGJA 3STWA 3ZWBA 3N76A 3VV2A 2UYGA 4XB6B 3NH9A 4OLJA 1PZXA 3ZPXA 5CB4F 4QOGA 5CJ2A 3IIJA 3SXPA 4PAOA 2FPPB 3LL4A 1CZOA 1XZMA 1U8TA 4ETNA 3IKLA 4E14A 2BBWA 1N92A 3CUUA 1TOAA 2E82A 2CGEA 3LX8A 4KMRA 4LJ8A 3RRXA 4E12A 4WA7A 1P81A 5A7FA 5FTLA 1NTOA 3ASVA 4B2YA 4ETWA 3X1XA 3AUFA 2GN1A 5BO5A 4I5FA 2A9KA 5FFFA 1H3EA 2A0KA 2PKQO 4UEJA 2WFMA 2Z0MA 1W88B 3MCWA 4UUPA 1JIQA 1EK5A 2CDCA 1FSSA 1NBIA 5CDUA 2R4TA 3KLMX 3O4RA 3CNOA 2BRUA 1NIJA 4TWJA 1FCJA 1W5BA 3PFIA 4DOMA 1MPTA 4C5BA 4U3JA 1D09A 2P6NA 1ZWKA 2B83A 3R09A 5L7TA 5LP1A 5C1IA 1LY1A 1UM8A 4B83A 4F2WA 1PK8A 1UKZA 2NO4A 2D3TA 4MKGA 1U81A 1ULSA 4IIYA 4OMFG 3F5DA 4CT4B 4X64B 1QGAA 3OBBA 4LSWA 4HDRA 3IMEA 1JXAA 3PGMA 4HP8A 4J16A 4K1XA 4RDIA 1DQNA 2XOEA 1R9NA 1ZK0A 4RXMA 1Z26A 3TQQA 4EJ2A 4A5SA 2QRVA 4RTPA 3LX4A 3V1MA 3PE3A 3DYVA 4B3MB 4LDJA 3WICA 3WHIA 1E94E 3JD3A 1V47A 2VNJA 4GM1A 4LHYA 5GJVC 3TR6A 2LCIA 5C9ZA 3PJRA 3UHFA 2HL6A 1DDIA 2WYHA 3UCFA 2DE0X 2G0NA 3B85A 5LB2A 1N2OA 3I9MA 4UMDA 2FG6C 2XUJA 2SBTA 1JV2B 1KTVA 4JBYA 4WX2B 4AIIA 1JEQB 1UDXA 3JATB 4J0KA 5FI3A 3KHKA 2YZKA 3UG7A 1S3SA 1HEUA 1VC2A 3HR4A 2O6LA 3BH6A 4NYIQ 5CDHA 3MVEA 1NQ5A 1XV5A 2Q5OA 3I9V6 5FUQA 3TBFA 1U11A 2XBLA 2VH1A 1W5EA 3UFXB 2EC5A 1OA0A 3L6RA 4NATA 3V7WA 3LNTA 4DDKA 4YR9A 5HTOA 4ITUA 1QBKC 3BSYA 3DG9A 3PZRA 3KE8A 4N12A 2BSXA 2IV2X 3ROPA 3L7LA 4GL4A 5CVJA 5TPWB 1NBME 1ID1A 5IJWA 3SIWA 2WWHA 2VATA 1O7JA 1KRHA 3AIIA 2HMAA 4A2WA 4DY4A 1CQJB 3EIQA 3PC4A 2LW7A 3I5YA 2NTYC 3RF7A 1B76A 1HTTA 3DMFA 2BHLA 2G83A 2EQBA 4XQ9A 1F6WA 1OTXA 1JA0A 4TX1A 4U1RA 4EGJA 4JVNA 1IZ9A 1VTKA 2G6TA 3I5MA 3ML1A 5AP9A 3CKMA 4Y6PA 4H7DA 3TX6A 4KDFA 4LNUB 2AF4C 3GLGE 1CRQA 3NORA 3A25A 3ETJA 2P75A 4KO4S 3O74A 5HJ5A 3PHGA 1HY3A 3B70A 4RIFA 3WSTA 4D4HA 4XWAA 3U6BA 2BCJQ 5LWQA 3MNFA 5DCUA 2B7CA 4IQ4A 1E60A 1HDRA 2Q3FA 3SZOA 3EVCA 2NUPB 1PNRA 1SIBE 4M1TA 4IILA 3NT2A 5F78A 4F3YA 3LF2A 2QMHA 4G25A 1G6Q1 4L27A 2DEUA 4LA4A 1QZ3A 1A4IA 1Y5LA 2HJWA 2FZEA 2G72A 4XQ0A 4J16C 2QTWB 4AMGA 3E70C 2GVNA 2ZS9A 3N59A 5ESDA 4CQLA 2FPOA 3HCFA 3LUPA 2G0TA 2HDWA 3GVCA 3OMLA 3OOJA 5FBLB 1Y3BE 3ZE9A 3ZQJA 4RD1A 2Q45A 3A3PA 4XVQA 3VNSA 2R25B 3VR5D 2E1PA 2PS3A 4BMNA 1ZW1A 1V6AA 1DRKA 1KU6A 1OZAA 1V41E 1UXHA 1GNRA 3E1GA 1PTKA 3H9UA 2CLDX 2WIJA 2F2TA 2H8KA 3ESYA 3NTXA 4MHOA 2PZKA 1QCYA 2XUKA 4G0ZA 1THGA 4OQZA 5REQA 3QELA 1ICEA 5LL6P 2FDCA 1VMIA 3JALA 1T2AA 3PUXA 8OHMA 3K5PA 4NVRA 4ZT2A 3T1QA 5EIXA 5EJ2A 4F8EA 4G65A 1ZDMA 2J5QA 2ZWAA 4N0DA 4Q02A 1PR1A 3GCWA 4WDRA 1MCZA 3E5RA 5CNKA 1RWXA 1XN4A 2GRUA 1KVQA 3DYIA 1VIYA 1ZH0A 2Q4DA 4NPAA 1BCRB 4PR0A 4R9VA 4RPLA 4AJJA 3K71B 1CZRA 2AW5A 2JHFA 3VH2A 1ISJA 4G5OA 4LDZA 4U00A 1Y8CA 2XRYA 5BMOA 2P2LA 4CKWB 2YOFA 2F1RA 2HADA 3GFOA 3Q10A 1NW6A 4FJ2A 5KKNB 3I30X 2UXCB 4OSOA 5DK6A 3WZ2A 1XPRA 2OLKA 4PAGA 4KPUB 3I04M 1G20E 1DEKA 3U4HA 3FB4A 1IEWA 6AT1A 4YR7A 3C74A 3GGGA 3LO8A 4UPVA 3A2KA 4G81A 2GQ0A 2EIHA 2CLKB 2HSJA 3EPRA 2HBQA 1KFJB 1J42A 1IWOA 2XYVA 3FFXA 3MXTA 2HA6A 4AKEA 2ZJ0A 2VDRB 3S5JA 1HMPA 4A82A 1P2VA 1C1HA 2WTUA 3QXSA 4J0FA 