5C36A

Crystal structure of gta + udp-c-gal + di
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
288
structure length
288
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 288
sequence length 288
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c36A00
2Y7AA 4FREA 2VFZA 3F1YA 1ZCUA 1ZCVA 3POLA 1MC3A 2P72A 1EZIA 2Y4LA 4AYLA 3CKJA 1OQMB 2V0KA 5FUHA 3OC9A 5BXCA 3U0XA 1FZWA 4EEGA 3V8YA 2I7BA 3ZGGA 1S4NA 2Q4JA 4D11C 2O1FA 3LW6A 3GUEA 1HJLA 1YROB 1VGTA 3CKNA 4Y64A 1INJA 4B4GA 3DK5A 2BO6A 1VGWA 4M28A 1ZJPA 5C1HA 2YQHA 2RIXA 4NAKA 3CKVA 2FYAA 5DDTA 1JVGA 1W57A 2XWNA 4LW3A 4HO5A 2W0WA 4AC3A 5AJOA 1ZJ1A 4G3PA 1VM8A 1FGXA 3PKQA 3CGXA 4M4KA 1QWJA 5C4BA 5EIYA 1O7OA 3T7OA 4KRVA 1JV1A 2QH5A 2E3DA 2FYCB 2V0JA 2OI7A 3V90A 4HO4A 4G87A 1GQ9A 5C8RA 5CMFX 4IRQA 2Y4MA 2AM5A 3QVBA 5CQMX 1IINA 3I0HA 2PA4A 4E1KA 3SXBA 2FFUA 4B4MA 2YQSA 4Y7FA 4ASYA 1GX0A 4EE5A 1YP3A 1VZTA 3FOQA 3ZLKA 4BMAA 5C48A 1ZCTA 4Y6NA 4KC2A 5FYEA 5FTSA 3CU0A 4DE7A 2Z86A 4ASJA 4KNRA 1FXOA 1LZJA 1R7XA 3U2TA 1MP4A 4HO2A 2VSIA 4Y7GA 4DECA 2RJ7A 2RJ0A 5C3BA 1S4PA 1OMZA 2RJ5A 3JUJA 3V0PA 4FRHA 1V84A 2FFVA 1G8OA 3SXDA 1V83A 5L6SA 4KQLA 2WVKA 5C47A 2RIZA 2VXLA 5DDVA 1LVWA 3OH0A 3I0CA 1HM9A 1JVDA 2XMHA 1MP3A 1JYKA 4K6RA 2FYDB 4P02A 2V0IA 3BRKX 1HV9A 4HO9A 5CQOA 2NXVA 2ZU8A 1H4EA 3T7NA 3U2VA 1TW5A 3JTJA 1WT2A 3D8VA 4KPXA 1ZI1A 1NWGB 2X5ZA 1O23B 4JD0A 4FRMA 1ZI5A 2Y4JA 4AYJA 2Z87A 3CKQA 1W77A 3I0KA 1NQIB 5FTVA 4UEGA 4CJCA 1JYLA 5AJNA 3SPTA 1LL0A 5EJZA 3U0YA 5J49A 1VPAA 2QGIA 3K8DA 4FROA 1VZUA 1ZDFA 2BO4A 1OMXA 2X5SA 2JCKA 3PNNA 5EJ1A 2YC3A 2YQJA 4FRQA 4FCEA 3R2WA 4HO6A 1H4DA 4MNDA 4C2SA 1QG8A 1GA8A 2YQCA 5JQQA 1O0RA 1H5SA 1ZCYA 5I1FA 4G3QA 3ST8A 1R7VA 3Q4SA 3SX5A 4KNXA 4EE4A 1ZDGA 5C3DA 3V0LA 1NHEB 4R7PA 3V8ZA 2BO8A 1YP4A 2VXMA 5IDSA 1H5TB 3SXEA 2V0LA 3TQDA 1E5KA 1PZYB 1H5TA 4Y6UA 3Q7UA 1HM0A 1VZXA 1R82A 3U2WA 3EE5A 1H5RA 4KXOA 4B2XA 1H7LA 2A8UA 3JUKA 4KPZA 3R3IA 1VGZA 2AESA 4LW6A 4DDZA 2O1GA 1S4OA 1FWYA 5C38A 3CKOA 4ARWA 1H7QA 4FRAA 3SXAA 1NF5B 5C4CA 2AM4A 5FU8A 1H5SC 5FV9A 4JISA 4CJBA 3SXGA 1H3MA 1FO9A 2WVLA 1WT0A 4Y62A 3I0EA 4L41C 4EEOA 1FR8A 2YC5A 4KT7A 2PX7A 4GBPA 4G3SA 2VS3A 2RIYA 3OH3A 1NKHB 4B4BA 1XZ6A 1FOAA 2GGOA 5HS2A 1LL3A 2ICYA 2I5KA 2UX8A 1FRWA 4KC1A 1VICA 5C1GA 4HG6A 2MZBA 2YCMA 3Q80A 2OEFA 3I0LA 3OH4A 1IIMA 2OI6A 4B2WA 1VGUA 3USRA 4CVHA 4NALA 1KWSA 1R80A 4J18A 3NGWA 1QGSA 2D7IA 1K4VA 4FCUA 4M2BA 2FYBA 4HOCA 1WT3A 5C4DA 2XWMA 3DUVA 4FRDA 5IFYA 1R81A 2XWLA 2V0HA 1G2VA 3D5NA 2ZU7A 2AE7A 3V0MA 1INIA 2OEGA 1G3LA 2RJ8A 4FRBA 1WVCA 4FRPA 1XHBA 1TW1A 2P6WA 3RMWA 5C3AA 1TVYA 1ZHJA 2P73A 3I0DA 3V0OA 4D48A 1R7YA 2QKXA 3OGZA 2APCA 2RJ4A 4HCQA 1O7QA 2WE9A 1GQCA 2RJ1A 1ZJ3A 3PKPA 2W0VA 2WGZA 3U2UA 2WAWA 1FG5N 4Y9XA 5C49A 3KIAA 4HO3A 2PGYA 4FQWA 2RITA 2E8BA 4B42A 1H7HA 2Y6PA 3DJ4A 5FU0A 2GGQA 4Y7TA 3SX3A 2WEEA 1H5SB 2X65A 1G95A 2OI5A 3HL3A 2VS4A 1V82A 3USQA 1GX4A 3ZF8A 3TZTA 1LZIA 1WSZA 4Y7VA 4XWIA 3SX7A 3D98A 5CMIA 3IOIA 1TZFA 1G9RA 3OAMA 3I0GA 3OH2A 3K8EA 5L6VA 1LZ0A 2RJ6A 2XMEA 3SX8A 1H5RB 5CMJA 4ECMA 4EVWA 3BCVA 3FWWA 3N9WA 4FRLA 1ON6A 2D7RA 1G97A 1ZIZA 3ZGFA 5C1LA 1H7EA 1VH1A 2AGDA 2JCLA 2RJ9A 2VSHA 1LZ7A 1ZI4A 2FY7A 1ZJOA 4HO8A 3RMVA 5CMHA 4M2AA 1YP2A 5CQNX 4AAWA 1GWWA 4NANA 4NAIA 1ON8A 2D0JA 1MP5A 2O1HA 4D0TA 1G0RA 2JCJA 1GWVA 2Y4KA 3I0FA 1G93A 4Y7UA 2DPWA 1R7TA 3T7MA 1LL2A 2ICXA 5C4FA 3I0IX 2YESA 1I52A 4Y63A 4HO0A 2JCOA 4YS8A 2VS5A 4EEAA 3RSBA 4BQHA 1ZJ2A 5C36A 1QGQA 4IRPA 5AJPA 2WVMA 1ZJ0A 1NMMB 2I5EA 4CJ8A 5CQPA 2PGVA 3IOHA 1H7FA 3I0JA 1WT1A 4KC4A 3V91A 1EYRA 3U2XA 1H5SD 4D0ZA 3OKRA 2A8WA 2AH9A 2ZU9A 5C4EA 1FXJA 2CU2A 3V0NA 4ZDQA 2BO7A 1H7GA 3E26A 2AECA 2X60A 1HM8A 3IOJA 4B3UA 5CMGX 1G1LA 1G23A 1PZTA 1ZI3A 1SS9A 3SXCA 1JV3A 1W55A 2VD4A 4P00A 1Z90A 3OH1A 5IDTA 1R7UA 3F1CA 4D11A 1H7TA 4B5BA 1FR9A 2AM3A 4EEMA 5CQLX 3V0QA 3E25A 3O3PA 4EE3A 1VH3A 4MYBA 1FO8A 1H4CA 3ZLLA 1FGGA 1HJJA
