5C3EH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eH00
2R7FA 4YY3L 5H1SE 4YHHQ 1SR3A 4PZ7A 1IBKL 5LMUL 1X3GA 4IFDI 3I4OA 4IFDJ 3JAMc 3L0OA 2EIFA 2JQOA 2ALYB 1SN8A 1A63A 4JI5Q 1Q1EA 1VQAA 1VQPA 4R4OA 1IBLQ 1XNRQ 2AKWB 1B8AA 1IZ6A 3SGIA 4DK3C 3KF8B 5E7NA 4LFAL 3DLLA 2JK8A 2K52A 3I4NH 1TWGH 1Z47A 1HJPA 2ATWA 3E9IA 1Q81C 2UUCQ 4GNXC 3HFZB 3G4SA 1YEZA 4JI8Q 3S1NH 4X6AH 1MJCA 4MNOA 2VUMG 1N32Q 4R1JA 2BA1A 4DV2Q 3PUZA 3HOXH 1PH9A 3S1MH 3KDFB 1YITA 3CCVA 4LF9L 1HR0Q 1CKNA 3UDFA 3D31A 3S17H 3S2DH 1N36L 1PH5A 1DGSA 5M5XH 4UP8A 3U4VA 2JA7G 3M4PA 3PGZA 4XTCS 2OQKA 2WB1G 1K0RA 2NZOA 4DV3L 4HIKA 4B3ML 1FJGQ 1XPRA 2R93G 5M5YH 3RLOA 1PA6A 4ALPA 2JA8H 4IJHA 4GOPB 3L2PA 1OXTA 1GM5A 1PH3A 4DR4L 5C44H 2JEAI 3CCRA 1EIYB 4NXML 1LYLA 2PI2E 4J15A 4JI7Q 4B3SL 2A8VA 1K8GA 1RIPA 4IPHA 1TXYA 4A3FG 2BA0A 2MQHA 3CCMA 4JV5Q 2VZAA 2IHFA 4AQYL 4JI3Q 2K5VA 3AYHB 4PZ6A 2E2JH 1XMOL 2UUAL 4WJ3M 2NVTH 4P72A 2B3GA 1YHBA 2AWOA 1KD1C 3S1QH 3CAMA 5IP7G 4LF6Q 4A3JG 1VQ8A 2PQAB 3G71A 1PH6A 2OTLA 4DR2Q 4YCWA 1D8LA 4LUZA 3DM3A 1KAWA 4L5TA 3Q8DA 4PG3A 5M3MG 2VQFL 4X65Q 5GAEC 1XMQQ 4A76A 1TWHH 1I50H 1V9PA 3CD6A 2Q2IA 2PNHA 3BU2A 3ER0A 2I0QA 1NJIC 1YJ9A 3STBD 3KDFA 4DV7L 3CCJA 4A3BG 2OQ0A 1RL2A 2RCNA 4QGUA 1LM0A 1P16A 4OWTB 3CPWA 2Z6KC 1WCMH 1XPOA 3OTOL 3HOUG 3S14H 3TS0A 2KHIA 1V43A 2K75A 2CWAA 1QVCA 1YHQA 1J5EL 4A3LG 4DUZQ 5JEAG 1W2BA 2CKZB 4GOPA 4AIMA 1I3QH 2AMCB 3KLWA 2ZJPA 4LF8Q 2ZJRA 1EYGA 1I94Q 4DR6L 4A3IH 3CC2A 1E22A 2CFMA 3PF5A 5FLMH 3CXCA 1UEBA 3EN2A 4HIOA 4H02A 1YVCA 2L15A 3KF6B 5C4XH 1YIJA 2JA5H 2JA7H 3KFUA 1OXXK 4R4CA 1X54A 4TVAB 3PUYA 1HNWL 3U50C 2YU9H 3WWVA 1MIUA 2LSSA 4IPDA 4DUYL 2UUBQ 2WP8J 4IPCA 3KJOA 1EWIA 3HKZG 3RN5A 2Q2TA 4B3RQ 4BA2I 2E8GA 2PQAA 4OONA 2UXDQ 3LGJA 3T1HQ 1XPUA 4EQ5A 2HIXA 4P74A 1LUZA 4IPGA 1YHAA 1X6OA 2WFWA 1S40A 4A3FH 4JI5L 1Q82C 3PO2H 1U0LA 3ERSX 4FDBA 1YJNA 1IBLL 1IBMQ 1XNRL 3S16H 1YBYA 1Y1WH 2HIVA 1H95A 2GVBA 5GQOA 1N34Q 3H3VI 3UE1A 4DR3Q 3K8AA 2NVXH 1UE1A 5IP7H 4IO9A 4IOCA 2PI2A 5AJ3Q 2UXCQ 1VQNA 4DKAC 4UP7A 4DV1L 2IY5B 1FGUA 4LF4Q 4DV0Q 2WAQE 3I4MH 3E9HA 2EQSA 3F8TA 4L5SA 3J81i 1T9HA 1EFWA 2EXDA 1N32L 1VQ4A 5IT9c 1N33Q 3NEMA 3PO3G 3K81C 4KI0A 1I5FA 3W5OA 1D7QA 4OO1G 3KOJA 3G6EA 2JE6I 1VQGA 1QZHA 4KHZA 1YNXA 4POGA 2B63H 3KF6A 3HOUH 4C3IH 4C3JH 1HNZQ 4QY7A 2JA9A 4JI1L 4BA1I 3PUVA 4P73A 1FJGL 4LFBQ 2MNAA 1EQRA 2BH8A 2ID0A 3I2ZA 1KXLA 3M4QA 1SROA 1GO3E 4A3LH 2JA6G 1K3RA 1LTLA 1XJVA 2UU9Q 1VQ9A 5FJ8G 1TWAH 2ZJQA 4DAMA 2R7ZG 4LUVA 1G51A 2XGTA 3NBHB 2R92H 4BBSG 4YWMA 4O0AA 1VQFA 3I56A 1VQ7A 2Y0SE 1K73C 2ASBA 4K0KQ 4JI2Q 1OXUA 4JV5L 4X64L 4A75A 1JT8A 2VS1A 3H3VH 4JI3L 2VQEQ 1NE3A 4DR1Q 1Y1VH 3FHWA 1EQQA 4DV4L 3CPFA 2N3SA 3TS2A 3PUWA 3AFQA 3K7UC 2AHOB 2ZTDA 3GO5A 4GLVB 4LF7Q 4OXPA 3CCEA 2UXBL 3RR5A 1NMGA 4NXNQ 5IY0A 3FKIH 1ASYA 4KHPQ 1FVIA 1HZ9A 1W3SA 2C35B 3GDEA 1OTCA 1TWFH 1HR0W 3PUXA 5M5WH 3HOWG 3GTMH 5J3BA 5IE8A 5FLXc 3J81j 2R7DA 1FL0A 1NTGA 2CCZA 3HOYH 3UE0A 1Y14B 2KCTA 1KC8C 1VQHA 4KLKA 3ULPA 4BY1H 4LW1A 2RF4A 4PZ8A 2YTVA 4A3MH 2GVAA 3J7ZC 3GTOH 3U4ZA 4DUZL 2K5NA 2K14A 3IRBA 2RHQB 4A3CG 3HOZG 4LF8L 1HZBA 4DPGA 1M1KC 5IYCH 4GOPC 1I94L 3GTKH 4JBKA 4QQBX 2F4VQ 3AFPA 5C0XG 2NN6G 4C3HH 4JG2A 4B3TQ 1VQCA 3ZJYC 4JBJA 1YJWA 1KQSA 1M90C 2PMZE 1CUKA 3GD7A 1HNXQ 2NVQH 3J81c 2I5HA 4HJ8A 4HJ9A 3F2CA 1E3PA 2ZTEA 2WAQG 2UUBL 3AEVA 4B3RL 5HY6A 3TQYA 4DV6Q 1JJCB 2QA4A 4P75A 5FJ8H 3CCSA 1GKHA 2YV5A 3U58A 3RZOH 1UE6A 2UXDL 3T1HL 2R7ZH 1SLJA 1NBWA 3PSIA 1QVGA 4BBSH 2DGYA 1X55A 4LWCA 2E5LQ 4MTNA 2VY3A 4DV5L 4OX9Q 1UE7A 4A3GG 1OXVA 1PYBA 1MJEA 2HHHQ 4A3DG 4QIWE 2XTIA 3UDGA 3FP9A 4HIMA 4DR3L 2VUMH 1NY4A 3UDXA 5IYDG 1PH8A 5GAHC 1U5KA 1WJJA 5AJ3L 5LMNQ 2UXCL 4Y52H 4A93G 4NPSA 3STBC 4GN3B 3A0JA 5IWAQ 1AE3A 4DV0L 4EX5A 4LF4L 3J7A5 2I5LX 3F1ZA 4DR5L 4NXMQ 4BY7G 2H5XA 4GN4B 4JOIA 2R93H 2IX0A 1N33L 3ULJA 2K4KA 1X56A 1B70B 1QVFA 2GN5A 4LNQA 4ME3A 4YWKA 3S2HH 5K36G 4YHHL 5JEAJ 4GS3A 1OXSC 3NENA 1HNZL 1L1OB 1BVSA 1L0WA 2OCEA 3I4NG 4LF5Q 4QJFA 4JI6Q 3PF4A 2LXKA 5GADC 3VDYA 2UU9L 4X62Q 3MEFA 2VQFQ 1K8AC 4A3CH 4JI4Q 1HZCA 5ELOA 3HOZH 3A74A 5HGQA 3GTGH 2I5MX 4A3JH 4GKJQ 4UY8C 2E2IH 4K0KL 1K9MC 2UUCL 5M3MH 4JI2L 4X66Q 3GTPH 4DV7Q 2NVYH 4JI8L 4GKKQ 2VQEL 4DR1L 4HJ5A 4AH6A 1X9NA 4R4TA 4DV2L 3CQZH 2YYZA 2ZM6Q 3S1RH 1HR0L 4LF7L 2JA8G 3TRZA 1YZ6A 4A3BH 1VQEA 3PIPA 4PMWA 3RNUA 1PV4A 1PHJA 4BXXG 4IFDG 2IHEA 1XTDA 4YCVA 5C44G 1WFQA 1S72A 2B29A 4NXNL 5M3FG 4Y7NH 2KENA 2D0PA 1UWVA 3KJPA 4A3GH 1VS0A 4HJ7A 3AQQA 3A5ZB 3K80C 3W1GA 4BBRG 1VQ5A 2MO0A 2N49A 4TQUS 1XNQQ 1SMXA 3CMEA 3W1BA 4DR7Q 4JI7L 3CMAA 2F3IA 3OYYA 1HNWQ 1C0AA 4GN5A 1KIXA 2A19A 1GD7A 2YTXA 1J6QA 2KHJA 5EAYA 5BR8Q 3OW2A 4A93H 1L1OA 4KHPL 3RLNA 4LFCQ 3RN2A 3HOVG 4OO1I 4DNIA 4GNXB 4BY7H 3T1YQ 4JBMA 5ELNA 4LF6L 1X3FA 2CWPA 2F4VL 4JC0A 4DR2L 3CCUA 3HKSA 4RG1A 4B3TL 1E7ZA 1KRSA 1HZAA 4YCUA 2KCMA 4X65L 1HNXL 4A3EG 1XMQL 1WCMG 4JI0Q 1CKOA 1AE2A 1VQJA 1N9WA 2KBNA 2K50A 2YTYA 4DV1Q 3KYHC 1EIFA 4LUOA 4DV6L 1Q86C 4IOAA 3I7FA 5JJIA 4MZ9A 4A4IA 2ES2A 3BJUA 3HKZE 1JE5A 5C3EG 1YI2A 4A3KG 1E1TA 4JYAQ 2E5LL 1UE5A 1MKHA 4A3IG 1CSQA 1A8VA 4O2DA 3CCQA 4OX9L 1S3OA 5FLMG 1SFOH 1EUJA 3UDIA 4YY3Q 2A1AA 2JA5G 5C4XG 2HHHL 1IBKQ 1A62A 3L7ZC 3H15A 3RLFA 3F2BA 1QUQB 5LMUQ 1VQMA 1VQKA 2V1CC 4JI1Q 3J80i 2JJQA 5DLQE 3S15H 3PO3H 1K83H 5LMNL 2OTJA 3PV0A 1N8RC 1IYJB 1KHIA 4BXXH 4GLXA 2MO1A 3D0FA 1Q7YC 5IWAL 1PH7A 1JMCA 4AYBE 1HH2P 3K0XA 4LFAQ 4NB3A 4IJLA 5M3FH 1IL2A 1NMFA 1G291 4GNXA 1SRUA 4OWWB 2JEBI 4JOIC 1PVOA 3PO2G 2JA6H 3CC7A 4X64Q 3RZDH 4JCVE 1PH2A 4BBRH 1Y1WG 1C7YA 4DV4Q 1G6PA 2IT1A 5IYBG 2CQOA 2IX1A 1BBWA 2N8NA 3B6YA 4LF5L 1PYSB 3H0GG 4LF9Q 4WJ4A 4JI6L 1IBML 1N36Q 2N78A 5C0XI 1E1OA 2NN6I 4X62L 5C0XJ 4YWLA 3HOVH 5IP9G 2LXJA 4DV3Q 1N34L 4JI4L 4B3MQ 3I4MG 3JAMi 2UXBQ 3M3YH 3K7AH 5C4JH 1VQBA 2FXQA 3TEHB 1KL9A 1Q46A 3ICEA 4GKJL 3S24A 1E24A 4R4IA 4X66L 2OWOA 1A0IA 4DR4Q 1VQDA 1Q1BA 2Q2UA 4GKKL 1VQ6A 4A3EH 2B63G 2Y0SG 1JB7A 2D0OA 4B3SQ 2MFIA 2Z0SA 3PIOA 5LMNW 1QUQA 3EIVA 2QEXA 4RMFA 2ZM6L 3HOWH 1JJGA 1R9TH 4AQYQ 3GTQH 1X65A 1XMOQ 2UUAQ 5C3EH 5JJKA 2E2HH 5GAGC 4A3KH 5GROA 2AWNA 4LFBL 2R92G 4L5QA 2WB1E 2VW9A 3CW2C 1PFSA 4UP9A 1CSPA 1L2FA 1WOCA 3CF5A 1EOVA 1QZGA 1I6HH 3CC4A 1XNQL 2QGQA 3M9BA 4DAYB 1TWCH 1Y1VG 1X3EA 4HIDA 1VCIA 4DR7L 3GTLH 1SE8A 1BKBA 3HOXG 2R6GA 4R4QA 1VQOA 1CKMA 1KRTA 5BR8L 2DUDA 1V1QA 3MXNB 3NELA 2HQLA 3BZCA 2Z6KA 2HT1A 4LFCL 3ULLA 4L5RC 4APVA 2D62A 1L1OC 1C9OA 4OWXB 3PCOB 3OTOQ 3T1YL 3FKIG 1WYDA 5JJLA 3E0EA 4JBWA 2VL6A 4DV5Q 1PH4A 1JJ2A 3J80c 1J5EQ 2BH2A 3A5UA 1BBUA 2K5HA 4UPAA 2VNUD 1VQIA 1Z9FA 1GVPA 3M85A 2RHSB 4GLAC 4HJAA 3HOYG 3JC66 2ZTCA 4POFA 5IYBH 4JI0L 3I55A 1CKNB 1O7IA 1B7YB 3EBEA 3G48A 4P71A 4BY1G 3TREA 1ASZA 4DR6Q 1IXRA 3H0GH 2Q2HA 3BZKA 4A3MG 4C2MH 4AYBG 3M7NA 4DK6C 4A3DH 1P8LA 5IP9H 1AH9A 1WI5A 4DR5Q 3GTJH 4QL5A 5IYDH 2F52A 2NZHA 1VQLA 3CP0A 4XIGS 5IYCG 4DUYQ 3CCLA 4JYAL 1Q8KA 1Q12A 3F2DA 3M4OH 1PH1A
chains in the Genus database with same CATH superfamily
1DXMA 5H1SE 5LMUL 3CU7A 4IFDI 3I4OA 1V8QA 3JAMc 3L0OA 4KTAA 1SN8A 1A63A 3SR1A 1VQAA 3EJIA 1VQPA 4R4OA 4ZAIA 4PMCA 2AKWB 5KEEA 1AEXA 4DK3C 3ITPA 2K52A 2B2WA 5ISRA 1HJPA 3VYUA 2ATWA 4RWSC 1Q81C 1ICFB 3G4SA 1YEZA 2A69D 1AZPA 3HOXH 1YITA 1HR0Q 4TRDA 1PH5A 3HEJA 3U4VA 3M4PA 3PGZA 2OQKA 1LACA 4CKEA 2R93G 4IUPA 2JA8H 5JOBA 1T5XD 1V1OA 4GOPB 3L2PA 1OXTA 4A93B 4K6DA 2JEAI 3C1EA 2PI2E 2A8VA 4TKOB 1Y8OB 1TXYA 4A3FG 2F3WA 1PRTC 5CV8A 2UUAL 2NVTH 2MUYA 1YHBA 1KD1C 1QB5D 4M8AA 2PW7A 1SYDA 3G71A 4YCWA 3FDTA 4LUZA 3R93A 2AUKA 4X65Q 2HCIA 3WOFA 2KQ3A 1I50H 2M9VA 1V9PA 3ER0A 2PNHA 4HMJA 1NJIC 3STBD 1WTWA 4A3BG 3CCJA 2RDFA 3S14H 4DF7A 1U4MA 2B8FA 2K75A 4RGTA 3PO3B 3M4YA 2CKZB 4GOPA 4DXFA 3S9WA 3KLWA 2ZJRA 3LX0A 1EYGA 4DR6L 1E22A 2PQEA 3CXCA 1TS4A 3OWFA 4ID6A 1O7LA 3LWEA 3N6RA 3L3OC 1OXXK 5G3LF 1UUPA 1X54A 4BBRB 2YU9H 2LSSA 4DUYL 4B9XA 3AB9A 4B3RQ 4IPCA 3R3OA 1U4LA 2FINB 1BOSA 3AMUA 2UXDQ 3LGJA 1SDFA 4P74A 4IPGA 3VYSA 1X6OA 2XRSD 1Q82C 1DCZA 4FDBA 1BCPD 1IBMQ 1XNRL 1AW7A 1JICA 1YBYA 3NTKA 3H3VI 3UE1A 1RHPA 4DR3Q 2NVXH 2KOLA 2PW5A 2ZT9C 1IYUA 5AJ3Q 1SJHD 2F0MA 1D5ZC 2MHVA 4L5SA 1T9HA 3GTQB 1QWYA 2EXDA 3KLRA 1ZEQX 4QF4A 5C3EB 3GP7A 3NEMA 2E75C 1RD9D 1D7QA 4KK7A 1AN8A 2KJXA 1YNXA 2K1BA 1FJGL 4BA1I 3PUVA 2MNAA 3I2ZA 1GO3E 1XJVA 1VQ9A 2CW0D 4J1MA 4K8IA 4DAMA 2R7ZG 1G51A 1A3VA 3NBHB 2R92H 4O0AA 2XNAC 1VQ7A 1DYQA 4JV5L 5F2DA 2K03A 4JI3L 3C3LA 3CPFA 1H9KA 4KD3A 3AFQA 2ZTDA 4J6HA 1IYVA 1LTTD 3CCEA 1I4XA 5ELFA 1ZYRD 3H0GB 2L12A 4C2MB 3URYA 1NMGA 5IY0A 2TMPA 1HZ9A 1W3SA 5T1GA 1HR0W 5M5WH 5A35A 3J81j 2R7DA 2XWBB 1NTGA 2F0WA 1YNJC 3UE0A 4C1NK 1Y14B 2KCTA 1VQHA 4DXGA 4LW1A 2YTVA 5KNBA 4A3MH 3GTOH 4ZCKA 2KEEA 4DUZL 4U673 2EYFA 2K5NA 3D4WA 3IRBA 2RHQB 4A3CG 2C9OA 4MIUA 4QQBX 1W6KA 3NBHA 3T53B 4LJZC 4JBJA 1KQSA 2PMZE 1CUKA 3GD7A 1HNXQ 3J81c 3VYRA 2Z4HA 4HJ8A 1CI3M 2SDFA 2ZTEA 5E4XA 1FYCA 5HY6A 4DV6Q 1JJCB 3S17B 3T1HL 1NBWA 1SLJA 2G9DA 2KCNA 2VY3A 3NWSA 4DA2A 1LABA 4A3GG 1A3UA 3MZ5A 3S15B 3TP6A 1SYEA 5CMDA 1Z6HA 1CA6A 1HA6A 4A3DG 4QIWE 2F0LA 3UDXA 1KDAA 2MP1A 5M3FB 5T1IA 2UXCL 1KDBA 1O78A 1MBYA 2N55A 4IUTA 1R4PB 4NXMQ 1STYA 3V2TA 1N33L 3ULJA 2K4KA 1X56A 4QMGA 5BN4A 3S1QB 1QVFA 4LNQA 1ML0D 3BZDB 1WVLA 4YHHL 3HOVB 3T4AC 1STNA 1BVSA 1TWHB 4R8NA 1B1ZA 1XX8A 2LXKA 5IOCA 1B44D 4G7OC 1K8AC 2A6HD 