1GUZA 2XJ4A 4P0TA 1PJAA 4EB0A 1KY3A 3EB9A 4LI3X 4PG8A 3IP8A 4KFSA 4GX5A 1PZNA 1UBUS 3RFUA 1VG8A 5KNCH 2BL4A 5TX7A 3OQ6A 2ZGVA 3GXOA 3OX3A 1KVSA 4IIEA 2QA5A 1H0SA 2YINC 4YHHB 1YR7A 1IQ0A 1JQDA 2C2OA 4HDQB 4MQEA 1A27A 3OFJA 1DE0A 1M2OB 1YZKA 4M22A 4JC5A 1GQSA 4O08A 3U5ZB 4CF3A 5ICEA 2AN1A 1MG0A 1RLMA 3PQ6A 5CUQA 2Q1TA 3BF7A 1VL5A 2AZTA 3EGOA 4KIUA 4CIAA 4JSRA 3KWFA 4YV1A 4Q7QA 1UKAA 3ECAA 4YRBA 2HYIC 1KP3A 3BREA 3ZZMA 2XX3A 1DSSG 1OTHA 5BVGB 3RF6A 4BO6A 5KIAA 2H59A 3HB9A 3W4IA 2JNWA 3MAGA 4U39A 2Q46A 2B4QA 4B87A 1GA1A 721PA 2YV2A 1HK7A 1S96A 4ZEVA 1L5FA 1H2FA 3ZKAA 4ALNA 1GTSA 2VDVE 5IN5A 1JNYA 3EXEB 3SBOA 1CUGA 5F98A 1KO8A 1PQPA 2C88A 3TE6A 1IN6A 1LS6A 2BM0A 3DT6A 3OPYB 1JKMA 4HDNA 4TS1A 3RE1A 4QGGA 1ABBA 3LBHA 4OBWA 3LQYA 2VZ0A 1V37A 2DKNA 2ZRBA 4YWJA 1XVTA 5BW4A 2XQFA 3KSRA 4HN2A 2D1RA 1O2DA 3A9CA 3MEQA 3OHSX 5B30A 5AHXA 1LW7A 2JFQA 3CVOA 2FPLA 2FSUA 3PR1A 2JVKA 2A7XA 5CG2A 3M4XA 3VZBA 1P9OA 3W9UA 2IE8A 3UWPA 3REQA 3O47A 2O48X 2W4QA 1WHTB 3ILHA 1X7HA 3N7AA 3Q7IA 5JPDA 3S8MA 2ZIXB 1GADO 3EMKA 4GGOA 3V2UA 4UNRA 4OH1A 3SJZA 1E2DA 1Q1ZA 1PR2A 3AXSA 3CCCA 3DHNA 1W0JA 3GC6A 4LY3A 4F6RA 4KYTA 1UZNA 2DBVO 2N1BA 3SXUB 2ZZMA 4HWOA 3UMRA 2EJBA 2PBLA 2N46A 3A2LA 4JJGA 3K8QA 4RHXA 2CNBA 3AVQA 3P4YA 3TSWA 3USZA 3R3JA 3NEYA 4POAA 3UMCA 3H84A 1C80A 4AN1A 3H9EO 3SFTA 2PIDA 2UUAB 3OZCA 3Q3IA 3NAQA 3ZLVA 5JHGB 1CCWA 4BLRA 3A1TA 3N9IA 3DMHA 5IF9A 2R6CA 2VTDA 1RP1A 3CBGA 4YONB 2AE1A 4F2HA 1M2KA 4JQZA 4OEHA 1QRRA 4WK6A 3EEBA 5BRNA 4HS4A 1GRQA 2QJTA 2WLSA 1OHHA 2JKZA 1K3UB 2ZTLA 5H3CA 2VAVA 4PQFA 1FYVA 2NP6A 1DBPA 1RS0A 1Y8QB 3AL0C 1NYQA 1RZRD 2GD1O 3GNSA 1SD1A 4REMA 3QKRA 1C7IA 1UAAA 7MHTA 4IKPA 3OM8A 4B2IA 3GG9A 1CDZA 4XX1A 5LYJB 4ILKA 2WYUA 4YAFA 2FX5A 4UM5A 4KRFA 1MDFA 1ULBA 1ZMBA 4EK9A 1NYTA 1QZZA 2I5PO 4ENQA 1C7JA 4QT0A 1JQAA 1W75A 4C29A 1SPBS 3IAM1 4RXTA 5L8VA 2GI4A 1M5UA 3LY9A 5D7BA 2GSDA 1RC1A 4ZT7A 1J8FA 3CKLA 4Y3UA 5EXTA 4GPAA 4AKGA 1QO7A 4IUDS 3H05A 2WJ3A 2Q0XA 3DS8A 3GJ4A 4OQYA 4RJ2A 4DSNA 1RWVA 2ZB4A 5K0TA 1WZNA 2J6CA 1KEWA 2QQGA 5HP4A 1UFKA 2GH1A 2MYTA 1CUHA 3N0WA 3ZYZA 3KQHA 5LIRA 4Y7DA 2BT4A 2HRRA 4ND8A 1C3OB 3AHFA 1Z68A 4DUYB 1BJRE 3QUQA 2C9DA 2J7KA 4Q4LA 1GKUB 4PN3A 4JUDX 4ZCLA 5DX8A 1SQFA 4WLFA 1SHJA 3P9NA 3HCWA 3KAQA 3R9IA 1MIOB 4D7AA 3W5JA 3HNOA 3GGDA 2GEDA 2V6MA 3SBXA 3IUPA 2W6PA 3A1UA 4LKOA 3OI7A 3DAGA 4MMXB 3ZEIA 3ETEA 4LDPA 3CRVA 4NFYA 3ADCA 4ME6A 4J90A 1NXSA 3GJ7A 3GWZA 3HWSA 3KOXA 4WBSA 2HEIA 4O3FA 5D3MB 3V7FA 4CL3A 4JYPA 1XTPA 3VBCA 2NZUG 2ZXFA 4B6PA 5FLEX 1A9ZA 5JTTA 2V9ZA 2Y1CA 5DYNA 3S6JA 1ZJ5A 3OJCA 2R8YA 3H17A 1MOZA 1GU0A 2JGIA 2JIQA 2QPTA 1QFYA 2WAOA 2OYCA 3C0KA 4DRZA 2JJ1A 3IPLA 3N0VA 1RQGA 1VGQA 4RO0A 4DWJA 5F9HA 1BX0A 1NAIA 3DMGA 1RAHA 4PAWA 1VZ2A 4DLYA 1NSFA 1RTTA 1WUHS 4PZZA 1TAUA 1TM1E 2HKIA 3GBPA 3K0AA 3I8SA 1O5TA 4UASA 3K70B 2P5SA 1CHNA 4BFYA 2BBSA 1QJCA 2RARA 3RUDA 2O2EA 4O2BF 2ODBA 3EIEA 2W8BA 5FORA 2P90A 2R6JA 1OKKA 2EBFX 2PM8A 4LBVA 3EFBA 1VE9A 5J4HA 4RBNA 4IIFA 3JAWB 1CTQA 3BOSA 2VZLA 3W0LB 