chains in the Genus database with same CATH superfamily
2Y7AA 4FREA 2VFZA 3F1YA 1ZCUA 1ZCVA 3POLA 1MC3A 2P72A 1EZIA 2Y4LA 4AYLA 3CKJA 1OQMB 2V0KA 5FUHA 3OC9A 5BXCA 3U0XA 1FZWA 4EEGA 3V8YA 2I7BA 3ZGGA 1S4NA 2Q4JA 4D11C 2O1FA 5D92A 3LW6A 3GUEA 1HJLA 1YROB 1VGTA 3CKNA 4Y64A 1INJA 4B4GA 3DK5A 2BO6A 1VGWA 4M28A 1ZJPA 5C1HA 2YQHA 2RIXA 4NAKA 3CKVA 2FYAA 5DDTA 1JVGA 1W57A 2XWNA 4LW3A 4HO5A 2W0WA 4AC3A 5AJOA 1ZJ1A 4G3PA 1VM8A 1FGXA 3PKQA 3CGXA 4M4KA 1QWJA 5C4BA 5EIYA 1O7OA 3T7OA 4KRVA 1JV1A 2QH5A 2E3DA 2FYCB 2V0JA 2OI7A 3V90A 4HO4A 4G87A 1GQ9A 5C8RA 5CMFX 4IRQA 2Y4MA 4O6NA 2AM5A 3QVBA 5CQMX 1IINA 3I0HA 2PA4A 4E1KA 3SXBA 2FFUA 4B4MA 2YQSA 4Y7FA 4ASYA 1GX0A 4EE5A 1YP3A 1VZTA 3FOQA 3ZLKA 4BMAA 5C48A 1ZCTA 4Y6NA 4KC2A 5FYEA 5FTSA 3CU0A 4DE7A 2Z86A 4ASJA 4KNRA 1FXOA 1LZJA 1R7XA 3U2TA 1MP4A 4HO2A 2VSIA 2J0BA 4Y7GA 4DECA 2RJ7A 2RJ0A 5C3BA 1S4PA 4MIXA 1OMZA 2RJ5A 3JUJA 3V0PA 4FRHA 1V84A 2FFVA 1G8OA 3SXDA 1V83A 5L6SA 4KQLA 2WVKA 5C47A 2RIZA 2VXLA 5DDVA 1LVWA 3OH0A 3I0CA 1HM9A 1JVDA 2XMHA 1MP3A 1JYKA 4K6RA 2FYDB 4P02A 2V0IA 3BRKX 1HV9A 4HO9A 5CQOA 2NXVA 2ZU8A 1H4EA 3T7NA 3U2VA 1TW5A 3JTJA 1WT2A 3D8VA 4KPXA 1ZI1A 1NWGB 2X5ZA 1O23B 4JD0A 4FRMA 1ZI5A 2Y4JA 4AYJA 2Z87A 3CKQA 1W77A 3I0KA 1NQIB 5FTVA 4UEGA 4CJCA 1JYLA 5AJNA 3SPTA 1LL0A 5EJZA 3U0YA 5J49A 1VPAA 2QGIA 3K8DA 4FROA 1VZUA 1ZDFA 2BO4A 1OMXA 2X5SA 2JCKA 3PNNA 5EJ1A 2YC3A 2YQJA 4FRQA 4FCEA 3R2WA 4HO6A 1H4DA 4MNDA 4C2SA 1QG8A 1GA8A 2YQCA 5JQQA 1O0RA 1H5SA 1ZCYA 5I1FA 4G3QA 3ST8A 1R7VA 3Q4SA 3SX5A 4KNXA 4EE4A 1ZDGA 5C3DA 3V0LA 1NHEB 4R7PA 3V8ZA 2BO8A 1YP4A 2VXMA 5IDSA 1H5TB 3SXEA 2V0LA 3TQDA 1E5KA 1PZYB 1H5TA 4Y6UA 3Q7UA 1HM0A 1VZXA 1R82A 3U2WA 3EE5A 1H5RA 4KXOA 4B2XA 1H7LA 2A8UA 3JUKA 4KPZA 4Q7CA 3R3IA 1VGZA 2AESA 4LW6A 4DDZA 2O1GA 1S4OA 1FWYA 5C38A 3CKOA 4ARWA 1H7QA 4FIXA 4FRAA 3SXAA 1NF5B 5C4CA 2AM4A 5FU8A 1H5SC 5FV9A 4JISA 4CJBA 3SXGA 1H3MA 1FO9A 2WVLA 1WT0A 4Y62A 3I0EA 4L41C 4EEOA 1FR8A 2YC5A 4KT7A 2PX7A 4GBPA 4G3SA 2VS3A 2RIYA 3OH3A 1NKHB 4B4BA 1XZ6A 1FOAA 2GGOA 5HS2A 1LL3A 2ICYA 2I5KA 2UX8A 1FRWA 4KC1A 1VICA 5C1GA 4HG6A 2MZBA 2YCMA 3Q80A 2OEFA 3I0LA 3OH4A 1IIMA 2OI6A 4B2WA 1VGUA 3USRA 4CVHA 4NALA 1KWSA 1R80A 4J18A 3NGWA 1QGSA 2D7IA 1K4VA 4FCUA 4M2BA 2FYBA 4HOCA 1WT3A 5C4DA 2XWMA 3DUVA 4FRDA 5IFYA 1R81A 2XWLA 2V0HA 1G2VA 3D5NA 2ZU7A 2AE7A 3V0MA 1INIA 2OEGA 1G3LA 2RJ8A 4FRBA 1WVCA 4FRPA 1XHBA 1TW1A 2P6WA 3RMWA 5C3AA 1TVYA 1ZHJA 2P73A 3I0DA 3V0OA 4D48A 1R7YA 2QKXA 3OGZA 2APCA 2RJ4A 4HCQA 1O7QA 2WE9A 1GQCA 2RJ1A 1ZJ3A 3PKPA 2W0VA 2WGZA 3U2UA 2WAWA 1FG5N 4Y9XA 5C49A 3KIAA 4HO3A 2VK9A 2PGYA 4FQWA 2RITA 2E8BA 4B42A 1H7HA 2Y6PA 3DJ4A 5FU0A 2GGQA 4Y7TA 3SX3A 2WEEA 1H5SB 2X65A 1G95A 2OI5A 3HL3A 2VS4A 1V82A 3USQA 1GX4A 3ZF8A 3TZTA 1LZIA 1WSZA 4Y7VA 4XWIA 3SX7A 3D98A 5CMIA 3IOIA 1TZFA 1G9RA 3OAMA 3I0GA 3OH2A 3K8EA 5L6VA 1LZ0A 2RJ6A 2XMEA 3SX8A 1H5RB 5CMJA 4ECMA 4EVWA 3BCVA 3FWWA 3N9WA 4FRLA 1ON6A 2D7RA 1G97A 1ZIZA 3ZGFA 5C1LA 1H7EA 1VH1A 2AGDA 2JCLA 2RJ9A 2VSHA 1LZ7A 1ZI4A 2FY7A 1ZJOA 4HO8A 3RMVA 5CMHA 4M2AA 1YP2A 5CQNX 4AAWA 1GWWA 4NANA 4NAIA 1ON8A 4O6MA 2D0JA 1MP5A 2O1HA 4D0TA 1G0RA 2JCJA 1GWVA 