4JI4Q 1RCVD 1HZCA 3SHLA 3D3RA 3VA5A 1WTXA 2K28A 2B2VC 5HGQA 5DM63 4A3JH 4GKJQ 4UY8C 4RFBA 4QCLA 2E2IH 4K0KL 3GTPH 5M3MH 4JI2L 1TY2A 1A2UA 3BVMA 2NVYH 4JI8L 1EEID 2F1MA 1X9NA 4R4TA 1I3QB 4RGOS 2JA8G 2YYZA 1NNXA 4BXXG 3J80L 1XTDA 4YCVA 1WFQA 5C4XB 1KTKA 2B29A 3KJPA 4RHRA 3VYTA 1VF7A 1BO0A 2EVBA 2XVSA 3OW7A 1F2MA 3K80C 1JWUD 1EZ6A 1SMXA 1PYWD 1IKLA 1K8OA 2HDMA 1J9OA 2YTXA 2KHJA 5BR8Q 1GUWA 1STGA 4F88A 4A3FB 4LFCQ 4DNRB 3RN2A 4OO1I 4GNXB 5I6YA 4JBMA 1B9NA 2CWPA 1JC7A 1KABA 3QR8A 4JC0A 1O7ZA 4H44C 4RG1A 4B3TL 1E7ZA 2DNCA 5J1ZA 3OSOA 3KBXA 4YCUA 5BN5A 5K36H 4A3EG 1XMQL 3I4MB 1CKOA 1Y8NB 3HG9A 4LUOA 2CHBD 4RAUC 1JE4A 4IOAA 1CZGA 4A4IA 3R8BA 3BJUA 3TMEA 2A69C 4N8FA 3OWEB 1I4RA 4A3KG 2PCFB 3TP7A 2E5LL 2Y0SB 5D3IB 4O2DA 4G7ZC 1S3OA 1IBKQ 1QCBD 3H15A 1QUQB 2HDLA 1TWAB 3S15H 5LMNL 2OTJA 3FEWX 1N8RC 1KHIA 3KK7A 4KHVA 4U68A 5IWAL 3Q22A 3K0XA 4LFAQ 5M3FH 1IL2A 1Y1VB 4GNXA 1SRUA 1PVOA 5JAVA 4X64Q 2EYHA 4PV1C 3V96A 4DV4Q 1G6PA 4ZK9B 1S5DD 4LF5L 3FKIB 5M5YB 1C48A 5C0XI 3H3VC 3HOVH 3H6MA 2UXBQ 3MXUA 1N34L 3M3YH 3VR6A 1SJED 3K7AH 5EKLA 1VMPA 5CORA 3S24A 4BY1B 1S5ED 3PIP3 4G7HC 4KY5A 1A0IA 2K32A 4FXDA 1VQDA 3NQTA 1HCZA 3T56B 4AYBB 4UDUC 5IODA 2F0VA 1JB7A 4B3SQ 2MJ8A 2Z0SA 1QUQA 2ZM6L 1X65A 2G5DA 4C3HB 2R92G 2F0NA 2Z9HA 1RKNA 5EGTA 4ZLTF 2F0IA 4MN3A 1S5CD 3CF5A 1II3A 1QZGA 1FNVA 2QGQA 3M9BA 1FGBD 4DAYB 3G7LA 1VCIA 4XT3B 1SE8A 1BKBA 1SSOA 2NN6H 1KRTA 1F9SA 2M00A 3NELA 2FJ2A 2HQLA 3BZCA 1XYIA 2QEJC 2L55A 1ILQA 3I3CA 3PCOB 4K6LA 3E0EA 2DN8A 2VL6A 4DV5Q 1PH4A 1Z9FA 3TDQA 1GVPA 2ICEC 3K5LA 4JI0L 3RUZA 5M9OA 1ONLA 2RCFA 2Q2HA 3BZKA 4A3MG 4DK6C 1P8LA 2RA4A 1WI5A 1PZJD 4KN7C 5IYDH 3CP0A 4XIGS 5E3FA 3CCLA 4LK1C 5CBAE 1PH1A 4YY3L 1RJTA 2B2YC 4PZ7A 4CDFC 1NR4A 2X6LA 2EYJA 4QB4A 4DAYA 2ALYB 4JI5Q 3C46A 1Q1EA 3A8KE 2HD3A 3GTGB 1IBLQ 1EIGA 1B8AA 3ND9A 4RKBA 3FPUB 2ZXPA 3MXGA 2RKSA 2WACA 5E7NA 3LNNA 2JK8A 3NP8A 3I4NH 1I4GA 1DONA 3E9IA 2QW7A 3A7LA 1DZ1A 5EPJA 4X6AH 1MJCA 2EY6A 1N32Q 4R1JA 2BA1A 4PNYA 1JQYD 1TS5A 2XN9C 1BF4A 3S2DH 1N36L 3NK9A 5M5XH 2JA7G 2F0HA 4B3ML 5M5YH 2JXMB 3RLOA 1F77A 2RSNA 4IJHA 2O5JC 4IUNA 1QNKA 1EIYB 1Y69U 4FO2A 4JI7Q 3J7AV 3A8JE 3U9OA 1CZWA 4DGZA 2F0JA 3SK6A 1TS3A 4PZ6A 2E2JH 4OHJA 2L1BA 2B3GA 3I70A 3K6OA 3CAMA 5IP7G 4LF6Q 3QIAA 4A3JG 1VQ8A 1G6ZA 2QF7A 4DR2Q 1EWHA 3A8IE 1D8LA 5M3MG 3DM3A 1KAWA 3J80E 1X3QA 5NUCA 1O80A 1JWMD 4A76A 4IUVA 2NTTA 3IL8A 1IW7C 3BU2A 3J81L 5EPKA 2FFKB 3DEPA 4XYQA 4DV7L 1P16A 4OWTB 2Z6KC 1XPOA 3D6CA 4FNFA 4C3IG 3K59A 5CBEE 2PNRC 4A3LG 4AIMA 2ZJPA 4LF8Q 4A3IH 2CFMA 1H9JA 1DOKA 1LLRD 4HIOA 1F9RA 2A6EC 2JA6B 3KFUA 4R4CA 3RZDB 1HNWL 3OPOA 3WWVA 5KNDA 1G2TA 4IPDA 2E2DC 4BBSB 3RN5A 4BA2I 1M8AA 1B3QA 3NBIA 1CA5A 4EQ5A 1NCVA 1LUZA 5C4ZA 5C5LA 2Q8IB 2B8GA 3S16H 2HIVA 2A6HC 1UE1A 2QCPX 4A3EB 2PI2A 4DKAC 4UP7A 2B2WC 1ENFA 1FGUA 4LF4Q 4DV0Q 2AQ2B 1SXTA 3F8TA 3HOWB 3TN2A 3P75A 5IGFA 5IT9c 2NUCA 2E2HB 4CGYB 4IQZA 3DM1A 1HPCA 1Q90A 2JE6I 1Z7TA 2TSSA 1QZHA 2B63H 3HOUH 4C3JH 3QG1A 4LFBQ 1TWCB 3HOZB 3GTLB 1SROA 1LTLA 2UU9Q 5G3LD 1GHKA 5FJ8G 4L6TB 2HCCA 1K73C 1D2BA 4A75A 1SMYC 2VS1A 1JT8A 4DK0A 3S1RB 1EQQA 2WKCA 2N3SA 1FNWA 3TS2A 4EQPA 3K7UC 2RDGA 4GLVB 1GUTA 2VXWA 3RR5A 4KHPQ 1OTCA 4X3TA 4C1NI 3GTMH 5IE8A 4RA8A 1FL0A 3HOYH 4I7AA 4KLKA 3ULPA 3GQBA 2L11A 3U4ZA 2KA7A 1HZBA 4DPGA 1M1KC 4GOPC 2NN6G 5KNCA 1TWGB 1EYAA 1VQCA 1YJWA 1ET9A 1GJXA 4K5XA 2I5HA 4NDXA 3S1NB 1PZID 1E3PA 2WAQG 3AEVA 4B3RL 3TQYA 3S1MB 2QA4A 2NTSA 3CCSA 1GKHA 3U58A 2UXDL 2EDGA 4BBSH 2DGYA 1X55A 4MTNA 2B2TA 4OX9Q 1OXVA 1LTBD 4N8X1 2FMMA 1JCKB 3EQLC 4CJ0B 2XTIA 2F0QA 4DR3L 2VUMH 4CDDC 1NY4A 5C44B 3D6WA 5IYDG 3DWQA 5GAHC 3DEOA 3FRPB 1ILPA 5CV5A 5AJ3L 2A74C 4ZUIA 1AE3A 2PMZB 2KVMA 2I5LX 3F1ZA 4KJOA 1BXTA 4DR5L 1I4PA 4BY7G 4GN4B 2DJFC 3O13A 4LAAA 4ME3A 3ND8A 1E2VA 5CV7A 2D2CC 3NENA 3RD4A 1F9PA 1STBA 1L1OB 3BYTB 3I4NG 2DNEA 4JVZA 1NUCA 2JP1A 4JI6Q 3PF4A 4KV6A 3MEFA 2F0KA 1EEFD 3HOZH 3A74A 3NE5B 4B08A 2I5MX 1WCMB 3R2TA 5EBCA 2F0UA 2UUCL 3C2PA 1EWCA 3QO2A 3WOEA 4DV2L 1TQOA 3S1RH 5HURA 1YZ6A 1WD1A 3CRKC 1HXYD 4XT1B 2ZXRA 5K5PA 2JA5B 1W6JA 2KENA 1SYCA 2D0PA 1UWVA 5JEAH 1VQ5A 2N49A 4TQUS 1XNQQ 4NP5A 3W1BA 3CMAA 5CYUA 3A56A 3J81E 4A93H 1I4HA 1PDQA 4WJWA 5EAYA 1L1OA 1MSHA 3OW2A 3PO2B 2NWGA 1EIHA 2J4XA 4L63B 1Y1WB 5EPLA 1L0XB 3DWPA 1STEA 4DAVA 1HUNA 3CCUA 1PLFA 2IWHA 1HNXL 1VQJA 2KBNA 1LTRD 3BS1A 1EY6A 4DV6L 3K0YA 3I7FA 3HKZE 4DFAA 3TZUA 2EY2A 3BDOA 1TVXA 1MKHA 1UE5A 3UI2A 4A3IG 3CCQA 1EUJA 3UDIA 2GA4B 1A62A 2A73B 3RLFA 4ZYSA 2MPMA 3KBGA 1VQMA 1EYCA 1B2TA 1AFPA 2JJQA 5DLQE 3PO3H 1JB3A 5TSSA 1JMCA 5JPNC 2BE5C 3OOCA 4NB3A 4IJLA 2OEOA 2EJGC 1IW7D 4FF2A 2JEBI 1EU3A 5KIXA 2WKDA 2KEDA 1SNPA 4BBRH 3TBIB 4G57A 1FR3A 3MXPA 2DY8A 5IYBG 4BS9A 1WTHA 2N8NA 3B6YA 4LF9Q 4JPBW 1E1OA 1BCPF 2LXJA 4DV3Q 4JI4L 1RDPD 5JPMC 3SVMA 3N52A 4EQNA 2QDLA 1VQBA 1SE2A 1Q46A 4GKJL 1E24A 3E5SA 4DR4Q 1EY7A 2A6ED 1Q1BA 3SK8A 2Q2UA 1GOZA 3I4LA 2B63G 3NXWA 2MFIA 4L8JA 1MSGA 1JJGA 3GTKB 4AQYQ 3GTQH 1KAAA 1XMOQ 1CHPD 5C3EH 5GAGC 1E2WA 2AWNA 3MC0B 2VW9A 4UP9A 5IGEA 3QOLA 3CKIB 4HIDA 3RZOB 3HOXG 1VQOA 1CKMA 5BR8L 3MXNB 1PTOF 1V1QA 1IKMA 1XTCD 2ZXOA 4LFCL 4L5RC 4Q0FA 3OTOQ 4H13C 2BH2A 1J5EQ 3OHXC 2K5HA 5JVG3 3X3MA 2RHSB 3KLSX 1G2SA 3MA2B 4HJAA 3HOYG 2RQXA 3JC66 2ZTCA 4R8IA 3DMUA 1LT3D 1CKNB 1DOMA 1B7YB 3K5OA 3G48A 1RTNA 2HUGA 2R61A 3TREA 5HGTA 2R93B 3H0GH 4C2MH 3M7NA 3A7AB 1GUOA 4M1UB 5IP9H 5FOBB 4XQNA 2F52A 4QUFA 1VQLA 2NYZD 1Q8KA 1Q12A 3F2DA 3T13A 3TZDA 2CVRA 4JK1C 5IT9L 1SMYD 2JN4A 1O7YA 1VMCA 1AP0A 2LY7A 4YHHQ 1SR3A 1IBKL 1X3GA 2L0CA 2CH4A 2EIFA 2KECA 1LTAD 2A68C 1HTLD 4X3KA 3SGIA 4KY6A 5KYIA 3MXNA 4LFAL 1Z47A 3E6ZX 4HSVA 1BR9A 4GNXC 3HFZB 1QJOA 3CQZB 1STAA 4JI8Q 3SDZA 2XSCA 4A3BB 4MNOA 2VUMG 1PH9A 4Y7NB 1CKNA 3S17H 5CV6A 2EXZA 1WTRA 4XTCS 1OO9B 2WB1G 2NZOA 4XDXA 2J0TD 3PIO3 1PA6A 3K5NA 4ALPA 4FP5D 4CKBA 1GM5A 1PH3A 4IFDH 1C4QA 1C8CA 5EQ0A 3CCRA 4B3SL 2MGSA 1RIPA 4IPHA 4UAIA 2BA0A 1EU4A 2MQHA 3T51B 3CCMA 1PFBA 2VZAA 2IHFA 3W3AA 1VF5C 3AYHB 4RCOA 4FF1A 4CDCC 3S1QH 2AWOA 2AQ3B 1K0SA 2PQAB 3EVQA 4KKSA 4HR7B 4L5TA 2B39A 2VQFL 1X32A 2JSOA 2PZTA 5GAEC 1XMQQ 1K3BC 2FMCA 2NBFA 1TWHH 3KLSA 2Q2IA 1GUNA 1YJ9A 2BOSA 4QGUA 2RCNA 1LM0A 1SFOB 2NB0A 3OIQA 3ZYYX 2QKIC 5DNFA 1IL8A 5BN3A 4IUQA 1EY9A 2CWAA 3MWYW 5IGGA 4HSPA 2I07B 3VA7A 5J39A 5JEAG 1YHQA 1W2BA 1UAPA 1K83B 2PPBC 2Z4IA 2WINB 1HA5A 1FD7D 1I3QH 2AMCB 1I94Q 2NVQB 2EPBA 3PF5A 2RDHA 1HUMA 3NUCA 2EY1A 5C4XH 1PZKD 5FO8B 1PFNA 4K5VA 4TVAB 2R7ZB 2SNMA 2UUBQ 2WP8J 3HKZG 1U4RA 2E8GA 2PQAA 4OONA 5C5MA 1XPUA 2F0DA 2HIXA 4A3FH 4JI5L 3ERSX 5C4JB 1IBLL 1N34Q 1BCPB 1SBBB 1ZKOA 4IOCA 2F0OA 2M2LA 1KNAA 1VQNA 3E0JA 4FF3A 4DV1L 2IY5B 4EGVA 2WAQE 3I4MH 1EQVA 1N32L 1VQ4A 1YNNC 3QJYA 3PO3G 4KI0A 1I5FA 2K33A 3W5OA 3KOJA 5IGBA 3A54A 4KHZA 4TSSA 4POGA 1I6HB 1HNZQ 1PRTF 2JA9A 4FXGC 4JI1L 2ID0A 2BH8A 1KXLA 3H91A 1K3RA 2KHSA 4ZUJA 1TWAH 1QILA 2XGTA 4IURA 2Y0SE 1ESFA 1PTOB 3H3VH 3CHBD 2VQEQ 4E6IA 1RODA 4DR1Q 1Y1VH 2VB3X 1STHA 3X3NA 2LMCB 2Q8RE 3PUWA 4N9TA 3J7YW 2AHOB 1ET6A 4LF7Q 3IKJA 4A3GB 3MVVA 2Z1CA 4NXNQ 1ASYA 3FKIH 4A3DB 2QDBA 1U4PA 2C35B 3GDEA 5CGKA 3GTJB 1Y8PB 5J3BA 2BE5D 1KC8C 4BY1H 1QNUA 1EQTA 2K14A 2ENBA 4Q5VA 4LF8L 2B2UC 5IGCA 5IYCH 1DM0B 1SYGA 4ZKCB 2F4VQ 1L0YB 4C3HH 4JG2A 3ZJYC 1M90C 3BDCA 1TU2B 3IFTA 1CHQD 2NVQH 5E4WC 1H9MA 5CV9A 4HJ9A 3I91A 3F2CA 3HOXB 4P75A 2YV5A 4N9PA 1UE6A 2R7ZH 1MGSA 1QVGA 5JJZA 5JVH3 1LT4D 1D5MC 4LWCA 1ENAA 5I2XA 2EYOA 5IT9E 1MJEA 2JA8B 1CM9A 2B2UA 3NHHA 4IZ8A 4K5WA 4NW2A 4B9WA 2HHHQ 1WTVA 3UDGA 4HIMA 4KKUA 1PH8A 1WJJA 4GN3B 4Z9CB 3A0JA 1LTSD 4LF4L 4DV0L 1E2ZA 2EZVA 1GHJA 2H5XA 4JOIA 2I46A 5ELCA 2N88A 2NVTB 1B70B 5CC4A 2GN5A 4YWKA 1VDZA 5K36G 3NSWA 5JEAJ 4GS3A 2HQEA 1L0WA 4EVOA 1EOTA 1B50A 5GADC 2UU9L 4X62Q 4A3CH 5ELOA 2IJ0A 2BCOA 1DJRD 3K58A 3GTGH 4I65A 3S14B 1BBXC 1K9MC 2OXPA 4X66Q 1PXUA 4DV7Q 1GXDC 1JOKA 4GKKQ 2D9UA 1ENCA 1MD2D 4HJ5A 3LWUA 5DAUA 4K2KA 1D1IA 4A3KB 1HR0L 3KUPA 3TRZA 2K7VA 1VQEA 3PIPA 4PMWA 3RNUA 1PV4A 1PHJA 4IFDG 4EQOA 1S72A 5M3FG 3D4DA 4A3GH 4JW0A 2A68D 3AQQA 4F8MA 1HRJA 1JWSD 2JYOA 4DR7Q 2F3IA 1HNWQ 1C0AA 2K5QA 2L9HA 3ERQA 2F0TA 1GD7A 1KDCA 4C56C 2K01A 3RLNA 3HOVG 1H9SB 4DNIA 3T1YQ 5L37A 1DOLA 2AQ1B 3EA6A 1BQQT 2NVXB 3SE0A 3HKSA 1KRSA 1HZAA 4KD4A 3CRLC 4X65L 4IALA 1AE2A 3OMCA 4OIKA 5ELDA 2K50A 1TIID 4P2CB 1XXGA 3FVQA 3KYHC 5JJIA 4MZ9A 2ES2A 1JE5A 3BYYB 1LV9A 2BDOA 2X6GA 1E1TA 2Z8LA 4JYAQ 3HP3A 4RH6A 1CSQA 1A8VA 4OX9L 2A1AA 2B2TC 2OT2A 5C4XG 5LMUQ 3F2BA 4MTKA 1PRTB 3J80i 1KNEA 2IW3A 3OIPA 2R92B 1IYJB 4BXXH 4OO1H 4H7BA 2MO1A 3D0FA 1Q7YC 1PH7A 1EY5A 2EYLA 1HH2P 5FLXL 2FHTA 1H9SA 2JA6H 1U9RA 3NWTA 2P5ZX 3RZDH 1PH2A 1EL0A 3HKZB 2DY7A 4LMQD 2G9HD 2IT1A 2Q8TA 2CQOA 3T16A 3L9AX 1D5XC 1BNZA 4WJ4A 5ELBA 4JI6L 1IBML 4ZKBB 2NN6I 3J7AF 4K14A 2A5HA 5M5WB 3I4MG 4KN4C 1TT2A 3JAMi 1A15A 1S5BD 2FXQA 3TEHB 1KL9A 3ICEA 2E76C 4R4IA 2OWOA 2X69A 4A3MB 3GTOB 1VQ6A 4A3EH 2Y0SG 2BDNA 4XYOA 3EIVA 4R9WA 3SXHA 2QEXA 4RMFA 3HOWH 1B4OA 5C6AA 2UUAQ 1A6XA 5JJKA 5I4DA 2E2HH 4A3KH 2KUMA 5D65A 2WB1E 3GV3A 1PFSA 5DM73 1CSPA 1L2FA 1EOVA 4QIWB 4F7XA 1XNQL 1TWCH 1Y1VG 3GTLH 5COYA 2O4XA 2R6GA 4R4QA 5C0XH 4MHEA 3VR2A 3NQIA 3P20A 2HT1A 1SNOA 4BWGB 3EROA 4APVA 2D62A 1L1OC 2RVLA 3HGBA 1C9OA 1S5FD 3GV6A 3FKIG 1YNND 1WYDA 2ICIA 3AU7A 1JJ2A 1GUGA 4HTHA 1BBUA 3A5UA 1VQIA 1WTPA 3M85A 4GLAC 