2OG1A 1G5TA 1SXGA 3FR7A 3NH6A 3TOSA 5AVJA 4BJ6A 1V45E 1YGYA 5JY6A 4R41A 3T99A 5B7PA 3PDIB 2RC5A 1T6YA 4BNHA 1PT7A 3D4BA 4MR8A 5TMBA 1G4HA 4K46A 2Y3IA 3ZHYA 1IVSA 2E3JA 1G8SA 1EVKA 3P0JA 1WSBA 5IVHA 2ZG6A 5DHFA 5J2TB 5IAEA 2WKRA 3MPOA 2FK8A 2XEDA 3TLMA 1SIWA 1KSHA 3ND6A 5EFZA 4GXNA 3OA0A 1LNQA 1Z0IA 4Z4CA 3FLEA 4JJIA 4HI0E 3KZMA 1Z5WA 3N8DA 4CV3A 5FPQA 3RSLA 2V7QA 3ABZA 3QX7A 4Q12A 4TKUA 2GXSA 1M83A 2X9VA 5DULA 4ZKDA 2BF4A 1PNQA 2NVBA 3OICA 4IX9A 2BI7A 2GPNA 3C70A 2Q4RA 3AVOA 4JA2A 1AQLA 4GO1A 2Q1YA 4ZEOA 2P6OA 1FRVA 4JQSA 1HNNA 5IJ9B 5JNVA 4RGVA 1ZRNA 1PDVA 1A95A 2JJ2D 1S1MA 2NSLA 3FYTA 1T1SA 1NF9A 3F5MA 3M7IA 2A84A 3UMGA 5I7VA 1QWSA 2AKYA 4RS3A 3NUZA 1O8BA 1A77A 1NFFA 2YV4A 1CY0A 2P2ZA 3N5CA 4XDGA 1R9JA 4FXOA 1GRCA 3M70A 2VH2A 1J39A 4LWQA 4CV2A 2F1OA 1N7GA 4TQ9A 1JLLA 2MR6A 4ZC1A 4GLBA 1QVZA 1S8OA 2EERA 3IAS1 1VCNA 4DSUA 2ZQ5A 1OY1A 1AZLA 4NBVA 3OZAA 3B48A 3VZSA 4ARAA 1M2OA 3VNBA 2FSSA 3V4FA 1B1CA 3TINA 3X43A 4D56A 4CL2A 1W0KA 1QCCA 3S44A 4C6TA 3ZDXB 4KQGA 1B7GO 1NVFA 4I1VA 1EAYA 4JI6B 4Q01A 2FLWA 2C7GA 2VA9A 3NYRA 3BH0A 4YCNA 4OI4A 3JYNA 5AVKA 3JWPA 2JAHA 1QHYA 1WJGA 1X9GA 4DG8A 1N9GB 4BV3A 3P52A 4WOKA 4RHTA 1VMAA 1P2BA 4YRNA 4ZQGA 3QHPA 1F2DA 3BIOA 4YUVA 1G9TA 4Q4CA 4IYRA 1DPFA 3OH8A 4FYXA 5ES3A 2M32A 3L4KA 2D2EA 2HPAA 4PNZA 1ISPA 4JOQA 5FJIA 2PMDA 4ZD6A 1TMOA 1UXIA 2ZROA 2CVHA 2BH9A 3F1KA 1YJAA 2VK4A 1NURA 1MJGM 2IDMA 2UUOA 3ICOA 4Z53A 1EG2A 1M75A 1NN1A 3AF1A 5G1OA 4HH0A 5GIOE 1J8DA 2IU0A 4MUFA 5EXPA 4NONA 3JD2A 5LSAA 2GXAA 2VSYA 3CLTD 1IB6A 4EY5A 2CXOA 1NNLA 4OA5A 2W93A 2RIPA 3DV9A 5LNK6 4NNOA 5IJAA 4M36A 4BMSA 2QJRA 3NYIA 3L7AA 4I3FA 3TIXB 3HSYA 1NGSA 4A2CA 2ZIUB 4G67A 2IHJA 4YV2A 5TS3A 3LKDA 1OI7A 1E1YA 1E32A 2VL7A 1AHNA 5ER9A 2AWOA 2ZTMA 2FKNA 2IUUA 3WK4A 4ZK2A 1VL8A 3N7TA 1YKGA 1Y1RA 1GD1O 2AZMA 2VK8A 4V03A 4Y0AA 4ZQFA 4EMTA 3QEAZ 4E5DA 3RRYA 2R1VA 4YRTA 3H2KA 4CIVA 2QTCA 4NULA 1QO0D 1UBSB 2Y0DA 4TZ0A 1UC8A 1XZFA 1JZSA 2OGZA 1IQRA 3MJVA 3R0VA 3TVTA 4K9PA 1C9KA 3R3ZA 1CULC 4MVWA 2RG7A 4YAOA 1J22A 2ESRA 2X0RA 1U0LA 5GQSA 1FU7A 2DTDA 1KK0A 3UO8B 1NQOA 3L6DA 1L8AA 4UAVA 4EUHA 4QT4A 4YCSA 3QQPA 5TEVA 1F3OA 2YZGA 1XEWY 4KW7A 3UUGA 4DJ5X 2O0HA 4FB5A 5IK2A 5JATA 1E6CA 1AUVA 3L7IA 2Q5JA 3W5AA 2WJVA 4UE3S 3WQSB 1MHTA 3LX6A 2Y66A 4IDDA 4R5HA 2VTKA 2OB1A 3Q3EA 3TJMA 4DQDA 3DTVB 4JJEA 1RNLA 3R5JA 1YMQA 1D6JA 3I2FA 3DTVD 3QWAA 3RPEA 1S2GA 1YVEI 1A4RA 1U9ZA 3F8TA 3P9CA 1CETA 2YIDA 3S70A 4EB8A 1XZAA 3H1PA 3DUFA 4P4GA 3DVAB 4R1OA 3VOBA 4C08A 3IEMA 2WWYA 2WG2A 4URXR 4E6EA 2R8EA 1N34B 2VEDA 2AOUB 3IMKA 2P9YA 1IBRA 2J41A 3NOQA 2OCLA 2ZE7A 3HUUA 3AEKB 2VHZA 1XRMA 2G77B 4ZOLB 1EVZA 1OWOA 3NTOA 4X45A 3LVQE 3RIXA 1W5FA 1HQYE 5BVGA 3CLUD 2O1EA 5BSGA 1O0BA 4NZMA 2QRGA 3JQAA 2R97A 1ENZA 1P6UA 4GNRA 4MS3B 4KC0A 4BJHB 4O59O 3T5DA 4C03A 5HNKA 4MDEA 1R5JA 4O4LA 1I24A 2XD9A 2ZRGA 2GZDA 3IVCA 1KEPA 2QB5A 1BXKA 4P3OA 3HTXA 3QKUA 4YP9A 3EIXA 2C4HA 2WQZA 2ET6A 1L9XA 1G8JA 1ZXXA 2FP3A 4N03A 1PTJC 5DISB 1O77A 5AVTA 1XTSA 5E2BA 2M6LA 3TQIA 4UTPA 4RKQA 