5C3EH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eH00
4BA2I 3UDXA 3PUYA 1VQMA 1NMFA 1VQCA 3W1BA 3JAMc 3S16H 5C3EH 5E7NA 3M4OH 3AFQA 4DR7L 4DV0L 1X65A 2Q2IA 4NXML 3CP0A 1TXYA 1UWVA 2B29A 3RR5A 4DR3Q 3S1MH 4GKKQ 5BR8L 2UUAQ 1HR0Q 3S2HH 4X6AH 2MO0A 1XMOQ 1Q8KA 2JA5G 3EBEA 5M3FG 1CKMA 1P8LA 1WYDA 2PQAB 2VZAA 1VQKA 3CCMA 3E9IA 3S15H 2C35B 4R4OA 3J81i 4J15A 4PG3A 3F2CA 1Q82C 2H5XA 3K7UC 3H15A 4JI0L 2IX1A 4H02A 4POFA 1V43A 3PV0A 4NXNQ 1XJVA 1XPUA 1XNQL 2WFWA 1M1KC 1AE2A 4HJ7A 4DR7Q 3I4NH 2A8VA 1KD1C 1UEBA 4IFDG 3T1YQ 4JBKA 1TWGH 4A3FH 4B3RQ 2GVBA 3GD7A 4B3SQ 1CSQA 1U5KA 5M3FH 1VQFA 4JI3Q 3HOZG 1Y1VH 1IBLQ 5M3MG 4HJ8A 4JI2L 4BY7H 1VQ9A 4O0AA 1VQAA 1NBWA 2IT1A 4A3EG 1VQJA 3PUXA 1EQRA 4GKJL 4AQYQ 3PO3G 4BBRH 2D0PA 2KENA 4DAYB 4DR1L 4LFCQ 4WJ3M 3G48A 3NENA 2B3GA 3Q8DA 2HT1A 2I5LX 4JI5L 1OXTA 5JJKA 4JI0Q 2LXKA 1EQQA 3CPFA 4QY7A 1J6QA 3UDFA 1PH6A 4JBJA 3K0XA 1YJWA 1QZHA 1VQLA 1PYSB 2JK8A 5C44H 4A3DG 2ZTEA 5M3MH 2I0QA 1Y1VG 4YWMA 3HOZH 3J81c 3H0GH 2ALYB 2EXDA 1SROA 2BH2A 3LGJA 1GO3E 4DV4L 1IXRA 4GS3A 1CKOA 2IX0A 4JOIC 4GNXB 2UXDL 3TREA 1YI2A 1TWHH 4GLVB 3U4VA 4DR6L 2OTLA 1FGUA 4A76A 4P71A 4DV5L 4NPSA 1SLJA 1Z9FA 3CCRA 1R9TH 1C7YA 1OXUA 4L5RC 2MQHA 2NVTH 3CQZH 4KHPL 2Y0SG 4C2MH 1QZGA 4JBWA 5H1SE 4X62Q 1B8AA 4LUVA 1K73C 4OXPA 3OYYA 3CAMA 2CFMA 1KC8C 4LF9L 4DV3Q 1S72A 2K5VA 4TQUS 1UE6A 2V1CC 5IWAL 4OWXB 1JE5A 3NELA 4YY3L 2GVAA 2BH8A 2OQ0A 2ZJRA 3AFPA 4LF8L 1L2FA 2R6GA 2RHQB 4DR4Q 3K7AH 5C3EG 4UY8C 2PNHA 2UXBQ 1RL2A 3CC4A 4JI3L 3J81j 4A3EH 1JMCA 4DV1L 4A3IG 4A93H 4HJ9A 4YHHQ 2N8NA 3ER0A 1YHBA 1HNXQ 5FLMH 4X65Q 4LF6L 1PA6A 3D0FA 3GTQH 1Q1EA 2E2JH 1IL2A 5GROA 3KOJA 4UPAA 1K8GA 2QEXA 4APVA 4DV3L 4L5SA 2AWOA 3B6YA 3T1HQ 1TWFH 4POGA 3PIOA 1NE3A 1A0IA 5C0XI 1B70B 5HY6A 2Q2UA 2NVYH 3OTOQ 2ZJPA 3I2ZA 1YHQA 2UXCL 3M4QA 4LFAQ 2JA8G 3H3VI 2ID0A 4DV0Q 1EFWA 1L1OB 2BA0A 2ZJQA 4OONA 4YCUA 4IO9A 4JI1L 5IY0A 1XNRQ 1YJNA 2L15A 1N32L 2JA5H 4HIMA 4JOIA 4P73A 3ULJA 5GADC 4DV7L 1I5FA 1NY4A 5GQOA 1G6PA 1VS0A 3J7A5 5M5YH 1N8RC 1D8LA 4DV2L 2K4KA 3I4MH 3S1NH 4JI6L 5LMNL 4YHHL 2R7ZG 3DM3A 1HZAA 4NB3A 4X64L 1NTGA 1VQPA 1Q81C 3FHWA 5M5WH 1GVPA 3CCUA 2UXBL 3F8TA 2I5MX 4DV6Q 3T1HL 1KL9A 4BBSG 1HR0W 3PUWA 4B3TL 4JI7L 2A1AA 4AH6A 3KDFB 3JC66 1YIJA 4A3FG 2UU9L 5LMNW 4DK3C 1EIYB 4B3SL 2VW9A 2VNUD 1HZ9A 2AMCB 2CWAA 5IP7H 3TS0A 1BVSA 1I6HH 4K0KL 1I50H 4X66Q 1Q86C 2OCEA 2Z6KA 1VQ6A 4IOAA 1IBMQ 1PYBA 3I55A 2K75A 2HHHQ 4A3BH 3S24A 1YJ9A 1E1OA 4LFBL 1N9WA 1S3OA 4L5TA 4DV4Q 1KQSA 1N33L 3STBC 2JQOA 5IYCH 1K9MC 1GD7A 3CC2A 1I3QH 1OXVA 2NZHA 1SN8A 3CCEA 4PZ6A 4C3JH 2JE6I 4OO1G 3HKSA 2B63H 1ASZA 1IBKL 4GNXA 2MFIA 4R4TA 2R93G 2VQEL 1BKBA 1EOVA 4GN4B 1VQHA 1K3RA 2D0OA 2GN5A 4DUZQ 1NMGA 1Q7YC 3I7FA 4HIOA 1MJCA 5LMUL 4GKKL 1AH9A 1BBUA 3E9HA 1PH7A 5IE8A 2ES2A 4IPHA 4YWKA 3U4ZA 4BBRG 2UXCQ 1XPRA 2IY5B 4BXXG 4AYBG 2JA7G 3HOUG 3KYHC 3PO2G 4TVAB 1G291 2YTXA 1A63A 4A3KG 1GM5A 4X66L 4BY7G 2DGYA 5FJ8H 5C4XG 2KHJA 5FJ8G 1O7IA 1NJIC 5C4XH 5ELOA 4A3KH 1SR3A 3A5UA 1VCIA 4HIDA 3F1ZA 4IPDA 4A4IA 2HHHL 4DK6C 4DR5L 2JA7H 1HH2P 3J7ZC 1Y1WH 5IYBH 1FL0A 3TQYA 3GTMH 4Y52H 1D7QA 1GKHA 4HJAA 4R4IA 1E1TA 1QVFA 1HNXL 4P75A 1TWAH 3JAMi 1SMXA 4DV1Q 2EIFA 2E5LQ 2VS1A 3J80c 1SRUA 2FXQA 4GN5A 3VDYA 1N34Q 1HNWQ 2JA6H 2Z0SA 1U0LA 2JJQA 4LFBQ 4GOPA 4KHPQ 4A3CH 4DR1Q 2OWOA 5IT9c 3A0JA 4A3BG 1LYLA 4LW1A 4B3MQ 4B3RL 4A3LG 4K0KQ 2R92H 5IYDH 1T9HA 3GTGH 1I94L 4MZ9A 4JI2Q 4XTCS 1SFOH 3GDEA 3UDGA 3KJOA 4BY1H 3TEHB 2N3SA 3HOYH 3HOVG 3ERSX 4JI8L 1PFSA 3S1QH 2IHEA 1X3EA 1S40A 1KRSA 3RZDH 1Q12A 1XNRL 3PF5A 1HR0L 1VQ4A 4A75A 2VUMH 3HOWH 3KDFA 1KXLA 4PZ8A 1PH2A 2NN6G 3G6EA 5IP9G 4JCVE 3W5OA 1L1OC 4BXXH 3ULLA 4GOPB 4OX9Q 1WFQA 1L1OA 4DR2Q 3AYHB 4B3ML 1VQGA 1OXSC 3I4MG 5FLXc 2ASBA 1ASYA 4HIKA 2ZTCA 1VQ7A 1E3PA 1LUZA 1XMQQ 3ULPA 3PF4A 3BZKA 3L2PA 2AKWB 1UE7A 4MNOA 2MO1A 1JB7A 2EQSA 1X54A 3FKIH 4GLXA 4A3MG 1HNWL 1VQIA 2YTVA 4LFAL 3FKIG 2XTIA 3KJPA 2F4VL 1QUQA 4EX5A 1PH1A 5AJ3L 3U58A 1N36L 2AHOB 4LF8Q 1C0AA 3KF6B 4IFDJ 2PI2A 1J5EL 5DLQE 1FVIA 1YHAA 2VQFQ 4JV5L 1XNQQ 3CD6A 1LTLA 3HOXG 5IP7G 3PIPA 4LF4Q 3L7ZC 4IOCA 1IYJB 3CW2C 3M3YH 4ALPA 3CCQA 1EIFA 3MEFA 4DR6Q 5FLMG 1B7YB 4BBSH 4IJLA 2WB1E 4C3IH 3OW2A 4DV7Q 3FP9A 3PO2H 5C4JH 4DV5Q 2RF4A 4GOPC 1V9PA 3CCJA 4DR3L 3HOYG 3S1RH 4R4CA 2VQEQ 4LWCA 1XMQL 1A8VA 1UE5A 1Z47A 1JJ2A 5LMNQ 3OTOL 3BU2A 2R92G 3KFUA 2KCTA 1YZ6A 3E0EA 4A3GH 1HNZL 4KI0A 3RN5A 4P72A 1L0WA 4PZ7A 2BA1A 4JI1Q 4DUZL 2NVQH 4A3CG 4DR5Q 1VQOA 3RNUA 2QA4A 1SE8A 2KCMA 1EYGA 1XTDA 3KLWA 1XPOA 2RCNA 5GAHC 2N78A 4DR2L 3NEMA 5C0XG 4KHZA 4IPCA 2UUBL 1KHIA 3CCVA 3M4PA 3CCLA 4GLAC 2HIXA 2N49A 4UP7A 4XIGS 5LMUQ 2Y0SE 4OWTB 2ATWA 4GKJQ 4KLKA 1IZ6A 3H0GG 2WP8J 5JEAJ 4A3JG 4O2DA 4PMWA 3BZCA 4LFCL 4JYAL 1EUJA 3HKZG 1CSPA 1VQ5A 1EWIA 1I94Q 1VQBA 2NVXH 5M5XH 3I4OA 2JEBI 1YITA 4GNXC 4JI6Q 5C0XJ 1QVCA 4DKAC 2VUMG 5AJ3Q 1N36Q 1N34L 1KRTA 4DPGA 4A3JH 2YV5A 1MIUA 1PH3A 4LF5L 3CF5A 1PH5A 4JV5Q 1MKHA 3GTKH 2R7FA 3SGIA 1VQDA 3HOVH 2A19A 1N32Q 5JEAG 1QUQB 1CUKA 4DV6L 4JI4L 3CC7A 1YBYA 2HIVA 3K80C 3S17H 3PGZA 3HKZE 1JT8A 2UUBQ 1HZCA 3F2DA 2Z6KC 2F52A 2AWNA 1OXXK 5IYCG 1X56A 2I5HA 4P74A 1WCMH 1A62A 3CMAA 1Q46A 1WCMG 3HFZB 1H95A 2JA6G 1HJPA 1C9OA 1WI5A 2YTYA 3G4SA 2Q2TA 1X3GA 2ZM6L 1JJCB 3I4NG 3GTLH 4ME3A 2IHFA 1PH9A 2VL6A 4BA1I 3BJUA 3DLLA 4DNIA 4LUZA 4LNQA 1K0RA 5GAEC 2RHSB 2K50A 2PMZE 4QJFA 3L0OA 4NXMQ 4IPGA 4QL5A 4AIMA 1IBKQ 1FJGL 3RLOA 5IYBG 3UE0A 4OO1I 1AE3A 3PUZA 3CXCA 1JJGA 4A3IH 2NN6I 2Q2HA 4JI4Q 1E22A 3NBHB 2ZTDA 4QIWE 5EAYA 2YYZA 4A93G 4LF4L 2R7ZH 1N33Q 1PHJA 3ICEA 2DUDA 3D31A 4C3HH 4EQ5A 4UP8A 1J5EQ 1PVOA 4IJHA 3RLFA 1E7ZA 3PCOB 4X65L 4LF6Q 2UUCQ 4LF7L 2PI2E 2CKZB 2JEAI 4L5QA 4FDBA 3KF8B 2OQKA 5HGQA 1IBLL 3CMEA 4QQBX 4WJ4A 4LUOA 4X64Q 4JYAQ 2R93H 2MNAA 3WWVA 3TS2A 1X3FA 3CCSA 3GO5A 4AQYL 3GTOH 4DR4L 2NZOA 4DUYL 5J3BA 3I56A 1VQNA 3UE1A 3A74A 2KBNA 1CKNA 3T1YL 2JA8H 3EN2A 3STBD 3M7NA 3RZOH 1QVGA 2K14A 4A3MH 3H3VH 2E2IH 4YCVA 1E24A 3S2DH 2WAQE 1TWCH 4JC0A 3UDIA 1MJEA 4A3GG 2OTJA 2JA9A 3K8AA 1FJGQ 5JJIA 2VY3A 4RG1A 2XGTA 3GTPH 1Q1BA 4HJ5A 3TRZA 4RMFA 4JBMA 3GTJH 3J80i 5BR8Q 5IP9H 2KHIA 4QGUA 4DV2Q 2UUAL 4OX9L 1LM0A 1V1QA 4YWLA 3RLNA 1HNZQ 2E2HH 4JI5Q 3HOWG 5K36G 1OTCA 1YEZA 2E8GA 2ZM6Q 3U50C 1X9NA 3HOUH 2R7DA 3M85A 1PH4A 3PUVA 1HZBA 2CCZA 4JG2A 1PH8A 2LXJA 2YU9H 3HOXH 4BY1G 2D62A 1X6OA 2QGQA 4UP9A 2WAQG 1X55A 1W2BA 1BBWA 1KAWA 3EIVA 3MXNB 3ZJYC 2UXDQ 1K8AC 3PO3H 2UU9Q 1RIPA 5IYDG 4A3LH 2F3IA 4LF5Q 4R4QA 1W3SA 1YNXA 2B63G 3A5ZB 2K5NA 5ELNA 2HQLA 4JI8Q 4OWWB 2WB1G 3M9BA 2LSSA 5GAGC 3AEVA 1CKNB 1IBML 1DGSA 4R1JA 2K52A 2CQOA 3AQQA 2CWPA 1UE1A 1VQ8A 2PQAA 4B3TQ 4JI7Q 3IRBA 3KF6A 2UUCL 4Y7NH 4LF7Q 4X62L 3W1GA 5IWAQ 1P16A 4YY3Q 1VQEA 2F4VQ 4DAMA 4AYBE 2E5LL 3G71A 4MTNA 1WJJA 4LF9Q 1K83H 1M90C 1Y1WG 4IFDI 3PSIA 1XMOL 1PV4A 2K5HA 4DUYQ 4A3DH 5C44G 3F2BA 3K81C 1YVCA 3S14H 3CPWA 1Y14B 4NXNL 2VQFL 3RN2A 5JJLA 1KIXA 4GN3B 4YCWA 1WOCA 1G51A
chains in the Genus database with same CATH superfamily
4BA2I 3UDXA 1IHZA 1QE6A 3JAMc 3S16H 2ICEC 2WKCA 5E7NA 4KKUA 3BS1A 4DR7L 2RA4A 1A3UA 3CP0A 2G9DA 3RR5A 1KABA 1FD7D 1HR0Q 3D8GA 1XMOQ 2JA5G 1WYDA 1VQKA 4X3UA 4C3JB 3S15H 1ESRA 4PG3A 1ET6A 1KDBA 2H5XA 3K7UC 2IX1A 3N6RA 4HMJA 4POFA 3IAYA 3PV0A 1TS4A 4NXNQ 2K05A 1XJVA 1SNPA 1XNQL 2WFWA 4HJ7A 1UEBA 1PZKD 3MXNA 1ESFA 3JAML 4A3FH 4GZYC 4B3SQ 4FXKC 1VQFA 1ICWA 3A8IE 4KD3A 4BY7H 4U68A 4GKJL 1NBWA 4A3EG 1VQJA 2QILA 3PO3G 2K33A 3Q8DA 2I5LX 3QWNA 3I4NB 3DWQA 1BOSA 2B8GA 3E5SA 3VA5A 1JR0D 2JK8A 1SMYC 2R61A 3HGBA 2ZTEA 2J4XA 5M3MH 1Y1VG 2E74C 3HOZH 3FKIB 2K5DA 3H0GH 4C1NK 5CV6A 4JOIC 3CRKC 1MSHA 1DXMA 4CBVA 2ZT9C 1Z9FA 5D3IB 5I9OA 5FLXE 1OXUA 4L5RC 2MQHA 3M4OB 3CQZH 4KHPL 3GTQB 5H1SE 4KJOA 4LUVA 1K73C 2NVQB 4DXFA 4OXPA 4LF9L 3CAMA 1KC8C 2XIWA 4DV3Q 4IUQA 1B3QA 1E2WA 2DY8A 3S1MB 5IWAL 1G91A 2ZJRA 5CV7A 4LF8L 5T1IA 2UXBQ 1D6EC 2L55A 3HZXA 3J81j 4A3KB 1RCVD 4YHHQ 5C4XB 1TWAB 4P2CB 1SYEA 5GROA 1K8GA 1EYDA 4ULLA 2QEXA 3B6YA 4CDFC 2HCCA 1Y1VB 4POGA 3PIOA 4ZAIA 3PIO3 4M8AA 5HY6A 2HDLA 2ZJPA 2R7ZB 3H3VI 5A2QE 2JA8G 1EFWA 2BA0A 2OT2A 3K5OA 1NR4A 1H9MA 1DJRD 4HIMA 4DV7L 3M4YA 1NY4A 5ELBA 4O42A 5M3FB 1STHA 5BN4A 3D3RA 2IWHA 2HDMA 2EVBA 3S1NH 4JI6L 5JVG3 1RKNA 5DM63 1ICFB 4CGYB 4NB3A 4X64L 1GVPA 1B2TA 4LK1C 2H1EA 2FMMA 2I5MX 4DV6Q 1KL9A 4B3TL 1AZPA 4DGZA 1IKMA 1EFID 1SMYD 2LKVA 5LMNW 1HXYD 4X66Q 5CV9A 1IBMQ 4G4KA 2F3WA 1N9WA 1S3OA 4HCSA 4L5TA 5J22A 4DV4Q 3K5LA 2JQOA 5IYCH 3CC2A 1I3QH 3CCEA 4PZ6A 4DNTB 2WACA 3HKSA 2B63H 3TP5A 2NYZD 2R93G 3OHXC 1Z7TA 1VQHA 2D0OA 4FO2A 1S5DD 2F0QA 2EDGA 1PH7A 1FR3A 4DXGA 4YWKA 4BBRG 2UXCQ 4BXXG 4Z9CB 1TIID 1VF5C 4A3KG 5C4XG 5FJ8G 1O7IA 1WD1A 4N9PA 1SR3A 1PTOD 4FVMA 3A5UA 1GUWA 2PZWA 1EY7A 3V2TA 2L9HA 3TQYA 3GTMH 3J7AV 3CKIB 3HEJA 4P75A 3JAMi 1SMXA 1PTOH 2K28A 3OIPA 4NW2A 3TP8A 4RAUC 3A8JE 4J8QA 1EL0A 1PRTF 3GP7A 1JE4A 2OWOA 2E2HB 1QB5D 4A3BG 3OOCA 1B50A 3CQZB 4K0KQ 3P1HA 4MZ9A 2F0NA 4JI2Q 4XTCS 1SFOH 1LTBD 4RGTA 4JI8L 4CJ1B 1LTID 2IHEA 5LL6S 1KRSA 3RZDH 4F8MA 4C2MB 3KDFA 3W5OA 3PQIA 4BXXH 1WFQA 4DR2Q 1YNJD 4B3ML 3I4MG 2PYKA 1TS3A 4HIKA 2NTSA 1PRTD 3S1QB 3ULPA 5IGFA 1G8ZD 3OW7A 1K83B 4JW0A 2KQ3A 4MNOA 5CORA 2MO1A 1R4QB 4JK1C 2YTVA 4K8IA 3FKIG 2MUYA 4OIJA 2F0IA 3SEBA 5ELEA 1PH1A 1JCKB 5KNBA 4QMGA 3HOYB 5DLQE 3I3CA 1YHAA 3HOXG 4EQPA 5IP7G 3E6ZX 4LF4Q 