3P1HA 2O2LD 2JA7B 1I4QA 2F0SA 1O7IA 4BY1G 4P71A 5EJWA 4DR6Q 1EYDA 1ASZA 3BDLA 2PZUA 4AYBG 1TR5A 1AH9A 4DR5Q 1E0BA 3DWAA 1HFGA 2PYKA 4QL5A 5IYCG 4DUYQ 1LT6D 4C3HG 1RF2D 2R7FA 2PO4A 1HQRD 5D14A 5EKKA 4IFDJ 2JQOA 5C4HA 4NMZA 3Q24A 3MHBA 1B53A 4A3JB 1XNRQ 1IZ6A 2E2IB 2F4IA 5M3MB 3GTPB 3KF8B 2NVYB 2VB2X 3DLLA 3EFXD 1TWGH 3D4RA 1PTOD 3NTIA 3NTHA 2SNSA 2UUCQ 3S1NH 2EOTA 2Z6BA 3QOJA 3BVGA 5C3XA 4DV2Q 1EZ8A 3PUZA 3S1MH 3KDFB 4C3IB 3CCVA 4LF9L 4HN7A 3UDFA 3D31A 1DGSA 4UP8A 1GUSA 4DV3L 4HIKA 1K0RA 1TKWB 1FJGQ 1XPRA 5LL6X 1V1PB 4DR4L 2RSOA 5C44H 4NXML 1LYLA 4J15A 4DU9A 1HQMC 1K8GA 2H1EA 4JV5Q 4FYDA 2K6AA 4AQYL 4OGQC 4JI3Q 1SNQA 4XQJA 2K5VA 4WJ3M 5KRUA 1XMOL 4P72A 5ELEA 3KF8A 3DHQA 4CJ2C 3D8GA 1PH6A 2OTLA 2OF1A 2WV6D 1TWFB 4F87A 4PG3A 3Q8DA 4RKLA 3MFGA 1D6EC 2L4NA 3CD6A 2I0QA 3KDFA 4KY7A 2OQ0A 1RL2A 3HOUG 3CPWA 1WCMH 4WRDA 4C3JG 3OTOL 3TS0A 1SAPA 2KHIA 3BG3A 1V43A 1SE3A 2SEBD 1IHZA 3HRZC 1QVCA 1J5EL 4DUZQ 5FK9C 2RBMA 1XWEA 1V1PA 1G91A 5KYLA 3CC2A 3U9SA 2EE1A 3E3XA 5FLMH 1UEBA 2EYMA 3EN2A 4H02A 1YVCA 2L15A 3KF6B 1YIJA 2JA5H 2JA7H 5AFWA 1B3AA 4UHVA 3PUYA 3WDNA 3U50C 1MIUA 3NPPA 3KJOA 1EWIA 2Q2TA 4HCSA 1MI2A 3H09A 4CKCA 1RTOA 3DUZA 3T1HQ 1YHAA 1S40A 2WFWA 3M3YB 2LFNA 3PO2H 1U0LA 3K7AB 4HMIA 2K5WA 4NKLA 1YJNA 2XWJB 1Y1WH 3I8ZA 1M4VA 1H95A 2GVBA 4V0BA 3G6JB 5GQOA 3PMFA 3K8AA 3PQIA 2XRQD 1F2YA 4IO9A 5IP7H 2J7ZA 2UXCQ 4K2LA 1HFNA 4DNTB 3SK5A 3IFDA 3E9HA 2EQSA 3J81i 1Q8IA 3S2HB 5FLXE 1EFWA 1CQFA 2F0FA 1N33Q 1J8IA 3K81C 1K8MA 1SYFA 4OO1G 4HAEA 2CQAA 3G6EA 1VQGA 3KF6A 3QWNA 4C3IH 4QY7A 4P73A 1EFID 1EQRA 2DJGC 1F9QA 3M4QA 4A3LH 2JA6G 2B2VA 1PMRA 2ZJQA 4S3SA 4LUVA 4CJ1B 4BBSG 4X3UA 4YWMA 1VQFA 3I56A 2ASBA 4K0KQ 4JI2Q 1OXUA 1R4QB 4X64L 2XIWA 2WAQB 1F2ZA 1NE3A 2AUJD 3FHWA 4IN3A 4DV4L 5DEHA 3DXJC 3VR5A 4PQXA 1LTID 3GO5A 4CBVA 3JAML 2EJMA 4OXPA 1EY0A 3Q0AA 2UXBL 1NAPA 1CK1A 1FVIA 4OL7A 2V4DA 3MFYA 1TWFH 3PUXA 2F0EA 4ULLA 1HTPA 2O5IC 3HOWG 3MTSA 5FLXc 2CH4W 5A2QL 3BVZA 2CCZA 2E74C 1ESRA 4BY7B 2RF4A 4PZ8A 5FO7B 2GVAA 5IIFA 3J7ZC 1K28A 1PRTD 2LKVA 3RMHA 1JR0D 3HOZG 2IPKD 1I94L 3GTKH 1SNMA 4RHSA 4JBKA 3AFPA 1ICWA 5C0XG 3I4NB 4B3TQ 2WIIB 1QE6A 4HCEA 1AZQA 3Q23A 3C1FA 4ODGA 4K8JA 2UUBL 4FF4A 2IL8A 1B9MA 5FJ8H 3RZOH 1UNSA 3S2DB 3PSIA 5M5XB 1LO5D 1I6VC 1HHVA 2E5LQ 1F2LA 4DV5L 1UE7A 4ILWA 3R2IA 1PYBA 4H0LC 1JOOA 2NZ1D 4O42A 3FP9A 3VR4A 2K5DA 5LL6S 2EYPA 1U5KA 3K57A 1ZXTA 5LMNQ 2F03A 4Y52H 4A93G 4NPSA 3STBC 5KGUA 5IWAQ 3M7GA 4EX5A 3K5MA 3J7A5 3FMCA 1S4ZA 3V05A 2R93H 2IX0A 2F0PA 2E2JB 4KMUC 5E1FA 4DN4M 3H94A 3S2HH 4OIJA 1OXSC 5I6WA 5J22A 2SOBA 1HNZL 5CV4A 2OCEA 4LF5Q 4QJFA 5CR3A 3VDYA 1FNUA 5IGDA 2VQFQ 4WORA 4OELB 2QILA 4FXKC 4ABNA 4IUUA 2H4OA 1LT5D 2EY5A 3MEHA 2LS01 4CDEC 2VQEL 1R9TB 4DR1L 1D1KA 3VR3A 4AH6A 3OMGA 1H9RA 3CQZH 2ZM6Q 5FO9B 4LF7L 3P7JA 1BCPC 4A3IB 4A3BH 2IHEA 5C44G 5EBDA 1QG7A 4NXNL 4Y7NH 3Q6SA 3MAQA 1VS0A 4HJ7A 3W1GA 3A5ZB 1SNCA 4BBRG 2MO0A 3CMEA 4JI7L 3OYYA 4GN5A 2K04A 1SE4A 2A19A 1KIXA 1UEAB 1J6QA 2D5DA 4ZQ3A 3I90A 4BY7H 3S16B 5ELNA 4LF6L 1X3FA 1WTQA 2F4VL 4DR2L 1SEBD 1WTOA 2PZWA 2CW0C 2KCMA 4WFN3 1WCMG 4JI0Q 1NR2A 3W2DA 1N9WA 1PTOC 1TS2A 3SEBA 4DK1A 3HS0C 2YTYA 4RCNA 4DV1Q 1EIFA 1Q86C 2KCCA 3M4OB 1YNJD 5C3EG 1YI2A 3SK4A 1JORA 2B63B 3HOUB 4HEDA 1SNDA 4C3JB 2B2YA 4G4KA 5FLMG 1SFOH 4XQQA 4YY3Q 2JA5G 1ZYRC 3ONAB 2HHHL 3L7ZC 1MHWC 4YIJA 1A3TA 1VQKA 2V1CC 4JI1Q 1WD0A 1K83H 1KLGD 3PV0A 2F3VA 4GLXA 4V190 4AYBE 5D3DA 3QB3A 1KLUD 3F2UA 1BDOA 1NMFA 1G291 3HZXA 3I72A 4OWWB 1LTGD 4JOIC 1SYBA 3PO2G 3CC7A 1DD2A 4JCVE 1Y1WG 1C7YA 4ME5A 3TSSA 2IX1A 1PFMA 1BBWA 4FVMA 1PYSB 3H0GG 1A2TA 5FKAC 1N36Q 2N78A 4X62L 5C0XJ 4YWLA 1CQVA 1TY0A 1CT1D 5IP9G 4GZYC 3GTMB 4PMBA 5LHY1 4B3MQ 1EY8A 3TP5A 5C4JH 4DAPA 3I73A 3HOYB 4ZRZA 4X66L 4I7ZC 4GKKL 2D0OA 4O1NA 3PIOA 5LMNW 3FPPA 1R9TH 1G8ZD 2EJFC 4J8QA 2C5CA 5GROA 4LFBL 4L5QA 3CW2C 5C3WA 1I50B 3JAME 1CFMA 1JOQA 1WOCA 1I6HH 1CTMA 3CC4A 1X3EA 4DR7L 4CHTB 2IX3A 1NSNS 2DUDA 2Z6KA 4XXEA 3ULLA 5I2YA 5A2QE 4X3SA 4OWXB 3T1YL 4OEMB 5EKIA 5JJLA 4JBWA 1PTOH 2VUMB 1X3PA 3J80c 4UPAA 1BUVT 2VNUD 1QOHA 4RGNA 2L5TA 4QUCA 3A55A 4KJNA 4POFA 5IYBH 4KHPL 3I55A 3EBEA 2WB1B 2F0GA 2K05A 3TP8A 2R3ZA 1IXRA 4RGMA 2YU9B 1T5EA 4A3DH 1EY4A 3GTJH 3IAYA 2NZHA 1Q3LA 4JYAL 4KKTA 3M4OH 5I9PA 5I9OA
chains in the Genus database with same CATH topology
2R7FA 4YY3L 5H1SE 4YHHQ 1SR3A 4PZ7A 1IBKL 5LMUL 1X3GA 4IFDI 3I4OA 4IFDJ 3JAMc 3L0OA 2EIFA 2JQOA 2ALYB 1SN8A 1A63A 4JI5Q 1Q1EA 1VQAA 1VQPA 4R4OA 1IBLQ 1XNRQ 2AKWB 1B8AA 1IZ6A 3SGIA 4DK3C 3KF8B 5E7NA 4LFAL 3DLLA 2JK8A 2K52A 3I4NH 1TWGH 1Z47A 1HJPA 2ATWA 3E9IA 1Q81C 2UUCQ 4GNXC 3HFZB 3G4SA 1YEZA 4JI8Q 3S1NH 4X6AH 1MJCA 4MNOA 2VUMG 1N32Q 4R1JA 2BA1A 4DV2Q 3PUZA 3HOXH 1PH9A 3S1MH 3KDFB 1YITA 3CCVA 4LF9L 1HR0Q 1CKNA 3UDFA 3D31A 3S17H 3S2DH 1N36L 1PH5A 1DGSA 5M5XH 4UP8A 3U4VA 2JA7G 3M4PA 3PGZA 4XTCS 2OQKA 2WB1G 1K0RA 2NZOA 4DV3L 4HIKA 4B3ML 1FJGQ 1XPRA 2R93G 5M5YH 3RLOA 1PA6A 4ALPA 2JA8H 4IJHA 4GOPB 3L2PA 1OXTA 1GM5A 1PH3A 4DR4L 5C44H 2JEAI 3CCRA 1EIYB 4NXML 1LYLA 2PI2E 4J15A 4JI7Q 4B3SL 2A8VA 1K8GA 1RIPA 4IPHA 1TXYA 4A3FG 2BA0A 2MQHA 3CCMA 4JV5Q 2VZAA 2IHFA 4AQYL 4JI3Q 2K5VA 3AYHB 4PZ6A 2E2JH 1XMOL 2UUAL 4WJ3M 2NVTH 4P72A 2B3GA 1YHBA 2AWOA 1KD1C 3S1QH 3CAMA 5IP7G 4LF6Q 4A3JG 1VQ8A 2PQAB 3G71A 1PH6A 2OTLA 4DR2Q 4YCWA 1D8LA 4LUZA 3DM3A 1KAWA 4L5TA 3Q8DA 4PG3A 5M3MG 2VQFL 4X65Q 5GAEC 1XMQQ 4A76A 1TWHH 1I50H 1V9PA 3CD6A 2Q2IA 2PNHA 3BU2A 3ER0A 2I0QA 1NJIC 1YJ9A 3STBD 3KDFA 4DV7L 3CCJA 4A3BG 2OQ0A 1RL2A 2RCNA 4QGUA 1LM0A 1P16A 4OWTB 3CPWA 2Z6KC 1WCMH 1XPOA 3OTOL 3HOUG 3S14H 3TS0A 2KHIA 1V43A 2K75A 2CWAA 1QVCA 1YHQA 1J5EL 4A3LG 4DUZQ 5JEAG 1W2BA 2CKZB 4GOPA 4AIMA 1I3QH 2AMCB 3KLWA 2ZJPA 4LF8Q 2ZJRA 1EYGA 1I94Q 4DR6L 4A3IH 3CC2A 1E22A 2CFMA 3PF5A 5FLMH 3CXCA 1UEBA 3EN2A 4HIOA 4H02A 1YVCA 2L15A 3KF6B 5C4XH 1YIJA 2JA5H 2JA7H 3KFUA 1OXXK 4R4CA 1X54A 4TVAB 3PUYA 1HNWL 3U50C 2YU9H 3WWVA 1MIUA 2LSSA 4IPDA 4DUYL 2UUBQ 2WP8J 4IPCA 3KJOA 1EWIA 3HKZG 3RN5A 2Q2TA 4B3RQ 4BA2I 2E8GA 2PQAA 4OONA 2UXDQ 3LGJA 3T1HQ 1XPUA 4EQ5A 2HIXA 4P74A 1LUZA 4IPGA 1YHAA 1X6OA 2WFWA 1S40A 4A3FH 4JI5L 1Q82C 3PO2H 1U0LA 3ERSX 4FDBA 1YJNA 1IBLL 1IBMQ 1XNRL 3S16H 1YBYA 1Y1WH 2HIVA 1H95A 2GVBA 5GQOA 1N34Q 3H3VI 3UE1A 4DR3Q 3K8AA 2NVXH 1UE1A 5IP7H 4IO9A 4IOCA 2PI2A 5AJ3Q 2UXCQ 1VQNA 4DKAC 4UP7A 4DV1L 2IY5B 1FGUA 4LF4Q 4DV0Q 2WAQE 3I4MH 3E9HA 2EQSA 3F8TA 4L5SA 3J81i 1T9HA 1EFWA 2EXDA 1N32L 1VQ4A 5IT9c 1N33Q 3NEMA 3PO3G 3K81C 4KI0A 1I5FA 3W5OA 1D7QA 4OO1G 3KOJA 3G6EA 2JE6I 1VQGA 1QZHA 4KHZA 1YNXA 4POGA 2B63H 3KF6A 3HOUH 4C3IH 4C3JH 1HNZQ 4QY7A 2JA9A 4JI1L 4BA1I 3PUVA 4P73A 1FJGL 4LFBQ 2MNAA 1EQRA 2BH8A 2ID0A 3I2ZA 1KXLA 3M4QA 1SROA 1GO3E 4A3LH 2JA6G 1K3RA 1LTLA 1XJVA 2UU9Q 1VQ9A 5FJ8G 1TWAH 2ZJQA 4DAMA 2R7ZG 4LUVA 1G51A 2XGTA 3NBHB 2R92H 4BBSG 4YWMA 4O0AA 1VQFA 3I56A 1VQ7A 2Y0SE 1K73C 2ASBA 4K0KQ 4JI2Q 1OXUA 4JV5L 4X64L 4A75A 1JT8A 2VS1A 3H3VH 4JI3L 2VQEQ 1NE3A 4DR1Q 1Y1VH 3FHWA 1EQQA 4DV4L 3CPFA 2N3SA 3TS2A 3PUWA 3AFQA 3K7UC 2AHOB 2ZTDA 3GO5A 4GLVB 4LF7Q 4OXPA 3CCEA 2UXBL 3RR5A 1NMGA 4NXNQ 5IY0A 3FKIH 1ASYA 4KHPQ 1FVIA 1HZ9A 1W3SA 2C35B 3GDEA 1OTCA 1TWFH 1HR0W 3PUXA 5M5WH 3HOWG 3GTMH 5J3BA 5IE8A 5FLXc 3J81j 2R7DA 1FL0A 1NTGA 2CCZA 3HOYH 3UE0A 1Y14B 2KCTA 1KC8C 1VQHA 4KLKA 3ULPA 4BY1H 4LW1A 2RF4A 4PZ8A 2YTVA 4A3MH 2GVAA 3J7ZC 3GTOH 3U4ZA 4DUZL 2K5NA 2K14A 3IRBA 2RHQB 4A3CG 3HOZG 4LF8L 1HZBA 4DPGA 1M1KC 5IYCH 4GOPC 1I94L 3GTKH 4JBKA 4QQBX 2F4VQ 3AFPA 5C0XG 2NN6G 4C3HH 4JG2A 4B3TQ 1VQCA 3ZJYC 4JBJA 1YJWA 1KQSA 1M90C 2PMZE 1CUKA 3GD7A 1HNXQ 2NVQH 3J81c 2I5HA 4HJ8A 4HJ9A 3F2CA 1E3PA 2ZTEA 2WAQG 2UUBL 3AEVA 4B3RL 5HY6A 3TQYA 4DV6Q 1JJCB 2QA4A 4P75A 5FJ8H 3CCSA 1GKHA 2YV5A 3U58A 3RZOH 1UE6A 2UXDL 3T1HL 2R7ZH 1SLJA 1NBWA 3PSIA 1QVGA 4BBSH 2DGYA 1X55A 4LWCA 2E5LQ 4MTNA 2VY3A 4DV5L 4OX9Q 1UE7A 4A3GG 1OXVA 1PYBA 1MJEA 2HHHQ 4A3DG 4QIWE 2XTIA 3UDGA 3FP9A 4HIMA 4DR3L 2VUMH 1NY4A 3UDXA 5IYDG 1PH8A 5GAHC 1U5KA 1WJJA 5AJ3L 5LMNQ 2UXCL 4Y52H 4A93G 4NPSA 3STBC 4GN3B 3A0JA 5IWAQ 1AE3A 4DV0L 4EX5A 4LF4L 3J7A5 2I5LX 3F1ZA 4DR5L 4NXMQ 4BY7G 2H5XA 4GN4B 4JOIA 2R93H 2IX0A 1N33L 3ULJA 2K4KA 1X56A 1B70B 1QVFA 2GN5A 4LNQA 4ME3A 4YWKA 3S2HH 5K36G 4YHHL 5JEAJ 4GS3A 1OXSC 3NENA 1HNZL 1L1OB 1BVSA 1L0WA 2OCEA 3I4NG 4LF5Q 4QJFA 4JI6Q 3PF4A 2LXKA 5GADC 3VDYA 2UU9L 4X62Q 3MEFA 2VQFQ 1K8AC 4A3CH 4JI4Q 1HZCA 5ELOA 3HOZH 3A74A 5HGQA 3GTGH 2I5MX 4A3JH 4GKJQ 4UY8C 2E2IH 4K0KL 1K9MC 2UUCL 5M3MH 4JI2L 4X66Q 3GTPH 4DV7Q 2NVYH 4JI8L 4GKKQ 2VQEL 4DR1L 4HJ5A 4AH6A 1X9NA 4R4TA 4DV2L 3CQZH 2YYZA 2ZM6Q 3S1RH 1HR0L 4LF7L 2JA8G 3TRZA 1YZ6A 4A3BH 1VQEA 3PIPA 4PMWA 3RNUA 1PV4A 1PHJA 4BXXG 4IFDG 2IHEA 1XTDA 4YCVA 5C44G 1WFQA 1S72A 2B29A 4NXNL 5M3FG 4Y7NH 2KENA 2D0PA 1UWVA 3KJPA 4A3GH 1VS0A 4HJ7A 3AQQA 3A5ZB 3K80C 3W1GA 4BBRG 1VQ5A 2MO0A 2N49A 4TQUS 1XNQQ 1SMXA 3CMEA 3W1BA 4DR7Q 4JI7L 3CMAA 2F3IA 3OYYA 1HNWQ 1C0AA 4GN5A 1KIXA 2A19A 1GD7A 2YTXA 1J6QA 2KHJA 5EAYA 5BR8Q 3OW2A 4A93H 1L1OA 4KHPL 3RLNA 4LFCQ 3RN2A 3HOVG 4OO1I 4DNIA 4GNXB 4BY7H 3T1YQ 4JBMA 5ELNA 4LF6L 1X3FA 2CWPA 2F4VL 4JC0A 4DR2L 3CCUA 3HKSA 4RG1A 4B3TL 1E7ZA 1KRSA 1HZAA 4YCUA 2KCMA 4X65L 1HNXL 4A3EG 1XMQL 1WCMG 4JI0Q 1CKOA 1AE2A 1VQJA 1N9WA 2KBNA 2K50A 2YTYA 4DV1Q 3KYHC 1EIFA 4LUOA 4DV6L 1Q86C 4IOAA 3I7FA 5JJIA 4MZ9A 4A4IA 2ES2A 3BJUA 3HKZE 1JE5A 