1FZQA 2J9YB 2YNMD 4HLUC 2O14A 3TRIA 1KZ1A 4CN9A 3SFZA 3KV3O 4DARA 5LVAA 2WUGA 3BICA 2C9ZA 5A5VA 1XRLA 4RD6A 1XRNA 5IVPA 2EFDB 4TKLA 3QEMB 2PS0A 2W70A 1G18A 1MX9A 1XL1A 1HMYA 4X61A 5IUJC 3U09A 2C98A 1Y6FA 1IU9A 3TW6A 1E2GA 4QQNA 4MVJA 1QNLA 3ZOZA 2YMLA 4PLYA 5C5EA 2XR1A 2CFTA 3A1DA 3D81A 1TM3E 1FP1D 1J4AA 2JZOA 3NQ41 3AR3A 1QRAA 4QTZA 5CIQA 5KQMA 1TJ5A 4OGWA 4PFKA 3QJYA 5CLGA 5ALWA 1XI2A 1P2SA 2P9CA 3BCSA 5EMMA 5P8WA 5C32A 1NNI1 3MG9A 5CDFE 1RWPA 2P62A 3AESB 3LT5A 3DOEA 1JU9A 1QGZA 2E4AA 1DAPA 1E3WB 1E2EA 1GQOA 2ZT8A 1GPBA 3T3MB 5A6SB 1OH6A 1KJNA 1I8TA 4C14A 3W3AD 2HEGA 4MRAA 1KPHA 2OCIA 5AI0A 3GFQA 4AZ0B 4FDMA 2DLNA 1BKYA 2A6PA 1OXKB 2NSDA 1M2WA 3OIDA 2WINI 4QECA 3ZC3A 4IIJB 4D6PA 2W4MA 1MJHA 1N7JA 3A6DA 2V58A 2ZYTX 3FJYA 5ALGA 1Z25A 1Q6ZA 1X6VA 4DA4A 3VR0A 4LECA 5H5JA 5IM4A 3KBBA 9LDBA 5CW1A 1EXNA 3W9BA 4YFYA 5B1HA 3DV0B 1J1UA 3EQ8A 1DELA 2ZYWX 1KC1A 2NO6A 2WJPA 3P4UA 4MWEA 1SZJG 4F9GA 1DT5A 4EJSA 1Q19A 3MERA 4MDFA 2QP4A 1KSJA 1T6BY 2DPLA 1Y80A 3UKDA 1ZD1A 3OTOB 2ROQA 1IYZA 3ENZA 4I3GA 1GAEO 4YRLA 1G17A 1GFSA 3B5EA 4QU8A 5E2AA 2QTGA 1T10A 3NCHA 4O4JB 4ATNA 4B6OA 2YXBA 3Q3CA 4ISCA 5D00A 3Q5GA 5T4BA 2OMKA 2RCNA 4GMKA 4JUCA 3TDNA 1EE9A 3TLBA 4RABA 1NP7A 4S2UA 4LMRA 1WP4A 1EYZA 1KYZA 3CLSD 1W1UA 4PHHA 1SCJA 3NIDB 4YS6A 1QRTA 4H4CA 4AJKA 3DXYA 5LDGA 1KFCB 1U3WA 4KODA 5DEIA 5ARBA 1EWQA 1GPLA 2HTEA 1KFKB 3FMFA 5FBKA 1D0IA 3H5WA 1YBFA 3SE0A 3RSFA 2FTKE 2Z2YA 1ND6A 3BGWA 2O8CA 5B57C 1FSGA 2YWDA 4DZZA 1M3SA 1D2AA 3PDWA 2P65A 2OM2A 2Q62A 3AEYA 3GZJA 4MYHA 3OA2A 4I55F 4NCHA 4OQMA 5JYEA 2IEZA 1C29B 4YJ2B 2UVPA 3LCJA 1YR3A 3DH0A 1BEZA 1T3ZA 2I3GA 2QR2A 3OT1A 1K97A 4RPHA 1T9ZA 3DMDA 3S99A 2VJQA 3T7JA 4BVHA 4CFSA 1JPNA 3GLIB 1NMSA 3MT0A 4AXXA 2X9GA 1M1ZA 2UAGA 5A0TA 1E5XA 1E4OA 2DBRA 2WVAA 5GOZA 5IASA 5I9MA 1QAQA 1DJPA 4HMQA 3KB8A 4KXQA 4PWYA 3G02A 5FUWA 1W48A 2IEGA 3IURA 4NZPA 3ROGA 4ZYYA 1ZC3A 3IALA 5JI2E 3ORFA 3EODA 4KOEC 3E9YA 3FAKA 1IDOA 1Z2AA 3O75A 3STTA 2P6MA 3S29A 4BVEA 4BECA 2B4KA 3MAAC 1AXRA 2VUTA 1JHDA 5KJFA 4HVCA 4MNTA 1UT5A 4H7EA 1USKA 2WJZB 3KLPX 2FDRA 4NHOA 3DTVA 4FMPA 4Q7KA 4ZAYA 5KTKA 1LZLA 3EA4A 4E09A 4LHVA 1HYHA 2NTJA 3MZ0A 4FHGA 4HNQA 3JAMA 1G42A 3MYRA 5IBPA 4AY4A 2ZUVA 2W90A 4B46A 2H1LA 3ID6C 3T5AA 3DT9A 5DTQA 2Z04A 5ALZA 2AOUA 2V7UA 1PJ3A 3FUCA 1A7AA 1P2GA 4J9UE 5PNTA 3E1SA 1WABA 3QKRB 3TS1A 4TXMA 1G8HA 5B64A 2VBFA 3T8YA 4DMRA 1UBJS 2LKDA 4QFMA 4IOMA 2PX3A 3DE3X 3TAHA 4MYUA 2YTZA 4GF5A 1QZTA 3AUJB 2AD1A 4JYMA 5CMLA 5JUWA 2COEA 2OO3A 5A0VA 1D2EA 4PZ9A 1VIDA 2HLNA 2XUQA 2JI6A 3A06A 2AEFA 3VVMA 3NVKI 2MMGA 1TD9A 1O3YA 3G68A 1YZ3A 5IMBA 2C2XA 3G1TA 4F3NA 2AVDA 1U2SA 2O7QA 2DHDA 4ALJA 1NY5A 2HHCA 1K6MA 4ID3A 2R00C 3GPIA 2HQBA 1C4OA 1IHPA 2CE7A 4CHTA 3H9QA 5DRTA 3SZGA 4G0QA 4AL4A 3THWA 2PRKA 4PCLA 1O6GA 3DNPA 3DZKA 5H81A 1YVDA 1JT9A 3M82A 2GLTA 2JLCA 1NW7A 4ND8B 3AF4A 2J9RA 4UMEA 3TM5A 3I34X 3KLOA 3L46A 3NO4A 1HE2A 2CXSA 4I99A 2VEOA 3RUFA 4F9TA 2VZ8A 1NT2A 1JG6A 3R1IA 1L5MA 3AFOA 1X80A 5KX5A 2Y1OA 3S2IA 4KQWA 4JLJA 1WETA 