3OMCA 1KDAA 1EEFD 1TQOA 2Z4HA 1B9NA 1EU3A 2K01A 1B7YB 4IJLA 2WB1E 3FVQA 3OW2A 4FF4A 1RODA 4DV5Q 4A3FB 3GQBA 2Q8TA 1MSGA 1V9PA 4R4CA 1SYCA 2VQEQ 1XMQL 1UE5A 1Z47A 4K14A 1JJ2A 2F0VA 1ZKOA 3BU2A 2KCTA 5LHY1 4RHSA 2OF1A 1TKWB 3E3XA 3RNUA 2KCMA 1A6XA 3KLWA 1XPOA 4BY1B 5D65A 5FOBB 1DOLA 1E2VA 5DAUA 3ERQA 1YNND 3S1RB 3CCVA 1F77A 1PTOF 1CT1D 3CCLA 2M00A 4XIGS 1HQRD 3IFDA 1QG7A 4A3JG 4O2DA 1Q3LA 3EROA 5L37A 1STBA 3HKZG 5EBDA 4K6DA 1VQ5A 1I94Q 3E0JA 1YITA 2VXWA 1F2LA 5AJ3Q 2QF7A 1KRTA 2QW7A 1N34L 5CBEE 1PH3A 3CF5A 5C5LA 4DFAA 1VQDA 3HOVH 2A19A 3MA2B 5JEAG 1QUQB 1GUSA 4DV6L 1EU4A 2B2VA 1YBYA 3CC7A 4JI4L 2O2LD 2A73B 2UUBQ 1HZCA 3F2DA 1WCMG 3NWTA 2JSOA 1HJPA 3MWYW 2ZM6L 3GTLH 1PH9A 2VL6A 1ILPA 3BZDB 4DK1A 2K50A 4QL5A 4AIMA 3M7GA 1K8MA 3CXCA 1JJGA 4K5XA 1O78A 1VMCA 5C3XA 2TMPA 3GTJB 3R8BA 2R7ZH 1N33Q 1B1ZA 3D31A 3VYRA 3SXHA 4EQ5A 1T5XD 2R92B 1J5EQ 1TU2B 4K2KA 3RLFA 2PCFB 4DK0A 1LTAD 4LF6Q 1J8IA 4LF7L 2R3ZA 2OQKA 5CC4A 2KHSA 1Q8IA 1GHKA 2R93H 1LTGD 1E0BA 3WWVA 4AQYL 3GTOH 4DR4L 2NZOA 2N55A 4ZUJA 4DAVA 3T1YL 3STBD 1BCPC 1LACA 4EVOA 4A3MH 1Y69U 1SE2A 3BG3A 1E24A 4JC0A 4Q0FA 3VR6A 2OTJA 1H9JA 1R9TB 1F2YA 4BWGB 2L5TA 2F1MA 5JJIA 2VY3A 1LT5D 3GTPH 4TSSA 3TDQA 4A93B 1EY8A 4QGUA 1PXUA 1HNZQ 4UDUC 1EIHA 3R3OA 5G3LF 2B2TC 2E8GA 3MAQA 1B53A 1DOKA 2R7DA 3BYYB 1PH4A 3PUVA 1PH8A 2LXJA 4OEMB 3Q23A 4FP5D 2UXDQ 1X55A 1BBWA 3EIVA 3ZJYC 3PO3H 1S5CD 4CJ0B 4NDXA 5IYDG 4A3LH 1B4OA 3J81E 1UNSA 2B2WC 1PFBA 5A35A 2E2DC 3KLRA 1TR5A 1HA6A 1GUNA 3TP7A 2O5IC 3ND9A 4RGNA 1UE1A 4U673 3IRBA 3KF6A 2UUCL 5G3LD 2DJGC 1VQEA 1K0SA 2ZXOA 3BVZA 1DOMA 1MD2D 1TS2A 2JA5B 2K5HA 4DUYQ 4A3DH 5C44G 3F2BA 4QCLA 5C4ZA 1SDFA 1YVCA 4NXNL 4GN3B 3DM1A 2F0LA 3NXWA 1WOCA 1DCZA 1G51A 5BN3A 1NMFA 3W1BA 4CKBA 3M4OH 1O7YA 2KJXA 2PO4A 4ZUIA 1DZ1A 4NXML 4GKKQ 4DR3Q 1AZQA 2E2IB 3WDNA 5BR8L 2UUAQ 3C46A 4X6AH 1Q8KA 4G7OC 2DN8A 4S3SA 5M3FG 3CCMA 3PMFA 4BBRB 3J81i 2FMCA 5M3MB 3H15A 1BCPD 4H02A 3HOZB 1KLGD 3MXGA 1V43A 2MP1A 1XPUA 1ZXTA 4KKSA 4IFDG 3T1YQ 4JBKA 3RD4A 1TWGH 1QCBD 4B3RQ 2VB3X 5EJWA 4JI3Q 2Z6BA 3HOZG 4F88A 1Y1VH 4JI2L 3K0YA 4HJ8A 2X69A 5D3DA 1SNQA 4O1NA 4DR1L 3SDZA 3TZDA 1OXTA 5JJKA 2LXKA 4IUNA 1J6QA 3UDFA 4JBJA 4OO1H 3K0XA 2WB1B 4L8JA 4A3JB 1SNMA 2K03A 1BXTA 2I0QA 3J81c 3I91A 2EXDA 3LGJA 1I6HB 1GO3E 4DV4L 5JJZA 3TREA 4GLVB 5CMDA 3AMUA 4DV5L 1R9TH 3CCRA 5ISRA 4IUTA 2NVTH 1QZGA 1H9SA 4OIKA 4X62Q 1B8AA 2CFMA 1WTRA 3H0GB 1S72A 2K5VA 1KLUD 4TQUS 2V1CC 2RVLA 1JE5A 3NELA 4CHTB 4YY3L 2BH8A 2N88A 4A3GB 4N9TA 3K7AH 3CC4A 4A3EH 4DV1L 4A3IG 4HEDA 3ER0A 1HNXQ 4X65Q 2SNSA 3GTQH 1PFMA 3KOJA 4DAYA 3KK7A 2EY2A 2XN9C 1G6ZA 5E1FA 3BVMA 2OXPA 5CR3A 5C0XI 1V1PB 1QWYA 2A6HC 2EYHA 3I2ZA 1WTPA 2ID0A 3DWAA 3H3VC 1WTOA 4JI1L 3TBIB 4XYQA 4RA8A 3T56B 1TWCB 1YJNA 2L15A 1N32L 2JA5H 4JOIA 1I5FA 1CM9A 2CW0C 3J7A5 5M5YH 1N8RC 3RZOB 2K6AA 3I4MH 3DM3A 1AP0A 1Q81C 1VQPA 2X6LA 2B2UC 3I70A 3F2UA 1WCMB 1S5BD 3VYUA 2A1AA 3KDFB 1O80A 1EIYB 2EYOA 2OEOA 1HZ9A 2AMCB 5IP7H 1FNWA 2AQ1B 1VQ6A 4ME5A 4A3IB 3S1NB 1PYBA 3I55A 2K75A 4A3BH 3S24A 2X6GA 4LFBL 1N33L 3STBC 1GD7A 1XYIA 1J9OA 2NZHA 1BO0A 2E76C 3EFXD 4RGMA 2JYOA 2IX3A 4CDDC 1I50B 4HN7A 1BKBA 3MVVA 1JOOA 1CA6A 2KOLA 4HIOA 1MJCA 5LMUL 4GKKL 1BBUA 3OWEB 5IE8A 2ES2A 1HTLD 3M3YB 1W6KA 3MTSA 2IY5B 4FNFA 2JA7G 1SNCA 4C3HG 1G291 1SXTA 1GM5A 1HA5A 1UUPA 1FNUA 2KHJA 5EGTA 1EOTA 5K36H 3F1ZA 4IPDA 2RBMA 4DR5L 3T51B 4YIJA 2JA7H 1Y1WH 4PMBA 2TSSA 3GTKB 1D1KA 3KBGA 5IYBH 1FL0A 4Y52H 4HJAA 2FHTA 1E1TA 1TWAH 1MHWC 2RSNA 3OWFA 1PLFA 3VDYA 4XQQA 1D5XC 4QB4A 4PMCA 5ELDA 2JA6H 1CZWA 2NZ1D 2JJQA 4LFBQ 1IYVA 1EQTA 1V1OA 2GA4B 4RH6A 5IT9c 3A0JA 1AFPA 1I94L 2K5QA 3H6MA 3QOLA 4KY6A 1S5FD 2KEDA 3UDGA 4BY1H 3HOYH 2N3SA 5FO9B 3HOVG 3MC0B 1S40A 1ZYRC 5CV4A 5EQ0A 1Z6HA 4A75A 3HOWH 1S5ED 1PH2A 5IP9G 5E3FA 1L1OC 3H91A 3ULLA 1I4QA 1OXSC 1X3QA 4H13C 4C3IB 3PO2B 1LUZA 3L2PA 1YNNC 1V8QA 1D1IA 2EQSA 1EY5A 1X54A 2CW0D 1VQIA 5I4DA 4FXDA 2XTIA 3KJPA 3QR8A 3GV3A 4G57A 2LY7A 2AHOB 1Y8NB 4IFDJ 2EY1A 1J5EL 3X3MA 2LFNA 1XNQQ 3W2DA 1ENAA 2IPKD 3L7ZC 4M1UB 4IOCA 1BCPB 3CCQA 3PO3B 1EIFA 3MEFA 3GTLB 4DR6Q 4BBSH 4G7HC 4C3IH 4DV7Q 1U4PA 1O7ZA 3FP9A 3PO2H 2RF4A 3BDLA 1CHQD 3DMUA 2EY6A 4DR3L 2PNRC 1A8VA 3D4RA 3A7AB 3NQTA 3OTOL 2R92G 3KFUA 4N8FA 1HNZL 3RN5A 4P72A 1L0WA 3P20A 4JI1Q 4DR5Q 1VQOA 2QA4A 1SE8A 1F9QA 2NTTA 1XTDA 5C6AA 2RCNA 4DR2L 5IGBA 5C0XG 3MEHA 4IPCA 2UUBL 3M4PA 3TSSA 1NNXA 1BR9A 4GLAC 1CHPD 5LMUQ 2Y0SE 4HR7B 5KRUA 4OWTB 4KLKA 3H0GG 1KTKA 4K5VA 2I46A 3T4AC 3Q22A 2NVXH 1KNAA 3C2PA 3I4OA 2JEBI 4DKAC 1UEAB 1N36Q 2DJFC 2A6EC 4KN7C 4JV5Q 5IGGA 1TVXA 3SGIA 3A8KE 4TRDA 1BNZA 1IW7D 3K80C 3NBHA 2JP1A 1F9RA 2RDHA 3HKZE 1JT8A 1TY2A 4WRDA 2F52A 3SK6A 4CDEC 2I5HA 3CMAA 1Q46A 3FPUB 2YTYA 1X3GA 2IHFA 4IUUA 4DNIA 1K0RA 1LTRD 2RDGA 4QJFA 4NXMQ 3L0OA 1VMPA 3QG1A 4IPGA 1IBKQ 2QDBA 5EKIA 3W3AA 1U4LA 2QEJC 4MIUA 4JI4Q 5EAYA 3NBHB 2YYZA 3WOEA 4LF4L 3SHLA 4WORA 4IJHA 4I7ZC 2UUCQ 2PI2E 4L5QA 4IALA 1SEBD 5HGQA 3SR1A 3CMEA 1IBLL 4RCOA 4WJ4A 1MBYA 1X3FA 2FFKB 3GO5A 4IZ8A 4DUYL 3A55A 3A74A 2KBNA 2G5DA 3EN2A 3M7NA 2K14A 3H3VH 2E2IH 4YCVA 2EYMA 2B2VC 3NE5B 3S2DH 1LT4D 5FO8B 4ZYSA 5M5WB 4Q5VA 5IGDA 3K8AA 3K5MA 1A15A 2SDFA 3U9SA 1Q1BA 1GXDC 4RMFA 3FMCA 3HRZC 2NB0A 5IP9H 2K32A 3GV6A 4JI5Q 3HOWG 1BCPF 3CHBD 3FDTA 5M5XB 3U50C 2JN4A 1DM0B 4L63B 2YU9H 1I6VC 4BY1G 4EQNA 2QGQA 4PNYA 4RHRA 2WAQG 4UP9A 4K5WA 1W2BA 3MXNB 1NCVA 2A69D 1RIPA 5FO7B 2F3IA 2DNEA 5IGCA 5JOBA 5ELNA 2AQ2B 3I90A 4ZRZA 2E2JB 3P7JA 3AEVA 3RZDB 2WIIB 2K52A 4V190 3A56A 2PQAA 4JI7Q 4LF7Q 5KNCA 2NVYB 2WV6D 4MTKA 4Y7NH 4ZK9B 1RJTA 1P16A 4QUFA 4DAMA 2JXMB 2EJGC 2E5LL 3G71A 5JPMC 5AFWA 1K83H 1EY0A 1M90C 1Y1WG 4IFDI 1U4RA 1PV4A 1FGBD 5KGUA 1GUOA 3K81C 2VQFL 5JJLA 1DD2A 4A93G 4JPBW 1VQMA 1XX8A 1X65A 5CV5A 2O4XA 3J80L 1TXYA 2B29A 3S1MH 3A54A 1RHPA 1H9RA 2MO0A 1PZID 1P8LA 1O7LA 3D4WA 2VZAA 3RMHA 3H94A 3E9IA 1CQFA 2C35B 2KECA 4J15A 2ICIA 3F2CA 2F0HA 2F3VA 3P75A 2BCOA 1M1KC 1AE2A 1PTOC 2A8VA 2CQAA 1I4PA 4LAAA 3DXJC 2GVBA 3GD7A 1V1PA 1EZ8A 2B2UA 5M3MG 1HFGA 1VQ9A 4O0AA 3OSOA 1VQAA 4KKTA 3PUXA 4AQYQ 4BBRH 2D0PA 4IURA 2KENA 1JQYD 4TKOB 1GHJA 1TWHB 4LFCQ 3G48A 2KEEA 2B3GA 3PIP3 1PRTC 4JI5L 4ODGA 4JI0Q 1EQQA 3CPFA 1JOKA 1KNEA 1YJWA 1F9PA 4ZCKA 1QZHA 1PYSB 5C44H 2Q8RE 4A3DG 2F0PA 2ALYB 1SROA 2BH2A 4A3MB 5EPLA 3C1EA 1IXRA 4GS3A 5EKKA 1CKOA 2IX0A 2UXDL 4DR6L 2OTLA 1FGUA 1QNKA 4P71A 3Q0AA 2K5WA 1SLJA 1C7YA 5C3EB 1PRTB 2Y0SG 4IQZA 4C2MH 1H9KA 1IYUA 3OYYA 3GTGB 1XTCD 3DEPA 1F2ZA 4KK7A 1UE6A 2DY7A 1G2TA 3AFPA 1L2FA 2R6GA 2RHQB 2Y0SB 4UY8C 1K3BC 4K6LA 3J7YW 1CZGA 2C9OA 4JI3L 1JMCA 1JORA 1I4HA 1LV9A 4C3HB 1YHBA 3MXPA 1EYCA 2AUJD 1PA6A 3D0FA 2Z8LA 3SE0A 1Q1EA 5JAVA 2I07B 3HOXB 3GTMB 3QO2A 1OO9B 4L5SA 2AWOA 1TWFH 1A0IA 1B70B 2Q2UA 2NVYH 4Y7NB 1YHQA 3M4QA 3GTOB 4DV0Q 2ZJQA 4OONA 4ID6A 1U4MA 2J7ZA 4F87A 2B8FA 4BY7B 1SBBB 3ULJA 1G6PA 5GQOA 3OMGA 1VS0A 1L0YB 2HUGA 1D8LA 2PQEA 4BS9A 3TMEA 3GTPB 5EPJA 4YHHL 2R7ZG 4RWSC 1HZAA 5IT9L 3FHWA 5IIFA 2UXBL 3T1HL 3PUWA 2AUKA 5IOCA 4JI7L 5KYLA 3AU7A 4AH6A 3JC66 1YIJA 1QJOA 3K5NA 2UU9L 4DAPA 4KMUC 4UHVA 4IFDH 2CWAA 1BVSA 2WAQB 3EA6A 1LT3D 2CH4W 5M5YB 2Z6KA 1SYGA 3I4MB 1DYQA 2G9HD 2HHHQ 1YJ9A 1E1OA 1KQSA 1L0XB 1WTQA 1SSOA 1K9MC 1SN8A 2C5CA 4C3JH 3C3LA 4OO1G 1IBKL 5IT9E 2MFIA 4OHJA 4GN4B 4IUVA 1K3RA 4DUZQ 1Q7YC 5KNDA 3I7FA 3HG9A 4JVZA 3MHBA 1SE3A 4AYBG 3HOUG 2MPMA 4TVAB 2YTXA 4C3IG 3VR5A 4BY7G 2DGYA 5FJ8H 1AN8A 1NJIC 3UI2A 5C4XH 4A3KH 1VCIA 4HIDA 5EBCA 4C56C 3LX0A 1HH2P 3J7ZC 4MN3A 2F0SA 1D7QA 4R4IA 1HNXL 5C0XH 2F0TA 5CYUA 2E5LQ 1SYDA 2VS1A 2WINB 1LTTD 3K6OA 4GN5A 4ABNA 3LWEA 4KHPQ 1KAAA 3LWUA 2L1BA 5M9OA 4B3RL 2ZXRA 2Z4IA 4A3LG 5IYDH 2R92H 1T9HA 4I65A 2F0FA 4HTHA 2VB2X 3ERSX 3S1QH 2IJ0A 1X3EA 2R93B 3PF5A 1HR0L 2IL8A 4G7ZC 4PZ8A 1HCZA 4JCVE 3NK9A 5KIXA 2HCIA 4GOPB 3H09A 5E4XA 3S17B 1VQGA 5FLXc 2F0MA 1ASYA 1E3PA 1TS5A 1XMQQ 2AKWB 1UE7A 4HMIA 2CHBD 1JB7A 1BQQT 3K59A 4RCNA 3FKIH 2K7VA 4A3MG 2XNAC 1GUGA 5ELCA 2PZTA 2F4VL 4KJNA 1N36L 3U58A 2SOBA 4LF8Q 1C0AA 4CKEA 3KF6B 2B63B 4KY5A 1FVIA 3D6WA 4JV5L 5IGEA 1JC7A 3TZUA 1IYJB 1EQVA 2A74C 3CW2C 1WVLA 4ALPA 1QOHA 1LTSD 1MI2A 3S15B 4V0BA 1SYFA 2EYJA 3I4LA 3HOYG 4LWCA 5LMNQ 5JPNC 1EEID 2EYPA 4A3GH 2F0OA 1STYA 5TSSA 2B39A 4PZ7A 2BA1A 4IUPA 5DEHA 4FF2A 5GAHC 2PZUA 3TP6A 2VUMB 2HIXA 4UP7A 4KY7A 3S14B 2XWJB 4GKJQ 3QOJA 5JEAJ 2V4DA 3ONAB 4ZQ3A 1EUJA 1D5MC 1CSPA 1VQBA 1HQMC 3FPPA 1ONLA 5C0XJ 2VUMG 1ET9A 2PPBC 4A3JH 2XRQD 2YV5A 4H7BA 4B9XA 1Y1WB 3GTKH 3QJYA 1QNUA 2R7FA 4RFBA 4FF1A 1N32Q 5FK9C 2A69C 2QDLA 3PGZA 3NTHA 2Z6KC 2AWNA 5IYCG 4IN3A 4P74A 1WCMH 1A62A 3HFZB 3L3OC 4LJZC 4KTAA 3G4SA 1EZ6A 3HOVB 5I6YA 5LL6X 3MXUA 4ME3A 4BA1I 3BJUA 3DLLA 3DWPA 2L12A 4LUZA 1HRJA 2RHSB 2PMZE 1FJGL 3Q24A 4OO1I 3UE0A 1AE3A 1AEXA 3S9WA 4A3IH 2NN6I 2Q2HA 2L11A 3FRPB 4J6HA 1F9SA 3ICEA 1PHJA 2A68C 3RUZA 1A2TA 2RSOA 4BBSB 4UP8A 4X65L 2JEAI 4QQBX 2F0EA 4FYDA 3NUCA 4LUOA 3QIAA 4JYAQ 3TS2A 3CCSA 4C3JG 1ZYRD 5J3BA 3I56A 1VQNA 1SNDA 4WJWA 2K04A 4H0LC 1QVGA 1HHVA 3VYTA 2WAQE 1TWCH 1EYAA 2L0CA 1MJEA 3J7AF 3OPOA 3NSWA 2XWBB 3HKZB 4RG1A 3BYTB 2XGTA 4UAIA 3EVQA 3TRZA 1FYCA 4JBMA 4DV2Q 1GUTA 2KHIA 1V1QA 2E2HH 3RLNA 4CJ2C 1C4QA 2IW3A 4E6IA 1YEZA 3NTKA 1EIGA 3R2TA 4X3SA 1X9NA 3KLSX 1TY0A 3HOUH 2M2LA 4B08A 1HZBA 2KA7A 5HGTA 2CCZA 3BVGA 3HOXH 1WTXA 2Z9HA 1KAWA 1I3QB 4XXEA 4LF5Q 4R4QA 1W3SA 