5C3EG 1YI2A 4A3KG 1E1TA 4JYAQ 2E5LL 1UE5A 1MKHA 4A3IG 1CSQA 1A8VA 4O2DA 3CCQA 4OX9L 1S3OA 5FLMG 1SFOH 1EUJA 3UDIA 4YY3Q 2A1AA 2JA5G 5C4XG 2HHHL 1IBKQ 1A62A 3L7ZC 3H15A 3RLFA 3F2BA 1QUQB 5LMUQ 1VQMA 1VQKA 2V1CC 4JI1Q 3J80i 2JJQA 5DLQE 3S15H 3PO3H 1K83H 5LMNL 2OTJA 3PV0A 1N8RC 1IYJB 1KHIA 4BXXH 4GLXA 2MO1A 3D0FA 1Q7YC 5IWAL 1PH7A 1JMCA 4AYBE 1HH2P 3K0XA 4LFAQ 4NB3A 4IJLA 5M3FH 1IL2A 1NMFA 1G291 4GNXA 1SRUA 4OWWB 2JEBI 4JOIC 1PVOA 3PO2G 2JA6H 3CC7A 4X64Q 3RZDH 4JCVE 1PH2A 4BBRH 1Y1WG 1C7YA 4DV4Q 1G6PA 2IT1A 5IYBG 2CQOA 2IX1A 1BBWA 2N8NA 3B6YA 4LF5L 1PYSB 3H0GG 4LF9Q 4WJ4A 4JI6L 1IBML 1N36Q 2N78A 5C0XI 1E1OA 2NN6I 4X62L 5C0XJ 4YWLA 3HOVH 5IP9G 2LXJA 4DV3Q 1N34L 4JI4L 4B3MQ 3I4MG 3JAMi 2UXBQ 3M3YH 3K7AH 5C4JH 1VQBA 2FXQA 3TEHB 1KL9A 1Q46A 3ICEA 4GKJL 3S24A 1E24A 4R4IA 4X66L 2OWOA 1A0IA 4DR4Q 1VQDA 1Q1BA 2Q2UA 4GKKL 1VQ6A 4A3EH 2B63G 2Y0SG 1JB7A 2D0OA 4B3SQ 2MFIA 2Z0SA 3PIOA 5LMNW 1QUQA 3EIVA 2QEXA 4RMFA 2ZM6L 3HOWH 1JJGA 1R9TH 4AQYQ 3GTQH 1X65A 1XMOQ 2UUAQ 5C3EH 5JJKA 2E2HH 5GAGC 4A3KH 5GROA 2AWNA 4LFBL 2R92G 4L5QA 2WB1E 2VW9A 3CW2C 1PFSA 4UP9A 1CSPA 1L2FA 1WOCA 3CF5A 1EOVA 1QZGA 1I6HH 3CC4A 1XNQL 2QGQA 3M9BA 4DAYB 1TWCH 1Y1VG 1X3EA 4HIDA 1VCIA 4DR7L 3GTLH 1SE8A 1BKBA 3HOXG 2R6GA 4R4QA 1VQOA 1CKMA 1KRTA 5BR8L 2DUDA 1V1QA 3MXNB 3NELA 2HQLA 3BZCA 2Z6KA 2HT1A 4LFCL 3ULLA 4L5RC 4APVA 2D62A 1L1OC 1C9OA 4OWXB 3PCOB 3OTOQ 3T1YL 3FKIG 1WYDA 5JJLA 3E0EA 4JBWA 2VL6A 4DV5Q 1PH4A 1JJ2A 3J80c 1J5EQ 2BH2A 3A5UA 1BBUA 2K5HA 4UPAA 2VNUD 1VQIA 1Z9FA 1GVPA 3M85A 2RHSB 4GLAC 4HJAA 3HOYG 3JC66 2ZTCA 4POFA 5IYBH 4JI0L 3I55A 1CKNB 1O7IA 1B7YB 3EBEA 3G48A 4P71A 4BY1G 3TREA 1ASZA 4DR6Q 1IXRA 3H0GH 2Q2HA 3BZKA 4A3MG 4C2MH 4AYBG 3M7NA 4DK6C 4A3DH 1P8LA 5IP9H 1AH9A 1WI5A 4DR5Q 3GTJH 4QL5A 5IYDH 2F52A 2NZHA 1VQLA 3CP0A 4XIGS 5IYCG 4DUYQ 3CCLA 4JYAL 1Q8KA 1Q12A 3F2DA 3M4OH 1PH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7F A;  4YY3 L;  5H1S E;  4YHH Q;  1SR3 A;  4PZ7 A;  1IBK L;  5LMU L;  1X3G A;  4IFD I;  3I4O A;  4IFD J;  3JAM c;  3L0O A;  2EIF A;  2JQO A;  2ALY B;  1SN8 A;  1A63 A;  4JI5 Q;  1Q1E A;  1VQA A;  1VQP A;  4R4O A;  1IBL Q;  1XNR Q;  2AKW B;  1B8A A;  1IZ6 A;  3SGI A;  4DK3 C;  3KF8 B;  5E7N A;  4LFA L;  3DLL A;  2JK8 A;  2K52 A;  3I4N H;  1TWG H;  1Z47 A;  1HJP A;  2ATW A;  3E9I A;  1Q81 C;  2UUC Q;  4GNX C;  3HFZ B;  3G4S A;  1YEZ A;  4JI8 Q;  3S1N H;  4X6A H;  1MJC A;  4MNO A;  2VUM G;  1N32 Q;  4R1J A;  2BA1 A;  4DV2 Q;  3PUZ A;  3HOX H;  1PH9 A;  3S1M H;  3KDF B;  1YIT A;  3CCV A;  4LF9 L;  1HR0 Q;  1CKN A;  3UDF A;  3D31 A;  3S17 H;  3S2D H;  1N36 L;  1PH5 A;  1DGS A;  5M5X H;  4UP8 A;  3U4V A;  2JA7 G;  3M4P A;  3PGZ A;  4XTC S;  2OQK A;  2WB1 G;  1K0R A;  2NZO A;  4DV3 L;  4HIK A;  4B3M L;  1FJG Q;  1XPR A;  2R93 G;  5M5Y H;  3RLO A;  1PA6 A;  4ALP A;  2JA8 H;  4IJH A;  4GOP B;  3L2P A;  1OXT A;  1GM5 A;  1PH3 A;  4DR4 L;  5C44 H;  2JEA I;  3CCR A;  1EIY B;  4NXM L;  1LYL A;  2PI2 E;  4J15 A;  4JI7 Q;  4B3S L;  2A8V A;  1K8G A;  1RIP A;  4IPH A;  1TXY A;  4A3F G;  2BA0 A;  2MQH A;  3CCM A;  4JV5 Q;  2VZA A;  2IHF A;  4AQY L;  4JI3 Q;  2K5V A;  3AYH B;  4PZ6 A;  2E2J H;  1XMO L;  2UUA L;  4WJ3 M;  2NVT H;  4P72 A;  2B3G A;  1YHB A;  2AWO A;  1KD1 C;  3S1Q H;  3CAM A;  5IP7 G;  4LF6 Q;  4A3J G;  1VQ8 A;  2PQA B;  3G71 A;  1PH6 A;  2OTL A;  4DR2 Q;  4YCW A;  1D8L A;  4LUZ A;  3DM3 A;  1KAW A;  4L5T A;  3Q8D A;  4PG3 A;  5M3M G;  2VQF L;  4X65 Q;  5GAE C;  1XMQ Q;  4A76 A;  1TWH H;  1I50 H;  1V9P A;  3CD6 A;  2Q2I A;  2PNH A;  3BU2 A;  3ER0 A;  2I0Q A;  1NJI C;  1YJ9 A;  3STB D;  3KDF A;  4DV7 L;  3CCJ A;  4A3B G;  2OQ0 A;  1RL2 A;  2RCN A;  4QGU A;  1LM0 A;  1P16 A;  4OWT B;  3CPW A;  2Z6K C;  1WCM H;  1XPO A;  3OTO L;  3HOU G;  3S14 H;  3TS0 A;  2KHI A;  1V43 A;  2K75 A;  2CWA A;  1QVC A;  1YHQ A;  1J5E L;  4A3L G;  4DUZ Q;  5JEA G;  1W2B A;  2CKZ B;  4GOP A;  4AIM A;  1I3Q H;  2AMC B;  3KLW A;  2ZJP A;  4LF8 Q;  2ZJR A;  1EYG A;  1I94 Q;  4DR6 L;  4A3I H;  3CC2 A;  1E22 A;  2CFM A;  3PF5 A;  5FLM H;  3CXC A;  1UEB A;  3EN2 A;  4HIO A;  4H02 A;  1YVC A;  2L15 A;  3KF6 B;  5C4X H;  1YIJ A;  2JA5 H;  2JA7 H;  3KFU A;  1OXX K;  4R4C A;  1X54 A;  4TVA B;  3PUY A;  1HNW L;  3U50 C;  2YU9 H;  3WWV A;  1MIU A;  2LSS A;  4IPD A;  4DUY L;  2UUB Q;  2WP8 J;  4IPC A;  3KJO A;  1EWI A;  3HKZ G;  3RN5 A;  2Q2T A;  4B3R Q;  4BA2 I;  2E8G A;  2PQA A;  4OON A;  2UXD Q;  3LGJ A;  3T1H Q;  1XPU A;  4EQ5 A;  2HIX A;  4P74 A;  1LUZ A;  4IPG A;  1YHA A;  1X6O A;  2WFW A;  1S40 A;  4A3F H;  4JI5 L;  1Q82 C;  3PO2 H;  1U0L A;  3ERS X;  4FDB A;  1YJN A;  1IBL L;  1IBM Q;  1XNR L;  3S16 H;  1YBY A;  1Y1W H;  2HIV A;  1H95 A;  2GVB A;  5GQO A;  1N34 Q;  3H3V I;  3UE1 A;  4DR3 Q;  3K8A A;  2NVX H;  1UE1 A;  5IP7 H;  4IO9 A;  4IOC A;  2PI2 A;  5AJ3 Q;  2UXC Q;  1VQN A;  4DKA C;  4UP7 A;  4DV1 L;  2IY5 B;  1FGU A;  4LF4 Q;  4DV0 Q;  2WAQ E;  3I4M H;  3E9H A;  2EQS A;  3F8T A;  4L5S A;  3J81 i;  1T9H A;  1EFW A;  2EXD A;  1N32 L;  1VQ4 A;  5IT9 c;  1N33 Q;  3NEM A;  3PO3 G;  3K81 C;  4KI0 A;  1I5F A;  3W5O A;  1D7Q A;  4OO1 G;  3KOJ A;  3G6E A;  2JE6 I;  1VQG A;  1QZH A;  4KHZ A;  1YNX A;  4POG A;  2B63 H;  3KF6 A;  3HOU H;  4C3I H;  4C3J H;  1HNZ Q;  4QY7 A;  2JA9 A;  4JI1 L;  4BA1 I;  3PUV A;  4P73 A;  1FJG L;  4LFB Q;  2MNA A;  1EQR A;  2BH8 A;  2ID0 A;  3I2Z A;  1KXL A;  3M4Q A;  1SRO A;  1GO3 E;  4A3L H;  2JA6 G;  1K3R A;  1LTL A;  1XJV A;  2UU9 Q;  1VQ9 A;  5FJ8 G;  1TWA H;  2ZJQ A;  4DAM A;  2R7Z G;  4LUV A;  1G51 A;  2XGT A;  3NBH B;  2R92 H;  4BBS G;  4YWM A;  4O0A A;  1VQF A;  3I56 A;  1VQ7 A;  2Y0S E;  1K73 C;  2ASB A;  4K0K Q;  4JI2 Q;  1OXU A;  4JV5 L;  4X64 L;  4A75 A;  1JT8 A;  2VS1 A;  3H3V H;  4JI3 L;  2VQE Q;  1NE3 A;  4DR1 Q;  1Y1V H;  3FHW A;  1EQQ A;  4DV4 L;  3CPF A;  2N3S A;  3TS2 A;  3PUW A;  3AFQ A;  3K7U C;  2AHO B;  2ZTD A;  3GO5 A;  4GLV B;  4LF7 Q;  4OXP A;  3CCE A;  2UXB L;  3RR5 A;  1NMG A;  4NXN Q;  5IY0 A;  3FKI H;  1ASY A;  4KHP Q;  1FVI A;  1HZ9 A;  1W3S A;  2C35 B;  3GDE A;  1OTC A;  1TWF H;  1HR0 W;  3PUX A;  5M5W H;  3HOW G;  3GTM H;  5J3B A;  5IE8 A;  5FLX c;  3J81 j;  2R7D A;  1FL0 A;  1NTG A;  2CCZ A;  3HOY H;  3UE0 A;  1Y14 B;  2KCT A;  1KC8 C;  1VQH A;  4KLK A;  3ULP A;  4BY1 H;  4LW1 A;  2RF4 A;  4PZ8 A;  2YTV A;  4A3M H;  2GVA A;  3J7Z C;  3GTO H;  3U4Z A;  4DUZ L;  2K5N A;  2K14 A;  3IRB A;  2RHQ B;  4A3C G;  3HOZ G;  4LF8 L;  1HZB A;  4DPG A;  1M1K C;  5IYC H;  4GOP C;  1I94 L;  3GTK H;  4JBK A;  4QQB X;  2F4V Q;  3AFP A;  5C0X G;  2NN6 G;  4C3H H;  4JG2 A;  4B3T Q;  1VQC A;  3ZJY C;  4JBJ A;  1YJW A;  1KQS A;  1M90 C;  2PMZ E;  1CUK A;  3GD7 A;  1HNX Q;  2NVQ H;  3J81 c;  2I5H A;  4HJ8 A;  4HJ9 A;  3F2C A;  1E3P A;  2ZTE A;  2WAQ G;  2UUB L;  3AEV A;  4B3R L;  5HY6 A;  3TQY A;  4DV6 Q;  1JJC B;  2QA4 A;  4P75 A;  5FJ8 H;  3CCS A;  1GKH A;  2YV5 A;  3U58 A;  3RZO H;  1UE6 A;  2UXD L;  3T1H L;  2R7Z H;  1SLJ A;  1NBW A;  3PSI A;  1QVG A;  4BBS H;  2DGY A;  1X55 A;  4LWC A;  2E5L Q;  4MTN A;  2VY3 A;  4DV5 L;  4OX9 Q;  1UE7 A;  4A3G G;  1OXV A;  1PYB A;  1MJE A;  2HHH Q;  4A3D G;  4QIW E;  2XTI A;  3UDG A;  3FP9 A;  4HIM A;  4DR3 L;  2VUM H;  1NY4 A;  3UDX A;  5IYD G;  1PH8 A;  5GAH C;  1U5K A;  1WJJ A;  5AJ3 L;  5LMN Q;  2UXC L;  4Y52 H;  4A93 G;  4NPS A;  3STB C;  4GN3 B;  3A0J A;  5IWA Q;  1AE3 A;  4DV0 L;  4EX5 A;  4LF4 L;  3J7A 5;  2I5L X;  3F1Z A;  4DR5 L;  4NXM Q;  4BY7 G;  2H5X A;  4GN4 B;  4JOI A;  2R93 H;  2IX0 A;  1N33 L;  3ULJ A;  2K4K A;  1X56 A;  1B70 B;  1QVF A;  2GN5 A;  4LNQ A;  4ME3 A;  4YWK A;  3S2H H;  5K36 G;  4YHH L;  5JEA J;  4GS3 A;  1OXS C;  3NEN A;  1HNZ L;  1L1O B;  1BVS A;  1L0W A;  2OCE A;  3I4N G;  4LF5 Q;  4QJF A;  4JI6 Q;  3PF4 A;  2LXK A;  5GAD C;  3VDY A;  2UU9 L;  4X62 Q;  3MEF A;  2VQF Q;  1K8A C;  4A3C H;  4JI4 Q;  1HZC A;  5ELO A;  3HOZ H;  3A74 A;  5HGQ A;  3GTG H;  2I5M X;  4A3J H;  4GKJ Q;  4UY8 C;  2E2I H;  4K0K L;  1K9M C;  2UUC L;  5M3M H;  4JI2 L;  4X66 Q;  3GTP H;  4DV7 Q;  2NVY H;  4JI8 L;  4GKK Q;  2VQE L;  4DR1 L;  4HJ5 A;  4AH6 A;  1X9N A;  4R4T A;  4DV2 L;  3CQZ H;  2YYZ A;  2ZM6 Q;  3S1R H;  1HR0 L;  4LF7 L;  2JA8 G;  3TRZ A;  1YZ6 A;  4A3B H;  1VQE A;  3PIP A;  4PMW A;  3RNU A;  1PV4 A;  1PHJ A;  4BXX G;  4IFD G;  2IHE A;  1XTD A;  4YCV A;  5C44 G;  1WFQ A;  1S72 A;  2B29 A;  4NXN L;  5M3F G;  4Y7N H;  2KEN A;  2D0P A;  1UWV A;  3KJP A;  4A3G H;  1VS0 A;  4HJ7 A;  3AQQ A;  3A5Z B;  3K80 C;  3W1G A;  4BBR G;  1VQ5 A;  2MO0 A;  2N49 A;  4TQU S;  1XNQ Q;  1SMX A;  3CME A;  3W1B A;  4DR7 Q;  4JI7 L;  3CMA A;  2F3I A;  3OYY A;  1HNW Q;  1C0A A;  4GN5 A;  1KIX A;  2A19 A;  1GD7 A;  2YTX A;  1J6Q A;  2KHJ A;  5EAY A;  5BR8 Q;  3OW2 A;  4A93 H;  1L1O A;  4KHP L;  3RLN A;  4LFC Q;  3RN2 A;  3HOV G;  4OO1 I;  4DNI A;  4GNX B;  4BY7 H;  3T1Y Q;  4JBM A;  5ELN A;  4LF6 L;  1X3F A;  2CWP A;  2F4V L;  4JC0 A;  4DR2 L;  3CCU A;  3HKS A;  4RG1 A;  4B3T L;  1E7Z A;  1KRS A;  1HZA A;  4YCU A;  2KCM A;  4X65 L;  1HNX L;  4A3E G;  1XMQ L;  1WCM G;  4JI0 Q;  1CKO A;  1AE2 A;  1VQJ A;  1N9W A;  2KBN A;  2K50 A;  2YTY A;  4DV1 Q;  3KYH C;  1EIF A;  4LUO A;  4DV6 L;  1Q86 C;  