2IOYA 1BWPA 1TKCA 4PYLA 2F9LA 3JAWA 1IOLA 2C04A 3W5IA 1IQUA 5B3LA 3ABOB 3BSSA 1R6BX 2B4YA 1Z4PX 3Q9UA 1KP2A 3R7LA 5CPFA 3EFEA 4ASUA 2DUMA 2ZM6B 5C4IA 1HZZC 2PXXA 1A76A 1Z2PX 2EYQA 2I66A 2DQYA 1ST3A 4C3OB 3HLKA 3LQ4A 2XUHA 4DABA 1LRLA 4FS3A 3C41J 1SAYA 3BXGA 2Q8QA 2MSKA 3PQ3A 4DCJA 1E5QA 3WADA 3ZR4B 4RPJA 4AWAA 1U7UA 2A58A 2B61A 2Q2WA 2WUFA 4LV8B 4BN0A 5FA5A 2IZ0A 5CEJA 4KAJA 5CK5A 5D7NA 4DMLA 3N0TA 3C4VA 4JGBA 1L7EA 3QSYA 1PUXA 1XCMA 3IMCA 2FP4B 1GARA 4FEYA 4C05A 4BCDA 2OV8A 3VYTB 2CCGA 1RYMA 4F6LA 4MCHA 1GCOA 3GWGA 2XSZA 4AO6A 2ATEA 4QYSA 4EG0A 1H4QA 2B5OA 4LPKA 3QVKA 3SGLA 4DZTA 3KQQA 5IEBA 1ZN8A 3CONA 5JNUA 3REFA 2ODWA 4N0QA 1F60A 1Y9JA 2O2HA 2RIRA 2XOKD 3AGQA 4OUDA 4R0MA 4OCZA 3ZJ5A 1DKLA 1U0SY 1BFUA 3B7WA 1VYUA 2C59A 1FU8A 1OBFO 3NEJA 1G5HA 2E4UA 5HX7A 5I6DA 1AKYA 3USCS 2QLNA 2VYVD 1OE0A 2X0FA 2JGJA 3ITNA 3BMOA 3AQIA 2F1HA 5A9SB 4QEDA 3CIOA 2RH8A 3CR3C 4TVOA 1D2GA 3GT4A 3DDWA 4H3KB 4IIBA 2AYXA 2F6RA 4G5HA 1A2KC 5FFMA 3FTEA 1K7CA 1M6HA 4XKJA 3O0DA 3EY4A 1IBLB 1D03A 3DD5A 3OJFA 3K1AA 5F3DA 4IY1A 2WU0A 1LBIA 1MTOA 3FTQA 4FLFA 4MR7A 3ZU6A 1SULA 3P1JA 5FHRA 4O0LA 4PAQA 1XD9A 3IOCA 4L7VA 3VMMA 1T36A 5K6AC 3T5CA 2P9QA 4HEA6 2YHAA 5KTOA 3L1VA 4R9UC 5C1PA 2QZJA 1LD3A 4C0QC 4R31A 3BX1A 1H0HA 3BKXA 1GCGA 4DC1A 5KBYA 4CLRB 4ZCPA 1JBEA 3RD5A 2AOWA 2A0YA 2RGDA 2ZU0C 3TCNA 3W2IA 2V55B 3ZD8A 3ZDZB 2Q5QA 4D81A 4JI8B 4CTNA 5IKMA 2PQ2A 3LYLA 1NRIA 1HR0B 1NPTO 1GKKA 5DF1A 2YXLA 4DCSA 2JCBA 4EHHA 3I6IA 2OBMA 1TU0A 2IYOA 5G0WA 3DO6A 5L3SB 5FUYA 1VJCA 3NGMA 3HJUA 4LW8A 4L78A 2PT5A 3OOHA 1XF1A 4HL6A 4PFSA 4UEOA 3RLFA 1ZIOA 2YRFA 2D4HA 2JF0A 1A9XB 2C3UA 4ICIA 1B2RA 1VCOA 1BMFA 2GCNA 1RKUA 1ONNA 4Q1VA 5JD3A 2PQ0A 5EP4A 2ODPA 1R2QA 4G0XA 4JVMA 1FUKA 4YJFA 1P80A 3H2ZA 2YN2A 4XIFA 1YZNA 3TTWA 4A8JA 4ZZ0A 3DEKA 5DXJA 4Z0PA 3AR8A 5CDYA 3AF6A 5JVDF 3KEQA 2EW8A 1FXUA 1ZLXA 2K2QB 4IIGA 1Q1QA 3I04A 4BO4A 1EX7A 2ECKA 1N3LA 3D0QA 4RQAA 4GMDA 4AQDA 2ZUFA 1IY2A 1BA2A 5JSYA 4L95C 1ECFA 1RLTA 4DHWA 3FNHA 5EZ6B 1KE1A 3K6SA 4M21A 3SLGA 1RHRA 4MQFB 3BE8A 4NOJA 1A88A 2BEKA 1Q7TA 4IXWA 2ERYA 1BD4A 4A27A 2EKPA 3KQYA 2B4TO 1Q44A 5TXGA 3U4AA 5DCLA 4UEWA 1GILA 3UNXA 1NHGA 4DNPA 3IOYA 2LPMA 2D00A 2APJA 3QZUA 1Z5NA 2OHIA 4HVAA 4QOEA 4RGYA 3WFJA 3ZVLA 2HW8A 4V0KA 1GCUA 4KE9A 2Z5GA 3IEUA 3VR6D 3KT8A 2EEZA 2J08A 3L0BA 2FZGA 1F8GA 4IKOA 4OI2A 4I6JA 2RAVA 4RAOA 1DWPA 2JAWA 3SJBA 4DQUA 3SVLA 3GLFE 3KSMA 4IH1A 1U9CA 1NMQA 1P60A 3L01A 4FONA 4TPKA 4KEAA 2H07A 1JSLA 4S3MA 1YZVA 4WK4B 4XJTA 3S3TA 3EEYA 4TXHA 1XMQB 5UKDA 4MWOA 3FNIA 1PZEA 1NKTA 2CV1A 1EGHA 1ETUA 4A26A 3RIGA 4JMLA 4UATA 1EWVA 1Q92A 3GD7A 1T1GA 1X9HA 6REQB 2P4UA 2HA4A 3CW2A 4F4DA 5IRCD 2VQEB 3DE6X 1ZLYA 3EGIA 1W4ZA 2OHVA 4R8VA 4R2HA 5H82A 1IHYA 2I2AA 4PQEA 3R0JA 4BVGA 3KVNA 5IMSA 3WLHA 5JEDA 4TTRA 1P6QA 1Z5ZA 1Q7CA 1S9HA 1SM4A 4Z9AA 4IV8A 3T0GA 1G8AA 2P8SA 1Y8AA 4FILA 5EIBD 2R1ZA 1POXA 5EVJA 3W6OA 3DMYA 5AKYA 4AZ3B 1TMKA 4LWOA 5K8VA 4FZRA 3ZE0B 4DADA 1DKRA 2NU7A 3LS2A 421PA 4EO4A 1DBIA 1NBWB 3GX1A 3LVRE 3B1KA 