2Y4KA 3I0FA 1G93A 4Y7UA 2DPWA 1R7TA 2C0NA 3T7MA 1LL2A 2ICXA 5C4FA 3I0IX 2YESA 1I52A 4Y63A 4HO0A 2JCOA 4YS8A 4FIYA 2VS5A 4EEAA 3RSBA 4BQHA 1ZJ2A 5C36A 1QGQA 4IRPA 5AJPA 2WVMA 1ZJ0A 1NMMB 2I5EA 4CJ8A 5CQPA 2PGVA 3IOHA 1H7FA 3I0JA 1WT1A 4KC4A 3V91A 1EYRA 3U2XA 1H5SD 4D0ZA 3OKRA 2A8WA 2AH9A 2ZU9A 5C4EA 1FXJA 2CU2A 3V0NA 4ZDQA 2BO7A 1H7GA 3E26A 2AECA 2X60A 5D91A 1HM8A 3IOJA 4B3UA 5CMGX 1G1LA 1G23A 1PZTA 1ZI3A 1SS9A 3SXCA 1JV3A 1W55A 2VD4A 4P00A 1Z90A 3OH1A 5IDTA 1R7UA 3F1CA 4D11A 1H7TA 4B5BA 1FR9A 2AM3A 4EEMA 5CQLX 3V0QA 3E25A 2J0AA 3O3PA 4EE3A 1VH3A 4MYBA 1FO8A 1H4CA 3ZLLA 1FGGA 1HJJA
chains in the Genus database with same CATH topology
2Y7AA 4FREA 2VFZA 3F1YA 1ZCUA 1ZCVA 3POLA 1MC3A 2P72A 1EZIA 2Y4LA 4AYLA 3CKJA 1OQMB 2V0KA 5FUHA 3OC9A 5BXCA 3U0XA 1FZWA 4EEGA 3V8YA 2I7BA 3ZGGA 1S4NA 2Q4JA 4D11C 2O1FA 5D92A 3LW6A 3GUEA 1HJLA 1YROB 1VGTA 3CKNA 4Y64A 1INJA 4B4GA 3DK5A 2BO6A 1VGWA 4M28A 1ZJPA 5C1HA 2YQHA 2RIXA 4NAKA 3CKVA 2FYAA 5DDTA 1JVGA 1W57A 2XWNA 4LW3A 4HO5A 2W0WA 4AC3A 5AJOA 1ZJ1A 4G3PA 1VM8A 1FGXA 3PKQA 3CGXA 4M4KA 1QWJA 5C4BA 5EIYA 1O7OA 3T7OA 4KRVA 1JV1A 2QH5A 2E3DA 2FYCB 2V0JA 2OI7A 3V90A 4HO4A 4G87A 1GQ9A 5C8RA 5CMFX 4IRQA 2Y4MA 4O6NA 2AM5A 3QVBA 5CQMX 1IINA 3I0HA 2PA4A 4E1KA 3SXBA 2FFUA 4B4MA 2YQSA 4Y7FA 4ASYA 1GX0A 4EE5A 1YP3A 1VZTA 3FOQA 3ZLKA 4BMAA 5C48A 1ZCTA 4Y6NA 4KC2A 5FYEA 5FTSA 3CU0A 4DE7A 2Z86A 4ASJA 4KNRA 1FXOA 1LZJA 1R7XA 3U2TA 1MP4A 4HO2A 2VSIA 2J0BA 4Y7GA 4DECA 2RJ7A 2RJ0A 5C3BA 1S4PA 4MIXA 1OMZA 2RJ5A 3JUJA 3V0PA 4FRHA 1V84A 2FFVA 1G8OA 3SXDA 1V83A 5L6SA 4KQLA 2WVKA 5C47A 2RIZA 2VXLA 5DDVA 1LVWA 3OH0A 3I0CA 1HM9A 1JVDA 2XMHA 1MP3A 1JYKA 4K6RA 2FYDB 4P02A 2V0IA 3BRKX 1HV9A 4HO9A 5CQOA 2NXVA 2ZU8A 1H4EA 3T7NA 3U2VA 1TW5A 3JTJA 1WT2A 3D8VA 4KPXA 1ZI1A 1NWGB 2X5ZA 1O23B 4JD0A 4FRMA 1ZI5A 2Y4JA 4AYJA 2Z87A 3CKQA 1W77A 3I0KA 1NQIB 5FTVA 4UEGA 4CJCA 1JYLA 5AJNA 3SPTA 1LL0A 5EJZA 3U0YA 5J49A 1VPAA 2QGIA 3K8DA 4FROA 1VZUA 1ZDFA 2BO4A 1OMXA 2X5SA 2JCKA 3PNNA 5EJ1A 2YC3A 2YQJA 4FRQA 4FCEA 3R2WA 4HO6A 1H4DA 4MNDA 4C2SA 1QG8A 1GA8A 2YQCA 5JQQA 1O0RA 1H5SA 1ZCYA 5I1FA 4G3QA 3ST8A 1R7VA 3Q4SA 3SX5A 4KNXA 4EE4A 1ZDGA 5C3DA 3V0LA 1NHEB 4R7PA 3V8ZA 2BO8A 1YP4A 2VXMA 5IDSA 1H5TB 3SXEA 2V0LA 3TQDA 1E5KA 1PZYB 1H5TA 4Y6UA 3Q7UA 1HM0A 1VZXA 1R82A 3U2WA 3EE5A 1H5RA 4KXOA 4B2XA 1H7LA 2A8UA 3JUKA 4KPZA 4Q7CA 3R3IA 1VGZA 2AESA 4LW6A 4DDZA 2O1GA 1S4OA 1FWYA 5C38A 3CKOA 4ARWA 1H7QA 4FIXA 4FRAA 3SXAA 1NF5B 5C4CA 2AM4A 5FU8A 1H5SC 5FV9A 4JISA 4CJBA 3SXGA 1H3MA 1FO9A 2WVLA 1WT0A 4Y62A 3I0EA 4L41C 4EEOA 1FR8A 2YC5A 4KT7A 2PX7A 4GBPA 4G3SA 2VS3A 2RIYA 3OH3A 1NKHB 4B4BA 1XZ6A 1FOAA 2GGOA 5HS2A 1LL3A 2ICYA 2I5KA 2UX8A 1FRWA 4KC1A 1VICA 5C1GA 4HG6A 2MZBA 2YCMA 3Q80A 2OEFA 3I0LA 3OH4A 1IIMA 2OI6A 4B2WA 1VGUA 3USRA 4CVHA 4NALA 1KWSA 1R80A 4J18A 3NGWA 1QGSA 2D7IA 1K4VA 4FCUA 4M2BA 2FYBA 4HOCA 1WT3A 5C4DA 2XWMA 3DUVA 4FRDA 5IFYA 1R81A 2XWLA 2V0HA 1G2VA 3D5NA 2ZU7A 2AE7A 3V0MA 1INIA 2OEGA 1G3LA 2RJ8A 4FRBA 1WVCA 4FRPA 1XHBA 1TW1A 2P6WA 3RMWA 5C3AA 1TVYA 1ZHJA 2P73A 3I0DA 3V0OA 4D48A 1R7YA 2QKXA 3OGZA 2APCA 2RJ4A 4HCQA 1O7QA 2WE9A 1GQCA 2RJ1A 1ZJ3A 3PKPA 2W0VA 2WGZA 3U2UA 2WAWA 1FG5N 4Y9XA 5C49A 3KIAA 4HO3A 2VK9A 2PGYA 4FQWA 2RITA 2E8BA 4B42A 1H7HA 2Y6PA 3DJ4A 5FU0A 2GGQA 4Y7TA 3SX3A 2WEEA 1H5SB 2X65A 1G95A 2OI5A 3HL3A 2VS4A 1V82A 3USQA 1GX4A 3ZF8A 3TZTA 1LZIA 1WSZA 4Y7VA 4XWIA 3SX7A 3D98A 5CMIA 3IOIA 1TZFA 1G9RA 3OAMA 3I0GA 3OH2A 3K8EA 5L6VA 1LZ0A 2RJ6A 2XMEA 3SX8A 1H5RB 5CMJA 4ECMA 4EVWA 3BCVA 3FWWA 