1I4GA 1TT2A 2FJ2A 2K5NA 3A5ZB 5DM73 2HQLA 3KLSA 4OWWB 1CKNB 1IBML 5I9PA 4R1JA 2CQOA 3VA7A 1DONA 1VQ8A 2M9VA 2MJ8A 3D6CA 4X62L 3W1GA 5CV8A 5IWAQ 2EPBA 1EY9A 2MHVA 4AYBE 2EXZA 1XWEA 4LF9Q 3HOUB 3NPPA 1WTHA 1XMOL 2KVMA 2BE5D 5BN5A 3S14H 3CPWA 2SEBD 1SYBA 3RN2A 2B2TA 3PUYA 1VQCA 2D5DA 4K8JA 1FNVA 5C3EH 3WOFA 3AFQA 2PMZB 3EQLC 4DV0L 3K7AB 1HUNA 2HQEA 2Q2IA 3BDCA 5FKAC 4FF3A 1UWVA 3NQIA 1WD0A 3S2HH 3X3NA 3EBEA 1CI3M 1CKMA 2PQAB 2KUMA 3NTIA 4A3EB 4R4OA 1Q82C 4JI0L 1QILA 2D9UA 1S4ZA 4RKLA 4DR7Q 3I4NH 1KD1C 2A5HA 1CSQA 1U5KA 2A6HD 5M3FH 1IBLQ 1STNA 1MGSA 1F2MA 2IT1A 4QUCA 5CBAE 1EQRA 4DAYB 5F2DA 5FLXL 4WJ3M 1BUVT 2F0JA 3NENA 2HT1A 2B2YC 1RDPD 1TWGB 5NUCA 4X3TA 2YU9B 1PH6A 3NWSA 2EJMA 1SJED 1VQLA 1C48A 2B2YA 1PYWD 4YWMA 2AQ3B 3SK5A 4ILWA 4GNXB 1PTOB 1YI2A 1TWHH 3U4VA 5KYIA 1BDOA 1H9SB 1M8AA 1PFNA 2ZXPA 4A76A 4NPSA 3IKJA 2RKSA 2BE5C 1D2BA 3HOWB 4DN4M 4JBWA 3I73A 1YNJC 3VR2A 2F0WA 5HURA 3KUPA 1SAPA 1SFOB 3IFTA 4OWXB 1GOZA 2GVAA 2OQ0A 1HTPA 1JWMD 4WFN3 2PW7A 3SK8A 4DR4Q 5C3EG 1JB3A 4HAEA 1STEA 2PNHA 1RL2A 4A93H 4HJ9A 1EY4A 2N8NA 4C1NI 1VDZA 2E75C 3LNNA 2JA7B 1E2ZA 5FLMH 4LF6L 4PV1C 1NUCA 3OIQA 2E2JH 1IL2A 4UPAA 4APVA 4DV3L 5ELFA 2HD3A 3T1HQ 3HS0C 4XT3B 4R8IA 4KN4C 3AB9A 1NE3A 3T53B 1PDQA 3OTOQ 2D2CC 2UXCL 4LFAQ 4KV6A 1L1OB 4YCUA 3NHHA 4IO9A 4DNRB 2LS01 5IY0A 1XNRQ 1M4VA 4OELB 4P73A 5GADC 3K57A 3S2DB 4ZKCB 2EOTA 4DV2L 5KEEA 2K4KA 2JA8B 2ENBA 3FEWX 5LMNL 3VR4A 3NP8A 2B2WA 2F0GA 1NTGA 4DF7A 5M5WH 4A3DB 3CCUA 3F8TA 4XYOA 4BBSG 1HR0W 3MFYA 5I2YA 3SVMA 3ZYYX 3S16B 4A3FG 2NWGA 4DK3C 4HCEA 4B3SL 5A2QL 2VW9A 2VNUD 1HFNA 3TS0A 1I6HH 4K0KL 1I50H 1K28A 3A7LA 1Q86C 2OCEA 4IOAA 4AYBB 2EYLA 4KHVA 3TN2A 2H4OA 4ZKBB 2CVRA 1OXVA 2NBFA 1A3VA 2JE6I 1D5ZC 1ASZA 4GNXA 2BDOA 4R4TA 4XT1B 2VQEL 1EOVA 2BOSA 2GN5A 1NMGA 1AH9A 3E9HA 4IPHA 3U4ZA 1ZEQX 1XPRA 5EKLA 3KYHC 3PO2G 1A63A 4X66L 3EJIA 4QIWB 1CTMA 5ELOA 2KCNA 4A4IA 2HHHL 4DK6C 1RF2D 4KD4A 5IODA 1SE4A 3G7LA 1GKHA 3R93A 1LT6D 2J0TD 1QVFA 3R2IA 4DV1Q 5J1ZA 2EIFA 3J80c 1SRUA 2FXQA 1HNWQ 1N34Q 3K58A 2Z0SA 1U0LA 4F7XA 4GOPA 3KF8A 4A3CH 4DR1Q 3DHQA 1KDCA 2RDFA 1LYLA 4LW1A 4B3MQ 2KCCA 3MZ5A 4CKCA 2SNMA 3GDEA 3D4DA 3KJOA 3TEHB 2NUCA 1PFSA 1SNOA 1Q12A 1XNRL 5D14A 4DA2A 1RTNA 3QB3A 1VQ4A 2VUMH 1KXLA 1CQVA 1ENFA 2NN6G 5DNFA 3G6EA 4OGQC 4LMQD 2EYFA 3NBIA 1NAPA 4OX9Q 2NVXB 1L1OA 5C3WA 3AYHB 2XSCA 1SJHD 2ASBA 2ZTCA 1LABA 4RGOS 1VQ7A 1B3AA 2P5ZX 3BZKA 3PF4A 4R8NA 1WTWA 4GLXA 1HNWL 4LFAL 1X3PA 1QUQA 4EX5A 5AJ3L 4CDCC 3BDOA 2PI2A 5I6WA 2VQFQ 3CD6A 1LTLA 3PIPA 1JICA 4HSVA 3M3YH 1PZJD 5FLMG 1C8CA 3N52A 1U9RA 1CFMA 5C4JH 1II3A 1R4PB 1XXGA 4N8X1 4GOPC 2QKIC 3CCJA 3S1RH 4NKLA 5C5MA 1YZ6A 3E0EA 3G6JB 1Y8OB 5CGKA 4KI0A 4A3CG 4DUZL 2NVQH 5E4WC 2F03A 1RD9D 2F4IA 1EYGA 3VYSA 2EY5A 4EQOA 2N78A 3L9AX 3NEMA 2CH4A 2DNCA 4KHZA 2RQXA 1KHIA 3I72A 5JEAH 1JWUD 4K2LA 3VR3A 2N49A 5C4JB 2ATWA 1IZ6A 2WP8J 1ILQA 4PMWA 3BZCA 4H44C 4LFCL 1IW7C 4JYAL 2EE1A 3DUZA 1EWIA 1TWFB 4I7AA 5M5XH 3S2HB 1AW7A 4GNXC 4JI6Q 1QVCA 3T16A 3J81L 1IL8A 4DPGA 2LMCB 5C44B 1MIUA 4LF5L 1ENCA 4EGVA 3DEOA 1PH5A 1CK1A 1MKHA 2WKDA 1LO5D 1HUMA 4XDXA 3KBXA 1A3TA 5C4HA 1B9MA 1CUKA 2HIVA 3I8ZA 1Q90A 3S17H 1I4RA 2EZVA 1EWCA 5JVH3 1WTVA 1OXXK 1X56A 2XRSD 1K8OA 2F0KA 1PMRA 2BDNA 1X32A 1H95A 1T5EA 1NR2A 2JA6G 1C9OA 1WI5A 2Q2TA 1JJCB 3I4NG 3J80E 4PQXA 4LNQA 5GAEC 2PW5A 4OL7A 1Y8PB 3RLOA 1VF7A 5IYBG 4R9WA 1BBXC 4HSPA 1EWHA 3PUZA 1W6JA 1GJXA 1E22A 4QIWE 2ZTDA 5EPKA 4XQNA 2L4NA 3C1FA 1CA5A 2DUDA 3Q6SA 4C3HH 3ITPA 4XQJA 1PVOA 3V96A 1E7ZA 3PCOB 2EJFC 2FINB 1RTOA 4MHEA 2CKZB 4FDBA 2K1BA 3KF8B 4NMZA 1B44D 4X64Q 2MNAA 1UAPA 2F0DA 5COYA 1NSNS 3T13A 1STGA 2A68D 1BF4A 2O5JC 2JA8H 3UE1A 1CKNA 3RZOH 4X3KA 1EY6A 4L6TB 2Q8IB 1HPCA 5I2XA 2XVSA 3CU7A 4QF4A 5J39A 3UDIA 4A3GG 2JA9A 1A2UA 1FJGQ 3IL8A 3V05A 2JA6B 4ZLTF 4HJ5A 2Z1CA 3GTJH 3J80i 5BR8Q 2UUAL 1JOQA 4OX9L 4B9WA 1LM0A 4YWLA 5K36G 1OTCA 1I4XA 1LLRD 2ZM6Q 2A6ED 3M85A 4A3BB 4JG2A 2D62A 1X6OA 3HP3A 1K8AC 2UU9Q 4FXGC 3O13A 3SK4A 2B63G 1YNXA 4NP5A 4JI8Q 2WB1G 3M9BA 1JWSD 2LSSA 3URYA 4J1MA 5GAGC 1DGSA 3JAME 5T1GA 3AQQA 2CWPA 4B3TQ 5K5PA 4YY3Q 2F4VQ 2NVTB 3CRLC 4MTNA 1WJJA 1ML0D 3MFGA 1STAA 4RKBA 3PSIA 3ND8A 2MGSA 2QCPX 2F0UA 2NN6H 2RCFA 3U9OA 4DU9A 1G2SA 1IKLA 1Y14B 1KIXA 3GTGH 4YCWA 4QY7A
chains in the Genus database with same CATH topology
4BA2I 3UDXA 3PUYA 1VQMA 1NMFA 1VQCA 3W1BA 3JAMc 3S16H 5C3EH 5E7NA 3M4OH 3AFQA 4DR7L 4DV0L 1X65A 2Q2IA 4NXML 3CP0A 1TXYA 1UWVA 2B29A 3RR5A 4DR3Q 3S1MH 4GKKQ 5BR8L 2UUAQ 1HR0Q 3S2HH 4X6AH 2MO0A 1XMOQ 1Q8KA 2JA5G 3EBEA 5M3FG 1CKMA 1P8LA 1WYDA 2PQAB 2VZAA 1VQKA 3CCMA 3E9IA 3S15H 2C35B 4R4OA 3J81i 4J15A 4PG3A 3F2CA 1Q82C 2H5XA 3K7UC 3H15A 4JI0L 2IX1A 4H02A 4POFA 1V43A 3PV0A 4NXNQ 1XJVA 1XPUA 1XNQL 2WFWA 1M1KC 1AE2A 4HJ7A 4DR7Q 3I4NH 2A8VA 1KD1C 1UEBA 4IFDG 3T1YQ 4JBKA 1TWGH 4A3FH 4B3RQ 2GVBA 3GD7A 4B3SQ 1CSQA 1U5KA 5M3FH 1VQFA 4JI3Q 3HOZG 1Y1VH 1IBLQ 5M3MG 4HJ8A 4JI2L 4BY7H 1VQ9A 4O0AA 1VQAA 1NBWA 2IT1A 4A3EG 1VQJA 3PUXA 1EQRA 4GKJL 4AQYQ 3PO3G 4BBRH 2D0PA 2KENA 4DAYB 4DR1L 4LFCQ 4WJ3M 3G48A 3NENA 2B3GA 3Q8DA 2HT1A 2I5LX 4JI5L 1OXTA 5JJKA 4JI0Q 2LXKA 1EQQA 3CPFA 4QY7A 1J6QA 3UDFA 1PH6A 4JBJA 3K0XA 1YJWA 1QZHA 1VQLA 1PYSB 2JK8A 5C44H 4A3DG 2ZTEA 5M3MH 2I0QA 1Y1VG 4YWMA 3HOZH 3J81c 3H0GH 2ALYB 2EXDA 1SROA 2BH2A 3LGJA 1GO3E 4DV4L 1IXRA 4GS3A 1CKOA 2IX0A 4JOIC 4GNXB 2UXDL 3TREA 1YI2A 1TWHH 4GLVB 3U4VA 4DR6L 2OTLA 1FGUA 4A76A 4P71A 4DV5L 4NPSA 1SLJA 1Z9FA 3CCRA 1R9TH 1C7YA 1OXUA 4L5RC 2MQHA 2NVTH 3CQZH 4KHPL 2Y0SG 4C2MH 1QZGA 4JBWA 5H1SE 4X62Q 1B8AA 4LUVA 1K73C 4OXPA 3OYYA 3CAMA 2CFMA 1KC8C 4LF9L 4DV3Q 1S72A 2K5VA 4TQUS 1UE6A 2V1CC 5IWAL 4OWXB 1JE5A 3NELA 4YY3L 2GVAA 2BH8A 2OQ0A 2ZJRA 3AFPA 4LF8L 1L2FA 2R6GA 2RHQB 4DR4Q 3K7AH 5C3EG 4UY8C 2PNHA 2UXBQ 1RL2A 3CC4A 4JI3L 3J81j 4A3EH 1JMCA 4DV1L 4A3IG 4A93H 4HJ9A 4YHHQ 2N8NA 3ER0A 1YHBA 1HNXQ 5FLMH 4X65Q 4LF6L 1PA6A 3D0FA 3GTQH 1Q1EA 2E2JH 1IL2A 5GROA 3KOJA 4UPAA 1K8GA 2QEXA 4APVA 4DV3L 4L5SA 2AWOA 3B6YA 3T1HQ 1TWFH 4POGA 3PIOA 1NE3A 1A0IA 5C0XI 1B70B 5HY6A 2Q2UA 2NVYH 3OTOQ 2ZJPA 3I2ZA 1YHQA 2UXCL 3M4QA 4LFAQ 2JA8G 3H3VI 2ID0A 4DV0Q 1EFWA 1L1OB 2BA0A 2ZJQA 4OONA 4YCUA 4IO9A 4JI1L 5IY0A 1XNRQ 1YJNA 2L15A 1N32L 2JA5H 4HIMA 4JOIA 4P73A 3ULJA 5GADC 4DV7L 1I5FA 1NY4A 5GQOA 1G6PA 1VS0A 3J7A5 5M5YH 1N8RC 1D8LA 4DV2L 2K4KA 3I4MH 3S1NH 4JI6L 5LMNL 4YHHL 2R7ZG 3DM3A 1HZAA 4NB3A 4X64L 1NTGA 1VQPA 1Q81C 3FHWA 5M5WH 1GVPA 3CCUA 2UXBL 3F8TA 2I5MX 4DV6Q 3T1HL 1KL9A 4BBSG 1HR0W 3PUWA 4B3TL 4JI7L 2A1AA 4AH6A 3KDFB 3JC66 1YIJA 4A3FG 2UU9L 5LMNW 4DK3C 1EIYB 4B3SL 2VW9A 2VNUD 1HZ9A 2AMCB 2CWAA 5IP7H 3TS0A 1BVSA 1I6HH 4K0KL 1I50H 4X66Q 1Q86C 2OCEA 2Z6KA 1VQ6A 4IOAA 1IBMQ 1PYBA 3I55A 2K75A 2HHHQ 4A3BH 3S24A 1YJ9A 1E1OA 4LFBL 1N9WA 1S3OA 4L5TA 4DV4Q 1KQSA 1N33L 3STBC 2JQOA 5IYCH 1K9MC 1GD7A 3CC2A 1I3QH 1OXVA 2NZHA 1SN8A 3CCEA 4PZ6A 4C3JH 2JE6I 4OO1G 3HKSA 2B63H 1ASZA 1IBKL 4GNXA 2MFIA 4R4TA 2R93G 2VQEL 1BKBA 1EOVA 4GN4B 1VQHA 1K3RA 2D0OA 2GN5A 4DUZQ 1NMGA 1Q7YC 3I7FA 4HIOA 1MJCA 5LMUL 4GKKL 1AH9A 1BBUA 3E9HA 1PH7A 5IE8A 2ES2A 4IPHA 4YWKA 3U4ZA 4BBRG 2UXCQ 1XPRA 2IY5B 4BXXG 4AYBG 2JA7G 3HOUG 3KYHC 3PO2G 4TVAB 1G291 2YTXA 1A63A 4A3KG 1GM5A 4X66L 4BY7G 2DGYA 5FJ8H 5C4XG 2KHJA 5FJ8G 1O7IA 1NJIC 5C4XH 5ELOA 4A3KH 1SR3A 3A5UA 1VCIA 4HIDA 3F1ZA 4IPDA 4A4IA 2HHHL 4DK6C 4DR5L 2JA7H 1HH2P 3J7ZC 1Y1WH 5IYBH 1FL0A 3TQYA 3GTMH 4Y52H 1D7QA 1GKHA 4HJAA 4R4IA 1E1TA 1QVFA 1HNXL 4P75A 1TWAH 3JAMi 1SMXA 4DV1Q 2EIFA 2E5LQ 2VS1A 3J80c 1SRUA 2FXQA 4GN5A 3VDYA 1N34Q 1HNWQ 2JA6H 2Z0SA 1U0LA 2JJQA 4LFBQ 4GOPA 4KHPQ 4A3CH 4DR1Q 2OWOA 5IT9c 3A0JA 4A3BG 1LYLA 4LW1A 4B3MQ 4B3RL 4A3LG 4K0KQ 2R92H 5IYDH 1T9HA 3GTGH 1I94L 4MZ9A 4JI2Q 4XTCS 1SFOH 3GDEA 3UDGA 3KJOA 4BY1H 3TEHB 2N3SA 3HOYH 3HOVG 3ERSX 4JI8L 1PFSA 3S1QH 2IHEA 1X3EA 1S40A 1KRSA 3RZDH 1Q12A 1XNRL 3PF5A 1HR0L 1VQ4A 4A75A 2VUMH 3HOWH 3KDFA 1KXLA 4PZ8A 1PH2A 2NN6G 3G6EA 5IP9G 4JCVE 3W5OA 1L1OC 4BXXH 3ULLA 4GOPB 4OX9Q 1WFQA 1L1OA 4DR2Q 3AYHB 4B3ML 1VQGA 1OXSC 3I4MG 5FLXc 2ASBA 1ASYA 4HIKA 2ZTCA 1VQ7A 1E3PA 1LUZA 1XMQQ 3ULPA 3PF4A 3BZKA 3L2PA 2AKWB 1UE7A 4MNOA 2MO1A 1JB7A 2EQSA 1X54A 3FKIH 4GLXA 4A3MG 1HNWL 1VQIA 2YTVA 4LFAL 3FKIG 2XTIA 3KJPA 2F4VL 1QUQA 4EX5A 1PH1A 5AJ3L 3U58A 1N36L 2AHOB 4LF8Q 1C0AA 3KF6B 4IFDJ 2PI2A 1J5EL 5DLQE 1FVIA 1YHAA 2VQFQ 4JV5L 1XNQQ 3CD6A 1LTLA 3HOXG 5IP7G 3PIPA 4LF4Q 3L7ZC 4IOCA 1IYJB 3CW2C 3M3YH 4ALPA 3CCQA 1EIFA 3MEFA 4DR6Q 5FLMG 1B7YB 4BBSH 4IJLA 2WB1E 4C3IH 3OW2A 4DV7Q 3FP9A 3PO2H 5C4JH 4DV5Q 2RF4A 4GOPC 1V9PA 3CCJA 4DR3L 3HOYG 3S1RH 4R4CA 2VQEQ 4LWCA 1XMQL 1A8VA 1UE5A 1Z47A 1JJ2A 5LMNQ 3OTOL 3BU2A 2R92G 3KFUA 2KCTA 1YZ6A 3E0EA 4A3GH 1HNZL 4KI0A 3RN5A 4P72A 1L0WA 4PZ7A 2BA1A 4JI1Q 4DUZL 2NVQH 4A3CG 4DR5Q 1VQOA 3RNUA 2QA4A 1SE8A 2KCMA 1EYGA 1XTDA 3KLWA 1XPOA 2RCNA 5GAHC 2N78A 4DR2L 3NEMA 5C0XG 4KHZA 4IPCA 2UUBL 1KHIA 3CCVA 3M4PA 3CCLA 4GLAC 2HIXA 2N49A 4UP7A 4XIGS 5LMUQ 2Y0SE 4OWTB 2ATWA 4GKJQ 4KLKA 1IZ6A 3H0GG 2WP8J 5JEAJ 4A3JG 4O2DA 4PMWA 3BZCA 4LFCL 4JYAL 1EUJA 3HKZG 1CSPA 1VQ5A 1EWIA 1I94Q 1VQBA 2NVXH 5M5XH 3I4OA 2JEBI 1YITA 4GNXC 4JI6Q 5C0XJ 1QVCA 4DKAC 2VUMG 5AJ3Q 1N36Q 1N34L 1KRTA 4DPGA 4A3JH 2YV5A 1MIUA 1PH3A 4LF5L 3CF5A 1PH5A 4JV5Q 1MKHA 3GTKH 2R7FA 3SGIA 1VQDA 3HOVH 2A19A 1N32Q 5JEAG 1QUQB 1CUKA 4DV6L 4JI4L 3CC7A 1YBYA 2HIVA 