3O83A 3Q9SA 4ER6A 5KNBD 4DR6B 4CM9D 4BNXA 5JECA 2VF5X 4QJ4A 4X6UA 3GLGA 1V48A 4IHJF 4ZPJA 4H08A 4QYIA 3RLIA 3VX3A 5JCOC 5E1MA 2SKDA 1IC6A 2ACWA 4TV8A 4CLOB 3QHQA 4NJMA 1Y48E 2W6MA 3TLXA 5K20A 4KWHA 3T38A 1D07A 1PYGA 1X8XA 5HJ7A 4KV7A 4GPEA 2QD2A 4UUMA 1R3UA 1AQYA 2VDKB 4RHYA 2YL2A 3ON5A 1F6DA 3G9ZA 4MW2A 1DZIA 3R5KA 3R3SA 3LGSA 3SHWA 1CEXA 3IA2A 4NABA 2K7ZA 4PRZA 3X1WA 1E3MA 1AKQA 3WRWA 3PEUA 3GCGA 3RRMA 1H2EA 2KI5A 3JQGA 4ABYA 5J4YA 1NMYA 1LSJA 2R60A 1ORIA 2XAAA 4K03A 4KQ2A 5FIUA 1Z47A 2FN4A 3HY6A 5AKLA 2IKQA 5LYYA 3UK2A 5IJZA 4AKTA 3AONB 3I5XA 1O0SA 1E9AA 3COVA 4JVSB 4M9QA 5E3JA 4R1MA 4URUR 1EX6A 1A9OA 1DG3A 1F5SA 1GDHA 4WQMA 2I0FA 4XSHA 2V45A 3WIEA 5DCWA 4RVHA 1MAUA 2HCTA 3DTNA 4DG5A 4Z4GA 3H6GA 3MTBA 1RI5A 4DA7A 5CVUA 3OT1B 1KDRA 4WKCA 4KAAA 2AMVA 1P1IA 4NX2A 2WVHA 1PD0A 5CHEA 5A6SA 4M7RA 4MEAA 2IWHA 3O82A 1ZCAA 4D98A 4E15A 5B1YA 4QBTA 2ZTVA 1P2FA 1T6XA 16PKA 1VI5A 1U31A 3INGA 3NKLA 3B60A 4N3AA 1K5HA 5EJFA 5CFLA 1RXCA 3I9OA 2JFVA 1RI2A 4TMTA 5BY2A 3DZ8A 5JRJA 1Z2NX 4PQRA 2XQVA 3SSNA 3CUTA 3L9XA 2IPXA 4JDUA 2V6JA 3QY0A 4W8OA 1T36B 2M6RA 3OSZA 4OHMA 3R9XA 2DSNA 2ECQA 4N5NA 1RWKA 2TYSB 1FLVA 3MTQA 1EFAA 3ZJYA 2PVCA 5AVZA 3LM8A 2ISCA 2E6KA 1U02A 4NZYA 3M6LA 4JLBA 3BSWA 4HZGA 3L1IA 3QE4A 1UOQA 4XE5A 4TSFD 3TDKA 3FWPA 4FEGA 2AOTB 2O0MA 3S81A 4LSZA 4BQOA 4UFPA 1NI5A 3LT2A 4FSHA 4BZWA 3D2AA 4LYDA 2W83A 4EVQA 1C9MA 3TZLA 3FD8A 2IHKA 3PL5A 1B6TA 4LQCA 5KSYA 1RWWA 3OTGA 5CT5A 4TSKA 2J3MA 4QPZA 4ZYUA 4I6GA 5EUBA 3B89A 5HRCA 1PAUA 1KJ9A 3UAZA 4U9IS 2VCEA 2AEJA 3U2QA 3ANLA 3B3JA 1UWVA 2ACKA 4ZVKA 3HJTA 2BZSA 4X6YA 4X7RA 3AIMA 3RHZA 3VPCA 1ZSYA 4RZ3A 3WLQA 4UU0A 4BYGA 2GERA 2H2AA 3M1IA 4JS0A 2ATCA 3N2IA 4JJFA 1HT1E 5IULC 4MVJG 1BWRA 3W3AH 1S3IA 4AC9A 4U2EA 2PD3A 2C2HA 4BNZA 4K86A 1G6KA 1KBOA 4ZO6A 4D74A 3C8HA 3PCRB 2XDQB 2Y4NA 1VKNA 1MO2A 1GIAA 4BZQA 5BXQC 4MUXA 1YTLA 3R6WA 2DPXA 4ERXA 2IYEA 3NKFA 1Y6QA 2CJXA 2WIKA 5E4JA 1A72A 3AZOA 3K20A 2A0UA 4QJIA 4AMZA 2XVYA 4M8LA 5I9BA 2ZP1A 4C43A 5EEGA 3HZRA 2PZAA 2FVXA 3H5NA 3RVPA 3LUHA 5KWEA 2Q6IA 1JMKC 3EXFA 2PVSA 1S02A 1LPAB 1J06A 4YFVA 5IDXA 4GL2A 5BSHA 4O33A 2EKDA 3TLYA 3ELDA 1A2OA 1FNCA 3LTEA 4I66A 3I5UA 5B55A 3SQLA 4HSEA 2WT9A 1TEXA 2V3VA 5REQB 1M10A 3LRPA 3PSAA 1JAHA 3HB5X 4QGHA 2B1JA 3VUEA 3ZKWA 4BV8A 3ANTA 4C4PA 2QNBA 3SEFA 5FL7A 2EGGA 1FVOA 5BN4A 4P84A 2X8JA 3O9VA 2F64A 1N2BA 2MINA 2VJMB 3MQ2A 1OQAA 2IUSA 2JAOA 3MB8A 1H2XA 3L02A 2H1VA 4QBIA 5T6MA 13PKA 2JPDA 1XLTC 2VHQA 3GPCA 4HGZA 4LJ6A 5EE9A 5FF9A 1GA4A 1ZVQA 5GP1A 1E2JA 4MGEA 5GINE 5L3VA 2R66A 3U80A 1NPYA 3KYIB 3OCCA 2HIAA 4ALLA 1UMBB 4NMHA 3T9FA 2D2VA 2ZWPA 3VGPA 5E95A 3AP3A 4BBJA 1OLUA 2G8NA 1VBNA 3IO3A 4OF4A 3V7UA 3AERA 4OFWA 1QHHB 2XKAA 1CJCA 4WACA 5KJCA 1EM8A 1U4OA 2HGZA 3BIFA 5FWYA 2CLFB 1IOZA 2V5UA 1HF3A 3IBGA 3KE9A 4LDNA 1ZH2A 4WCFC 1PZHA 5I9SA 3VU9B 2B35A 3ZY6A 4N82A 3D8SA 3PT9A 4OHRA 1WV1A 2X5XA 4AY2A 1T9CA 4MR9A 5CM2Z 1Q3KA 1EBUA 1JDUA 3R7WB 3RC8A 3RBXA 4NCKA 1AY0A 1UQUA 4A92A 4I55A 1EDEA 4XQGA 3OLZA 1LPNA 5JV5A 4B3DA 