3N9WA 4FRLA 1ON6A 2D7RA 1G97A 1ZIZA 3ZGFA 5C1LA 1H7EA 1VH1A 2AGDA 2JCLA 2RJ9A 2VSHA 1LZ7A 1ZI4A 2FY7A 1ZJOA 4HO8A 3RMVA 5CMHA 4M2AA 1YP2A 5CQNX 4AAWA 1GWWA 4NANA 4NAIA 1ON8A 4O6MA 2D0JA 1MP5A 2O1HA 4D0TA 1G0RA 2JCJA 1GWVA 2Y4KA 3I0FA 1G93A 4Y7UA 2DPWA 1R7TA 2C0NA 3T7MA 1LL2A 2ICXA 5C4FA 3I0IX 2YESA 1I52A 4Y63A 4HO0A 2JCOA 4YS8A 4FIYA 2VS5A 4EEAA 3RSBA 4BQHA 1ZJ2A 5C36A 1QGQA 4IRPA 5AJPA 2WVMA 1ZJ0A 1NMMB 2I5EA 4CJ8A 5CQPA 2PGVA 3IOHA 1H7FA 3I0JA 1WT1A 4KC4A 3V91A 1EYRA 3U2XA 1H5SD 4D0ZA 3OKRA 2A8WA 2AH9A 2ZU9A 5C4EA 1FXJA 2CU2A 3V0NA 4ZDQA 2BO7A 1H7GA 3E26A 2AECA 2X60A 5D91A 1HM8A 3IOJA 4B3UA 5CMGX 1G1LA 1G23A 1PZTA 1ZI3A 1SS9A 3SXCA 1JV3A 1W55A 2VD4A 4P00A 1Z90A 3OH1A 5IDTA 1R7UA 3F1CA 4D11A 1H7TA 4B5BA 1FR9A 2AM3A 4EEMA 5CQLX 3V0QA 3E25A 2J0AA 3O3PA 4EE3A 1VH3A 4MYBA 1FO8A 1H4CA 3ZLLA 1FGGA 1HJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7A A;  4FRE A;  2VFZ A;  3F1Y A;  1ZCU A;  1ZCV A;  3POL A;  1MC3 A;  2P72 A;  1EZI A;  2Y4L A;  4AYL A;  3CKJ A;  1OQM B;  2V0K A;  5FUH A;  3OC9 A;  5BXC A;  3U0X A;  1FZW A;  4EEG A;  3V8Y A;  2I7B A;  3ZGG A;  1S4N A;  2Q4J A;  4D11 C;  2O1F A;  3LW6 A;  3GUE A;  1HJL A;  1YRO B;  1VGT A;  3CKN A;  4Y64 A;  1INJ A;  4B4G A;  3DK5 A;  2BO6 A;  1VGW A;  4M28 A;  1ZJP A;  5C1H A;  2YQH A;  2RIX A;  4NAK A;  3CKV A;  2FYA A;  5DDT A;  1JVG A;  1W57 A;  2XWN A;  4LW3 A;  4HO5 A;  2W0W A;  4AC3 A;  5AJO A;  1ZJ1 A;  4G3P A;  1VM8 A;  1FGX A;  3PKQ A;  3CGX A;  4M4K A;  1QWJ A;  5C4B A;  5EIY A;  1O7O A;  3T7O A;  4KRV A;  1JV1 A;  2QH5 A;  2E3D A;  2FYC B;  2V0J A;  2OI7 A;  3V90 A;  4HO4 A;  4G87 A;  1GQ9 A;  5C8R A;  5CMF X;  4IRQ A;  2Y4M A;  2AM5 A;  3QVB A;  5CQM X;  1IIN A;  3I0H A;  2PA4 A;  4E1K A;  3SXB A;  2FFU A;  4B4M A;  2YQS A;  4Y7F A;  4ASY A;  1GX0 A;  4EE5 A;  1YP3 A;  1VZT A;  3FOQ A;  3ZLK A;  4BMA A;  5C48 A;  1ZCT A;  4Y6N A;  4KC2 A;  5FYE A;  5FTS A;  3CU0 A;  4DE7 A;  2Z86 A;  4ASJ A;  4KNR A;  1FXO A;  1LZJ A;  1R7X A;  3U2T A;  1MP4 A;  4HO2 A;  2VSI A;  4Y7G A;  4DEC A;  2RJ7 A;  2RJ0 A;  5C3B A;  1S4P A;  1OMZ A;  2RJ5 A;  3JUJ A;  3V0P A;  4FRH A;  1V84 A;  2FFV A;  1G8O A;  3SXD A;  1V83 A;  5L6S A;  4KQL A;  2WVK A;  5C47 A;  2RIZ A;  2VXL A;  5DDV A;  1LVW A;  3OH0 A;  3I0C A;  1HM9 A;  1JVD A;  2XMH A;  1MP3 A;  1JYK A;  4K6R A;  2FYD B;  4P02 A;  2V0I A;  3BRK X;  1HV9 A;  4HO9 A;  5CQO A;  2NXV A;  2ZU8 A;  1H4E A;  3T7N A;  3U2V A;  1TW5 A;  3JTJ A;  1WT2 A;  3D8V A;  4KPX A;  1ZI1 A;  1NWG B;  2X5Z A;  1O23 B;  4JD0 A;  4FRM A;  1ZI5 A;  2Y4J A;  4AYJ A;  2Z87 A;  3CKQ A;  1W77 A;  3I0K A;  1NQI B;  5FTV A;  4UEG A;  4CJC A;  1JYL A;  5AJN A;  3SPT A;  1LL0 A;  5EJZ A;  3U0Y A;  5J49 A;  1VPA A;  2QGI A;  3K8D A;  4FRO A;  1VZU A;  1ZDF A;  2BO4 A;  1OMX A;  2X5S A;  2JCK A;  3PNN A;  5EJ1 A;  2YC3 A;  2YQJ A;  4FRQ A;  4FCE A;  3R2W A;  4HO6 A;  1H4D A;  4MND A;  4C2S A;  1QG8 A;  1GA8 A;  2YQC A;  5JQQ A;  1O0R A;  1H5S A;  1ZCY A;  5I1F A;  4G3Q A;  3ST8 A;  1R7V A;  3Q4S A;  3SX5 A;  4KNX A;  4EE4 A;  1ZDG A;  5C3D A;  3V0L A;  1NHE B;  4R7P A;  3V8Z A;  2BO8 A;  1YP4 A;  2VXM A;  5IDS A;  1H5T B;  3SXE A;  2V0L A;  3TQD A;  1E5K A;  1PZY B;  1H5T A;  4Y6U A;  3Q7U A;  1HM0 A;  1VZX A;  1R82 A;  3U2W A;  3EE5 A;  1H5R A;  4KXO A;  4B2X A;  1H7L A;  2A8U A;  3JUK A;  4KPZ A;  3R3I A;  1VGZ A;  2AES A;  4LW6 A;  4DDZ A;  2O1G A;  1S4O A;  1FWY A;  5C38 A;  3CKO A;  4ARW A;  1H7Q A;  4FRA A;  3SXA A;  