3K80C 3S17H 3PGZA 3HKZE 1JT8A 2UUBQ 1HZCA 3F2DA 2Z6KC 2F52A 2AWNA 1OXXK 5IYCG 1X56A 2I5HA 4P74A 1WCMH 1A62A 3CMAA 1Q46A 1WCMG 3HFZB 1H95A 2JA6G 1HJPA 1C9OA 1WI5A 2YTYA 3G4SA 2Q2TA 1X3GA 2ZM6L 1JJCB 3I4NG 3GTLH 4ME3A 2IHFA 1PH9A 2VL6A 4BA1I 3BJUA 3DLLA 4DNIA 4LUZA 4LNQA 1K0RA 5GAEC 2RHSB 2K50A 2PMZE 4QJFA 3L0OA 4NXMQ 4IPGA 4QL5A 4AIMA 1IBKQ 1FJGL 3RLOA 5IYBG 3UE0A 4OO1I 1AE3A 3PUZA 3CXCA 1JJGA 4A3IH 2NN6I 2Q2HA 4JI4Q 1E22A 3NBHB 2ZTDA 4QIWE 5EAYA 2YYZA 4A93G 4LF4L 2R7ZH 1N33Q 1PHJA 3ICEA 2DUDA 3D31A 4C3HH 4EQ5A 4UP8A 1J5EQ 1PVOA 4IJHA 3RLFA 1E7ZA 3PCOB 4X65L 4LF6Q 2UUCQ 4LF7L 2PI2E 2CKZB 2JEAI 4L5QA 4FDBA 3KF8B 2OQKA 5HGQA 1IBLL 3CMEA 4QQBX 4WJ4A 4LUOA 4X64Q 4JYAQ 2R93H 2MNAA 3WWVA 3TS2A 1X3FA 3CCSA 3GO5A 4AQYL 3GTOH 4DR4L 2NZOA 4DUYL 5J3BA 3I56A 1VQNA 3UE1A 3A74A 2KBNA 1CKNA 3T1YL 2JA8H 3EN2A 3STBD 3M7NA 3RZOH 1QVGA 2K14A 4A3MH 3H3VH 2E2IH 4YCVA 1E24A 3S2DH 2WAQE 1TWCH 4JC0A 3UDIA 1MJEA 4A3GG 2OTJA 2JA9A 3K8AA 1FJGQ 5JJIA 2VY3A 4RG1A 2XGTA 3GTPH 1Q1BA 4HJ5A 3TRZA 4RMFA 4JBMA 3GTJH 3J80i 5BR8Q 5IP9H 2KHIA 4QGUA 4DV2Q 2UUAL 4OX9L 1LM0A 1V1QA 4YWLA 3RLNA 1HNZQ 2E2HH 4JI5Q 3HOWG 5K36G 1OTCA 1YEZA 2E8GA 2ZM6Q 3U50C 1X9NA 3HOUH 2R7DA 3M85A 1PH4A 3PUVA 1HZBA 2CCZA 4JG2A 1PH8A 2LXJA 2YU9H 3HOXH 4BY1G 2D62A 1X6OA 2QGQA 4UP9A 2WAQG 1X55A 1W2BA 1BBWA 1KAWA 3EIVA 3MXNB 3ZJYC 2UXDQ 1K8AC 3PO3H 2UU9Q 1RIPA 5IYDG 4A3LH 2F3IA 4LF5Q 4R4QA 1W3SA 1YNXA 2B63G 3A5ZB 2K5NA 5ELNA 2HQLA 4JI8Q 4OWWB 2WB1G 3M9BA 2LSSA 5GAGC 3AEVA 1CKNB 1IBML 1DGSA 4R1JA 2K52A 2CQOA 3AQQA 2CWPA 1UE1A 1VQ8A 2PQAA 4B3TQ 4JI7Q 3IRBA 3KF6A 2UUCL 4Y7NH 4LF7Q 4X62L 3W1GA 5IWAQ 1P16A 4YY3Q 1VQEA 2F4VQ 4DAMA 4AYBE 2E5LL 3G71A 4MTNA 1WJJA 4LF9Q 1K83H 1M90C 1Y1WG 4IFDI 3PSIA 1XMOL 1PV4A 2K5HA 4DUYQ 4A3DH 5C44G 3F2BA 3K81C 1YVCA 3S14H 3CPWA 1Y14B 4NXNL 2VQFL 3RN2A 5JJLA 1KIXA 4GN3B 4YCWA 1WOCA 1G51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA2 I;  3UDX A;  3PUY A;  1VQM A;  1NMF A;  1VQC A;  3W1B A;  3JAM c;  3S16 H;  5C3E H;  5E7N A;  3M4O H;  3AFQ A;  4DR7 L;  4DV0 L;  1X65 A;  2Q2I A;  4NXM L;  3CP0 A;  1TXY A;  1UWV A;  2B29 A;  3RR5 A;  4DR3 Q;  3S1M H;  4GKK Q;  5BR8 L;  2UUA Q;  1HR0 Q;  3S2H H;  4X6A H;  2MO0 A;  1XMO Q;  1Q8K A;  2JA5 G;  3EBE A;  5M3F G;  1CKM A;  1P8L A;  1WYD A;  2PQA B;  2VZA A;  1VQK A;  3CCM A;  3E9I A;  3S15 H;  2C35 B;  4R4O A;  3J81 i;  4J15 A;  4PG3 A;  3F2C A;  1Q82 C;  2H5X A;  3K7U C;  3H15 A;  4JI0 L;  2IX1 A;  4H02 A;  4POF A;  1V43 A;  3PV0 A;  4NXN Q;  1XJV A;  1XPU A;  1XNQ L;  2WFW A;  1M1K C;  1AE2 A;  4HJ7 A;  4DR7 Q;  3I4N H;  2A8V A;  1KD1 C;  1UEB A;  4IFD G;  3T1Y Q;  4JBK A;  1TWG H;  4A3F H;  4B3R Q;  2GVB A;  3GD7 A;  4B3S Q;  1CSQ A;  1U5K A;  5M3F H;  1VQF A;  4JI3 Q;  3HOZ G;  1Y1V H;  1IBL Q;  5M3M G;  4HJ8 A;  4JI2 L;  4BY7 H;  1VQ9 A;  4O0A A;  1VQA A;  1NBW A;  2IT1 A;  4A3E G;  1VQJ A;  3PUX A;  1EQR A;  4GKJ L;  4AQY Q;  3PO3 G;  4BBR H;  2D0P A;  2KEN A;  4DAY B;  4DR1 L;  4LFC Q;  4WJ3 M;  3G48 A;  3NEN A;  2B3G A;  3Q8D A;  2HT1 A;  2I5L X;  4JI5 L;  1OXT A;  5JJK A;  4JI0 Q;  2LXK A;  1EQQ A;  3CPF A;  4QY7 A;  1J6Q A;  3UDF A;  1PH6 A;  4JBJ A;  3K0X A;  1YJW A;  1QZH A;  1VQL A;  1PYS B;  2JK8 A;  5C44 H;  4A3D G;  2ZTE A;  5M3M H;  2I0Q A;  1Y1V G;  4YWM A;  3HOZ H;  3J81 c;  3H0G H;  2ALY B;  2EXD A;  1SRO A;  2BH2 A;  3LGJ A;  1GO3 E;  4DV4 L;  1IXR A;  4GS3 A;  1CKO A;  2IX0 A;  4JOI C;  4GNX B;  2UXD L;  3TRE A;  1YI2 A;  1TWH H;  4GLV B;  3U4V A;  4DR6 L;  2OTL A;  1FGU A;  4A76 A;  4P71 A;  4DV5 L;  4NPS A;  1SLJ A;  1Z9F A;  3CCR A;  1R9T H;  1C7Y A;  1OXU A;  4L5R C;  2MQH A;  2NVT H;  3CQZ H;  4KHP L;  2Y0S G;  4C2M H;  1QZG A;  4JBW A;  5H1S E;  4X62 Q;  1B8A A;  4LUV A;  1K73 C;  4OXP A;  3OYY A;  3CAM A;  2CFM A;  1KC8 C;  4LF9 L;  4DV3 Q;  1S72 A;  2K5V A;  4TQU S;  1UE6 A;  2V1C C;  5IWA L;  4OWX B;  1JE5 A;  3NEL A;  4YY3 L;  2GVA A;  2BH8 A;  2OQ0 A;  2ZJR A;  3AFP A;  4LF8 L;  1L2F A;  2R6G A;  2RHQ B;  4DR4 Q;  3K7A H;  5C3E G;  4UY8 C;  2PNH A;  2UXB Q;  1RL2 A;  3CC4 A;  4JI3 L;  3J81 j;  4A3E H;  1JMC A;  4DV1 L;  4A3I G;  4A93 H;  4HJ9 A;  4YHH Q;  2N8N A;  3ER0 A;  1YHB A;  1HNX Q;  5FLM H;  4X65 Q;  4LF6 L;  1PA6 A;  3D0F A;  3GTQ H;  1Q1E A;  2E2J H;  1IL2 A;  5GRO A;  3KOJ A;  4UPA A;  1K8G A;  2QEX A;  4APV A;  4DV3 L;  4L5S A;  2AWO A;  3B6Y A;  3T1H Q;  1TWF H;  4POG A;  3PIO A;  1NE3 A;  1A0I A;  5C0X I;  1B70 B;  5HY6 A;  2Q2U A;  2NVY H;  3OTO Q;  2ZJP A;  3I2Z A;  1YHQ A;  2UXC L;  3M4Q A;  4LFA Q;  2JA8 G;  3H3V I;  2ID0 A;  4DV0 Q;  1EFW A;  1L1O B;  2BA0 A;  2ZJQ A;  4OON A;  4YCU A;  4IO9 A;  4JI1 L;  5IY0 A;  1XNR Q;  1YJN A;  2L15 A;  1N32 L;  2JA5 H;  4HIM A;  4JOI A;  4P73 A;  3ULJ A;  5GAD C;  4DV7 L;  1I5F A;  1NY4 A;  5GQO A;  1G6P A;  1VS0 A;  3J7A 5;  5M5Y H;  1N8R C;  1D8L A;  4DV2 L;  2K4K A;  3I4M H;  3S1N H;  4JI6 L;  5LMN L;  4YHH L;  2R7Z G;  3DM3 A;  1HZA A;  4NB3 A;  4X64 L;  1NTG A;  1VQP A;  1Q81 C;  3FHW A;  5M5W H;  1GVP A;  3CCU A;  2UXB L;  3F8T A;  2I5M X;  4DV6 Q;  3T1H L;  1KL9 A;  4BBS G;  1HR0 W;  3PUW A;  4B3T L;  4JI7 L;  2A1A A;  4AH6 A;  3KDF B;  3JC6 6;  1YIJ A;  4A3F G;  2UU9 L;  5LMN W;  4DK3 C;  1EIY B;  4B3S L;  2VW9 A;  2VNU D;  1HZ9 A;  2AMC B;  2CWA A;  5IP7 H;  3TS0 A;  1BVS A;  1I6H H;  4K0K L;  1I50 H;  4X66 Q;  1Q86 C;  2OCE A;  2Z6K A;  1VQ6 A;  4IOA A;  1IBM Q;  1PYB A;  3I55 A;  2K75 A;  2HHH Q;  4A3B H;  3S24 A;  1YJ9 A;  1E1O A;  4LFB L;  1N9W A;  1S3O A;  4L5T A;  4DV4 Q;  1KQS A;  1N33 L;  3STB C;  2JQO A;  5IYC H;  1K9M C;  1GD7 A;  3CC2 A;  1I3Q H;  1OXV A;  2NZH A;  1SN8 A;  3CCE A;  4PZ6 A;  4C3J H;  2JE6 I;  4OO1 G;  3HKS A;  2B63 H;  1ASZ A;  1IBK L;  4GNX A;  2MFI A;  4R4T A;  2R93 G;  2VQE L;  1BKB A;  1EOV A;  4GN4 B;  1VQH A;  1K3R A;  2D0O A;  2GN5 A;  4DUZ Q;  1NMG A;  1Q7Y C;  3I7F A;  4HIO A;  1MJC A;  5LMU L;  4GKK L;  1AH9 A;  1BBU A;  3E9H A;  1PH7 A;  5IE8 A;  2ES2 A;  4IPH A;  4YWK A;  3U4Z A;  4BBR G;  2UXC Q;  1XPR A;  2IY5 B;  4BXX G;  4AYB G;  2JA7 G;  3HOU G;  3KYH C;  3PO2 G;  4TVA B;  1G29 1;  2YTX A;  1A63 A;  4A3K G;  1GM5 A;  4X66 L;  4BY7 G;  2DGY A;  5FJ8 H;  5C4X G;  2KHJ A;  5FJ8 G;  1O7I A;  1NJI C;  5C4X H;  5ELO A;  4A3K H;  1SR3 A;  3A5U A;  1VCI A;  4HID A;  3F1Z A;  4IPD A;  4A4I A;  2HHH L;  4DK6 C;  4DR5 L;  2JA7 H;  1HH2 P;  3J7Z C;  1Y1W H;  5IYB H;  1FL0 A;  3TQY A;  3GTM H;  4Y52 H;  1D7Q A;  1GKH A;  4HJA A;  4R4I A;  1E1T A;  1QVF A;  1HNX L;  4P75 A;  1TWA H;  3JAM i;  1SMX A;  4DV1 Q;  2EIF A;  2E5L Q;  2VS1 A;  3J80 c;  1SRU A;  2FXQ A;  4GN5 A;  3VDY A;  1N34 Q;  1HNW Q;  2JA6 H;  2Z0S A;  1U0L A;  2JJQ A;  4LFB Q;  4GOP A;  4KHP Q;  4A3C H;  4DR1 Q;  2OWO A;  5IT9 c;  3A0J A;  4A3B G;  1LYL A;  4LW1 A;  4B3M Q;  4B3R L;  4A3L G;  4K0K Q;  2R92 H;  5IYD H;  1T9H A;  3GTG H;  1I94 L;  4MZ9 A;  4JI2 Q;  4XTC S;  1SFO H;  3GDE A;  3UDG A;  3KJO A;  4BY1 H;  3TEH B;  2N3S A;  3HOY H;  3HOV G;  3ERS X;  4JI8 L;  1PFS A;  3S1Q H;  2IHE A;  1X3E A;  1S40 A;  1KRS A;  3RZD H;  1Q12 A;  1XNR L;  3PF5 A;  1HR0 L;  1VQ4 A;  4A75 A;  2VUM H;  3HOW H;  3KDF A;  1KXL A;  4PZ8 A;  1PH2 A;  2NN6 G;  3G6E A;  5IP9 G;  4JCV E;  3W5O A;  1L1O C;  4BXX H;  3ULL A;  4GOP B;  4OX9 Q;  1WFQ A;  1L1O A;  4DR2 Q;  3AYH B;  4B3M L;  1VQG A;  1OXS C;  3I4M G;  5FLX c;  2ASB A;  1ASY A;  4HIK A;  2ZTC A;  1VQ7 A;  1E3P A;  1LUZ A;  1XMQ Q;  3ULP A;  3PF4 A;  3BZK A;  3L2P A;  2AKW B;  1UE7 A;  4MNO A;  2MO1 A;  1JB7 A;  2EQS A;  1X54 A;  3FKI H;  4GLX A;  4A3M G;  1HNW L;  1VQI A;  2YTV A;  4LFA L;  3FKI G;  2XTI A;  3KJP A;  2F4V L;  1QUQ A;  4EX5 A;  1PH1 A;  5AJ3 L;  3U58 A;  1N36 L;  2AHO B;  4LF8 Q;  1C0A A;  3KF6 B;  4IFD J;  2PI2 A;  1J5E L;  5DLQ E;  1FVI A;  1YHA A;  2VQF Q;  4JV5 L;  1XNQ Q;  3CD6 A;  1LTL A;  3HOX G;  5IP7 G;  3PIP A;  4LF4 Q;  3L7Z C;  4IOC A;  1IYJ B;  3CW2 C;  3M3Y H;  4ALP A;  3CCQ A;  1EIF A;  3MEF A;  4DR6 Q;  5FLM G;  1B7Y B;  4BBS H;  4IJL A;  2WB1 E;  4C3I H;  3OW2 A;  4DV7 Q;  3FP9 A;  3PO2 H;  5C4J H;  4DV5 Q;  2RF4 A;  4GOP C;  1V9P A;  3CCJ A;  4DR3 L;  3HOY G;  3S1R H;  4R4C A;  2VQE Q;  4LWC A;  1XMQ L;  1A8V A;  1UE5 A;  1Z47 A;  1JJ2 A;  5LMN Q;  3OTO L;  3BU2 A;  2R92 G;  3KFU A;  2KCT A;  1YZ6 A;  3E0E A;  4A3G H;  1HNZ L;  4KI0 A;  3RN5 A;  4P72 A;  1L0W A;  4PZ7 A;  2BA1 A;  4JI1 Q;  4DUZ L;  2NVQ H;  4A3C G;  4DR5 Q;  1VQO A;  3RNU A;  2QA4 A;  1SE8 A;  2KCM A;  1EYG A;  1XTD A;  3KLW A;  1XPO A;  2RCN A;  5GAH C;  2N78 A;  4DR2 L;  3NEM A;  5C0X G;  4KHZ A;  4IPC A;  2UUB L;  1KHI A;  3CCV A;  3M4P A;  3CCL A;  4GLA C;  2HIX A;  2N49 A;  4UP7 A;  4XIG S;  5LMU Q;  2Y0S E;  4OWT B;  2ATW A;  4GKJ Q;  4KLK A;  1IZ6 A;  3H0G G;  2WP8 J;  5JEA J;  4A3J G;  4O2D A;  4PMW A;  3BZC A;  4LFC L;  4JYA L;  1EUJ A;  3HKZ G;  1CSP A;  1VQ5 A;  1EWI A;  1I94 Q;  1VQB A;  2NVX H;  5M5X H;  3I4O A;  2JEB I;  1YIT A;  4GNX C;  4JI6 Q;  5C0X J;  1QVC A;  4DKA C;  2VUM G;  5AJ3 Q;  1N36 Q;  1N34 L;  1KRT A;  4DPG A;  4A3J H;  2YV5 A;  1MIU A;  1PH3 A;  4LF5 L;  3CF5 A;  1PH5 A;  4JV5 Q;  1MKH A;  3GTK H;  2R7F A;  3SGI A;  1VQD A;  3HOV H;  2A19 A;  