4IOA A;  3I7F A;  5JJI A;  4MZ9 A;  4A4I A;  2ES2 A;  3BJU A;  3HKZ E;  1JE5 A;  5C3E G;  1YI2 A;  4A3K G;  1E1T A;  4JYA Q;  2E5L L;  1UE5 A;  1MKH A;  4A3I G;  1CSQ A;  1A8V A;  4O2D A;  3CCQ A;  4OX9 L;  1S3O A;  5FLM G;  1SFO H;  1EUJ A;  3UDI A;  4YY3 Q;  2A1A A;  2JA5 G;  5C4X G;  2HHH L;  1IBK Q;  1A62 A;  3L7Z C;  3H15 A;  3RLF A;  3F2B A;  1QUQ B;  5LMU Q;  1VQM A;  1VQK A;  2V1C C;  4JI1 Q;  3J80 i;  2JJQ A;  5DLQ E;  3S15 H;  3PO3 H;  1K83 H;  5LMN L;  2OTJ A;  3PV0 A;  1N8R C;  1IYJ B;  1KHI A;  4BXX H;  4GLX A;  2MO1 A;  3D0F A;  1Q7Y C;  5IWA L;  1PH7 A;  1JMC A;  4AYB E;  1HH2 P;  3K0X A;  4LFA Q;  4NB3 A;  4IJL A;  5M3F H;  1IL2 A;  1NMF A;  1G29 1;  4GNX A;  1SRU A;  4OWW B;  2JEB I;  4JOI C;  1PVO A;  3PO2 G;  2JA6 H;  3CC7 A;  4X64 Q;  3RZD H;  4JCV E;  1PH2 A;  4BBR H;  1Y1W G;  1C7Y A;  4DV4 Q;  1G6P A;  2IT1 A;  5IYB G;  2CQO A;  2IX1 A;  1BBW A;  2N8N A;  3B6Y A;  4LF5 L;  1PYS B;  3H0G G;  4LF9 Q;  4WJ4 A;  4JI6 L;  1IBM L;  1N36 Q;  2N78 A;  5C0X I;  1E1O A;  2NN6 I;  4X62 L;  5C0X J;  4YWL A;  3HOV H;  5IP9 G;  2LXJ A;  4DV3 Q;  1N34 L;  4JI4 L;  4B3M Q;  3I4M G;  3JAM i;  2UXB Q;  3M3Y H;  3K7A H;  5C4J H;  1VQB A;  2FXQ A;  3TEH B;  1KL9 A;  1Q46 A;  3ICE A;  4GKJ L;  3S24 A;  1E24 A;  4R4I A;  4X66 L;  2OWO A;  1A0I A;  4DR4 Q;  1VQD A;  1Q1B A;  2Q2U A;  4GKK L;  1VQ6 A;  4A3E H;  2B63 G;  2Y0S G;  1JB7 A;  2D0O A;  4B3S Q;  2MFI A;  2Z0S A;  3PIO A;  5LMN W;  1QUQ A;  3EIV A;  2QEX A;  4RMF A;  2ZM6 L;  3HOW H;  1JJG A;  1R9T H;  4AQY Q;  3GTQ H;  1X65 A;  1XMO Q;  2UUA Q;  5C3E H;  5JJK A;  2E2H H;  5GAG C;  4A3K H;  5GRO A;  2AWN A;  4LFB L;  2R92 G;  4L5Q A;  2WB1 E;  2VW9 A;  3CW2 C;  1PFS A;  4UP9 A;  1CSP A;  1L2F A;  1WOC A;  3CF5 A;  1EOV A;  1QZG A;  1I6H H;  3CC4 A;  1XNQ L;  2QGQ A;  3M9B A;  4DAY B;  1TWC H;  1Y1V G;  1X3E A;  4HID A;  1VCI A;  4DR7 L;  3GTL H;  1SE8 A;  1BKB A;  3HOX G;  2R6G A;  4R4Q A;  1VQO A;  1CKM A;  1KRT A;  5BR8 L;  2DUD A;  1V1Q A;  3MXN B;  3NEL A;  2HQL A;  3BZC A;  2Z6K A;  2HT1 A;  4LFC L;  3ULL A;  4L5R C;  4APV A;  2D62 A;  1L1O C;  1C9O A;  4OWX B;  3PCO B;  3OTO Q;  3T1Y L;  3FKI G;  1WYD A;  5JJL A;  3E0E A;  4JBW A;  2VL6 A;  4DV5 Q;  1PH4 A;  1JJ2 A;  3J80 c;  1J5E Q;  2BH2 A;  3A5U A;  1BBU A;  2K5H A;  4UPA A;  2VNU D;  1VQI A;  1Z9F A;  1GVP A;  3M85 A;  2RHS B;  4GLA C;  4HJA A;  3HOY G;  3JC6 6;  2ZTC A;  4POF A;  5IYB H;  4JI0 L;  3I55 A;  1CKN B;  1O7I A;  1B7Y B;  3EBE A;  3G48 A;  4P71 A;  4BY1 G;  3TRE A;  1ASZ A;  4DR6 Q;  1IXR A;  3H0G H;  2Q2H A;  3BZK A;  4A3M G;  4C2M H;  4AYB G;  3M7N A;  4DK6 C;  4A3D H;  1P8L A;  5IP9 H;  1AH9 A;  1WI5 A;  4DR5 Q;  3GTJ H;  4QL5 A;  5IYD H;  2F52 A;  2NZH A;  1VQL A;  3CP0 A;  4XIG S;  5IYC G;  4DUY Q;  3CCL A;  4JYA L;  1Q8K A;  1Q12 A;  3F2D A;  3M4O H;  1PH1 A; 
#chains in the Genus database with same CATH topology
 1DXM A;  5H1S E;  5LMU L;  3CU7 A;  4IFD I;  3I4O A;  1V8Q A;  3JAM c;  3L0O A;  4KTA A;  1SN8 A;  1A63 A;  3SR1 A;  1VQA A;  3EJI A;  1VQP A;  4R4O A;  4ZAI A;  4PMC A;  2AKW B;  5KEE A;  1AEX A;  4DK3 C;  3ITP A;  2K52 A;  2B2W A;  5ISR A;  1HJP A;  3VYU A;  2ATW A;  4RWS C;  1Q81 C;  1ICF B;  3G4S A;  1YEZ A;  2A69 D;  1AZP A;  3HOX H;  1YIT A;  1HR0 Q;  4TRD A;  1PH5 A;  3HEJ A;  3U4V A;  3M4P A;  3PGZ A;  2OQK A;  1LAC A;  4CKE A;  2R93 G;  4IUP A;  2JA8 H;  5JOB A;  1T5X D;  1V1O A;  4GOP B;  3L2P A;  1OXT A;  4A93 B;  4K6D A;  2JEA I;  3C1E A;  2PI2 E;  2A8V A;  4TKO B;  1Y8O B;  1TXY A;  4A3F G;  2F3W A;  1PRT C;  5CV8 A;  2UUA L;  2NVT H;  2MUY A;  1YHB A;  1KD1 C;  1QB5 D;  4M8A A;  2PW7 A;  1SYD A;  3G71 A;  4YCW A;  3FDT A;  4LUZ A;  3R93 A;  2AUK A;  4X65 Q;  2HCI A;  3WOF A;  2KQ3 A;  1I50 H;  2M9V A;  1V9P A;  3ER0 A;  2PNH A;  4HMJ A;  1NJI C;  3STB D;  1WTW A;  4A3B G;  3CCJ A;  2RDF A;  3S14 H;  4DF7 A;  1U4M A;  2B8F A;  2K75 A;  4RGT A;  3PO3 B;  3M4Y A;  2CKZ B;  4GOP A;  4DXF A;  3S9W A;  3KLW A;  2ZJR A;  3LX0 A;  1EYG A;  4DR6 L;  1E22 A;  2PQE A;  3CXC A;  1TS4 A;  3OWF A;  4ID6 A;  1O7L A;  3LWE A;  3N6R A;  3L3O C;  1OXX K;  5G3L F;  1UUP A;  1X54 A;  4BBR B;  2YU9 H;  2LSS A;  4DUY L;  4B9X A;  3AB9 A;  4B3R Q;  4IPC A;  3R3O A;  1U4L A;  2FIN B;  1BOS A;  3AMU A;  2UXD Q;  3LGJ A;  1SDF A;  4P74 A;  4IPG A;  3VYS A;  1X6O A;  2XRS D;  1Q82 C;  1DCZ A;  4FDB A;  1BCP D;  1IBM Q;  1XNR L;  1AW7 A;  1JIC A;  1YBY A;  3NTK A;  3H3V I;  3UE1 A;  1RHP A;  4DR3 Q;  2NVX H;  2KOL A;  2PW5 A;  2ZT9 C;  1IYU A;  5AJ3 Q;  1SJH D;  2F0M A;  1D5Z C;  2MHV A;  4L5S A;  1T9H A;  3GTQ B;  1QWY A;  2EXD A;  3KLR A;  1ZEQ X;  4QF4 A;  5C3E B;  3GP7 A;  3NEM A;  2E75 C;  1RD9 D;  1D7Q A;  4KK7 A;  1AN8 A;  2KJX A;  1YNX A;  2K1B A;  1FJG L;  4BA1 I;  3PUV A;  2MNA A;  3I2Z A;  1GO3 E;  1XJV A;  1VQ9 A;  2CW0 D;  4J1M A;  4K8I A;  4DAM A;  2R7Z G;  1G51 A;  1A3V A;  3NBH B;  2R92 H;  4O0A A;  2XNA C;  1VQ7 A;  1DYQ A;  4JV5 L;  5F2D A;  2K03 A;  4JI3 L;  3C3L A;  3CPF A;  1H9K A;  4KD3 A;  3AFQ A;  2ZTD A;  4J6H A;  1IYV A;  1LTT D;  3CCE A;  1I4X A;  5ELF A;  1ZYR D;  3H0G B;  2L12 A;  4C2M B;  3URY A;  1NMG A;  5IY0 A;  2TMP A;  1HZ9 A;  1W3S A;  5T1G A;  1HR0 W;  5M5W H;  5A35 A;  3J81 j;  2R7D A;  2XWB B;  1NTG A;  2F0W A;  1YNJ C;  3UE0 A;  4C1N K;  1Y14 B;  2KCT A;  1VQH A;  4DXG A;  4LW1 A;  2YTV A;  5KNB A;  4A3M H;  3GTO H;  4ZCK A;  2KEE A;  4DUZ L;  4U67 3;  2EYF A;  2K5N A;  3D4W A;  3IRB A;  2RHQ B;  4A3C G;  2C9O A;  4MIU A;  4QQB X;  1W6K A;  3NBH A;  3T53 B;  4LJZ C;  4JBJ A;  1KQS A;  2PMZ E;  1CUK A;  3GD7 A;  1HNX Q;  3J81 c;  3VYR A;  2Z4H A;  4HJ8 A;  1CI3 M;  2SDF A;  2ZTE A;  5E4X A;  1FYC A;  5HY6 A;  4DV6 Q;  1JJC B;  3S17 B;  3T1H L;  1NBW A;  1SLJ A;  2G9D A;  2KCN A;  2VY3 A;  3NWS A;  4DA2 A;  1LAB A;  4A3G G;  1A3U A;  3MZ5 A;  3S15 B;  3TP6 A;  1SYE A;  5CMD A;  1Z6H A;  1CA6 A;  1HA6 A;  4A3D G;  4QIW E;  2F0L A;  3UDX A;  1KDA A;  2MP1 A;  5M3F B;  5T1I A;  2UXC L;  1KDB A;  1O78 A;  1MBY A;  2N55 A;  4IUT A;  1R4P B;  4NXM Q;  1STY A;  3V2T A;  1N33 L;  3ULJ A;  2K4K A;  1X56 A;  4QMG A;  5BN4 A;  3S1Q B;  1QVF A;  4LNQ A;  1ML0 D;  3BZD B;  1WVL A;  4YHH L;  3HOV B;  3T4A C;  1STN A;  1BVS A;  1TWH B;  4R8N A;  1B1Z A;  1XX8 A;  2LXK A;  5IOC A;  1B44 D;  4G7O C;  1K8A C;  2A6H D;  4JI4 Q;  1RCV D;  1HZC A;  3SHL A;  3D3R A;  3VA5 A;  1WTX A;  2K28 A;  2B2V C;  5HGQ A;  5DM6 3;  4A3J H;  4GKJ Q;  4UY8 C;  4RFB A;  4QCL A;  2E2I H;  4K0K L;  3GTP H;  5M3M H;  4JI2 L;  1TY2 A;  1A2U A;  3BVM A;  2NVY H;  4JI8 L;  1EEI D;  2F1M A;  1X9N A;  4R4T A;  1I3Q B;  4RGO S;  2JA8 G;  2YYZ A;  1NNX A;  4BXX G;  3J80 L;  1XTD A;  4YCV A;  1WFQ A;  5C4X B;  1KTK A;  2B29 A;  3KJP A;  4RHR A;  3VYT A;  1VF7 A;  1BO0 A;  2EVB A;  2XVS A;  3OW7 A;  1F2M A;  3K80 C;  1JWU D;  1EZ6 A;  1SMX A;  1PYW D;  1IKL A;  1K8O A;  2HDM A;  1J9O A;  2YTX A;  2KHJ A;  5BR8 Q;  1GUW A;  1STG A;  4F88 A;  4A3F B;  4LFC Q;  4DNR B;  3RN2 A;  4OO1 I;  4GNX B;  5I6Y A;  4JBM A;  1B9N A;  2CWP A;  1JC7 A;  1KAB A;  3QR8 A;  4JC0 A;  1O7Z A;  4H44 C;  4RG1 A;  4B3T L;  1E7Z A;  2DNC A;  5J1Z A;  3OSO A;  3KBX A;  4YCU A;  5BN5 A;  5K36 H;  4A3E G;  1XMQ L;  3I4M B;  1CKO A;  1Y8N B;  3HG9 A;  4LUO A;  2CHB D;  4RAU C;  1JE4 A;  4IOA A;  1CZG A;  4A4I A;  3R8B A;  3BJU A;  3TME A;  2A69 C;  4N8F A;  3OWE B;  1I4R A;  4A3K G;  2PCF B;  3TP7 A;  2E5L L;  2Y0S B;  5D3I B;  4O2D A;  4G7Z C;  1S3O A;  1IBK Q;  1QCB D;  3H15 A;  1QUQ B;  2HDL A;  1TWA B;  3S15 H;  5LMN L;  2OTJ A;  3FEW X;  1N8R C;  1KHI A;  3KK7 A;  4KHV A;  4U68 A;  5IWA L;  3Q22 A;  3K0X A;  4LFA Q;  5M3F H;  1IL2 A;  1Y1V B;  4GNX A;  1SRU A;  1PVO A;  5JAV A;  4X64 Q;  2EYH A;  4PV1 C;  3V96 A;  4DV4 Q;  1G6P A;  4ZK9 B;  1S5D D;  4LF5 L;  3FKI B;  5M5Y B;  1C48 A;  5C0X I;  3H3V C;  3HOV H;  3H6M A;  2UXB Q;  3MXU A;  1N34 L;  3M3Y H;  3VR6 A;  1SJE D;  3K7A H;  5EKL A;  1VMP A;  5COR A;  3S24 A;  4BY1 B;  1S5E D;  3PIP 3;  4G7H C;  4KY5 A;  1A0I A;  2K32 A;  4FXD A;  1VQD A;  3NQT A;  1HCZ A;  3T56 B;  4AYB B;  4UDU C;  5IOD A;  2F0V A;  1JB7 A;  4B3S Q;  2MJ8 A;  2Z0S A;  1QUQ A;  2ZM6 L;  1X65 A;  2G5D A;  4C3H B;  2R92 G;  2F0N A;  2Z9H A;  1RKN A;  5EGT A;  4ZLT F;  2F0I A;  4MN3 A;  1S5C D;  3CF5 A;  1II3 A;  1QZG A;  1FNV A;  2QGQ A;  3M9B A;  1FGB D;  4DAY B;  3G7L A;  1VCI A;  4XT3 B;  1SE8 A;  1BKB A;  1SSO A;  2NN6 H;  1KRT A;  1F9S A;  2M00 A;  3NEL A;  2FJ2 A;  2HQL A;  3BZC A;  1XYI A;  2QEJ C;  2L55 A;  1ILQ A;  3I3C A;  3PCO B;  4K6L A;  3E0E A;  2DN8 A;  2VL6 A;  4DV5 Q;  1PH4 A;  1Z9F A;  3TDQ A;  1GVP A;  2ICE C;  3K5L A;  4JI0 L;  3RUZ A;  5M9O A;  1ONL A;  2RCF A;  2Q2H A;  3BZK A;  4A3M G;  4DK6 C;  1P8L A;  2RA4 A;  1WI5 A;  1PZJ D;  4KN7 C;  5IYD H;  3CP0 A;  4XIG S;  5E3F A;  3CCL A;  4LK1 C;  5CBA E;  1PH1 A;  4YY3 L;  1RJT A;  2B2Y C;  4PZ7 A;  4CDF C;  1NR4 A;  2X6L A;  2EYJ A;  4QB4 A;  4DAY A;  2ALY B;  4JI5 Q;  3C46 A;  1Q1E A;  3A8K E;  2HD3 A;  3GTG B;  1IBL Q;  1EIG A;  1B8A A;  3ND9 A;  4RKB A;  3FPU B;  2ZXP A;  3MXG A;  2RKS A;  2WAC A;  5E7N A;  3LNN A;  