1NF5 B;  5C4C A;  2AM4 A;  5FU8 A;  1H5S C;  5FV9 A;  4JIS A;  4CJB A;  3SXG A;  1H3M A;  1FO9 A;  2WVL A;  1WT0 A;  4Y62 A;  3I0E A;  4L41 C;  4EEO A;  1FR8 A;  2YC5 A;  4KT7 A;  2PX7 A;  4GBP A;  4G3S A;  2VS3 A;  2RIY A;  3OH3 A;  1NKH B;  4B4B A;  1XZ6 A;  1FOA A;  2GGO A;  5HS2 A;  1LL3 A;  2ICY A;  2I5K A;  2UX8 A;  1FRW A;  4KC1 A;  1VIC A;  5C1G A;  4HG6 A;  2MZB A;  2YCM A;  3Q80 A;  2OEF A;  3I0L A;  3OH4 A;  1IIM A;  2OI6 A;  4B2W A;  1VGU A;  3USR A;  4CVH A;  4NAL A;  1KWS A;  1R80 A;  4J18 A;  3NGW A;  1QGS A;  2D7I A;  1K4V A;  4FCU A;  4M2B A;  2FYB A;  4HOC A;  1WT3 A;  5C4D A;  2XWM A;  3DUV A;  4FRD A;  5IFY A;  1R81 A;  2XWL A;  2V0H A;  1G2V A;  3D5N A;  2ZU7 A;  2AE7 A;  3V0M A;  1INI A;  2OEG A;  1G3L A;  2RJ8 A;  4FRB A;  1WVC A;  4FRP A;  1XHB A;  1TW1 A;  2P6W A;  3RMW A;  5C3A A;  1TVY A;  1ZHJ A;  2P73 A;  3I0D A;  3V0O A;  4D48 A;  1R7Y A;  2QKX A;  3OGZ A;  2APC A;  2RJ4 A;  4HCQ A;  1O7Q A;  2WE9 A;  1GQC A;  2RJ1 A;  1ZJ3 A;  3PKP A;  2W0V A;  2WGZ A;  3U2U A;  2WAW A;  1FG5 N;  4Y9X A;  5C49 A;  3KIA A;  4HO3 A;  2PGY A;  4FQW A;  2RIT A;  2E8B A;  4B42 A;  1H7H A;  2Y6P A;  3DJ4 A;  5FU0 A;  2GGQ A;  4Y7T A;  3SX3 A;  2WEE A;  1H5S B;  2X65 A;  1G95 A;  2OI5 A;  3HL3 A;  2VS4 A;  1V82 A;  3USQ A;  1GX4 A;  3ZF8 A;  3TZT A;  1LZI A;  1WSZ A;  4Y7V A;  4XWI A;  3SX7 A;  3D98 A;  5CMI A;  3IOI A;  1TZF A;  1G9R A;  3OAM A;  3I0G A;  3OH2 A;  3K8E A;  5L6V A;  1LZ0 A;  2RJ6 A;  2XME A;  3SX8 A;  1H5R B;  5CMJ A;  4ECM A;  4EVW A;  3BCV A;  3FWW A;  3N9W A;  4FRL A;  1ON6 A;  2D7R A;  1G97 A;  1ZIZ A;  3ZGF A;  5C1L A;  1H7E A;  1VH1 A;  2AGD A;  2JCL A;  2RJ9 A;  2VSH A;  1LZ7 A;  1ZI4 A;  2FY7 A;  1ZJO A;  4HO8 A;  3RMV A;  5CMH A;  4M2A A;  1YP2 A;  5CQN X;  4AAW A;  1GWW A;  4NAN A;  4NAI A;  1ON8 A;  2D0J A;  1MP5 A;  2O1H A;  4D0T A;  1G0R A;  2JCJ A;  1GWV A;  2Y4K A;  3I0F A;  1G93 A;  4Y7U A;  2DPW A;  1R7T A;  3T7M A;  1LL2 A;  2ICX A;  5C4F A;  3I0I X;  2YES A;  1I52 A;  4Y63 A;  4HO0 A;  2JCO A;  4YS8 A;  2VS5 A;  4EEA A;  3RSB A;  4BQH A;  1ZJ2 A;  5C36 A;  1QGQ A;  4IRP A;  5AJP A;  2WVM A;  1ZJ0 A;  1NMM B;  2I5E A;  4CJ8 A;  5CQP A;  2PGV A;  3IOH A;  1H7F A;  3I0J A;  1WT1 A;  4KC4 A;  3V91 A;  1EYR A;  3U2X A;  1H5S D;  4D0Z A;  3OKR A;  2A8W A;  2AH9 A;  2ZU9 A;  5C4E A;  1FXJ A;  2CU2 A;  3V0N A;  4ZDQ A;  2BO7 A;  1H7G A;  3E26 A;  2AEC A;  2X60 A;  1HM8 A;  3IOJ A;  4B3U A;  5CMG X;  1G1L A;  1G23 A;  1PZT A;  1ZI3 A;  1SS9 A;  3SXC A;  1JV3 A;  1W55 A;  2VD4 A;  4P00 A;  1Z90 A;  3OH1 A;  5IDT A;  1R7U A;  3F1C A;  4D11 A;  1H7T A;  4B5B A;  1FR9 A;  2AM3 A;  4EEM A;  5CQL X;  3V0Q A;  3E25 A;  3O3P A;  4EE3 A;  1VH3 A;  4MYB A;  1FO8 A;  1H4C A;  3ZLL A;  1FGG A;  1HJJ A; 
#chains in the Genus database with same CATH topology
 2Y7A A;  4FRE A;  2VFZ A;  3F1Y A;  1ZCU A;  1ZCV A;  3POL A;  1MC3 A;  2P72 A;  1EZI A;  2Y4L A;  4AYL A;  3CKJ A;  1OQM B;  2V0K A;  5FUH A;  3OC9 A;  5BXC A;  3U0X A;  1FZW A;  4EEG A;  3V8Y A;  2I7B A;  3ZGG A;  1S4N A;  2Q4J A;  4D11 C;  2O1F A;  5D92 A;  3LW6 A;  3GUE A;  1HJL A;  1YRO B;  1VGT A;  3CKN A;  4Y64 A;  1INJ A;  4B4G A;  3DK5 A;  2BO6 A;  1VGW A;  4M28 A;  1ZJP A;  5C1H A;  2YQH A;  2RIX A;  4NAK A;  3CKV A;  2FYA A;  5DDT A;  1JVG A;  1W57 A;  2XWN A;  4LW3 A;  4HO5 A;  2W0W A;  4AC3 A;  5AJO A;  1ZJ1 A;  4G3P A;  1VM8 A;  1FGX A;  3PKQ A;  3CGX A;  4M4K A;  1QWJ A;  5C4B A;  5EIY A;  