1N32 Q;  5JEA G;  1QUQ B;  1CUK A;  4DV6 L;  4JI4 L;  3CC7 A;  1YBY A;  2HIV A;  3K80 C;  3S17 H;  3PGZ A;  3HKZ E;  1JT8 A;  2UUB Q;  1HZC A;  3F2D A;  2Z6K C;  2F52 A;  2AWN A;  1OXX K;  5IYC G;  1X56 A;  2I5H A;  4P74 A;  1WCM H;  1A62 A;  3CMA A;  1Q46 A;  1WCM G;  3HFZ B;  1H95 A;  2JA6 G;  1HJP A;  1C9O A;  1WI5 A;  2YTY A;  3G4S A;  2Q2T A;  1X3G A;  2ZM6 L;  1JJC B;  3I4N G;  3GTL H;  4ME3 A;  2IHF A;  1PH9 A;  2VL6 A;  4BA1 I;  3BJU A;  3DLL A;  4DNI A;  4LUZ A;  4LNQ A;  1K0R A;  5GAE C;  2RHS B;  2K50 A;  2PMZ E;  4QJF A;  3L0O A;  4NXM Q;  4IPG A;  4QL5 A;  4AIM A;  1IBK Q;  1FJG L;  3RLO A;  5IYB G;  3UE0 A;  4OO1 I;  1AE3 A;  3PUZ A;  3CXC A;  1JJG A;  4A3I H;  2NN6 I;  2Q2H A;  4JI4 Q;  1E22 A;  3NBH B;  2ZTD A;  4QIW E;  5EAY A;  2YYZ A;  4A93 G;  4LF4 L;  2R7Z H;  1N33 Q;  1PHJ A;  3ICE A;  2DUD A;  3D31 A;  4C3H H;  4EQ5 A;  4UP8 A;  1J5E Q;  1PVO A;  4IJH A;  3RLF A;  1E7Z A;  3PCO B;  4X65 L;  4LF6 Q;  2UUC Q;  4LF7 L;  2PI2 E;  2CKZ B;  2JEA I;  4L5Q A;  4FDB A;  3KF8 B;  2OQK A;  5HGQ A;  1IBL L;  3CME A;  4QQB X;  4WJ4 A;  4LUO A;  4X64 Q;  4JYA Q;  2R93 H;  2MNA A;  3WWV A;  3TS2 A;  1X3F A;  3CCS A;  3GO5 A;  4AQY L;  3GTO H;  4DR4 L;  2NZO A;  4DUY L;  5J3B A;  3I56 A;  1VQN A;  3UE1 A;  3A74 A;  2KBN A;  1CKN A;  3T1Y L;  2JA8 H;  3EN2 A;  3STB D;  3M7N A;  3RZO H;  1QVG A;  2K14 A;  4A3M H;  3H3V H;  2E2I H;  4YCV A;  1E24 A;  3S2D H;  2WAQ E;  1TWC H;  4JC0 A;  3UDI A;  1MJE A;  4A3G G;  2OTJ A;  2JA9 A;  3K8A A;  1FJG Q;  5JJI A;  2VY3 A;  4RG1 A;  2XGT A;  3GTP H;  1Q1B A;  4HJ5 A;  3TRZ A;  4RMF A;  4JBM A;  3GTJ H;  3J80 i;  5BR8 Q;  5IP9 H;  2KHI A;  4QGU A;  4DV2 Q;  2UUA L;  4OX9 L;  1LM0 A;  1V1Q A;  4YWL A;  3RLN A;  1HNZ Q;  2E2H H;  4JI5 Q;  3HOW G;  5K36 G;  1OTC A;  1YEZ A;  2E8G A;  2ZM6 Q;  3U50 C;  1X9N A;  3HOU H;  2R7D A;  3M85 A;  1PH4 A;  3PUV A;  1HZB A;  2CCZ A;  4JG2 A;  1PH8 A;  2LXJ A;  2YU9 H;  3HOX H;  4BY1 G;  2D62 A;  1X6O A;  2QGQ A;  4UP9 A;  2WAQ G;  1X55 A;  1W2B A;  1BBW A;  1KAW A;  3EIV A;  3MXN B;  3ZJY C;  2UXD Q;  1K8A C;  3PO3 H;  2UU9 Q;  1RIP A;  5IYD G;  4A3L H;  2F3I A;  4LF5 Q;  4R4Q A;  1W3S A;  1YNX A;  2B63 G;  3A5Z B;  2K5N A;  5ELN A;  2HQL A;  4JI8 Q;  4OWW B;  2WB1 G;  3M9B A;  2LSS A;  5GAG C;  3AEV A;  1CKN B;  1IBM L;  1DGS A;  4R1J A;  2K52 A;  2CQO A;  3AQQ A;  2CWP A;  1UE1 A;  1VQ8 A;  2PQA A;  4B3T Q;  4JI7 Q;  3IRB A;  3KF6 A;  2UUC L;  4Y7N H;  4LF7 Q;  4X62 L;  3W1G A;  5IWA Q;  1P16 A;  4YY3 Q;  1VQE A;  2F4V Q;  4DAM A;  4AYB E;  2E5L L;  3G71 A;  4MTN A;  1WJJ A;  4LF9 Q;  1K83 H;  1M90 C;  1Y1W G;  4IFD I;  3PSI A;  1XMO L;  1PV4 A;  2K5H A;  4DUY Q;  4A3D H;  5C44 G;  3F2B A;  3K81 C;  1YVC A;  3S14 H;  3CPW A;  1Y14 B;  4NXN L;  2VQF L;  3RN2 A;  5JJL A;  1KIX A;  4GN3 B;  4YCW A;  1WOC A;  1G51 A; 
#chains in the Genus database with same CATH topology
 4BA2 I;  3UDX A;  1IHZ A;  1QE6 A;  3JAM c;  3S16 H;  2ICE C;  2WKC A;  5E7N A;  4KKU A;  3BS1 A;  4DR7 L;  2RA4 A;  1A3U A;  3CP0 A;  2G9D A;  3RR5 A;  1KAB A;  1FD7 D;  1HR0 Q;  3D8G A;  1XMO Q;  2JA5 G;  1WYD A;  1VQK A;  4X3U A;  4C3J B;  3S15 H;  1ESR A;  4PG3 A;  1ET6 A;  1KDB A;  2H5X A;  3K7U C;  2IX1 A;  3N6R A;  4HMJ A;  4POF A;  3IAY A;  3PV0 A;  1TS4 A;  4NXN Q;  2K05 A;  1XJV A;  1SNP A;  1XNQ L;  2WFW A;  4HJ7 A;  1UEB A;  1PZK D;  3MXN A;  1ESF A;  3JAM L;  4A3F H;  4GZY C;  4B3S Q;  4FXK C;  1VQF A;  1ICW A;  3A8I E;  4KD3 A;  4BY7 H;  4U68 A;  4GKJ L;  1NBW A;  4A3E G;  1VQJ A;  2QIL A;  3PO3 G;  2K33 A;  3Q8D A;  2I5L X;  3QWN A;  3I4N B;  3DWQ A;  1BOS A;  2B8G A;  3E5S A;  3VA5 A;  1JR0 D;  2JK8 A;  1SMY C;  2R61 A;  3HGB A;  2ZTE A;  2J4X A;  5M3M H;  1Y1V G;  2E74 C;  3HOZ H;  3FKI B;  2K5D A;  3H0G H;  4C1N K;  5CV6 A;  4JOI C;  3CRK C;  1MSH A;  1DXM A;  4CBV A;  2ZT9 C;  1Z9F A;  5D3I B;  5I9O A;  5FLX E;  1OXU A;  4L5R C;  2MQH A;  3M4O B;  3CQZ H;  4KHP L;  3GTQ B;  5H1S E;  4KJO A;  4LUV A;  1K73 C;  2NVQ B;  4DXF A;  4OXP A;  4LF9 L;  3CAM A;  1KC8 C;  2XIW A;  4DV3 Q;  4IUQ A;  1B3Q A;  1E2W A;  2DY8 A;  3S1M B;  5IWA L;  1G91 A;  2ZJR A;  5CV7 A;  4LF8 L;  5T1I A;  2UXB Q;  1D6E C;  2L55 A;  3HZX A;  3J81 j;  4A3K B;  1RCV D;  4YHH Q;  5C4X B;  1TWA B;  4P2C B;  1SYE A;  5GRO A;  1K8G A;  1EYD A;  4ULL A;  2QEX A;  3B6Y A;  4CDF C;  2HCC A;  1Y1V B;  4POG A;  3PIO A;  4ZAI A;  3PIO 3;  4M8A A;  5HY6 A;  2HDL A;  2ZJP A;  2R7Z B;  3H3V I;  5A2Q E;  2JA8 G;  1EFW A;  2BA0 A;  2OT2 A;  3K5O A;  1NR4 A;  1H9M A;  1DJR D;  4HIM A;  4DV7 L;  3M4Y A;  1NY4 A;  5ELB A;  4O42 A;  5M3F B;  1STH A;  5BN4 A;  3D3R A;  2IWH A;  2HDM A;  2EVB A;  3S1N H;  4JI6 L;  5JVG 3;  1RKN A;  5DM6 3;  1ICF B;  4CGY B;  4NB3 A;  4X64 L;  1GVP A;  1B2T A;  4LK1 C;  2H1E A;  2FMM A;  2I5M X;  4DV6 Q;  1KL9 A;  4B3T L;  1AZP A;  4DGZ A;  1IKM A;  1EFI D;  1SMY D;  2LKV A;  5LMN W;  1HXY D;  4X66 Q;  5CV9 A;  1IBM Q;  4G4K A;  2F3W A;  1N9W A;  1S3O A;  4HCS A;  4L5T A;  5J22 A;  4DV4 Q;  3K5L A;  2JQO A;  5IYC H;  3CC2 A;  1I3Q H;  3CCE A;  4PZ6 A;  4DNT B;  2WAC A;  3HKS A;  2B63 H;  3TP5 A;  2NYZ D;  2R93 G;  3OHX C;  1Z7T A;  1VQH A;  2D0O A;  4FO2 A;  1S5D D;  2F0Q A;  2EDG A;  1PH7 A;  1FR3 A;  4DXG A;  4YWK A;  4BBR G;  2UXC Q;  4BXX G;  4Z9C B;  1TII D;  1VF5 C;  4A3K G;  5C4X G;  5FJ8 G;  1O7I A;  1WD1 A;  4N9P A;  1SR3 A;  1PTO D;  4FVM A;  3A5U A;  1GUW A;  2PZW A;  1EY7 A;  3V2T A;  2L9H A;  3TQY A;  3GTM H;  3J7A V;  3CKI B;  3HEJ A;  4P75 A;  3JAM i;  1SMX A;  1PTO H;  2K28 A;  3OIP A;  4NW2 A;  3TP8 A;  4RAU C;  3A8J E;  4J8Q A;  1EL0 A;  1PRT F;  3GP7 A;  1JE4 A;  2OWO A;  2E2H B;  1QB5 D;  4A3B G;  3OOC A;  1B50 A;  3CQZ B;  4K0K Q;  3P1H A;  4MZ9 A;  2F0N A;  4JI2 Q;  4XTC S;  1SFO H;  1LTB D;  4RGT A;  4JI8 L;  4CJ1 B;  1LTI D;  2IHE A;  5LL6 S;  1KRS A;  3RZD H;  4F8M A;  4C2M B;  3KDF A;  3W5O A;  3PQI A;  4BXX H;  1WFQ A;  4DR2 Q;  1YNJ D;  4B3M L;  3I4M G;  2PYK A;  1TS3 A;  4HIK A;  2NTS A;  1PRT D;  3S1Q B;  3ULP A;  5IGF A;  1G8Z D;  3OW7 A;  1K83 B;  4JW0 A;  2KQ3 A;  4MNO A;  5COR A;  2MO1 A;  1R4Q B;  4JK1 C;  2YTV A;  4K8I A;  3FKI G;  2MUY A;  4OIJ A;  2F0I A;  3SEB A;  5ELE A;  1PH1 A;  1JCK B;  5KNB A;  4QMG A;  3HOY B;  5DLQ E;  3I3C A;  1YHA A;  3HOX G;  4EQP A;  5IP7 G;  3E6Z X;  4LF4 Q;  3OMC A;  1KDA A;  1EEF D;  1TQO A;  2Z4H A;  1B9N A;  1EU3 A;  2K01 A;  1B7Y B;  4IJL A;  2WB1 E;  3FVQ A;  3OW2 A;  4FF4 A;  1ROD A;  4DV5 Q;  4A3F B;  3GQB A;  2Q8T A;  1MSG A;  1V9P A;  4R4C A;  1SYC A;  2VQE Q;  1XMQ L;  1UE5 A;  1Z47 A;  4K14 A;  1JJ2 A;  2F0V A;  1ZKO A;  3BU2 A;  2KCT A;  5LHY 1;  4RHS A;  2OF1 A;  1TKW B;  3E3X A;  3RNU A;  2KCM A;  1A6X A;  3KLW A;  1XPO A;  4BY1 B;  5D65 A;  5FOB B;  1DOL A;  1E2V A;  5DAU A;  3ERQ A;  1YNN D;  3S1R B;  3CCV A;  1F77 A;  1PTO F;  1CT1 D;  3CCL A;  2M00 A;  4XIG S;  1HQR D;  3IFD A;  1QG7 A;  4A3J G;  4O2D A;  1Q3L A;  3ERO A;  5L37 A;  1STB A;  3HKZ G;  5EBD A;  4K6D A;  1VQ5 A;  1I94 Q;  3E0J A;  1YIT A;  2VXW A;  1F2L A;  5AJ3 Q;  2QF7 A;  1KRT A;  2QW7 A;  1N34 L;  5CBE E;  1PH3 A;  3CF5 A;  5C5L A;  4DFA A;  1VQD A;  3HOV H;  2A19 A;  3MA2 B;  5JEA G;  1QUQ B;  1GUS A;  4DV6 L;  1EU4 A;  2B2V A;  1YBY A;  3CC7 A;  4JI4 L;  2O2L D;  2A73 B;  2UUB Q;  1HZC A;  3F2D A;  1WCM G;  3NWT A;  2JSO A;  1HJP A;  3MWY W;  2ZM6 L;  3GTL H;  1PH9 A;  2VL6 A;  1ILP A;  3BZD B;  4DK1 A;  2K50 A;  4QL5 A;  4AIM A;  3M7G A;  1K8M A;  3CXC A;  1JJG A;  4K5X A;  1O78 A;  1VMC A;  5C3X A;  2TMP A;  3GTJ B;  3R8B A;  2R7Z H;  1N33 Q;  1B1Z A;  3D31 A;  3VYR A;  3SXH A;  4EQ5 A;  1T5X D;  2R92 B;  1J5E Q;  1TU2 B;  4K2K A;  3RLF A;  2PCF B;  4DK0 A;  1LTA D;  4LF6 Q;  1J8I A;  4LF7 L;  2R3Z A;  2OQK A;  5CC4 A;  2KHS A;  1Q8I A;  1GHK A;  2R93 H;  1LTG D;  1E0B A;  3WWV A;  4AQY L;  3GTO H;  4DR4 L;  2NZO A;  2N55 A;  4ZUJ A;  4DAV A;  3T1Y L;  3STB D;  1BCP C;  1LAC A;  4EVO A;  4A3M H;  1Y69 U;  1SE2 A;  3BG3 A;  1E24 A;  4JC0 A;  4Q0F A;  3VR6 A;  2OTJ A;  1H9J A;  1R9T B;  1F2Y A;  4BWG B;  2L5T A;  2F1M A;  5JJI A;  2VY3 A;  1LT5 D;  3GTP H;  4TSS A;  3TDQ A;  4A93 B;  1EY8 A;  4QGU A;  1PXU A;  1HNZ Q;  4UDU C;  1EIH A;  3R3O A;  5G3L F;  2B2T C;  2E8G A;  3MAQ A;  1B53 A;  1DOK A;  2R7D A;  3BYY B;  1PH4 A;  3PUV A;  1PH8 A;  2LXJ A;  4OEM B;  3Q23 A;  4FP5 D;  2UXD Q;  1X55 A;  1BBW A;  3EIV A;  3ZJY C;  3PO3 H;  1S5C D;  4CJ0 B;  4NDX A;  5IYD G;  4A3L H;  1B4O A;  3J81 E;  1UNS A;  2B2W C;  1PFB A;  5A35 A;  2E2D C;  3KLR A;  1TR5 A;  1HA6 A;  1GUN A;  3TP7 A;  2O5I C;  3ND9 A;  4RGN A;  1UE1 A;  4U67 3;  3IRB A;  3KF6 A;  2UUC L;  5G3L D;  2DJG C;  1VQE A;  1K0S A;  2ZXO A;  3BVZ A;  1DOM A;  1MD2 D;  1TS2 A;  2JA5 B;  2K5H A;  4DUY Q;  4A3D H;  5C44 G;  3F2B A;  4QCL A;  5C4Z A;  1SDF A;  1YVC A;  4NXN L;  4GN3 B;  3DM1 A;  2F0L A;  3NXW A;  1WOC A;  1DCZ A;  1G51 A;  5BN3 A;  1NMF A;  3W1B A;  4CKB A;  3M4O H;  1O7Y A;  2KJX A;  2PO4 A;  4ZUI A;  1DZ1 A;  4NXM L;  4GKK Q;  4DR3 Q;  1AZQ A;  2E2I B;  3WDN A;  5BR8 L;  2UUA Q;  3C46 A;  4X6A H;  1Q8K A;  4G7O C;  2DN8 A;  4S3S A;  5M3F G;  