2JK8 A;  3NP8 A;  3I4N H;  1I4G A;  1DON A;  3E9I A;  2QW7 A;  3A7L A;  1DZ1 A;  5EPJ A;  4X6A H;  1MJC A;  2EY6 A;  1N32 Q;  4R1J A;  2BA1 A;  4PNY A;  1JQY D;  1TS5 A;  2XN9 C;  1BF4 A;  3S2D H;  1N36 L;  3NK9 A;  5M5X H;  2JA7 G;  2F0H A;  4B3M L;  5M5Y H;  2JXM B;  3RLO A;  1F77 A;  2RSN A;  4IJH A;  2O5J C;  4IUN A;  1QNK A;  1EIY B;  1Y69 U;  4FO2 A;  4JI7 Q;  3J7A V;  3A8J E;  3U9O A;  1CZW A;  4DGZ A;  2F0J A;  3SK6 A;  1TS3 A;  4PZ6 A;  2E2J H;  4OHJ A;  2L1B A;  2B3G A;  3I70 A;  3K6O A;  3CAM A;  5IP7 G;  4LF6 Q;  3QIA A;  4A3J G;  1VQ8 A;  1G6Z A;  2QF7 A;  4DR2 Q;  1EWH A;  3A8I E;  1D8L A;  5M3M G;  3DM3 A;  1KAW A;  3J80 E;  1X3Q A;  5NUC A;  1O80 A;  1JWM D;  4A76 A;  4IUV A;  2NTT A;  3IL8 A;  1IW7 C;  3BU2 A;  3J81 L;  5EPK A;  2FFK B;  3DEP A;  4XYQ A;  4DV7 L;  1P16 A;  4OWT B;  2Z6K C;  1XPO A;  3D6C A;  4FNF A;  4C3I G;  3K59 A;  5CBE E;  2PNR C;  4A3L G;  4AIM A;  2ZJP A;  4LF8 Q;  4A3I H;  2CFM A;  1H9J A;  1DOK A;  1LLR D;  4HIO A;  1F9R A;  2A6E C;  2JA6 B;  3KFU A;  4R4C A;  3RZD B;  1HNW L;  3OPO A;  3WWV A;  5KND A;  1G2T A;  4IPD A;  2E2D C;  4BBS B;  3RN5 A;  4BA2 I;  1M8A A;  1B3Q A;  3NBI A;  1CA5 A;  4EQ5 A;  1NCV A;  1LUZ A;  5C4Z A;  5C5L A;  2Q8I B;  2B8G A;  3S16 H;  2HIV A;  2A6H C;  1UE1 A;  2QCP X;  4A3E B;  2PI2 A;  4DKA C;  4UP7 A;  2B2W C;  1ENF A;  1FGU A;  4LF4 Q;  4DV0 Q;  2AQ2 B;  1SXT A;  3F8T A;  3HOW B;  3TN2 A;  3P75 A;  5IGF A;  5IT9 c;  2NUC A;  2E2H B;  4CGY B;  4IQZ A;  3DM1 A;  1HPC A;  1Q90 A;  2JE6 I;  1Z7T A;  2TSS A;  1QZH A;  2B63 H;  3HOU H;  4C3J H;  3QG1 A;  4LFB Q;  1TWC B;  3HOZ B;  3GTL B;  1SRO A;  1LTL A;  2UU9 Q;  5G3L D;  1GHK A;  5FJ8 G;  4L6T B;  2HCC A;  1K73 C;  1D2B A;  4A75 A;  1SMY C;  2VS1 A;  1JT8 A;  4DK0 A;  3S1R B;  1EQQ A;  2WKC A;  2N3S A;  1FNW A;  3TS2 A;  4EQP A;  3K7U C;  2RDG A;  4GLV B;  1GUT A;  2VXW A;  3RR5 A;  4KHP Q;  1OTC A;  4X3T A;  4C1N I;  3GTM H;  5IE8 A;  4RA8 A;  1FL0 A;  3HOY H;  4I7A A;  4KLK A;  3ULP A;  3GQB A;  2L11 A;  3U4Z A;  2KA7 A;  1HZB A;  4DPG A;  1M1K C;  4GOP C;  2NN6 G;  5KNC A;  1TWG B;  1EYA A;  1VQC A;  1YJW A;  1ET9 A;  1GJX A;  4K5X A;  2I5H A;  4NDX A;  3S1N B;  1PZI D;  1E3P A;  2WAQ G;  3AEV A;  4B3R L;  3TQY A;  3S1M B;  2QA4 A;  2NTS A;  3CCS A;  1GKH A;  3U58 A;  2UXD L;  2EDG A;  4BBS H;  2DGY A;  1X55 A;  4MTN A;  2B2T A;  4OX9 Q;  1OXV A;  1LTB D;  4N8X 1;  2FMM A;  1JCK B;  3EQL C;  4CJ0 B;  2XTI A;  2F0Q A;  4DR3 L;  2VUM H;  4CDD C;  1NY4 A;  5C44 B;  3D6W A;  5IYD G;  3DWQ A;  5GAH C;  3DEO A;  3FRP B;  1ILP A;  5CV5 A;  5AJ3 L;  2A74 C;  4ZUI A;  1AE3 A;  2PMZ B;  2KVM A;  2I5L X;  3F1Z A;  4KJO A;  1BXT A;  4DR5 L;  1I4P A;  4BY7 G;  4GN4 B;  2DJF C;  3O13 A;  4LAA A;  4ME3 A;  3ND8 A;  1E2V A;  5CV7 A;  2D2C C;  3NEN A;  3RD4 A;  1F9P A;  1STB A;  1L1O B;  3BYT B;  3I4N G;  2DNE A;  4JVZ A;  1NUC A;  2JP1 A;  4JI6 Q;  3PF4 A;  4KV6 A;  3MEF A;  2F0K A;  1EEF D;  3HOZ H;  3A74 A;  3NE5 B;  4B08 A;  2I5M X;  1WCM B;  3R2T A;  5EBC A;  2F0U A;  2UUC L;  3C2P A;  1EWC A;  3QO2 A;  3WOE A;  4DV2 L;  1TQO A;  3S1R H;  5HUR A;  1YZ6 A;  1WD1 A;  3CRK C;  1HXY D;  4XT1 B;  2ZXR A;  5K5P A;  2JA5 B;  1W6J A;  2KEN A;  1SYC A;  2D0P A;  1UWV A;  5JEA H;  1VQ5 A;  2N49 A;  4TQU S;  1XNQ Q;  4NP5 A;  3W1B A;  3CMA A;  5CYU A;  3A56 A;  3J81 E;  4A93 H;  1I4H A;  1PDQ A;  4WJW A;  5EAY A;  1L1O A;  1MSH A;  3OW2 A;  3PO2 B;  2NWG A;  1EIH A;  2J4X A;  4L63 B;  1Y1W B;  5EPL A;  1L0X B;  3DWP A;  1STE A;  4DAV A;  1HUN A;  3CCU A;  1PLF A;  2IWH A;  1HNX L;  1VQJ A;  2KBN A;  1LTR D;  3BS1 A;  1EY6 A;  4DV6 L;  3K0Y A;  3I7F A;  3HKZ E;  4DFA A;  3TZU A;  2EY2 A;  3BDO A;  1TVX A;  1MKH A;  1UE5 A;  3UI2 A;  4A3I G;  3CCQ A;  1EUJ A;  3UDI A;  2GA4 B;  1A62 A;  2A73 B;  3RLF A;  4ZYS A;  2MPM A;  3KBG A;  1VQM A;  1EYC A;  1B2T A;  1AFP A;  2JJQ A;  5DLQ E;  3PO3 H;  1JB3 A;  5TSS A;  1JMC A;  5JPN C;  2BE5 C;  3OOC A;  4NB3 A;  4IJL A;  2OEO A;  2EJG C;  1IW7 D;  4FF2 A;  2JEB I;  1EU3 A;  5KIX A;  2WKD A;  2KED A;  1SNP A;  4BBR H;  3TBI B;  4G57 A;  1FR3 A;  3MXP A;  2DY8 A;  5IYB G;  4BS9 A;  1WTH A;  2N8N A;  3B6Y A;  4LF9 Q;  4JPB W;  1E1O A;  1BCP F;  2LXJ A;  4DV3 Q;  4JI4 L;  1RDP D;  5JPM C;  3SVM A;  3N52 A;  4EQN A;  2QDL A;  1VQB A;  1SE2 A;  1Q46 A;  4GKJ L;  1E24 A;  3E5S A;  4DR4 Q;  1EY7 A;  2A6E D;  1Q1B A;  3SK8 A;  2Q2U A;  1GOZ A;  3I4L A;  2B63 G;  3NXW A;  2MFI A;  4L8J A;  1MSG A;  1JJG A;  3GTK B;  4AQY Q;  3GTQ H;  1KAA A;  1XMO Q;  1CHP D;  5C3E H;  5GAG C;  1E2W A;  2AWN A;  3MC0 B;  2VW9 A;  4UP9 A;  5IGE A;  3QOL A;  3CKI B;  4HID A;  3RZO B;  3HOX G;  1VQO A;  1CKM A;  5BR8 L;  3MXN B;  1PTO F;  1V1Q A;  1IKM A;  1XTC D;  2ZXO A;  4LFC L;  4L5R C;  4Q0F A;  3OTO Q;  4H13 C;  2BH2 A;  1J5E Q;  3OHX C;  2K5H A;  5JVG 3;  3X3M A;  2RHS B;  3KLS X;  1G2S A;  3MA2 B;  4HJA A;  3HOY G;  2RQX A;  3JC6 6;  2ZTC A;  4R8I A;  3DMU A;  1LT3 D;  1CKN B;  1DOM A;  1B7Y B;  3K5O A;  3G48 A;  1RTN A;  2HUG A;  2R61 A;  3TRE A;  5HGT A;  2R93 B;  3H0G H;  4C2M H;  3M7N A;  3A7A B;  1GUO A;  4M1U B;  5IP9 H;  5FOB B;  4XQN A;  2F52 A;  4QUF A;  1VQL A;  2NYZ D;  1Q8K A;  1Q12 A;  3F2D A;  3T13 A;  3TZD A;  2CVR A;  4JK1 C;  5IT9 L;  1SMY D;  2JN4 A;  1O7Y A;  1VMC A;  1AP0 A;  2LY7 A;  4YHH Q;  1SR3 A;  1IBK L;  1X3G A;  2L0C A;  2CH4 A;  2EIF A;  2KEC A;  1LTA D;  2A68 C;  1HTL D;  4X3K A;  3SGI A;  4KY6 A;  5KYI A;  3MXN A;  4LFA L;  1Z47 A;  3E6Z X;  4HSV A;  1BR9 A;  4GNX C;  3HFZ B;  1QJO A;  3CQZ B;  1STA A;  4JI8 Q;  3SDZ A;  2XSC A;  4A3B B;  4MNO A;  2VUM G;  1PH9 A;  4Y7N B;  1CKN A;  3S17 H;  5CV6 A;  2EXZ A;  1WTR A;  4XTC S;  1OO9 B;  2WB1 G;  2NZO A;  4XDX A;  2J0T D;  3PIO 3;  1PA6 A;  3K5N A;  4ALP A;  4FP5 D;  4CKB A;  1GM5 A;  1PH3 A;  4IFD H;  1C4Q A;  1C8C A;  5EQ0 A;  3CCR A;  4B3S L;  2MGS A;  1RIP A;  4IPH A;  4UAI A;  2BA0 A;  1EU4 A;  2MQH A;  3T51 B;  3CCM A;  1PFB A;  2VZA A;  2IHF A;  3W3A A;  1VF5 C;  3AYH B;  4RCO A;  4FF1 A;  4CDC C;  3S1Q H;  2AWO A;  2AQ3 B;  1K0S A;  2PQA B;  3EVQ A;  4KKS A;  4HR7 B;  4L5T A;  2B39 A;  2VQF L;  1X32 A;  2JSO A;  2PZT A;  5GAE C;  1XMQ Q;  1K3B C;  2FMC A;  2NBF A;  1TWH H;  3KLS A;  2Q2I A;  1GUN A;  1YJ9 A;  2BOS A;  4QGU A;  2RCN A;  1LM0 A;  1SFO B;  2NB0 A;  3OIQ A;  3ZYY X;  2QKI C;  5DNF A;  1IL8 A;  5BN3 A;  4IUQ A;  1EY9 A;  2CWA A;  3MWY W;  5IGG A;  4HSP A;  2I07 B;  3VA7 A;  5J39 A;  5JEA G;  1YHQ A;  1W2B A;  1UAP A;  1K83 B;  2PPB C;  2Z4I A;  2WIN B;  1HA5 A;  1FD7 D;  1I3Q H;  2AMC B;  1I94 Q;  2NVQ B;  2EPB A;  3PF5 A;  2RDH A;  1HUM A;  3NUC A;  2EY1 A;  5C4X H;  1PZK D;  5FO8 B;  1PFN A;  4K5V A;  4TVA B;  2R7Z B;  2SNM A;  2UUB Q;  2WP8 J;  3HKZ G;  1U4R A;  2E8G A;  2PQA A;  4OON A;  5C5M A;  1XPU A;  2F0D A;  2HIX A;  4A3F H;  4JI5 L;  3ERS X;  5C4J B;  1IBL L;  1N34 Q;  1BCP B;  1SBB B;  1ZKO A;  4IOC A;  2F0O A;  2M2L A;  1KNA A;  1VQN A;  3E0J A;  4FF3 A;  4DV1 L;  2IY5 B;  4EGV A;  2WAQ E;  3I4M H;  1EQV A;  1N32 L;  1VQ4 A;  1YNN C;  3QJY A;  3PO3 G;  4KI0 A;  1I5F A;  2K33 A;  3W5O A;  3KOJ A;  5IGB A;  3A54 A;  4KHZ A;  4TSS A;  4POG A;  1I6H B;  1HNZ Q;  1PRT F;  2JA9 A;  4FXG C;  4JI1 L;  2ID0 A;  2BH8 A;  1KXL A;  3H91 A;  1K3R A;  2KHS A;  4ZUJ A;  1TWA H;  1QIL A;  2XGT A;  4IUR A;  2Y0S E;  1ESF A;  1PTO B;  3H3V H;  3CHB D;  2VQE Q;  4E6I A;  1ROD A;  4DR1 Q;  1Y1V H;  2VB3 X;  1STH A;  3X3N A;  2LMC B;  2Q8R E;  3PUW A;  4N9T A;  3J7Y W;  2AHO B;  1ET6 A;  4LF7 Q;  3IKJ A;  4A3G B;  3MVV A;  2Z1C A;  4NXN Q;  1ASY A;  3FKI H;  4A3D B;  2QDB A;  1U4P A;  2C35 B;  3GDE A;  5CGK A;  3GTJ B;  1Y8P B;  5J3B A;  2BE5 D;  1KC8 C;  4BY1 H;  1QNU A;  1EQT A;  2K14 A;  2ENB A;  4Q5V A;  4LF8 L;  2B2U C;  5IGC A;  5IYC H;  1DM0 B;  1SYG A;  4ZKC B;  2F4V Q;  1L0Y B;  4C3H H;  4JG2 A;  3ZJY C;  1M90 C;  3BDC A;  1TU2 B;  3IFT A;  1CHQ D;  2NVQ H;  5E4W C;  1H9M A;  5CV9 A;  4HJ9 A;  3I91 A;  3F2C A;  3HOX B;  4P75 A;  2YV5 A;  4N9P A;  1UE6 A;  2R7Z H;  1MGS A;  1QVG A;  5JJZ A;  5JVH 3;  1LT4 D;  1D5M C;  4LWC A;  1ENA A;  5I2X A;  2EYO A;  5IT9 E;  1MJE A;  2JA8 B;  1CM9 A;  2B2U A;  3NHH A;  4IZ8 A;  4K5W A;  4NW2 A;  4B9W A;  2HHH Q;  1WTV A;  3UDG A;  4HIM A;  4KKU A;  1PH8 A;  1WJJ A;  4GN3 B;  4Z9C B;  3A0J A;  1LTS D;  4LF4 L;  4DV0 L;  1E2Z A;  2EZV A;  1GHJ A;  2H5X A;  4JOI A;  2I46 A;  5ELC A;  2N88 A;  2NVT B;  1B70 B;  5CC4 A;  2GN5 A;  4YWK A;  1VDZ A;  5K36 G;  3NSW A;  5JEA J;  4GS3 A;  2HQE A;  1L0W A;  4EVO A;  1EOT A;  1B50 A;  5GAD C;  2UU9 L;  4X62 Q;  4A3C H;  5ELO A;  2IJ0 A;  2BCO A;  1DJR D;  3K58 A;  3GTG H;  4I65 A;  3S14 B;  1BBX C;  1K9M C;  2OXP A;  4X66 Q;  1PXU A;  4DV7 Q;  1GXD C;  1JOK A;  4GKK Q;  2D9U A;  1ENC A;  1MD2 D;  4HJ5 A;  3LWU A;  5DAU A;  4K2K A;  1D1I A;  4A3K B;  1HR0 L;  3KUP A;  3TRZ A;  2K7V A;  1VQE A;  3PIP A;  4PMW A;  3RNU A;  1PV4 A;  1PHJ A;  4IFD G;  4EQO A;  1S72 A;  5M3F G;  3D4D A;  4A3G H;  4JW0 A;  2A68 D;  3AQQ A;  4F8M A;  1HRJ A;  1JWS D;  2JYO A;  4DR7 Q;  2F3I A;  1HNW Q;  1C0A A;  2K5Q A;  2L9H A;  3ERQ A;  2F0T