5AT1A 5H68A 1JKXA 4M8SA 4GSKA 2H3HA 3K1AB 2BTEA 2OGUA 3ZDCA 3JY6A 1MO6A 3LXRA 1DRVA 3DOIA 3BMCB 3UWMA 1W0JD 4ENUA 1NR1A 5IJ9A 4FBMA 4B33A 4HYEA 1XP5A 1DO2A 3CZ5A 3KAPA 5AW1A 2JG3A 3P32A 4H31A 4LMAA 2AA3A 5KQLA 3OJEA 4UTVA 4YMGA 4GDMA 1HKHA 4GR4A 4K1LA 4UUOA 5LBUA 4GUDA 3WK7A 2X3FA 3RVKA 2H7XA 3PC2A 5E1DA 3VHXB 2IYTA 3FFWA 3K9CA 3NU1A 4M76B 1Z3IX 3U26A 3WNQA 3N58A 2PU7A 3K0FB 4WUVA 3BB4A 2FEOA 4UMVA 2OVFA 5DHAA 2PS9A 1OROA 1B16A 3OZBA 1YI1A 3PTZA 4UE2A 2QJOA 5DGIA 2RK3A 5NLLA 1YRHA 4WFIA 3G85A 4EPRA 4FQ5A 5B1EA 5LA6B 3FBTA 3Q9NA 4DDWA 4B81A 3NHLA 3R40A 4ZI2A 1C4XA 2B8JA 4FYPA 3AETA 3E9MA 2PCLA 3MLEA 4IOKA 5DNEA 4ZVOA 3CG0A 1Z9BA 3TTYA 3BRWD 5A9TA 3A4MA 3E03A 4JI0B 4FTWA 3DPSA 1LFAA 3HU1A 3CZMA 2BZGA 2VQSA 3EZLA 3OQNA 2RH9B 3QTBA 1EQ2A 2NU8A 3SYLA 2ZUEA 4QDUA 3KUUA 3ZWVA 1Y3FE 4IJQA 4UQPA 1W2WB 2NZWA 4Q4HA 4W5QA 4MA5A 4X20B 1QTIA 2XMGA 3D1VA 4H15A 1G1MA 2Y76A 2ZW9A 3FKSD 3INNA 4G63A 3OC0A 4I14A 4Q39A 5HGXA 4OHKA 1N7HA 1VHLA 5EKDA 4QAQA 3RU3A 2OZLB 2BM9A 1QIMA 3DOOA 3HRHA 3OIGA 3B6JA 2LUOA 4P3XA 4JQCA 2H7CA 3ZE2B 1W581 4TLAA 4ZRNA 3IRVA 2C7PA 3ROQA 3TCKA 2YS7A 3EC7A 3PX2A 2ZTUA 3R5SA 3QWBA 1PJLA 3HFGA 3WX0A 5CAEA 5FUMA 1DBVO 3GRVA 2PKYX 2XW6A 4BO8A 1EFRA 1JDVA 4X85A 1IN7A 4Z4HA 2YJGA 2UVQA 4O3MA 5J2UA 2BMFA 3DBHA 3PQ8A 1Z2EA 4DE5A 1TTTA 5GGXA 2I7CA 4RPIA 1J49A 4E32A 1GSHA 5LQUA 2GAOA 3I1FA 1OHHD 1CJVC 2WUEA 3GROA 3K2QA 2O8EB 2F90A 2R1VB 5LQJA 4RD4A 4QPJC 2XECA 4BQEA 3BRQA 4UHDA 4K6FA 4JA0A 4LYAA 4WUTA 3WVNA 4RK6A 5BORA 2F00A 3ZU3A 5CYOA 3UHAA 2OXEA 4N76A 2ZT7A 2QJWA 2Q49A 3EBPA 2MT9A 3MWYW 2ZQZA 5HSGA 1NHWA 3OHMA 4HNSA 4I7EA 5G1NA 3U49A 1DAKA 3V80A 4A1OA 1SCIA 1W76A 4G97A 2BCEA 1UJ5A 2R0QC 4HN4B 1RWMA 4OU4A 1ULZA 1P2UA 2VQFB 1M1YA 2VH5R 2E21A 2RHLA 2VT2A 1NLYA 2PQMA 1Q7RA 2E18A 2W43A 3NHAA 3E7FA 4JEMA 5ERGB 3VZCA 1LDBA 4KAFA 1MGPA 1WY7A 2B1GA 1QH9A 1Q0SA 2C2YA 4X93A 3T9AA 4C4XA 2ZSHA 4IIDA 2ZT5A 3DWGA 1CJTC 3IFSA 2KPOA 2V3WA 3AM3A 1ESCA 5F2EA 3LSYA 1QH1B 3DB1A 4NU6A 5DU2A 4M37A 4ILEA 1C1XA 5AVVA 2YCBA 3A4IA 1SVWA 2B1QA 4GKJB 1SQSA 2GK3A 4HAIA 2OKGA 1E1NA 4B3GA 2XI4A 4ZYLA 2D1SA 3EHDA 3P97A 1Z17A 5KVVA 3JYHA 2F3SA 3VVCA 5C7OO 4V0QA 3JASB 3DZHA 1LPPA 1YBAA 3QMVA 4RDCA 2Q8NA 2YICA 3IP1A 1J20A 5C4GB 2HRZA 2HQOA 2IS6A 1CF4A 2I2CA 5DNDA 4N54A 4Q24A 2O7NA 3HDYA 2HBRA 4K6GA 4J2TA 4RLQA 4WFQA 3C3MA 4DUGA 4UEQA 1FP7A 5ERXA 1SXJD 2C42A 4LYHA 1V96A 5AESA 4OHZA 5LU9A 3PGJA 3ZCQA 4CFZA 1E0AA 3FZYA 2ABWA 2Q3EA 4DAOA 1ZGGA 2IEDA 3KKZA 4QHTA 3G8CA 2CXQA 2Q0SA 2QLJA 3IKVA 5TT1A 5IKPA 3IJ5A 1VPEA 1GAWA 3IT1A 1Z6AA 1UFOA 1K8ZB 1XXHB 4YXWD 2F4VB 2XT0A 3GLSA 3RI3A 1JEEA 1F8XA 4WESB 5CVVA 5K9ZA 2JCGA 2JJ2A 4AJIA 4LZPA 4LFCB 1GU7A 2Z58A 5AW4A 3DKRA 1WBDA 4YQZA 1O1YA 3DVAA 2Y77A 1QRSA 4ZO8A 5ALRA 1QV6A 3VOTA 2H4FA 4QXAA 4BFCA 5BYAA 2JFNA 3IL2A 1EINA 4YQEA 3WL8A 4JEIA 1E2QA 2ZJOA 2QRJA 4KLCA 4JB2A 2OG2A 3D0KA 4BJ1A 1TQHA 1JFSA 5C81A 2J85A 4A0RA 4RY8A 2WOJA 3IKMB 1TT5B 3RARA 2I6TA 4V1CB 1UKYA 2DQ4A 4AZ3A 3E7WA 3HWRA 1NI4A 2YS6A 5CRIA 3VXKA 4Q7EA 