3CCM A;  3PMF A;  4BBR B;  3J81 i;  2FMC A;  5M3M B;  3H15 A;  1BCP D;  4H02 A;  3HOZ B;  1KLG D;  3MXG A;  1V43 A;  2MP1 A;  1XPU A;  1ZXT A;  4KKS A;  4IFD G;  3T1Y Q;  4JBK A;  3RD4 A;  1TWG H;  1QCB D;  4B3R Q;  2VB3 X;  5EJW A;  4JI3 Q;  2Z6B A;  3HOZ G;  4F88 A;  1Y1V H;  4JI2 L;  3K0Y A;  4HJ8 A;  2X69 A;  5D3D A;  1SNQ A;  4O1N A;  4DR1 L;  3SDZ A;  3TZD A;  1OXT A;  5JJK A;  2LXK A;  4IUN A;  1J6Q A;  3UDF A;  4JBJ A;  4OO1 H;  3K0X A;  2WB1 B;  4L8J A;  4A3J B;  1SNM A;  2K03 A;  1BXT A;  2I0Q A;  3J81 c;  3I91 A;  2EXD A;  3LGJ A;  1I6H B;  1GO3 E;  4DV4 L;  5JJZ A;  3TRE A;  4GLV B;  5CMD A;  3AMU A;  4DV5 L;  1R9T H;  3CCR A;  5ISR A;  4IUT A;  2NVT H;  1QZG A;  1H9S A;  4OIK A;  4X62 Q;  1B8A A;  2CFM A;  1WTR A;  3H0G B;  1S72 A;  2K5V A;  1KLU D;  4TQU S;  2V1C C;  2RVL A;  1JE5 A;  3NEL A;  4CHT B;  4YY3 L;  2BH8 A;  2N88 A;  4A3G B;  4N9T A;  3K7A H;  3CC4 A;  4A3E H;  4DV1 L;  4A3I G;  4HED A;  3ER0 A;  1HNX Q;  4X65 Q;  2SNS A;  3GTQ H;  1PFM A;  3KOJ A;  4DAY A;  3KK7 A;  2EY2 A;  2XN9 C;  1G6Z A;  5E1F A;  3BVM A;  2OXP A;  5CR3 A;  5C0X I;  1V1P B;  1QWY A;  2A6H C;  2EYH A;  3I2Z A;  1WTP A;  2ID0 A;  3DWA A;  3H3V C;  1WTO A;  4JI1 L;  3TBI B;  4XYQ A;  4RA8 A;  3T56 B;  1TWC B;  1YJN A;  2L15 A;  1N32 L;  2JA5 H;  4JOI A;  1I5F A;  1CM9 A;  2CW0 C;  3J7A 5;  5M5Y H;  1N8R C;  3RZO B;  2K6A A;  3I4M H;  3DM3 A;  1AP0 A;  1Q81 C;  1VQP A;  2X6L A;  2B2U C;  3I70 A;  3F2U A;  1WCM B;  1S5B D;  3VYU A;  2A1A A;  3KDF B;  1O80 A;  1EIY B;  2EYO A;  2OEO A;  1HZ9 A;  2AMC B;  5IP7 H;  1FNW A;  2AQ1 B;  1VQ6 A;  4ME5 A;  4A3I B;  3S1N B;  1PYB A;  3I55 A;  2K75 A;  4A3B H;  3S24 A;  2X6G A;  4LFB L;  1N33 L;  3STB C;  1GD7 A;  1XYI A;  1J9O A;  2NZH A;  1BO0 A;  2E76 C;  3EFX D;  4RGM A;  2JYO A;  2IX3 A;  4CDD C;  1I50 B;  4HN7 A;  1BKB A;  3MVV A;  1JOO A;  1CA6 A;  2KOL A;  4HIO A;  1MJC A;  5LMU L;  4GKK L;  1BBU A;  3OWE B;  5IE8 A;  2ES2 A;  1HTL D;  3M3Y B;  1W6K A;  3MTS A;  2IY5 B;  4FNF A;  2JA7 G;  1SNC A;  4C3H G;  1G29 1;  1SXT A;  1GM5 A;  1HA5 A;  1UUP A;  1FNU A;  2KHJ A;  5EGT A;  1EOT A;  5K36 H;  3F1Z A;  4IPD A;  2RBM A;  4DR5 L;  3T51 B;  4YIJ A;  2JA7 H;  1Y1W H;  4PMB A;  2TSS A;  3GTK B;  1D1K A;  3KBG A;  5IYB H;  1FL0 A;  4Y52 H;  4HJA A;  2FHT A;  1E1T A;  1TWA H;  1MHW C;  2RSN A;  3OWF A;  1PLF A;  3VDY A;  4XQQ A;  1D5X C;  4QB4 A;  4PMC A;  5ELD A;  2JA6 H;  1CZW A;  2NZ1 D;  2JJQ A;  4LFB Q;  1IYV A;  1EQT A;  1V1O A;  2GA4 B;  4RH6 A;  5IT9 c;  3A0J A;  1AFP A;  1I94 L;  2K5Q A;  3H6M A;  3QOL A;  4KY6 A;  1S5F D;  2KED A;  3UDG A;  4BY1 H;  3HOY H;  2N3S A;  5FO9 B;  3HOV G;  3MC0 B;  1S40 A;  1ZYR C;  5CV4 A;  5EQ0 A;  1Z6H A;  4A75 A;  3HOW H;  1S5E D;  1PH2 A;  5IP9 G;  5E3F A;  1L1O C;  3H91 A;  3ULL A;  1I4Q A;  1OXS C;  1X3Q A;  4H13 C;  4C3I B;  3PO2 B;  1LUZ A;  3L2P A;  1YNN C;  1V8Q A;  1D1I A;  2EQS A;  1EY5 A;  1X54 A;  2CW0 D;  1VQI A;  5I4D A;  4FXD A;  2XTI A;  3KJP A;  3QR8 A;  3GV3 A;  4G57 A;  2LY7 A;  2AHO B;  1Y8N B;  4IFD J;  2EY1 A;  1J5E L;  3X3M A;  2LFN A;  1XNQ Q;  3W2D A;  1ENA A;  2IPK D;  3L7Z C;  4M1U B;  4IOC A;  1BCP B;  3CCQ A;  3PO3 B;  1EIF A;  3MEF A;  3GTL B;  4DR6 Q;  4BBS H;  4G7H C;  4C3I H;  4DV7 Q;  1U4P A;  1O7Z A;  3FP9 A;  3PO2 H;  2RF4 A;  3BDL A;  1CHQ D;  3DMU A;  2EY6 A;  4DR3 L;  2PNR C;  1A8V A;  3D4R A;  3A7A B;  3NQT A;  3OTO L;  2R92 G;  3KFU A;  4N8F A;  1HNZ L;  3RN5 A;  4P72 A;  1L0W A;  3P20 A;  4JI1 Q;  4DR5 Q;  1VQO A;  2QA4 A;  1SE8 A;  1F9Q A;  2NTT A;  1XTD A;  5C6A A;  2RCN A;  4DR2 L;  5IGB A;  5C0X G;  3MEH A;  4IPC A;  2UUB L;  3M4P A;  3TSS A;  1NNX A;  1BR9 A;  4GLA C;  1CHP D;  5LMU Q;  2Y0S E;  4HR7 B;  5KRU A;  4OWT B;  4KLK A;  3H0G G;  1KTK A;  4K5V A;  2I46 A;  3T4A C;  3Q22 A;  2NVX H;  1KNA A;  3C2P A;  3I4O A;  2JEB I;  4DKA C;  1UEA B;  1N36 Q;  2DJF C;  2A6E C;  4KN7 C;  4JV5 Q;  5IGG A;  1TVX A;  3SGI A;  3A8K E;  4TRD A;  1BNZ A;  1IW7 D;  3K80 C;  3NBH A;  2JP1 A;  1F9R A;  2RDH A;  3HKZ E;  1JT8 A;  1TY2 A;  4WRD A;  2F52 A;  3SK6 A;  4CDE C;  2I5H A;  3CMA A;  1Q46 A;  3FPU B;  2YTY A;  1X3G A;  2IHF A;  4IUU A;  4DNI A;  1K0R A;  1LTR D;  2RDG A;  4QJF A;  4NXM Q;  3L0O A;  1VMP A;  3QG1 A;  4IPG A;  1IBK Q;  2QDB A;  5EKI A;  3W3A A;  1U4L A;  2QEJ C;  4MIU A;  4JI4 Q;  5EAY A;  3NBH B;  2YYZ A;  3WOE A;  4LF4 L;  3SHL A;  4WOR A;  4IJH A;  4I7Z C;  2UUC Q;  2PI2 E;  4L5Q A;  4IAL A;  1SEB D;  5HGQ A;  3SR1 A;  3CME A;  1IBL L;  4RCO A;  4WJ4 A;  1MBY A;  1X3F A;  2FFK B;  3GO5 A;  4IZ8 A;  4DUY L;  3A55 A;  3A74 A;  2KBN A;  2G5D A;  3EN2 A;  3M7N A;  2K14 A;  3H3V H;  2E2I H;  4YCV A;  2EYM A;  2B2V C;  3NE5 B;  3S2D H;  1LT4 D;  5FO8 B;  4ZYS A;  5M5W B;  4Q5V A;  5IGD A;  3K8A A;  3K5M A;  1A15 A;  2SDF A;  3U9S A;  1Q1B A;  1GXD C;  4RMF A;  3FMC A;  3HRZ C;  2NB0 A;  5IP9 H;  2K32 A;  3GV6 A;  4JI5 Q;  3HOW G;  1BCP F;  3CHB D;  3FDT A;  5M5X B;  3U50 C;  2JN4 A;  1DM0 B;  4L63 B;  2YU9 H;  1I6V C;  4BY1 G;  4EQN A;  2QGQ A;  4PNY A;  4RHR A;  2WAQ G;  4UP9 A;  4K5W A;  1W2B A;  3MXN B;  1NCV A;  2A69 D;  1RIP A;  5FO7 B;  2F3I A;  2DNE A;  5IGC A;  5JOB A;  5ELN A;  2AQ2 B;  3I90 A;  4ZRZ A;  2E2J B;  3P7J A;  3AEV A;  3RZD B;  2WII B;  2K52 A;  4V19 0;  3A56 A;  2PQA A;  4JI7 Q;  4LF7 Q;  5KNC A;  2NVY B;  2WV6 D;  4MTK A;  4Y7N H;  4ZK9 B;  1RJT A;  1P16 A;  4QUF A;  4DAM A;  2JXM B;  2EJG C;  2E5L L;  3G71 A;  5JPM C;  5AFW A;  1K83 H;  1EY0 A;  1M90 C;  1Y1W G;  4IFD I;  1U4R A;  1PV4 A;  1FGB D;  5KGU A;  1GUO A;  3K81 C;  2VQF L;  5JJL A;  1DD2 A;  4A93 G;  4JPB W;  1VQM A;  1XX8 A;  1X65 A;  5CV5 A;  2O4X A;  3J80 L;  1TXY A;  2B29 A;  3S1M H;  3A54 A;  1RHP A;  1H9R A;  2MO0 A;  1PZI D;  1P8L A;  1O7L A;  3D4W A;  2VZA A;  3RMH A;  3H94 A;  3E9I A;  1CQF A;  2C35 B;  2KEC A;  4J15 A;  2ICI A;  3F2C A;  2F0H A;  2F3V A;  3P75 A;  2BCO A;  1M1K C;  1AE2 A;  1PTO C;  2A8V A;  2CQA A;  1I4P A;  4LAA A;  3DXJ C;  2GVB A;  3GD7 A;  1V1P A;  1EZ8 A;  2B2U A;  5M3M G;  1HFG A;  1VQ9 A;  4O0A A;  3OSO A;  1VQA A;  4KKT A;  3PUX A;  4AQY Q;  4BBR H;  2D0P A;  4IUR A;  2KEN A;  1JQY D;  4TKO B;  1GHJ A;  1TWH B;  4LFC Q;  3G48 A;  2KEE A;  2B3G A;  3PIP 3;  1PRT C;  4JI5 L;  4ODG A;  4JI0 Q;  1EQQ A;  3CPF A;  1JOK A;  1KNE A;  1YJW A;  1F9P A;  4ZCK A;  1QZH A;  1PYS B;  5C44 H;  2Q8R E;  4A3D G;  2F0P A;  2ALY B;  1SRO A;  2BH2 A;  4A3M B;  5EPL A;  3C1E A;  1IXR A;  4GS3 A;  5EKK A;  1CKO A;  2IX0 A;  2UXD L;  4DR6 L;  2OTL A;  1FGU A;  1QNK A;  4P71 A;  3Q0A A;  2K5W A;  1SLJ A;  1C7Y A;  5C3E B;  1PRT B;  2Y0S G;  4IQZ A;  4C2M H;  1H9K A;  1IYU A;  3OYY A;  3GTG B;  1XTC D;  3DEP A;  1F2Z A;  4KK7 A;  1UE6 A;  2DY7 A;  1G2T A;  3AFP A;  1L2F A;  2R6G A;  2RHQ B;  2Y0S B;  4UY8 C;  1K3B C;  4K6L A;  3J7Y W;  1CZG A;  2C9O A;  4JI3 L;  1JMC A;  1JOR A;  1I4H A;  1LV9 A;  4C3H B;  1YHB A;  3MXP A;  1EYC A;  2AUJ D;  1PA6 A;  3D0F A;  2Z8L A;  3SE0 A;  1Q1E A;  5JAV A;  2I07 B;  3HOX B;  3GTM B;  3QO2 A;  1OO9 B;  4L5S A;  2AWO A;  1TWF H;  1A0I A;  1B70 B;  2Q2U A;  2NVY H;  4Y7N B;  1YHQ A;  3M4Q A;  3GTO B;  4DV0 Q;  2ZJQ A;  4OON A;  4ID6 A;  1U4M A;  2J7Z A;  4F87 A;  2B8F A;  4BY7 B;  1SBB B;  3ULJ A;  1G6P A;  5GQO A;  3OMG A;  1VS0 A;  1L0Y B;  2HUG A;  1D8L A;  2PQE A;  4BS9 A;  3TME A;  3GTP B;  5EPJ A;  4YHH L;  2R7Z G;  4RWS C;  1HZA A;  5IT9 L;  3FHW A;  5IIF A;  2UXB L;  3T1H L;  3PUW A;  2AUK A;  5IOC A;  4JI7 L;  5KYL A;  3AU7 A;  4AH6 A;  3JC6 6;  1YIJ A;  1QJO A;  3K5N A;  2UU9 L;  4DAP A;  4KMU C;  4UHV A;  4IFD H;  2CWA A;  1BVS A;  2WAQ B;  3EA6 A;  1LT3 D;  2CH4 W;  5M5Y B;  2Z6K A;  1SYG A;  3I4M B;  1DYQ A;  2G9H D;  2HHH Q;  1YJ9 A;  1E1O A;  1KQS A;  1L0X B;  1WTQ A;  1SSO A;  1K9M C;  1SN8 A;  2C5C A;  4C3J H;  3C3L A;  4OO1 G;  1IBK L;  5IT9 E;  2MFI A;  4OHJ A;  4GN4 B;  4IUV A;  1K3R A;  4DUZ Q;  1Q7Y C;  5KND A;  3I7F A;  3HG9 A;  4JVZ A;  3MHB A;  1SE3 A;  4AYB G;  3HOU G;  2MPM A;  4TVA B;  2YTX A;  4C3I G;  3VR5 A;  4BY7 G;  2DGY A;  5FJ8 H;  1AN8 A;  1NJI C;  3UI2 A;  5C4X H;  4A3K H;  1VCI A;  4HID A;  5EBC A;  4C56 C;  3LX0 A;  1HH2 P;  3J7Z C;  4MN3 A;  2F0S A;  1D7Q A;  4R4I A;  1HNX L;  5C0X H;  2F0T A;  5CYU A;  2E5L Q;  1SYD A;  2VS1 A;  2WIN B;  1LTT D;  3K6O A;  4GN5 A;  4ABN A;  3LWE A;  4KHP Q;  1KAA A;  3LWU A;  2L1B A;  5M9O A;  4B3R L;  2ZXR A;  2Z4I A;  4A3L G;  5IYD H;  2R92 H;  1T9H A;  4I65 A;  2F0F A;  4HTH A;  2VB2 X;  3ERS X;  3S1Q H;  2IJ0 A;  1X3E A;  2R93 B;  3PF5 A;  1HR0 L;  2IL8 A;  4G7Z C;  4PZ8 A;  1HCZ A;  4JCV E;  3NK9 A;  5KIX A;  2HCI A;  4GOP B;  3H09 A;  5E4X A;  3S17 B;  1VQG A;  5FLX c;  2F0M A;  1ASY A;  1E3P A;  1TS5 A;  1XMQ Q;  2AKW B;  1UE7 A;  4HMI A;  2CHB D;  1JB7 A;  1BQQ T;  3K59 A;  4RCN A;  3FKI H;  2K7V A;  4A3M G;  2XNA C;  1GUG A;  5ELC A;  2PZT A;  2F4V L;  4KJN A;  1N36 L;  3U58 A;  2SOB A;  4LF8 Q;  1C0A A;  4CKE A;  3KF6 B;  2B63 B;  4KY5 A;  1FVI A;  3D6W A;  4JV5 L;  5IGE A;  1JC7 A;  3TZU A;  1IYJ B;  1EQV A;  2A74 C;  3CW2 C;  1WVL A;  4ALP A;  1QOH A;  1LTS D;  1MI2 A;  3S15 