A;  1GD7 A;  1KDC A;  4C56 C;  2K01 A;  3RLN A;  3HOV G;  1H9S B;  4DNI A;  3T1Y Q;  5L37 A;  1DOL A;  2AQ1 B;  3EA6 A;  1BQQ T;  2NVX B;  3SE0 A;  3HKS A;  1KRS A;  1HZA A;  4KD4 A;  3CRL C;  4X65 L;  4IAL A;  1AE2 A;  3OMC A;  4OIK A;  5ELD A;  2K50 A;  1TII D;  4P2C B;  1XXG A;  3FVQ A;  3KYH C;  5JJI A;  4MZ9 A;  2ES2 A;  1JE5 A;  3BYY B;  1LV9 A;  2BDO A;  2X6G A;  1E1T A;  2Z8L A;  4JYA Q;  3HP3 A;  4RH6 A;  1CSQ A;  1A8V A;  4OX9 L;  2A1A A;  2B2T C;  2OT2 A;  5C4X G;  5LMU Q;  3F2B A;  4MTK A;  1PRT B;  3J80 i;  1KNE A;  2IW3 A;  3OIP A;  2R92 B;  1IYJ B;  4BXX H;  4OO1 H;  4H7B A;  2MO1 A;  3D0F A;  1Q7Y C;  1PH7 A;  1EY5 A;  2EYL A;  1HH2 P;  5FLX L;  2FHT A;  1H9S A;  2JA6 H;  1U9R A;  3NWT A;  2P5Z X;  3RZD H;  1PH2 A;  1EL0 A;  3HKZ B;  2DY7 A;  4LMQ D;  2G9H D;  2IT1 A;  2Q8T A;  2CQO A;  3T16 A;  3L9A X;  1D5X C;  1BNZ A;  4WJ4 A;  5ELB A;  4JI6 L;  1IBM L;  4ZKB B;  2NN6 I;  3J7A F;  4K14 A;  2A5H A;  5M5W B;  3I4M G;  4KN4 C;  1TT2 A;  3JAM i;  1A15 A;  1S5B D;  2FXQ A;  3TEH B;  1KL9 A;  3ICE A;  2E76 C;  4R4I A;  2OWO A;  2X69 A;  4A3M B;  3GTO B;  1VQ6 A;  4A3E H;  2Y0S G;  2BDN A;  4XYO A;  3EIV A;  4R9W A;  3SXH A;  2QEX A;  4RMF A;  3HOW H;  1B4O A;  5C6A A;  2UUA Q;  1A6X A;  5JJK A;  5I4D A;  2E2H H;  4A3K H;  2KUM A;  5D65 A;  2WB1 E;  3GV3 A;  1PFS A;  5DM7 3;  1CSP A;  1L2F A;  1EOV A;  4QIW B;  4F7X A;  1XNQ L;  1TWC H;  1Y1V G;  3GTL H;  5COY A;  2O4X A;  2R6G A;  4R4Q A;  5C0X H;  4MHE A;  3VR2 A;  3NQI A;  3P20 A;  2HT1 A;  1SNO A;  4BWG B;  3ERO A;  4APV A;  2D62 A;  1L1O C;  2RVL A;  3HGB A;  1C9O A;  1S5F D;  3GV6 A;  3FKI G;  1YNN D;  1WYD A;  2ICI A;  3AU7 A;  1JJ2 A;  1GUG A;  4HTH A;  1BBU A;  3A5U A;  1VQI A;  1WTP A;  3M85 A;  4GLA C;  3P1H A;  2O2L D;  2JA7 B;  1I4Q A;  2F0S A;  1O7I A;  4BY1 G;  4P71 A;  5EJW A;  4DR6 Q;  1EYD A;  1ASZ A;  3BDL A;  2PZU A;  4AYB G;  1TR5 A;  1AH9 A;  4DR5 Q;  1E0B A;  3DWA A;  1HFG A;  2PYK A;  4QL5 A;  5IYC G;  4DUY Q;  1LT6 D;  4C3H G;  1RF2 D;  2R7F A;  2PO4 A;  1HQR D;  5D14 A;  5EKK A;  4IFD J;  2JQO A;  5C4H A;  4NMZ A;  3Q24 A;  3MHB A;  1B53 A;  4A3J B;  1XNR Q;  1IZ6 A;  2E2I B;  2F4I A;  5M3M B;  3GTP B;  3KF8 B;  2NVY B;  2VB2 X;  3DLL A;  3EFX D;  1TWG H;  3D4R A;  1PTO D;  3NTI A;  3NTH A;  2SNS A;  2UUC Q;  3S1N H;  2EOT A;  2Z6B A;  3QOJ A;  3BVG A;  5C3X A;  4DV2 Q;  1EZ8 A;  3PUZ A;  3S1M H;  3KDF B;  4C3I B;  3CCV A;  4LF9 L;  4HN7 A;  3UDF A;  3D31 A;  1DGS A;  4UP8 A;  1GUS A;  4DV3 L;  4HIK A;  1K0R A;  1TKW B;  1FJG Q;  1XPR A;  5LL6 X;  1V1P B;  4DR4 L;  2RSO A;  5C44 H;  4NXM L;  1LYL A;  4J15 A;  4DU9 A;  1HQM C;  1K8G A;  2H1E A;  4JV5 Q;  4FYD A;  2K6A A;  4AQY L;  4OGQ C;  4JI3 Q;  1SNQ A;  4XQJ A;  2K5V A;  4WJ3 M;  5KRU A;  1XMO L;  4P72 A;  5ELE A;  3KF8 A;  3DHQ A;  4CJ2 C;  3D8G A;  1PH6 A;  2OTL A;  2OF1 A;  2WV6 D;  1TWF B;  4F87 A;  4PG3 A;  3Q8D A;  4RKL A;  3MFG A;  1D6E C;  2L4N A;  3CD6 A;  2I0Q A;  3KDF A;  4KY7 A;  2OQ0 A;  1RL2 A;  3HOU G;  3CPW A;  1WCM H;  4WRD A;  4C3J G;  3OTO L;  3TS0 A;  1SAP A;  2KHI A;  3BG3 A;  1V43 A;  1SE3 A;  2SEB D;  1IHZ A;  3HRZ C;  1QVC A;  1J5E L;  4DUZ Q;  5FK9 C;  2RBM A;  1XWE A;  1V1P A;  1G91 A;  5KYL A;  3CC2 A;  3U9S A;  2EE1 A;  3E3X A;  5FLM H;  1UEB A;  2EYM A;  3EN2 A;  4H02 A;  1YVC A;  2L15 A;  3KF6 B;  1YIJ A;  2JA5 H;  2JA7 H;  5AFW A;  1B3A A;  4UHV A;  3PUY A;  3WDN A;  3U50 C;  1MIU A;  3NPP A;  3KJO A;  1EWI A;  2Q2T A;  4HCS A;  1MI2 A;  3H09 A;  4CKC A;  1RTO A;  3DUZ A;  3T1H Q;  1YHA A;  1S40 A;  2WFW A;  3M3Y B;  2LFN A;  3PO2 H;  1U0L A;  3K7A B;  4HMI A;  2K5W A;  4NKL A;  1YJN A;  2XWJ B;  1Y1W H;  3I8Z A;  1M4V A;  1H95 A;  2GVB A;  4V0B A;  3G6J B;  5GQO A;  3PMF A;  3K8A A;  3PQI A;  2XRQ D;  1F2Y A;  4IO9 A;  5IP7 H;  2J7Z A;  2UXC Q;  4K2L A;  1HFN A;  4DNT B;  3SK5 A;  3IFD A;  3E9H A;  2EQS A;  3J81 i;  1Q8I A;  3S2H B;  5FLX E;  1EFW A;  1CQF A;  2F0F A;  1N33 Q;  1J8I A;  3K81 C;  1K8M A;  1SYF A;  4OO1 G;  4HAE A;  2CQA A;  3G6E A;  1VQG A;  3KF6 A;  3QWN A;  4C3I H;  4QY7 A;  4P73 A;  1EFI D;  1EQR A;  2DJG C;  1F9Q A;  3M4Q A;  4A3L H;  2JA6 G;  2B2V A;  1PMR A;  2ZJQ A;  4S3S A;  4LUV A;  4CJ1 B;  4BBS G;  4X3U A;  4YWM A;  1VQF A;  3I56 A;  2ASB A;  4K0K Q;  4JI2 Q;  1OXU A;  1R4Q B;  4X64 L;  2XIW A;  2WAQ B;  1F2Z A;  1NE3 A;  2AUJ D;  3FHW A;  4IN3 A;  4DV4 L;  5DEH A;  3DXJ C;  3VR5 A;  4PQX A;  1LTI D;  3GO5 A;  4CBV A;  3JAM L;  2EJM A;  4OXP A;  1EY0 A;  3Q0A A;  2UXB L;  1NAP A;  1CK1 A;  1FVI A;  4OL7 A;  2V4D A;  3MFY A;  1TWF H;  3PUX A;  2F0E A;  4ULL A;  1HTP A;  2O5I C;  3HOW G;  3MTS A;  5FLX c;  2CH4 W;  5A2Q L;  3BVZ A;  2CCZ A;  2E74 C;  1ESR A;  4BY7 B;  2RF4 A;  4PZ8 A;  5FO7 B;  2GVA A;  5IIF A;  3J7Z C;  1K28 A;  1PRT D;  2LKV A;  3RMH A;  1JR0 D;  3HOZ G;  2IPK D;  1I94 L;  3GTK H;  1SNM A;  4RHS A;  4JBK A;  3AFP A;  1ICW A;  5C0X G;  3I4N B;  4B3T Q;  2WII B;  1QE6 A;  4HCE A;  1AZQ A;  3Q23 A;  3C1F A;  4ODG A;  4K8J A;  2UUB L;  4FF4 A;  2IL8 A;  1B9M A;  5FJ8 H;  3RZO H;  1UNS A;  3S2D B;  3PSI A;  5M5X B;  1LO5 D;  1I6V C;  1HHV A;  2E5L Q;  1F2L A;  4DV5 L;  1UE7 A;  4ILW A;  3R2I A;  1PYB A;  4H0L C;  1JOO A;  2NZ1 D;  4O42 A;  3FP9 A;  3VR4 A;  2K5D A;  5LL6 S;  2EYP A;  1U5K A;  3K57 A;  1ZXT A;  5LMN Q;  2F03 A;  4Y52 H;  4A93 G;  4NPS A;  3STB C;  5KGU A;  5IWA Q;  3M7G A;  4EX5 A;  3K5M A;  3J7A 5;  3FMC A;  1S4Z A;  3V05 A;  2R93 H;  2IX0 A;  2F0P A;  2E2J B;  4KMU C;  5E1F A;  4DN4 M;  3H94 A;  3S2H H;  4OIJ A;  1OXS C;  5I6W A;  5J22 A;  2SOB A;  1HNZ L;  5CV4 A;  2OCE A;  4LF5 Q;  4QJF A;  5CR3 A;  3VDY A;  1FNU A;  5IGD A;  2VQF Q;  4WOR A;  4OEL B;  2QIL A;  4FXK C;  4ABN A;  4IUU A;  2H4O A;  1LT5 D;  2EY5 A;  3MEH A;  2LS0 1;  4CDE C;  2VQE L;  1R9T B;  4DR1 L;  1D1K A;  3VR3 A;  4AH6 A;  3OMG A;  1H9R A;  3CQZ H;  2ZM6 Q;  5FO9 B;  4LF7 L;  3P7J A;  1BCP C;  4A3I B;  4A3B H;  2IHE A;  5C44 G;  5EBD A;  1QG7 A;  4NXN L;  4Y7N H;  3Q6S A;  3MAQ A;  1VS0 A;  4HJ7 A;  3W1G A;  3A5Z B;  1SNC A;  4BBR G;  2MO0 A;  3CME A;  4JI7 L;  3OYY A;  4GN5 A;  2K04 A;  1SE4 A;  2A19 A;  1KIX A;  1UEA B;  1J6Q A;  2D5D A;  4ZQ3 A;  3I90 A;  4BY7 H;  3S16 B;  5ELN A;  4LF6 L;  1X3F A;  1WTQ A;  2F4V L;  4DR2 L;  1SEB D;  1WTO A;  2PZW A;  2CW0 C;  2KCM A;  4WFN 3;  1WCM G;  4JI0 Q;  1NR2 A;  3W2D A;  1N9W A;  1PTO C;  1TS2 A;  3SEB A;  4DK1 A;  3HS0 C;  2YTY A;  4RCN A;  4DV1 Q;  1EIF A;  1Q86 C;  2KCC A;  3M4O B;  1YNJ D;  5C3E G;  1YI2 A;  3SK4 A;  1JOR A;  2B63 B;  3HOU B;  4HED A;  1SND A;  4C3J B;  2B2Y A;  4G4K A;  5FLM G;  1SFO H;  4XQQ A;  4YY3 Q;  2JA5 G;  1ZYR C;  3ONA B;  2HHH L;  3L7Z C;  1MHW C;  4YIJ A;  1A3T A;  1VQK A;  2V1C C;  4JI1 Q;  1WD0 A;  1K83 H;  1KLG D;  3PV0 A;  2F3V A;  4GLX A;  4V19 0;  4AYB E;  5D3D A;  3QB3 A;  1KLU D;  3F2U A;  1BDO A;  1NMF A;  1G29 1;  3HZX A;  3I72 A;  4OWW B;  1LTG D;  4JOI C;  1SYB A;  3PO2 G;  3CC7 A;  1DD2 A;  4JCV E;  1Y1W G;  1C7Y A;  4ME5 A;  3TSS A;  2IX1 A;  1PFM A;  1BBW A;  4FVM A;  1PYS B;  3H0G G;  1A2T A;  5FKA C;  1N36 Q;  2N78 A;  4X62 L;  5C0X J;  4YWL A;  1CQV A;  1TY0 A;  1CT1 D;  5IP9 G;  4GZY C;  3GTM B;  4PMB A;  5LHY 1;  4B3M Q;  1EY8 A;  3TP5 A;  5C4J H;  4DAP A;  3I73 A;  3HOY B;  4ZRZ A;  4X66 L;  4I7Z C;  4GKK L;  2D0O A;  4O1N A;  3PIO A;  5LMN W;  3FPP A;  1R9T H;  1G8Z D;  2EJF C;  4J8Q A;  2C5C A;  5GRO A;  4LFB L;  4L5Q A;  3CW2 C;  5C3W A;  1I50 B;  3JAM E;  1CFM A;  1JOQ A;  1WOC A;  1I6H H;  1CTM A;  3CC4 A;  1X3E A;  4DR7 L;  4CHT B;  2IX3 A;  1NSN S;  2DUD A;  2Z6K A;  4XXE A;  3ULL A;  5I2Y A;  5A2Q E;  4X3S A;  4OWX B;  3T1Y L;  4OEM B;  5EKI A;  5JJL A;  4JBW A;  1PTO H;  2VUM B;  1X3P A;  3J80 c;  4UPA A;  1BUV T;  2VNU D;  1QOH A;  4RGN A;  2L5T A;  4QUC A;  3A55 A;  4KJN A;  4POF A;  5IYB H;  4KHP L;  3I55 A;  3EBE A;  2WB1 B;  2F0G A;  2K05 A;  3TP8 A;  2R3Z A;  1IXR A;  4RGM A;  2YU9 B;  1T5E A;  4A3D H;  1EY4 A;  3GTJ H;  3IAY A;  2NZH A;  1Q3L A;  4JYA L;  4KKT A;  3M4O H;  5I9P A;  5I9O A; 
#chains in the Genus database with same CATH homology