1O7O A;  3T7O A;  4KRV A;  1JV1 A;  2QH5 A;  2E3D A;  2FYC B;  2V0J A;  2OI7 A;  3V90 A;  4HO4 A;  4G87 A;  1GQ9 A;  5C8R A;  5CMF X;  4IRQ A;  2Y4M A;  4O6N A;  2AM5 A;  3QVB A;  5CQM X;  1IIN A;  3I0H A;  2PA4 A;  4E1K A;  3SXB A;  2FFU A;  4B4M A;  2YQS A;  4Y7F A;  4ASY A;  1GX0 A;  4EE5 A;  1YP3 A;  1VZT A;  3FOQ A;  3ZLK A;  4BMA A;  5C48 A;  1ZCT A;  4Y6N A;  4KC2 A;  5FYE A;  5FTS A;  3CU0 A;  4DE7 A;  2Z86 A;  4ASJ A;  4KNR A;  1FXO A;  1LZJ A;  1R7X A;  3U2T A;  1MP4 A;  4HO2 A;  2VSI A;  2J0B A;  4Y7G A;  4DEC A;  2RJ7 A;  2RJ0 A;  5C3B A;  1S4P A;  4MIX A;  1OMZ A;  2RJ5 A;  3JUJ A;  3V0P A;  4FRH A;  1V84 A;  2FFV A;  1G8O A;  3SXD A;  1V83 A;  5L6S A;  4KQL A;  2WVK A;  5C47 A;  2RIZ A;  2VXL A;  5DDV A;  1LVW A;  3OH0 A;  3I0C A;  1HM9 A;  1JVD A;  2XMH A;  1MP3 A;  1JYK A;  4K6R A;  2FYD B;  4P02 A;  2V0I A;  3BRK X;  1HV9 A;  4HO9 A;  5CQO A;  2NXV A;  2ZU8 A;  1H4E A;  3T7N A;  3U2V A;  1TW5 A;  3JTJ A;  1WT2 A;  3D8V A;  4KPX A;  1ZI1 A;  1NWG B;  2X5Z A;  1O23 B;  4JD0 A;  4FRM A;  1ZI5 A;  2Y4J A;  4AYJ A;  2Z87 A;  3CKQ A;  1W77 A;  3I0K A;  1NQI B;  5FTV A;  4UEG A;  4CJC A;  1JYL A;  5AJN A;  3SPT A;  1LL0 A;  5EJZ A;  3U0Y A;  5J49 A;  1VPA A;  2QGI A;  3K8D A;  4FRO A;  1VZU A;  1ZDF A;  2BO4 A;  1OMX A;  2X5S A;  2JCK A;  3PNN A;  5EJ1 A;  2YC3 A;  2YQJ A;  4FRQ A;  4FCE A;  3R2W A;  4HO6 A;  1H4D A;  4MND A;  4C2S A;  1QG8 A;  1GA8 A;  2YQC A;  5JQQ A;  1O0R A;  1H5S A;  1ZCY A;  5I1F A;  4G3Q A;  3ST8 A;  1R7V A;  3Q4S A;  3SX5 A;  4KNX A;  4EE4 A;  1ZDG A;  5C3D A;  3V0L A;  1NHE B;  4R7P A;  3V8Z A;  2BO8 A;  1YP4 A;  2VXM A;  5IDS A;  1H5T B;  3SXE A;  2V0L A;  3TQD A;  1E5K A;  1PZY B;  1H5T A;  4Y6U A;  3Q7U A;  1HM0 A;  1VZX A;  1R82 A;  3U2W A;  3EE5 A;  1H5R A;  4KXO A;  4B2X A;  1H7L A;  2A8U A;  3JUK A;  4KPZ A;  4Q7C A;  3R3I A;  1VGZ A;  2AES A;  4LW6 A;  4DDZ A;  2O1G A;  1S4O A;  1FWY A;  5C38 A;  3CKO A;  4ARW A;  1H7Q A;  4FIX A;  4FRA A;  3SXA A;  1NF5 B;  5C4C A;  2AM4 A;  5FU8 A;  1H5S C;  5FV9 A;  4JIS A;  4CJB A;  3SXG A;  1H3M A;  1FO9 A;  2WVL A;  1WT0 A;  4Y62 A;  3I0E A;  4L41 C;  4EEO A;  1FR8 A;  2YC5 A;  4KT7 A;  2PX7 A;  4GBP A;  4G3S A;  2VS3 A;  2RIY A;  3OH3 A;  1NKH B;  4B4B A;  1XZ6 A;  1FOA A;  2GGO A;  5HS2 A;  1LL3 A;  2ICY A;  2I5K A;  2UX8 A;  1FRW A;  4KC1 A;  1VIC A;  5C1G A;  4HG6 A;  2MZB A;  2YCM A;  3Q80 A;  2OEF A;  3I0L A;  3OH4 A;  1IIM A;  2OI6 A;  4B2W A;  1VGU A;  3USR A;  4CVH A;  4NAL A;  1KWS A;  1R80 A;  4J18 A;  3NGW A;  1QGS A;  2D7I A;  1K4V A;  4FCU A;  4M2B A;  2FYB A;  4HOC A;  1WT3 A;  5C4D A;  2XWM A;  3DUV A;  4FRD A;  5IFY A;  1R81 A;  2XWL A;  2V0H A;  1G2V A;  3D5N A;  2ZU7 A;  2AE7 A;  3V0M A;  1INI A;  2OEG A;  1G3L A;  2RJ8 A;  4FRB A;  1WVC A;  4FRP A;  1XHB A;  1TW1 A;  2P6W A;  3RMW A;  5C3A A;  1TVY A;  1ZHJ A;  2P73 A;  3I0D A;  3V0O A;  4D48 A;  1R7Y A;  2QKX A;  3OGZ A;  2APC A;  2RJ4 A;  4HCQ A;  1O7Q A;  2WE9 A;  1GQC A;  2RJ1 A;  1ZJ3 A;  3PKP A;  2W0V A;  2WGZ A;  3U2U A;  2WAW A;  1FG5 N;  4Y9X A;  5C49 A;  3KIA A;  4HO3 A;  2VK9 A;  2PGY A;  4FQW A;  2RIT A;  2E8B A;  4B42 A;  1H7H A;  2Y6P A;  3DJ4 A;  5FU0 A;  2GGQ A;  4Y7T A;  3SX3 A;  2WEE A;  1H5S B;  2X65 A;  1G95 A;  2OI5 A;  3HL3 A;  2VS4 A;  1V82 A;  3USQ A;  1GX4 A;  3ZF8 A;  3TZT A;  1LZI A;  1WSZ A;  4Y7V A;  4XWI A;  3SX7 A;  3D98 A;  5CMI A;  3IOI A;  1TZF A;  1G9R A;  3OAM A;  3I0G A;  3OH2 A;  3K8E A;  