4EY7A 3RVLA 3IS3A 3HJHA 3WQHA 4J7CA 3HO1A 1VSTA 3ADPA 5L45A 2CSXA 4DKXA 1AV6A 1RWQA 3GT7A 2NO0A 4D3DA 3AV0B 2LD4A 1DUVG 1Q74A 1HFWA 4BCBA 3U7GA 4YMUA 2R6R1 3LFUA 4L51A 1WD7A 4GGPA 2QVZX 2WV7A 4L3OA 4OMCA 1RQ2A 1NONA 1SHKA 1ZCFA 3R0QA 4URHA 4W4TA 3X2FA 4BTVA 1T24A 3COSA 4G1VA 2IP1A 4LRWA 4XDZA 5LD2C 1GYPA 4C0SA 1AGNA 2NIPA 5F7XA 4OAOA 1WMFA 4ON9A 3E3OA 3RSQA 2OOSA 4D0GA 4EVSA 5FX2A 2A9OA 4D99A 5IH7A 3D3QA 2ZIWB 1R8XA 1TQ2A 4Z9BA 1IL0A 1U7OA 2XIJA 2ETXA 3Q98A 4DM7A 4V39A 3WIOA 1ZIDA 4XSGA 2ZWMA 2J0UA 4KR2A 2R44A 2ZR0A 1XNRB 3OLYA 4D96A 1TRKA 4WCVA 5MHTA 4J9VA 4D5EA 1ZL2A 4MQ5A 3T95A 4MDYA 4ZC8A 1U3FA 3IEKA 4A0GA 5ELXA 2XHZA 2UYYA 2WFAA 1RYFA 3L4BC 4M60A 1PO7A 1W36C 3JQ7A 1YRLA 3ORRA 2PZFA 3EZ2A 4CTMA 4P98A 1AKMA 2WM8A 1UBFA 5FULA 4DYDA 2VPWA 3BCRA 4Q3CA 1FX0A 3QF4B 1TD1A 2OILA 3QVSA 1OFVA 3LCCA 1N6KA 2DBYA 5DDIP 3IUSA 3T0FA 1LTHR 1S2LA 1A0OA 3K4PA 4U7FA 3T9CA 1Z7EA 5HZMA 1Z37A 2WV9A 4ZMBA 1CK4A 4P32A 3EBOA 1BCSA 3AKEA 1J2YA 3DOHA 3DVRX 3IV6A 4MWGA 1DS6A 1ECCA 3BSFA 3Q6IA 4HB4A 3TRFA 1P61B 2Q9AA 2WF5A 4DBLC 5I47A 2CLMB 3RVOA 3VDNB 2Y0PA 2BGKA 1XDBA 5IM4F 2IXGA 4GR9A 4DWVA 2J5XA 3I92A 5HBRA 4J6EA 4UBNA 4BCCA 1OZHA 4IBOA 4IW3B 1UOOA 1NI3A 1LF5A 1HNWB 3C7AA 5K4GA 4IRUB 4RD2A 3TMYA 3VNVA 4E33A 4P33A 4XR9A 3MGGA 4WN9A 2JC3A 3PYLA 4L0MA 5HIKA 1EH5A 2P9BA 3B5IA 4MV9A 1E5VA 1V16B 3SXUA 3EGWA 3QXHA 4LK3A 5LNK1 1OLSB 3CZCA 3LI2A 5LA6A 3TPFA 2GM3A 5A2GA 4OH7A 4ZVQA 2O4CA 3TUZC 1FP4A 2Z43A 2LTAA 3BXFA 3NVDA 4PSUA 4WSOA 4F1JA 1RMQA 3IKTA 4OVKA 5KO2A 3BRWA 5LZ8A 3AHCA 5HQTA 3FZEA 1J9ZA 1AQUA 1COZA 3LYHA 2IYXA 4GEGA 3FYUA 6GPBA 1RQPA 4AROA 2WA2A 3SYNA 3ME5A 1B43A 3V1NA 1ZOSA 4YCDA 2YIVX 3BUSA 4M87A 5ALQA 3ZDYB 1BJTA 3H9CA 1T3GA 3COZA 2PVPA 4MUGA 2P77A 3F90A 5EOVA 4OHYA 3BGSA 4MSUA 3RUIA 1W46A 4N8SA 2O0LA 4FNMA 2FZ5A 3CT4A 3U9SA 3X2EA 1ZSNA 3QPVA 3VM6A 4UPEA 3GLTA 5DE3A 4EPXA 3PRHA 4LXGA 3LUDA 5E7IA 4XLLA 3HYTA 3TLKA 3WBFA 3QLUA 1L4BA 3LQ2A 4D82A 4IIJF 1KYVA 1RXIA 4MKRA 3LZ6A 2H17A 3WHPA 5F5NA 3M9WA 4UFNA 5DGCA 1Z2DA 3VTZA 1AQNA 3QFRA 2ZDQA 3JR3A 3C2QA 5CXUA 4JP5A 2IWRA 3U7JA 4BTLA 2HH9A 2J7PD 3MBIA 4NAUA 4HLDA 3WNBA 1WTAA 4W7IA 4EB3A 2WDPA 1PT9A 2J9ZB 4FKZA 4JP1A 5BUSA 3DDHA 2NU9B 1V9CA 1Z5VA 3NDRA 1MB9A 3FNQA 1WCWA 1K88A 4QD3A 1TNDA 4AUKA 2GM5A 2MCFA 5GTDA 5ILGA 1LNZA 3GJ3A 3GLIA 2JLXA 1DEAA 4GAEA 1JEOA 1QUEA 2AUMA 2BFEB 2VDNB 5JMPA 3W2GA 5DN6D 3SM3A 1D2CA 2JA2A 2E2WA 2KX7A 3HC7A 3PC6A 3TOZA 4HHEA 2NQ8A 8ATCA 4FFMA 3OO1A 1IZYA 4BV2A 1FYDA 5GMOA 2IIVA 2NG1A 1NASA 1ISMA 4JLWA 1CDOA 4XUEA 1YHYA 2D0DA 3U40A 4CT0A 3W8NA 4II3A 5KVSA 2PQ6A 2MIIA 4UXHA 3LKBA 1H94A 1XE3A 3ZNPA 4MLDA 5C37A 1RHKA 1WCXA 1ZMOA 1J00A 4YB8A 3BE6A 3GT3A 4LZLA 1CW2B 3HKEA 4KRXA 2PYDA 3F49S 1NRXA 3QKSB 2F55A 3M6XA 2MU1A 4TMXA 2AW3A 1Z0JA 2NO9A 5MGBA 3RIMA 5HJEA 1O9GA 1YAHA 3B3AA 1T25A 5JI3E 4JSYA 1TKRA 2GZ1A 4BKOA 1QU2A 1J33A 2HF9A 2VDJA 1S3GA 4CI0B 3QLJA 1HEYA 4D8WA 1RXWA 2A33A 1WZEA 3KVRA 1I80A 2JHAA 1VLLA 1PT8A 1SNYA 3AZPA 1LDGA 4U2BA 1CJBA 4LRSB 2VPTA 2JGNA 3GRRA 3HVJA