 2R7F A;  4YY3 L;  5H1S E;  4YHH Q;  1SR3 A;  4PZ7 A;  1IBK L;  5LMU L;  1X3G A;  4IFD I;  3I4O A;  4IFD J;  3JAM c;  3L0O A;  2EIF A;  2JQO A;  2ALY B;  1SN8 A;  1A63 A;  4JI5 Q;  1Q1E A;  1VQA A;  1VQP A;  4R4O A;  1IBL Q;  1XNR Q;  2AKW B;  1B8A A;  1IZ6 A;  3SGI A;  4DK3 C;  3KF8 B;  5E7N A;  4LFA L;  3DLL A;  2JK8 A;  2K52 A;  3I4N H;  1TWG H;  1Z47 A;  1HJP A;  2ATW A;  3E9I A;  1Q81 C;  2UUC Q;  4GNX C;  3HFZ B;  3G4S A;  1YEZ A;  4JI8 Q;  3S1N H;  4X6A H;  1MJC A;  4MNO A;  2VUM G;  1N32 Q;  4R1J A;  2BA1 A;  4DV2 Q;  3PUZ A;  3HOX H;  1PH9 A;  3S1M H;  3KDF B;  1YIT A;  3CCV A;  4LF9 L;  1HR0 Q;  1CKN A;  3UDF A;  3D31 A;  3S17 H;  3S2D H;  1N36 L;  1PH5 A;  1DGS A;  5M5X H;  4UP8 A;  3U4V A;  2JA7 G;  3M4P A;  3PGZ A;  4XTC S;  2OQK A;  2WB1 G;  1K0R A;  2NZO A;  4DV3 L;  4HIK A;  4B3M L;  1FJG Q;  1XPR A;  2R93 G;  5M5Y H;  3RLO A;  1PA6 A;  4ALP A;  2JA8 H;  4IJH A;  4GOP B;  3L2P A;  1OXT A;  1GM5 A;  1PH3 A;  4DR4 L;  5C44 H;  2JEA I;  3CCR A;  1EIY B;  4NXM L;  1LYL A;  2PI2 E;  4J15 A;  4JI7 Q;  4B3S L;  2A8V A;  1K8G A;  1RIP A;  4IPH A;  1TXY A;  4A3F G;  2BA0 A;  2MQH A;  3CCM A;  4JV5 Q;  2VZA A;  2IHF A;  4AQY L;  4JI3 Q;  2K5V A;  3AYH B;  4PZ6 A;  2E2J H;  1XMO L;  2UUA L;  4WJ3 M;  2NVT H;  4P72 A;  2B3G A;  1YHB A;  2AWO A;  1KD1 C;  3S1Q H;  3CAM A;  5IP7 G;  4LF6 Q;  4A3J G;  1VQ8 A;  2PQA B;  3G71 A;  1PH6 A;  2OTL A;  4DR2 Q;  4YCW A;  1D8L A;  4LUZ A;  3DM3 A;  1KAW A;  4L5T A;  3Q8D A;  4PG3 A;  5M3M G;  2VQF L;  4X65 Q;  5GAE C;  1XMQ Q;  4A76 A;  1TWH H;  1I50 H;  1V9P A;  3CD6 A;  2Q2I A;  2PNH A;  3BU2 A;  3ER0 A;  2I0Q A;  1NJI C;  1YJ9 A;  3STB D;  3KDF A;  4DV7 L;  3CCJ A;  4A3B G;  2OQ0 A;  1RL2 A;  2RCN A;  4QGU A;  1LM0 A;  1P16 A;  4OWT B;  3CPW A;  2Z6K C;  1WCM H;  1XPO A;  3OTO L;  3HOU G;  3S14 H;  3TS0 A;  2KHI A;  1V43 A;  2K75 A;  2CWA A;  1QVC A;  1YHQ A;  1J5E L;  4A3L G;  4DUZ Q;  5JEA G;  1W2B A;  2CKZ B;  4GOP A;  4AIM A;  1I3Q H;  2AMC B;  3KLW A;  2ZJP A;  4LF8 Q;  2ZJR A;  1EYG A;  1I94 Q;  4DR6 L;  4A3I H;  3CC2 A;  1E22 A;  2CFM A;  3PF5 A;  5FLM H;  3CXC A;  1UEB A;  3EN2 A;  4HIO A;  4H02 A;  1YVC A;  2L15 A;  3KF6 B;  5C4X H;  1YIJ A;  2JA5 H;  2JA7 H;  3KFU A;  1OXX K;  4R4C A;  1X54 A;  4TVA B;  3PUY A;  1HNW L;  3U50 C;  2YU9 H;  3WWV A;  1MIU A;  2LSS A;  4IPD A;  4DUY L;  2UUB Q;  2WP8 J;  4IPC A;  3KJO A;  1EWI A;  3HKZ G;  3RN5 A;  2Q2T A;  4B3R Q;  4BA2 I;  2E8G A;  2PQA A;  4OON A;  2UXD Q;  3LGJ A;  3T1H Q;  1XPU A;  4EQ5 A;  2HIX A;  4P74 A;  1LUZ A;  4IPG A;  1YHA A;  1X6O A;  2WFW A;  1S40 A;  4A3F H;  4JI5 L;  1Q82 C;  3PO2 H;  1U0L A;  3ERS X;  4FDB A;  1YJN A;  1IBL L;  1IBM Q;  1XNR L;  3S16 H;  1YBY A;  1Y1W H;  2HIV A;  1H95 A;  2GVB A;  5GQO A;  1N34 Q;  3H3V I;  3UE1 A;  4DR3 Q;  3K8A A;  2NVX H;  1UE1 A;  5IP7 H;  4IO9 A;  4IOC A;  2PI2 A;  5AJ3 Q;  2UXC Q;  1VQN A;  4DKA C;  4UP7 A;  4DV1 L;  2IY5 B;  1FGU A;  4LF4 Q;  4DV0 Q;  2WAQ E;  3I4M H;  3E9H A;  2EQS A;  3F8T A;  4L5S A;  3J81 i;  1T9H A;  1EFW A;  2EXD A;  1N32 L;  1VQ4 A;  5IT9 c;  1N33 Q;  3NEM A;  3PO3 G;  3K81 C;  4KI0 A;  1I5F A;  3W5O A;  1D7Q A;  4OO1 G;  3KOJ A;  3G6E A;  2JE6 I;  1VQG A;  1QZH A;  4KHZ A;  1YNX A;  4POG A;  2B63 H;  3KF6 A;  3HOU H;  4C3I H;  4C3J H;  1HNZ Q;  4QY7 A;  2JA9 A;  4JI1 L;  4BA1 I;  3PUV A;  4P73 A;  1FJG L;  4LFB Q;  2MNA A;  1EQR A;  2BH8 A;  2ID0 A;  3I2Z A;  1KXL A;  3M4Q A;  1SRO A;  1GO3 E;  4A3L H;  2JA6 G;  1K3R A;  1LTL A;  1XJV A;  2UU9 Q;  1VQ9 A;  5FJ8 G;  1TWA H;  2ZJQ A;  4DAM A;  2R7Z G;  4LUV A;  1G51 A;  2XGT A;  3NBH B;  2R92 H;  4BBS G;  4YWM A;  4O0A A;  1VQF A;  3I56 A;  1VQ7 A;  2Y0S E;  1K73 C;  2ASB A;  4K0K Q;  4JI2 Q;  1OXU A;  4JV5 L;  4X64 L;  4A75 A;  1JT8 A;  2VS1 A;  3H3V H;  4JI3 L;  2VQE Q;  1NE3 A;  4DR1 Q;  1Y1V H;  3FHW A;  1EQQ A;  4DV4 L;  3CPF A;  2N3S A;  3TS2 A;  3PUW A;  3AFQ A;  3K7U C;  2AHO B;  2ZTD A;  3GO5 A;  4GLV B;  4LF7 Q;  4OXP A;  3CCE A;  2UXB L;  3RR5 A;  1NMG A;  4NXN Q;  5IY0 A;  3FKI H;  1ASY A;  4KHP Q;  1FVI A;  1HZ9 A;  1W3S A;  2C35 B;  3GDE A;  1OTC A;  1TWF H;  1HR0 W;  3PUX A;  5M5W H;  3HOW G;  3GTM H;  5J3B A;  5IE8 A;  5FLX c;  3J81 j;  2R7D A;  1FL0 A;  1NTG A;  2CCZ A;  3HOY H;  3UE0 A;  1Y14 B;  2KCT A;  1KC8 C;  1VQH A;  4KLK A;  3ULP A;  4BY1 H;  4LW1 A;  2RF4 A;  4PZ8 A;  2YTV A;  4A3M H;  2GVA A;  3J7Z C;  3GTO H;  3U4Z A;  4DUZ L;  2K5N A;  2K14 A;  3IRB A;  2RHQ B;  4A3C G;  3HOZ G;  4LF8 L;  1HZB A;  4DPG A;  1M1K C;  5IYC H;  4GOP C;  1I94 L;  3GTK H;  4JBK A;  4QQB X;  2F4V Q;  3AFP A;  5C0X G;  2NN6 G;  4C3H H;  4JG2 A;  4B3T Q;  1VQC A;  3ZJY C;  4JBJ A;  1YJW A;  1KQS A;  1M90 C;  2PMZ E;  1CUK A;  3GD7 A;  1HNX Q;  2NVQ H;  3J81 c;  2I5H A;  4HJ8 A;  4HJ9 A;  3F2C A;  1E3P A;  2ZTE A;  2WAQ G;  2UUB L;  3AEV A;  4B3R L;  5HY6 A;  3TQY A;  4DV6 Q;  1JJC B;  2QA4 A;  4P75 A;  5FJ8 H;  3CCS A;  1GKH A;  2YV5 A;  3U58 A;  3RZO H;  1UE6 A;  2UXD L;  3T1H L;  2R7Z H;  1SLJ A;  1NBW A;  3PSI A;  1QVG A;  4BBS H;  2DGY A;  1X55 A;  4LWC A;  2E5L Q;  4MTN A;  2VY3 A;  4DV5 L;  4OX9 Q;  1UE7 A;  4A3G G;  1OXV A;  1PYB A;  1MJE A;  2HHH Q;  4A3D G;  4QIW E;  2XTI A;  3UDG A;  3FP9 A;  4HIM A;  4DR3 L;  2VUM H;  1NY4 A;  3UDX A;  5IYD G;  1PH8 A;  5GAH C;  1U5K A;  1WJJ A;  5AJ3 L;  5LMN Q;  2UXC L;  4Y52 H;  4A93 G;  4NPS A;  3STB C;  4GN3 B;  3A0J A;  5IWA Q;  1AE3 A;  4DV0 L;  4EX5 A;  4LF4 L;  3J7A 5;  2I5L X;  3F1Z A;  4DR5 L;  4NXM Q;  4BY7 G;  2H5X A;  4GN4 B;  4JOI A;  2R93 H;  2IX0 A;  1N33 L;  3ULJ A;  2K4K A;  1X56 A;  1B70 B;  1QVF A;  2GN5 A;  4LNQ A;  4ME3 A;  4YWK A;  3S2H H;  5K36 G;  4YHH L;  5JEA J;  4GS3 A;  1OXS C;  3NEN A;  1HNZ L;  1L1O B;  1BVS A;  1L0W A;  2OCE A;  3I4N G;  4LF5 Q;  4QJF A;  4JI6 Q;  3PF4 A;  2LXK A;  5GAD C;  3VDY A;  2UU9 L;  4X62 Q;  3MEF A;  2VQF Q;  1K8A C;  4A3C H;  4JI4 Q;  1HZC A;  5ELO A;  3HOZ H;  3A74 A;  5HGQ A;  3GTG H;  2I5M X;  4A3J H;  4GKJ Q;  4UY8 C;  2E2I H;  4K0K L;  1K9M C;  2UUC L;  5M3M H;  4JI2 L;  4X66 Q;  3GTP H;  4DV7 Q;  2NVY H;  4JI8 L;  4GKK Q;  2VQE L;  4DR1 L;  4HJ5 A;  4AH6 A;  1X9N A;  4R4T A;  4DV2 L;  3CQZ H;  2YYZ A;  2ZM6 Q;  3S1R H;  1HR0 L;  4LF7 L;  2JA8 G;  3TRZ A;  1YZ6 A;  4A3B H;  1VQE A;  3PIP A;  4PMW A;  3RNU A;  1PV4 A;  1PHJ A;  4BXX G;  4IFD G;  2IHE A;  1XTD A;  4YCV A;  5C44 G;  1WFQ A;  1S72 A;  2B29 A;  4NXN L;  5M3F G;  4Y7N H;  2KEN A;  2D0P A;  1UWV A;  3KJP A;  4A3G H;  1VS0 A;  4HJ7 A;  3AQQ A;  3A5Z B;  3K80 C;  3W1G A;  4BBR G;  1VQ5 A;  2MO0 A;  2N49 A;  4TQU S;  1XNQ Q;  1SMX A;  3CME A;  3W1B A;  4DR7 Q;  4JI7 L;  3CMA A;  2F3I A;  3OYY A;  1HNW Q;  1C0A A;  4GN5 A;  1KIX A;  2A19 A;  1GD7 A;  2YTX A;  1J6Q A;  2KHJ A;  5EAY A;  5BR8 Q;  3OW2 A;  4A93 H;  1L1O A;  4KHP L;  3RLN A;  4LFC Q;  3RN2 A;  3HOV G;  4OO1 I;  4DNI A;  4GNX B;  4BY7 H;  3T1Y Q;  4JBM A;  5ELN A;  4LF6 L;  1X3F A;  2CWP A;  2F4V L;  4JC0 A;  4DR2 L;  3CCU A;  3HKS A;  4RG1 A;  4B3T L;  1E7Z A;  1KRS A;  1HZA A;  4YCU A;  2KCM A;  4X65 L;  1HNX L;  4A3E G;  1XMQ L;  1WCM G;  4JI0 Q;  1CKO A;  1AE2 A;  1VQJ A;  1N9W A;  2KBN A;  2K50 A;  2YTY A;  4DV1 Q;  3KYH C;  1EIF A;  4LUO A;  4DV6 L;  1Q86 C;  4IOA A;  3I7F A;  5JJI A;  4MZ9 A;  4A4I A;  2ES2 A;  3BJU A;  3HKZ E;  1JE5 A;  5C3E G;  1YI2 A;  4A3K G;  1E1T A;  4JYA Q;  2E5L L;  1UE5 A;  1MKH A;  4A3I G;  1CSQ A;  1A8V A;  4O2D A;  3CCQ A;  4OX9 L;  1S3O A;  5FLM G;  1SFO H;  1EUJ A;  3UDI A;  4YY3 Q;  2A1A A;  2JA5 G;  5C4X G;  2HHH L;  1IBK Q;  1A62 A;  3L7Z C;  3H15 A;  3RLF A;  3F2B A;  1QUQ B;  5LMU Q;  1VQM A;  1VQK A;  2V1C C;  4JI1 Q;  3J80 i;  2JJQ A;  5DLQ E;  3S15 H;  3PO3 H;  1K83 H;  5LMN L;  2OTJ A;  3PV0 A;  1N8R C;  1IYJ B;  1KHI A;  4BXX H;  4GLX A;  2MO1 A;  3D0F A;  1Q7Y C;  5IWA L;  1PH7 A;  1JMC A;  4AYB E;  1HH2 P;  3K0X A;  4LFA Q;  4NB3 A;  4IJL A;  5M3F H;  1IL2 A;  1NMF A;  1G29 1;  4GNX A;  1SRU A;  4OWW B;  2JEB I;  4JOI C;  1PVO A;  3PO2 G;  2JA6 H;  3CC7 A;  4X64 Q;  3RZD H;  4JCV E;  1PH2 A;  4BBR H;  1Y1W G;  1C7Y A;  4DV4 Q;  1G6P A;  2IT1 A;  5IYB G;  2CQO A;  2IX1 A;  1BBW A;  2N8N A;  3B6Y A;  4LF5 L;  1PYS B;  3H0G G;  4LF9 Q;  4WJ4 A;  4JI6 L;  1IBM L;  1N36 Q;  2N78 A;  5C0X I;  1E1O A;  2NN6 I;  4X62 L;  5C0X J;  4YWL A;  3HOV H;  5IP9 G;  2LXJ A;  4DV3 Q;  1N34 L;  4JI4 L;  4B3M Q;  3I4M G;  3JAM i;  2UXB Q;  3M3Y H;  3K7A H;  5C4J H;  1VQB A;  2FXQ A;  3TEH B;  1KL9 A;  1Q46 A;  3ICE A;  4GKJ L;  3S24 A;  1E24 A;  4R4I A;  4X66 L;  2OWO A;  1A0I A;  4DR4 Q;  1VQD A;  1Q1B A;  2Q2U A;  4GKK L;  1VQ6 A;  4A3E H;  2B63 G;  2Y0S G;  1JB7 A;  2D0O A;  4B3S Q;  2MFI A;  2Z0S A;  3PIO A;  5LMN W;  1QUQ A;  3EIV A;  2QEX A;  4RMF A;  2ZM6 L;  3HOW H;  1JJG A;  1R9T H;  4AQY Q;  3GTQ H;  1X65 A;  1XMO Q;  2UUA Q;  5C3E H;  5JJK A;  2E2H H;  5GAG C;  4A3K H;  5GRO A;  2AWN A;  4LFB L;  2R92 G;  4L5Q A;  2WB1 E;  2VW9 A;  3CW2 C;  1PFS A;  4UP9 A;  1CSP A;  1L2F A;  1WOC A;  3CF5 A;  1EOV A;  1QZG A;  1I6H H;  3CC4 A;  1XNQ L;  2QGQ A;  3M9B A;  4DAY B;  1TWC H;  1Y1V G;  1X3E A;  4HID A;  1VCI A;  4DR7 L;  3GTL H;  1SE8 A;  1BKB A;  3HOX G;  2R6G A;  4R4Q A;  1VQO A;  1CKM A;  1KRT A;  5BR8 L;  2DUD A;  1V1Q A;  3MXN B;  3NEL A;  2HQL A;  3BZC A;  2Z6K A;  2HT1 A;  4LFC L;  3ULL A;  4L5R C;  4APV A;  2D62 A;  1L1O C;  1C9O A;  4OWX B;  3PCO B;  3OTO Q;  3T1Y L;  3FKI G;  1WYD A;  5JJL A;  3E0E A;  4JBW A;  2VL6 A;  4DV5 Q;  1PH4 A;  1JJ2 A;  3J80 c;  1J5E Q;  2BH2 A;  3A5U A;  1BBU A;  2K5H A;  4UPA A;  2VNU D;  1VQI A;  1Z9F A;  1GVP A;  3M85 A;  2RHS B;  4GLA C;  4HJA A;  3HOY G;  3JC6 6;  2ZTC A;  4POF A;  5IYB H;  4JI0 L;  3I55 A;  1CKN B;  1O7I A;  1B7Y B;  3EBE A;  3G48 A;  4P71 A;  4BY1 G;  3TRE A;  1ASZ A;  4DR6 Q;  1IXR A;  3H0G H;  2Q2H A;  3BZK A;  4A3M G;  4C2M H;  4AYB G;  3M7N A;  4DK6 C;  4A3D H;  1P8L A;  5IP9 H;  1AH9 A;  1WI5 A;  4DR5 Q;  3GTJ H;  4QL5 A;  5IYD H;  2F52 A;  2NZH A;  1VQL A;  3CP0 A;  4XIG S;  5IYC G;  4DUY Q;  3CCL A;  4JYA L;  1Q8K A;  1Q12 A;  3F2D A;  3M4O H;  1PH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...