5L6V A;  1LZ0 A;  2RJ6 A;  2XME A;  3SX8 A;  1H5R B;  5CMJ A;  4ECM A;  4EVW A;  3BCV A;  3FWW A;  3N9W A;  4FRL A;  1ON6 A;  2D7R A;  1G97 A;  1ZIZ A;  3ZGF A;  5C1L A;  1H7E A;  1VH1 A;  2AGD A;  2JCL A;  2RJ9 A;  2VSH A;  1LZ7 A;  1ZI4 A;  2FY7 A;  1ZJO A;  4HO8 A;  3RMV A;  5CMH A;  4M2A A;  1YP2 A;  5CQN X;  4AAW A;  1GWW A;  4NAN A;  4NAI A;  1ON8 A;  4O6M A;  2D0J A;  1MP5 A;  2O1H A;  4D0T A;  1G0R A;  2JCJ A;  1GWV A;  2Y4K A;  3I0F A;  1G93 A;  4Y7U A;  2DPW A;  1R7T A;  2C0N A;  3T7M A;  1LL2 A;  2ICX A;  5C4F A;  3I0I X;  2YES A;  1I52 A;  4Y63 A;  4HO0 A;  2JCO A;  4YS8 A;  4FIY A;  2VS5 A;  4EEA A;  3RSB A;  4BQH A;  1ZJ2 A;  5C36 A;  1QGQ A;  4IRP A;  5AJP A;  2WVM A;  1ZJ0 A;  1NMM B;  2I5E A;  4CJ8 A;  5CQP A;  2PGV A;  3IOH A;  1H7F A;  3I0J A;  1WT1 A;  4KC4 A;  3V91 A;  1EYR A;  3U2X A;  1H5S D;  4D0Z A;  3OKR A;  2A8W A;  2AH9 A;  2ZU9 A;  5C4E A;  1FXJ A;  2CU2 A;  3V0N A;  4ZDQ A;  2BO7 A;  1H7G A;  3E26 A;  2AEC A;  2X60 A;  5D91 A;  1HM8 A;  3IOJ A;  4B3U A;  5CMG X;  1G1L A;  1G23 A;  1PZT A;  1ZI3 A;  1SS9 A;  3SXC A;  1JV3 A;  1W55 A;  2VD4 A;  4P00 A;  1Z90 A;  3OH1 A;  5IDT A;  1R7U A;  3F1C A;  4D11 A;  1H7T A;  4B5B A;  1FR9 A;  2AM3 A;  4EEM A;  5CQL X;  3V0Q A;  3E25 A;  2J0A A;  3O3P A;  4EE3 A;  1VH3 A;  4MYB A;  1FO8 A;  1H4C A;  3ZLL A;  1FGG A;  1HJJ A; 
#chains in the Genus database with same CATH homology
 2Y7A A;  4FRE A;  2VFZ A;  3F1Y A;  1ZCU A;  1ZCV A;  3POL A;  1MC3 A;  2P72 A;  1EZI A;  2Y4L A;  4AYL A;  3CKJ A;  1OQM B;  2V0K A;  5FUH A;  3OC9 A;  5BXC A;  3U0X A;  1FZW A;  4EEG A;  3V8Y A;  2I7B A;  3ZGG A;  1S4N A;  2Q4J A;  4D11 C;  2O1F A;  5D92 A;  3LW6 A;  3GUE A;  1HJL A;  1YRO B;  1VGT A;  3CKN A;  4Y64 A;  1INJ A;  4B4G A;  3DK5 A;  2BO6 A;  1VGW A;  4M28 A;  1ZJP A;  5C1H A;  2YQH A;  2RIX A;  4NAK A;  3CKV A;  2FYA A;  5DDT A;  1JVG A;  1W57 A;  2XWN A;  4LW3 A;  4HO5 A;  2W0W A;  4AC3 A;  5AJO A;  1ZJ1 A;  4G3P A;  1VM8 A;  1FGX A;  3PKQ A;  3CGX A;  4M4K A;  1QWJ A;  5C4B A;  5EIY A;  1O7O A;  3T7O A;  4KRV A;  1JV1 A;  2QH5 A;  2E3D A;  2FYC B;  2V0J A;  2OI7 A;  3V90 A;  4HO4 A;  4G87 A;  1GQ9 A;  5C8R A;  5CMF X;  4IRQ A;  2Y4M A;  4O6N A;  2AM5 A;  3QVB A;  5CQM X;  1IIN A;  3I0H A;  2PA4 A;  4E1K A;  3SXB A;  2FFU A;  4B4M A;  2YQS A;  4Y7F A;  4ASY A;  1GX0 A;  4EE5 A;  1YP3 A;  1VZT A;  3FOQ A;  3ZLK A;  4BMA A;  5C48 A;  1ZCT A;  4Y6N A;  4KC2 A;  5FYE A;  5FTS A;  3CU0 A;  4DE7 A;  2Z86 A;  4ASJ A;  4KNR A;  1FXO A;  1LZJ A;  1R7X A;  3U2T A;  1MP4 A;  4HO2 A;  2VSI A;  2J0B A;  4Y7G A;  4DEC A;  2RJ7 A;  2RJ0 A;  5C3B A;  1S4P A;  4MIX A;  1OMZ A;  2RJ5 A;  3JUJ A;  3V0P A;  4FRH A;  1V84 A;  2FFV A;  1G8O A;  3SXD A;  1V83 A;  5L6S A;  4KQL A;  2WVK A;  5C47 A;  2RIZ A;  2VXL A;  5DDV A;  1LVW A;  3OH0 A;  3I0C A;  1HM9 A;  1JVD A;  2XMH A;  1MP3 A;  1JYK A;  4K6R A;  2FYD B;  4P02 A;  2V0I A;  3BRK X;  1HV9 A;  4HO9 A;  5CQO A;  2NXV A;  2ZU8 A;  1H4E A;  3T7N A;  3U2V A;  1TW5 A;  3JTJ A;  1WT2 A;  3D8V A;  4KPX A;  1ZI1 A;  1NWG B;  2X5Z A;  1O23 B;  4JD0 A;  4FRM A;  1ZI5 A;  2Y4J A;  4AYJ A;  2Z87 A;  3CKQ A;  1W77 A;  3I0K A;  1NQI B;  5FTV A;  4UEG A;  4CJC A;  1JYL A;  5AJN A;  3SPT A;  1LL0 A;  5EJZ A;  3U0Y A;  5J49 A;  1VPA A;  2QGI A;  3K8D A;  4FRO A;  1VZU A;  1ZDF A;  2BO4 A;  1OMX A;  2X5S A;  2JCK A;  3PNN A;  5EJ1 A;  2YC3 A;  2YQJ A;  4FRQ A;  4FCE A;  3R2W A;  4HO6 A;  1H4D A;  4MND A;  4C2S