B;  4V0B A;  1SYF A;  2EYJ A;  3I4L A;  3HOY G;  4LWC A;  5LMN Q;  5JPN C;  1EEI D;  2EYP A;  4A3G H;  2F0O A;  1STY A;  5TSS A;  2B39 A;  4PZ7 A;  2BA1 A;  4IUP A;  5DEH A;  4FF2 A;  5GAH C;  2PZU A;  3TP6 A;  2VUM B;  2HIX A;  4UP7 A;  4KY7 A;  3S14 B;  2XWJ B;  4GKJ Q;  3QOJ A;  5JEA J;  2V4D A;  3ONA B;  4ZQ3 A;  1EUJ A;  1D5M C;  1CSP A;  1VQB A;  1HQM C;  3FPP A;  1ONL A;  5C0X J;  2VUM G;  1ET9 A;  2PPB C;  4A3J H;  2XRQ D;  2YV5 A;  4H7B A;  4B9X A;  1Y1W B;  3GTK H;  3QJY A;  1QNU A;  2R7F A;  4RFB A;  4FF1 A;  1N32 Q;  5FK9 C;  2A69 C;  2QDL A;  3PGZ A;  3NTH A;  2Z6K C;  2AWN A;  5IYC G;  4IN3 A;  4P74 A;  1WCM H;  1A62 A;  3HFZ B;  3L3O C;  4LJZ C;  4KTA A;  3G4S A;  1EZ6 A;  3HOV B;  5I6Y A;  5LL6 X;  3MXU A;  4ME3 A;  4BA1 I;  3BJU A;  3DLL A;  3DWP A;  2L12 A;  4LUZ A;  1HRJ A;  2RHS B;  2PMZ E;  1FJG L;  3Q24 A;  4OO1 I;  3UE0 A;  1AE3 A;  1AEX A;  3S9W A;  4A3I H;  2NN6 I;  2Q2H A;  2L11 A;  3FRP B;  4J6H A;  1F9S A;  3ICE A;  1PHJ A;  2A68 C;  3RUZ A;  1A2T A;  2RSO A;  4BBS B;  4UP8 A;  4X65 L;  2JEA I;  4QQB X;  2F0E A;  4FYD A;  3NUC A;  4LUO A;  3QIA A;  4JYA Q;  3TS2 A;  3CCS A;  4C3J G;  1ZYR D;  5J3B A;  3I56 A;  1VQN A;  1SND A;  4WJW A;  2K04 A;  4H0L C;  1QVG A;  1HHV A;  3VYT A;  2WAQ E;  1TWC H;  1EYA A;  2L0C A;  1MJE A;  3J7A F;  3OPO A;  3NSW A;  2XWB B;  3HKZ B;  4RG1 A;  3BYT B;  2XGT A;  4UAI A;  3EVQ A;  3TRZ A;  1FYC A;  4JBM A;  4DV2 Q;  1GUT A;  2KHI A;  1V1Q A;  2E2H H;  3RLN A;  4CJ2 C;  1C4Q A;  2IW3 A;  4E6I A;  1YEZ A;  3NTK A;  1EIG A;  3R2T A;  4X3S A;  1X9N A;  3KLS X;  1TY0 A;  3HOU H;  2M2L A;  4B08 A;  1HZB A;  2KA7 A;  5HGT A;  2CCZ A;  3BVG A;  3HOX H;  1WTX A;  2Z9H A;  1KAW A;  1I3Q B;  4XXE A;  4LF5 Q;  4R4Q A;  1W3S A;  1I4G A;  1TT2 A;  2FJ2 A;  2K5N A;  3A5Z B;  5DM7 3;  2HQL A;  3KLS A;  4OWW B;  1CKN B;  1IBM L;  5I9P A;  4R1J A;  2CQO A;  3VA7 A;  1DON A;  1VQ8 A;  2M9V A;  2MJ8 A;  3D6C A;  4X62 L;  3W1G A;  5CV8 A;  5IWA Q;  2EPB A;  1EY9 A;  2MHV A;  4AYB E;  2EXZ A;  1XWE A;  4LF9 Q;  3HOU B;  3NPP A;  1WTH A;  1XMO L;  2KVM A;  2BE5 D;  5BN5 A;  3S14 H;  3CPW A;  2SEB D;  1SYB A;  3RN2 A;  2B2T A;  3PUY A;  1VQC A;  2D5D A;  4K8J A;  1FNV A;  5C3E H;  3WOF A;  3AFQ A;  2PMZ B;  3EQL C;  4DV0 L;  3K7A B;  1HUN A;  2HQE A;  2Q2I A;  3BDC A;  5FKA C;  4FF3 A;  1UWV A;  3NQI A;  1WD0 A;  3S2H H;  3X3N A;  3EBE A;  1CI3 M;  1CKM A;  2PQA B;  2KUM A;  3NTI A;  4A3E B;  4R4O A;  1Q82 C;  4JI0 L;  1QIL A;  2D9U A;  1S4Z A;  4RKL A;  4DR7 Q;  3I4N H;  1KD1 C;  2A5H A;  1CSQ A;  1U5K A;  2A6H D;  5M3F H;  1IBL Q;  1STN A;  1MGS A;  1F2M A;  2IT1 A;  4QUC A;  5CBA E;  1EQR A;  4DAY B;  5F2D A;  5FLX L;  4WJ3 M;  1BUV T;  2F0J A;  3NEN A;  2HT1 A;  2B2Y C;  1RDP D;  1TWG B;  5NUC A;  4X3T A;  2YU9 B;  1PH6 A;  3NWS A;  2EJM A;  1SJE D;  1VQL A;  1C48 A;  2B2Y A;  1PYW D;  4YWM A;  2AQ3 B;  3SK5 A;  4ILW A;  4GNX B;  1PTO B;  1YI2 A;  1TWH H;  3U4V A;  5KYI A;  1BDO A;  1H9S B;  1M8A A;  1PFN A;  2ZXP A;  4A76 A;  4NPS A;  3IKJ A;  2RKS A;  2BE5 C;  1D2B A;  3HOW B;  4DN4 M;  4JBW A;  3I73 A;  1YNJ C;  3VR2 A;  2F0W A;  5HUR A;  3KUP A;  1SAP A;  1SFO B;  3IFT A;  4OWX B;  1GOZ A;  2GVA A;  2OQ0 A;  1HTP A;  1JWM D;  4WFN 3;  2PW7 A;  3SK8 A;  4DR4 Q;  5C3E G;  1JB3 A;  4HAE A;  1STE A;  2PNH A;  1RL2 A;  4A93 H;  4HJ9 A;  1EY4 A;  2N8N A;  4C1N I;  1VDZ A;  2E75 C;  3LNN A;  2JA7 B;  1E2Z A;  5FLM H;  4LF6 L;  4PV1 C;  1NUC A;  3OIQ A;  2E2J H;  1IL2 A;  4UPA A;  4APV A;  4DV3 L;  5ELF A;  2HD3 A;  3T1H Q;  3HS0 C;  4XT3 B;  4R8I A;  4KN4 C;  3AB9 A;  1NE3 A;  3T53 B;  1PDQ A;  3OTO Q;  2D2C C;  2UXC L;  4LFA Q;  4KV6 A;  1L1O B;  4YCU A;  3NHH A;  4IO9 A;  4DNR B;  2LS0 1;  5IY0 A;  1XNR Q;  1M4V A;  4OEL B;  4P73 A;  5GAD C;  3K57 A;  3S2D B;  4ZKC B;  2EOT A;  4DV2 L;  5KEE A;  2K4K A;  2JA8 B;  2ENB A;  3FEW X;  5LMN L;  3VR4 A;  3NP8 A;  2B2W A;  2F0G A;  1NTG A;  4DF7 A;  5M5W H;  4A3D B;  3CCU A;  3F8T A;  4XYO A;  4BBS G;  1HR0 W;  3MFY A;  5I2Y A;  3SVM A;  3ZYY X;  3S16 B;  4A3F G;  2NWG A;  4DK3 C;  4HCE A;  4B3S L;  5A2Q L;  2VW9 A;  2VNU D;  1HFN A;  3TS0 A;  1I6H H;  4K0K L;  1I50 H;  1K28 A;  3A7L A;  1Q86 C;  2OCE A;  4IOA A;  4AYB B;  2EYL A;  4KHV A;  3TN2 A;  2H4O A;  4ZKB B;  2CVR A;  1OXV A;  2NBF A;  1A3V A;  2JE6 I;  1D5Z C;  1ASZ A;  4GNX A;  2BDO A;  4R4T A;  4XT1 B;  2VQE L;  1EOV A;  2BOS A;  2GN5 A;  1NMG A;  1AH9 A;  3E9H A;  4IPH A;  3U4Z A;  1ZEQ X;  1XPR A;  5EKL A;  3KYH C;  3PO2 G;  1A63 A;  4X66 L;  3EJI A;  4QIW B;  1CTM A;  5ELO A;  2KCN A;  4A4I A;  2HHH L;  4DK6 C;  1RF2 D;  4KD4 A;  5IOD A;  1SE4 A;  3G7L A;  1GKH A;  3R93 A;  1LT6 D;  2J0T D;  1QVF A;  3R2I A;  4DV1 Q;  5J1Z A;  2EIF A;  3J80 c;  1SRU A;  2FXQ A;  1HNW Q;  1N34 Q;  3K58 A;  2Z0S A;  1U0L A;  4F7X A;  4GOP A;  3KF8 A;  4A3C H;  4DR1 Q;  3DHQ A;  1KDC A;  2RDF A;  1LYL A;  4LW1 A;  4B3M Q;  2KCC A;  3MZ5 A;  4CKC A;  2SNM A;  3GDE A;  3D4D A;  3KJO A;  3TEH B;  2NUC A;  1PFS A;  1SNO A;  1Q12 A;  1XNR L;  5D14 A;  4DA2 A;  1RTN A;  3QB3 A;  1VQ4 A;  2VUM H;  1KXL A;  1CQV A;  1ENF A;  2NN6 G;  5DNF A;  3G6E A;  4OGQ C;  4LMQ D;  2EYF A;  3NBI A;  1NAP A;  4OX9 Q;  2NVX B;  1L1O A;  5C3W A;  3AYH B;  2XSC A;  1SJH D;  2ASB A;  2ZTC A;  1LAB A;  4RGO S;  1VQ7 A;  1B3A A;  2P5Z X;  3BZK A;  3PF4 A;  4R8N A;  1WTW A;  4GLX A;  1HNW L;  4LFA L;  1X3P A;  1QUQ A;  4EX5 A;  5AJ3 L;  4CDC C;  3BDO A;  2PI2 A;  5I6W A;  2VQF Q;  3CD6 A;  1LTL A;  3PIP A;  1JIC A;  4HSV A;  3M3Y H;  1PZJ D;  5FLM G;  1C8C A;  3N52 A;  1U9R A;  1CFM A;  5C4J H;  1II3 A;  1R4P B;  1XXG A;  4N8X 1;  4GOP C;  2QKI C;  3CCJ A;  3S1R H;  4NKL A;  5C5M A;  1YZ6 A;  3E0E A;  3G6J B;  1Y8O B;  5CGK A;  4KI0 A;  4A3C G;  4DUZ L;  2NVQ H;  5E4W C;  2F03 A;  1RD9 D;  2F4I A;  1EYG A;  3VYS A;  2EY5 A;  4EQO A;  2N78 A;  3L9A X;  3NEM A;  2CH4 A;  2DNC A;  4KHZ A;  2RQX A;  1KHI A;  3I72 A;  5JEA H;  1JWU D;  4K2L A;  3VR3 A;  2N49 A;  5C4J B;  2ATW A;  1IZ6 A;  2WP8 J;  1ILQ A;  4PMW A;  3BZC A;  4H44 C;  4LFC L;  1IW7 C;  4JYA L;  2EE1 A;  3DUZ A;  1EWI A;  1TWF B;  4I7A A;  5M5X H;  3S2H B;  1AW7 A;  4GNX C;  4JI6 Q;  1QVC A;  3T16 A;  3J81 L;  1IL8 A;  4DPG A;  2LMC B;  5C44 B;  1MIU A;  4LF5 L;  1ENC A;  4EGV A;  3DEO A;  1PH5 A;  1CK1 A;  1MKH A;  2WKD A;  1LO5 D;  1HUM A;  4XDX A;  3KBX A;  1A3T A;  5C4H A;  1B9M A;  1CUK A;  2HIV A;  3I8Z A;  1Q90 A;  3S17 H;  1I4R A;  2EZV A;  1EWC A;  5JVH 3;  1WTV A;  1OXX K;  1X56 A;  2XRS D;  1K8O A;  2F0K A;  1PMR A;  2BDN A;  1X32 A;  1H95 A;  1T5E A;  1NR2 A;  2JA6 G;  1C9O A;  1WI5 A;  2Q2T A;  1JJC B;  3I4N G;  3J80 E;  4PQX A;  4LNQ A;  5GAE C;  2PW5 A;  4OL7 A;  1Y8P B;  3RLO A;  1VF7 A;  5IYB G;  4R9W A;  1BBX C;  4HSP A;  1EWH A;  3PUZ A;  1W6J A;  1GJX A;  1E22 A;  4QIW E;  2ZTD A;  5EPK A;  4XQN A;  2L4N A;  3C1F A;  1CA5 A;  2DUD A;  3Q6S A;  4C3H H;  3ITP A;  4XQJ A;  1PVO A;  3V96 A;  1E7Z A;  3PCO B;  2EJF C;  2FIN B;  1RTO A;  4MHE A;  2CKZ B;  4FDB A;  2K1B A;  3KF8 B;  4NMZ A;  1B44 D;  4X64 Q;  2MNA A;  1UAP A;  2F0D A;  5COY A;  1NSN S;  3T13 A;  1STG A;  2A68 D;  1BF4 A;  2O5J C;  2JA8 H;  3UE1 A;  1CKN A;  3RZO H;  4X3K A;  1EY6 A;  4L6T B;  2Q8I B;  1HPC A;  5I2X A;  2XVS A;  3CU7 A;  4QF4 A;  5J39 A;  3UDI A;  4A3G G;  2JA9 A;  1A2U A;  1FJG Q;  3IL8 A;  3V05 A;  2JA6 B;  4ZLT F;  4HJ5 A;  2Z1C A;  3GTJ H;  3J80 i;  5BR8 Q;  2UUA L;  1JOQ A;  4OX9 L;  4B9W A;  1LM0 A;  4YWL A;  5K36 G;  1OTC A;  1I4X A;  1LLR D;  2ZM6 Q;  2A6E D;  3M85 A;  4A3B B;  4JG2 A;  2D62 A;  1X6O A;  3HP3 A;  1K8A C;  2UU9 Q;  4FXG C;  3O13 A;  3SK4 A;  2B63 G;  1YNX A;  4NP5 A;  4JI8 Q;  2WB1 G;  3M9B A;  1JWS D;  2LSS A;  3URY A;  4J1M A;  5GAG C;  1DGS A;  3JAM E;  5T1G A;  3AQQ A;  2CWP A;  4B3T Q;  5K5P A;  4YY3 Q;  2F4V Q;  2NVT B;  3CRL C;  4MTN A;  1WJJ A;  1ML0 D;  3MFG A;  1STA A;  4RKB A;  3PSI A;  3ND8 A;  2MGS A;  2QCP X;  2F0U A;  2NN6 H;  2RCF A;  3U9O A;  4DU9 A;  1G2S A;  1IKL A;  1Y14 B;  1KIX A;  3GTG H;  4YCW A;  4QY7 A; 
#chains in the Genus database with same CATH homology
 4BA2 I;  3UDX A;  3PUY A;  1VQM A;  1NMF A;  1VQC A;  3W1B A;  3JAM c;  3S16 H;  5C3E H;  5E7N A;  3M4O H;  3AFQ A;  4DR7 L;  4DV0 L;  1X65 A;  2Q2I A;  4NXM L;  3CP0 A;  1TXY A;  1UWV A;  2B29 A;  3RR5 A;  4DR3 Q;  3S1M H;  4GKK Q;  5BR8 L;  2UUA Q;  1HR0 Q;  3S2H H;  4X6A H;  2MO0 A;  1XMO Q;  1Q8K A;  2JA5 G;  3EBE A;  5M3F G;  1CKM A;  1P8L A;  1WYD A;  2PQA B;  2VZA A;  1VQK A;  3CCM A;  3E9I A;  3S15 H;  2C35 B;  4R4O A;  3J81 i;  4J15 A;  4PG3 A;  3F2C A;  1Q82 C;  2H5X A;  3K7U C;  3H15 A;  4JI0 L;  2IX1 A;  4H02 A;  4POF A;  1V43 A;  3PV0 A;  4NXN Q;  1XJV A;  1XPU A;  1XNQ L;  2WFW A;  1M1K C;  1AE2 A;  4HJ7 A;  4DR7 Q;  3I4N H;  2A8V A;  1KD1 C;  1UEB A;  4IFD G;  3T1Y Q;  4JBK A;  1TWG H;  4A3F H;  4B3R Q;  2GVB A;  3GD7 A;  4B3S Q;  1CSQ A;  1U5K A;  5M3F H;  1VQF A;  4JI3 Q;  3HOZ G;  1Y1V H;  1IBL Q;  5M3M G;  4HJ8 A;  4JI2 L;  4BY7 H;  1VQ9 A;  4O0A A;  1VQA A;  1NBW A;  2IT1 A;  4A3E G;  1VQJ A;  3PUX A;  1EQR A;  4GKJ L;  4AQY Q;  3PO3 G;  4BBR H;  2D0P A;  2KEN A;  4DAY B;  4DR1 L;  4LFC Q;  4WJ3 M;  3G48 A;  3NEN A;  2B3G A;  3Q8D A;  2HT1 A;  2I5L X;  4JI5 L;  1OXT A;  5JJK A;  4JI0 Q;  2LXK A;  1EQQ A;  3CPF A;  4QY7 A;  1J6Q A;  3UDF A;  1PH6 A;  4JBJ A;  3K0X A;  1YJW A;  1QZH A;  1VQL A;  1PYS B;  2JK8 A;  5C44 H;  4A3D G;  2ZTE A;  5M3M H;  2I0Q A;  1Y1V G;  4YWM A;  3HOZ H;  3J81 c;  3H0G H;  2ALY B;  2EXD A;  1SRO A;  2BH2 A;  3LGJ A;  1GO3 E;  4DV4 L;  1IXR A;  4GS3 A;  1CKO A;  2IX0 A;  4JOI C;  4GNX B;  2UXD L;  3TRE A;  1YI2 A;  1TWH H;  4GLV B;  3U4V A;  4DR6 L;  2OTL A;  1FGU A;  4A76 A;  4P71 A;  4DV5 L;  4NPS A;  1SLJ A;  1Z9F A;  3CCR A;  1R9T H;  1C7Y A;  1OXU A;  4L5R C;  2MQH A;  2NVT H;  3CQZ H;  4KHP L;  2Y0S G;  4C2M H;  1QZG A;  4JBW A;  5H1S E;  4X62 Q;  1B8A A;  4LUV A;  1K73 C;  4OXP A;  3OYY A;  3CAM A;  2CFM A;  1KC8 C;  4LF9 L;  4DV3 Q;  1S72 A;  2K5V A;  4TQU S;  1UE6 A;  2V1C C;  5IWA L;  4OWX B;  1JE5 A;  3NEL A;  4YY3 L;  2GVA A;  2BH8 A;  2OQ0 A;  2ZJR A;  3AFP A;  4LF8 L;  1L2F A;  2R6G A;  2RHQ B;  4DR4 Q;  3K7A H;  5C3E G;  4UY8 C;  2PNH A;  2UXB Q;  1RL2 A;  3CC4 A;  4JI3 L;  3J81 j;  4A3E H;  1JMC A;  4DV1 L;  4A3I G;  4A93 H;  4HJ9 A;  4YHH Q;  2N8N A;  3ER0 A;  1YHB A;  1HNX Q;  5FLM H;  4X65 Q;  4LF6 L;  1PA6 A;  3D0F A;  3GTQ H;  1Q1E A;  2E2J H;  1IL2 A;  5GRO A;  3KOJ A;  4UPA A;  1K8G A;  2QEX A;  4APV A;  4DV3 L;  4L5S A;  2AWO A;  3B6Y A;  3T1H Q;  1TWF H;  4POG A;  3PIO A;  1NE3 A;  1A0I A;  5C0X I;  1B70 B;  5HY6 A;  2Q2U A;  2NVY H;  3OTO Q;  2ZJP A;  3I2Z A;  1YHQ A;  2UXC L;  3M4Q A;  4LFA Q;  2JA8 G;  3H3V I;  2ID0 A;  4DV0 Q;  1EFW A;  1L1O B;  2BA0 A;  2ZJQ A;  4OON A;  4YCU A;  4IO9 A;  4JI1 L;  5IY0 A;  1XNR Q;  1YJN A;  2L15 A;  1N32 L;  2JA5 H;  4HIM A;  4JOI A;  4P73 A;  3ULJ A;  5GAD C;  4DV7 L;  1I5F A;  1NY4 A;  5GQO A;  1G6P A;  1VS0 A;  3J7A 5;  5M5Y H;  1N8R C;  1D8L A;  4DV2 L;  2K4K A;  3I4M H;  3S1N H;  4JI6 L;  5LMN L;  4YHH L;  2R7Z G;  3DM3 A;  1HZA A;  4NB3 A;  4X64 L;  1NTG A;  1VQP A;  1Q81 C;  3FHW A;  5M5W H;  1GVP A;  3CCU A;  2UXB L;  3F8T A;  2I5M X;  4DV6 Q;  3T1H L;  1KL9 A;  4BBS G;  1HR0 W;  3PUW A;  4B3T L;  4JI7 L;  2A1A A;  4AH6 A;  3KDF B;  3JC6 6;  1YIJ A;  4A3F G;  2UU9 L;  5LMN W;  4DK3 C;  1EIY B;  4B3S L;  2VW9 A;  2VNU D;  1HZ9 A;  2AMC B;  2CWA A;  5IP7 H;  3TS0 A;  1BVS A;  1I6H H;  4K0K L;  1I50 H;  4X66 Q;  1Q86 C;  2OCE A;  2Z6K A;  1VQ6 A;  4IOA A;  1IBM Q;  1PYB A;  3I55 A;  2K75 A;  2HHH Q;  4A3B H;  3S24 A;  1YJ9 A;  1E1O A;  4LFB L;  1N9W A;  1S3O A;  4L5T A;  4DV4 Q;  1KQS A;  1N33 L;  3STB C;  2JQO A;  5IYC H;  1K9M C;  1GD7 A;  3CC2 A;  1I3Q H;  1OXV A;  2NZH A;  1SN8 A;  3CCE A;  4PZ6 A;  4C3J H;  2JE6 I;  4OO1 G;  3HKS A;  2B63 H;  1ASZ A;  1IBK L;  4GNX A;  2MFI A;  4R4T A;  2R93 G;  2VQE L;  1BKB A;  1EOV A;  4GN4 B;  1VQH A;  1K3R A;  2D0O A;  2GN5 A;  4DUZ Q;  1NMG A;  1Q7Y C;  3I7F A;  4HIO A;  1MJC A;  5LMU L;  4GKK L;  1AH9 A;  1BBU A;  3E9H A;  1PH7 A;  5IE8 A;  2ES2 A;  4IPH A;  4YWK A;  3U4Z A;  4BBR G;  2UXC Q;  1XPR A;  2IY5 B;  4BXX G;  4AYB G;  2JA7 G;  3HOU G;  3KYH C;  3PO2 G;  4TVA B;  1G29 1;  2YTX A;  1A63 A;  4A3K G;  1GM5 A;  4X66 L;  4BY7 G;  2DGY A;  5FJ8 H;  5C4X G;  2KHJ A;  5FJ8 G;  1O7I A;  1NJI C;  5C4X H;  5ELO A;  4A3K H;  1SR3 A;  3A5U A;  1VCI A;  4HID A;  3F1Z A;  4IPD A;  4A4I A;  2HHH L;  4DK6 C;  4DR5 L;  2JA7 H;  1HH2 P;  3J7Z C;  1Y1W H;  5IYB H;  1FL0 A;  3TQY A;  3GTM H;  4Y52 H;  1D7Q A;  1GKH A;  4HJA A;  4R4I A;  1E1T A;  1QVF A;  1HNX L;  4P75 A;  1TWA H;  3JAM i;  1SMX A;  4DV1 Q;  2EIF A;  2E5L Q;  2VS1 A;  3J80 c;  1SRU A;  2FXQ A;  4GN5 A;  3VDY A;  1N34 Q;  1HNW Q;  2JA6 H;  2Z0S A;  1U0L A;  2JJQ A;  4LFB Q;  4GOP A;  4KHP Q;  4A3C H;  4DR1 Q;  2OWO A;  5IT9 c;  3A0J A;  4A3B G;  1LYL A;  4LW1 A;  4B3M Q;  4B3R L;  4A3L G;  4K0K Q;  2R92 H;  5IYD H;  1T9H A;  3GTG H;  1I94 L;  4MZ9 A;  4JI2 Q;  4XTC S;  1SFO H;  3GDE A;  3UDG A;  3KJO A;  4BY1 H;  3TEH B;  2N3S A;  3HOY H;  3HOV G;  3ERS X;  4JI8 L;  1PFS A;  3S1Q H;  2IHE A;  1X3E A;  1S40 A;  1KRS A;  3RZD H;  1Q12 A;  1XNR L;  3PF5 A;  1HR0 L;  1VQ4 A;  4A75 A;  2VUM H;  3HOW H;  3KDF A;  1KXL A;  4PZ8 A;  1PH2 A;  2NN6 G;  3G6E A;  5IP9 G;  4JCV E;  3W5O A;  1L1O C;  4BXX H;  3ULL A;  4GOP B;  4OX9 Q;  1WFQ A;  1L1O A;  4DR2 Q;  3AYH B;  4B3M L;  1VQG A;  1OXS C;  3I4M G;  5FLX c;  2ASB A;  1ASY A;  4HIK A;  2ZTC A;  1VQ7 A;  1E3P A;  1LUZ A;  1XMQ Q;  3ULP A;  3PF4 A;  3BZK A;  3L2P A;  2AKW B;  1UE7 A;  4MNO A;  2MO1 A;  1JB7 A;  2EQS A;  1X54 A;  3FKI H;  4GLX A;  4A3M G;  1HNW L;  1VQI A;  2YTV A;  4LFA L;  3FKI G;  2XTI A;  3KJP A;  2F4V L;  1QUQ A;  4EX5 A;  1PH1 A;  5AJ3 L;  3U58 A;  1N36 L;  2AHO B;  4LF8 Q;  1C0A A;  3KF6 B;  4IFD J;  2PI2 A;  1J5E L;  5DLQ E;  1FVI A;  1YHA A;  2VQF Q;  4JV5 L;  1XNQ Q;  3CD6 A;  1LTL A;  3HOX G;  5IP7 G;  3PIP A;  4LF4 Q;  3L7Z C;  4IOC A;  1IYJ B;  3CW2 C;  3M3Y H;  4ALP A;  3CCQ A;  1EIF A;  3MEF A;  4DR6 Q;  5FLM G;  1B7Y B;  4BBS H;  4IJL A;  2WB1 E;  4C3I H;  3OW2 A;  4DV7 Q;  3FP9 A;  3PO2 H;  5C4J H;  4DV5 Q;  2RF4 A;  4GOP C;  1V9P A;  3CCJ A;  4DR3 L;  3HOY G;  3S1R H;  4R4C A;  2VQE Q;  4LWC A;  1XMQ L;  1A8V A;  1UE5 A;  1Z47 A;  1JJ2 A;  5LMN Q;  3OTO L;  3BU2 A;  2R92 G;  3KFU A;  2KCT A;  1YZ6 A;  3E0E A;  4A3G H;  1HNZ L;  4KI0 A;  3RN5 A;  4P72 A;  1L0W A;  4PZ7 A;  2BA1 A;  4JI1 Q;  4DUZ L;  2NVQ H;  4A3C G;  4DR5 Q;  1VQO A;  3RNU A;  2QA4 A;  1SE8 A;  2KCM A;  1EYG A;  1XTD A;  3KLW A;  1XPO A;  2RCN A;  5GAH C;  2N78 A;  4DR2 L;  3NEM A;  5C0X G;  4KHZ A;  4IPC A;  2UUB L;  1KHI A;  3CCV A;  3M4P A;  3CCL A;  4GLA C;  2HIX A;  2N49 A;  4UP7 A;  4XIG S;  5LMU Q;  2Y0S E;  4OWT B;  2ATW A;  4GKJ Q;  4KLK A;  1IZ6 A;  3H0G G;  2WP8 J;  5JEA J;  4A3J G;  4O2D A;  4PMW A;  3BZC A;  4LFC L;  4JYA L;  1EUJ A;  3HKZ G;  1CSP A;  1VQ5 A;  1EWI A;  1I94 Q;  1VQB A;  2NVX H;  5M5X H;  3I4O A;  2JEB I;  1YIT A;  4GNX C;  4JI6 Q;  5C0X J;  1QVC A;  4DKA C;  2VUM G;  5AJ3 Q;  1N36 Q;  1N34 L;  1KRT A;  4DPG A;  4A3J H;  2YV5 A;  1MIU A;  1PH3 A;  4LF5 L;  3CF5 A;  1PH5 A;  4JV5 Q;  1MKH A;  3GTK H;  2R7F A;  3SGI A;  1VQD A;  3HOV H;  2A19 A;  1N32 Q;  5JEA G;  1QUQ B;  1CUK A;  4DV6 L;  4JI4 L;  3CC7 A;  1YBY A;  2HIV A;  3K80 C;  3S17 H;  3PGZ A;  3HKZ E;  1JT8 A;  2UUB Q;  1HZC A;  3F2D A;  2Z6K C;  2F52 A;  2AWN A;  1OXX K;  5IYC G;  1X56 A;  2I5H A;  4P74 A;  1WCM H;  1A62 A;  3CMA A;  1Q46 A;  1WCM G;  3HFZ B;  1H95 A;  2JA6 G;  1HJP A;  1C9O A;  1WI5 A;  2YTY A;  3G4S A;  2Q2T A;  1X3G A;  2ZM6 L;  1JJC B;  3I4N G;  3GTL H;  4ME3 A;  2IHF A;  1PH9 A;  2VL6 A;  4BA1 I;  3BJU A;  3DLL A;  4DNI A;  4LUZ A;  4LNQ A;  1K0R A;  5GAE C;  2RHS B;  2K50 A;  2PMZ E;  4QJF A;  3L0O A;  4NXM Q;  4IPG A;  4QL5 A;  4AIM A;  1IBK Q;  1FJG L;  3RLO A;  5IYB G;  3UE0 A;  4OO1 I;  1AE3 A;  3PUZ A;  3CXC A;  1JJG A;  4A3I H;  2NN6 I;  2Q2H A;  4JI4 Q;  1E22 A;  3NBH B;  2ZTD A;  4QIW E;  5EAY A;  2YYZ A;  4A93 G;  4LF4 L;  2R7Z H;  1N33 Q;  1PHJ A;  3ICE A;  2DUD A;  3D31 A;  4C3H H;  4EQ5 A;  4UP8 A;  1J5E Q;  1PVO A;  4IJH A;  3RLF A;  1E7Z A;  3PCO B;  4X65 L;  4LF6 Q;  2UUC Q;  4LF7 L;  2PI2 E;  2CKZ B;  2JEA I;  4L5Q A;  4FDB A;  3KF8 B;  2OQK A;  5HGQ A;  1IBL L;  3CME A;  4QQB X;  4WJ4 A;  4LUO A;  4X64 Q;  4JYA Q;  2R93 H;  2MNA A;  3WWV A;  3TS2 A;  1X3F A;  3CCS A;  3GO5 A;  4AQY L;  3GTO H;  4DR4 L;  2NZO A;  4DUY L;  5J3B A;  3I56 A;  1VQN A;  3UE1 A;  3A74 A;  2KBN A;  1CKN A;  3T1Y L;  2JA8 H;  3EN2 A;  3STB D;  3M7N A;  3RZO H;  1QVG A;  2K14 A;  4A3M H;  3H3V H;  2E2I H;  4YCV A;  1E24 A;  3S2D H;  2WAQ E;  1TWC H;  4JC0 A;  3UDI A;  1MJE A;  4A3G G;  2OTJ A;  2JA9 A;  3K8A A;  1FJG Q;  5JJI A;  2VY3 A;  4RG1 A;  2XGT A;  3GTP H;  1Q1B A;  4HJ5 A;  3TRZ A;  4RMF A;  4JBM A;  3GTJ H;  3J80 i;  5BR8 Q;  5IP9 H;  2KHI A;  4QGU A;  4DV2 Q;  2UUA L;  4OX9 L;  1LM0 A;  1V1Q A;  4YWL A;  3RLN A;  1HNZ Q;  2E2H H;  4JI5 Q;  3HOW G;  5K36 G;  1OTC A;  1YEZ A;  2E8G A;  2ZM6 Q;  3U50 C;  1X9N A;  3HOU H;  2R7D A;  3M85 A;  1PH4 A;  3PUV A;  1HZB A;  2CCZ A;  4JG2 A;  1PH8 A;  2LXJ A;  2YU9 H;  3HOX H;  4BY1 G;  2D62 A;  1X6O A;  2QGQ A;  4UP9 A;  2WAQ G;  1X55 A;  1W2B A;  1BBW A;  1KAW A;  3EIV A;  3MXN B;  3ZJY C;  2UXD Q;  1K8A C;  3PO3 H;  2UU9 Q;  1RIP A;  5IYD G;  4A3L H;  2F3I A;  4LF5 Q;  4R4Q A;  1W3S A;  1YNX A;  2B63 G;  3A5Z B;  2K5N A;  5ELN A;  2HQL A;  4JI8 Q;  4OWW B;  2WB1 G;  3M9B A;  2LSS A;  5GAG C;  3AEV A;  1CKN B;  1IBM L;  1DGS A;  4R1J A;  2K52 A;  2CQO A;  3AQQ A;  2CWP A;  1UE1 A;  1VQ8 A;  2PQA A;  4B3T Q;  4JI7 Q;  3IRB A;  3KF6 A;  2UUC L;  4Y7N H;  4LF7 Q;  4X62 L;  3W1G A;  5IWA Q;  1P16 A;  4YY3 Q;  1VQE A;  2F4V Q;  4DAM A;  4AYB E;  2E5L L;  3G71 A;  4MTN A;  1WJJ A;  4LF9 Q;  1K83 H;  1M90 C;  1Y1W G;  4IFD I;  3PSI A;  1XMO L;  1PV4 A;  2K5H A;  4DUY Q;  4A3D H;  5C44 G;  3F2B A;  3K81 C;  1YVC A;  3S14 H;  3CPW A;  1Y14 B;  4NXN L;  2VQF L;  3RN2 A;  5JJL A;  1KIX A;  4GN3 B;  4YCW A;  1WOC A;  1G51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...