A;  1QG8 A;  1GA8 A;  2YQC A;  5JQQ A;  1O0R A;  1H5S A;  1ZCY A;  5I1F A;  4G3Q A;  3ST8 A;  1R7V A;  3Q4S A;  3SX5 A;  4KNX A;  4EE4 A;  1ZDG A;  5C3D A;  3V0L A;  1NHE B;  4R7P A;  3V8Z A;  2BO8 A;  1YP4 A;  2VXM A;  5IDS A;  1H5T B;  3SXE A;  2V0L A;  3TQD A;  1E5K A;  1PZY B;  1H5T A;  4Y6U A;  3Q7U A;  1HM0 A;  1VZX A;  1R82 A;  3U2W A;  3EE5 A;  1H5R A;  4KXO A;  4B2X A;  1H7L A;  2A8U A;  3JUK A;  4KPZ A;  4Q7C A;  3R3I A;  1VGZ A;  2AES A;  4LW6 A;  4DDZ A;  2O1G A;  1S4O A;  1FWY A;  5C38 A;  3CKO A;  4ARW A;  1H7Q A;  4FIX A;  4FRA A;  3SXA A;  1NF5 B;  5C4C A;  2AM4 A;  5FU8 A;  1H5S C;  5FV9 A;  4JIS A;  4CJB A;  3SXG A;  1H3M A;  1FO9 A;  2WVL A;  1WT0 A;  4Y62 A;  3I0E A;  4L41 C;  4EEO A;  1FR8 A;  2YC5 A;  4KT7 A;  2PX7 A;  4GBP A;  4G3S A;  2VS3 A;  2RIY A;  3OH3 A;  1NKH B;  4B4B A;  1XZ6 A;  1FOA A;  2GGO A;  5HS2 A;  1LL3 A;  2ICY A;  2I5K A;  2UX8 A;  1FRW A;  4KC1 A;  1VIC A;  5C1G A;  4HG6 A;  2MZB A;  2YCM A;  3Q80 A;  2OEF A;  3I0L A;  3OH4 A;  1IIM A;  2OI6 A;  4B2W A;  1VGU A;  3USR A;  4CVH A;  4NAL A;  1KWS A;  1R80 A;  4J18 A;  3NGW A;  1QGS A;  2D7I A;  1K4V A;  4FCU A;  4M2B A;  2FYB A;  4HOC A;  1WT3 A;  5C4D A;  2XWM A;  3DUV A;  4FRD A;  5IFY A;  1R81 A;  2XWL A;  2V0H A;  1G2V A;  3D5N A;  2ZU7 A;  2AE7 A;  3V0M A;  1INI A;  2OEG A;  1G3L A;  2RJ8 A;  4FRB A;  1WVC A;  4FRP A;  1XHB A;  1TW1 A;  2P6W A;  3RMW A;  5C3A A;  1TVY A;  1ZHJ A;  2P73 A;  3I0D A;  3V0O A;  4D48 A;  1R7Y A;  2QKX A;  3OGZ A;  2APC A;  2RJ4 A;  4HCQ A;  1O7Q A;  2WE9 A;  1GQC A;  2RJ1 A;  1ZJ3 A;  3PKP A;  2W0V A;  2WGZ A;  3U2U A;  2WAW A;  1FG5 N;  4Y9X A;  5C49 A;  3KIA A;  4HO3 A;  2VK9 A;  2PGY A;  4FQW A;  2RIT A;  2E8B A;  4B42 A;  1H7H A;  2Y6P A;  3DJ4 A;  5FU0 A;  2GGQ A;  4Y7T A;  3SX3 A;  2WEE A;  1H5S B;  2X65 A;  1G95 A;  2OI5 A;  3HL3 A;  2VS4 A;  1V82 A;  3USQ A;  1GX4 A;  3ZF8 A;  3TZT A;  1LZI A;  1WSZ A;  4Y7V A;  4XWI A;  3SX7 A;  3D98 A;  5CMI A;  3IOI A;  1TZF A;  1G9R A;  3OAM A;  3I0G A;  3OH2 A;  3K8E A;  5L6V A;  1LZ0 A;  2RJ6 A;  2XME A;  3SX8 A;  1H5R B;  5CMJ A;  4ECM A;  4EVW A;  3BCV A;  3FWW A;  3N9W A;  4FRL A;  1ON6 A;  2D7R A;  1G97 A;  1ZIZ A;  3ZGF A;  5C1L A;  1H7E A;  1VH1 A;  2AGD A;  2JCL A;  2RJ9 A;  2VSH A;  1LZ7 A;  1ZI4 A;  2FY7 A;  1ZJO A;  4HO8 A;  3RMV A;  5CMH A;  4M2A A;  1YP2 A;  5CQN X;  4AAW A;  1GWW A;  4NAN A;  4NAI A;  1ON8 A;  4O6M A;  2D0J A;  1MP5 A;  2O1H A;  4D0T A;  1G0R A;  2JCJ A;  1GWV A;  2Y4K A;  3I0F A;  1G93 A;  4Y7U A;  2DPW A;  1R7T A;  2C0N A;  3T7M A;  1LL2 A;  2ICX A;  5C4F A;  3I0I X;  2YES A;  1I52 A;  4Y63 A;  4HO0 A;  2JCO A;  4YS8 A;  4FIY A;  2VS5 A;  4EEA A;  3RSB A;  4BQH A;  1ZJ2 A;  5C36 A;  1QGQ A;  4IRP A;  5AJP A;  2WVM A;  1ZJ0 A;  1NMM B;  2I5E A;  4CJ8 A;  5CQP A;  2PGV A;  3IOH A;  1H7F A;  3I0J A;  1WT1 A;  4KC4 A;  3V91 A;  1EYR A;  3U2X A;  1H5S D;  4D0Z A;  3OKR A;  2A8W A;  2AH9 A;  2ZU9 A;  5C4E A;  1FXJ A;  2CU2 A;  3V0N A;  4ZDQ A;  2BO7 A;  1H7G A;  3E26 A;  2AEC A;  2X60 A;  5D91 A;  1HM8 A;  3IOJ A;  4B3U A;  5CMG X;  1G1L A;  1G23 A;  1PZT A;  1ZI3 A;  1SS9 A;  3SXC A;  1JV3 A;  1W55 A;  2VD4 A;  4P00 A;  1Z90 A;  3OH1 A;  5IDT A;  1R7U A;  3F1C A;  4D11 A;  1H7T A;  4B5B A;  1FR9 A;  2AM3 A;  4EEM A;  5CQL X;  3V0Q A;  3E25 A;  2J0A A;  3O3P A;  4EE3 A;  1VH3 A;  4MYB A;  1FO8 A;  1H4C A;  3ZLL A;  1FGG A;  1HJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...