5C3EH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eH00
3AFQA 4LF6L 1A62A 3E9IA 4GKJQ 1SR3A 2JA6H 3STBC 2VQFL 5C4JH 1VQMA 4XTCS 1E1OA 5IYDH 4JBKA 3IRBA 3K8AA 4LWCA 2R7ZH 2GVAA 2JEBI 3UE1A 3DLLA 1IYJB 2Q2UA 4K0KQ 3FHWA 4DAMA 1X6OA 4XIGS 4IO9A 2JA5H 5E7NA 4KHPQ 4X65L 3GTLH 4OXPA 2RHSB 3PO2G 1T9HA 1IXRA 1Y14B 1CKNB 3A0JA 3EBEA 4JG2A 4L5QA 5FJ8G 4NXNL 3CCJA 2PI2A 4JI7L 2VUMG 1CSQA 3U4ZA 1Z9FA 2ZM6L 1L2FA 3I2ZA 1UE5A 3FKIH 5IYBH 3VDYA 2B3GA 1VQHA 3GD7A 5GAGC 4BBSG 3PGZA 2JA8G 3H3VI 1A8VA 5C4XH 1EIYB 1X56A 4OWWB 4JI2Q 2UU9L 3PV0A 3H0GG 3J7ZC 1N33L 1VQFA 4YHHL 2OWOA 3OW2A 1HR0W 3HKZE 2XGTA 2N3SA 1YIJA 4RG1A 3RR5A 1JB7A 3A5ZB 5DLQE 1M90C 4GS3A 4QQBX 4YWMA 3CPWA 5C3EH 4GOPC 3Q8DA 1LTLA 1NY4A 2E2IH 1L1OB 4IJHA 2KENA 4P72A 3M85A 3NBHB 1LYLA 4BBRH 1JJCB 5M3FG 4A3EH 1XMOL 1XMQQ 4IFDI 3T1HL 2IX1A 2K4KA 4GLVB 4BA2I 4JI3L 3CCQA 1U5KA 1PH1A 5GQOA 4R4IA 2HHHQ 1OXVA 3S16H 4LF7Q 3NENA 4OWXB 3GTKH 5IY0A 5M5WH 1YJNA 4JI1Q 5IE8A 3CC4A 1YEZA 1J5EL 3HOZG 3S1QH 4YCUA 1UWVA 3ZJYC 3GTPH 4JI8L 5GADC 2MQHA 4DV1L 1CSPA 3HOYG 2AHOB 1PH5A 3K7AH 4BXXH 5H1SE 2R7DA 4MNOA 3L2PA 3KLWA 4DV2Q 1VQEA 4UY8C 3U50C 1SMXA 2B63H 2R93H 4YCWA 4DR5Q 4BY7H 2CFMA 2R7FA 4DV4L 2JA6G 4A4IA 1X3FA 4YWKA 2I5LX 2K75A 4DV6L 1N32Q 2YTXA 1VQDA 2FXQA 3CCEA 3KF6B 4RMFA 3I56A 4A3GH 3OYYA 1TWFH 2ID0A 3GTGH 1QVCA 3CCLA 2IX0A 1IBMQ 4YY3Q 3U58A 3CAMA 2VQEL 3CD6A 3TEHB 3LGJA 1UE7A 4A3KG 4DR6Q 2WB1E 3PO2H 1S40A 4B3RQ 4LW1A 5M5YH 1JE5A 4DV3Q 1PA6A 4LF4Q 2ZTEA 5IYBG 4AYBE 2F4VQ 2OCEA 1VQBA 1Y1VH 1MJCA 1Q12A 3NELA 4GNXC 1I6HH 2NVQH 5C4XG 2CWPA 2KBNA 3AEVA 2BA0A 1HNXL 2JA8H 3T1YQ 1VCIA 3CCSA 4HIDA 5GROA 2ES2A 4DR2L 1PYBA 1RIPA 4X66Q 2QGQA 2UUCQ 2UXCQ 1JJGA 4IPCA 1J6QA 2EXDA 5C3EG 2A1AA 3ULJA 2EIFA 4HJ5A 4JI5Q 4KHPL 4JV5L 2DUDA 3CCUA 1BKBA 2CCZA 4JBMA 4JI6Q 3S17H 1ASZA 2MO1A 3CP0A 4BBRG 4A3EG 1WOCA 4EQ5A 3F2BA 4UP7A 2UXDQ 4P73A 4ALPA 2PQAA 4GN5A 5M3FH 5C0XJ 5AJ3Q 1HNZL 4DPGA 3TREA 3A74A 4DV5Q 2HIXA 3AFPA 1KAWA 4DR4Q 4A3MH 1Q1EA 1MKHA 1FL0A 1WJJA 2DGYA 3BU2A 3K0XA 1VQ6A 3F8TA 5IYCG 3RLFA 5BR8Q 1QZGA 1K9MC 4JI2L 1VQIA 5IP9H 2NVYH 4X62Q 2E2HH 3H3VH 4WJ3M 1I50H 5HGQA 1HR0Q 3I4NH 4PMWA 4AIMA 3G71A 5LMUL 3HOZH 3F1ZA 4BXXG 1JT8A 1WCMG 4L5TA 3HOYH 2Y0SE 1X54A 2C35B 2B63G 4BY7G 4JYAQ 5IWAL 4R4OA 4B3SL 1HNWL 2ZJRA 3GTJH 4LFCQ 2E2JH 1UE1A 1AE2A 1XMQL 1QZHA 1E3PA 3S2HH 1HZBA 1WYDA 1KIXA 3PSIA 3RZDH 2K52A 2K5NA 4A3GG 2HHHL 5K36G 2VY3A 3ULLA 3J81i 1VQ8A 1Q46A 2N8NA 4DR3Q 4QJFA 2R92G 1TWGH 1OTCA 1SLJA 4A3LH 3ER0A 3RNUA 1PH8A 3HOUG 4LFBQ 4P71A 4A75A 3DM3A 3RN2A 1YJ9A 4PG3A 4A3KH 2NN6I 2ZJPA 1P16A 1CKMA 4DV2L 1AH9A 2JQOA 2YYZA 3S1MH 4YCVA 2GVBA 3PUXA 1YI2A 2XTIA 1OXUA 4DR5L 1C9OA 1Y1WG 1XNQQ 4GKKQ 1Y1VG 5LMNQ 1Q7YC 1BVSA 1SE8A 1N32L 2B29A 5FLMG 4A3CH 3GTOH 4A3FH 3RLNA 4LUVA 2NZHA 1G291 4KLKA 2E8GA 2N49A 3G48A 2AWOA 4PZ8A 1PV4A 3CC7A 3I4MG 4A3DG 4DR7Q 1IBML 4YY3L 1LUZA 1TWCH 2K50A 1VQPA 3OTOL 1X65A 3W5OA 1YITA 1QVGA 4GLAC 1XPUA 4DR6L 3GO5A 4JOIA 2Z6KA 3KOJA 1HZAA 4B3RL 4JI4Q 4Y7NH 1X55A 1Q1BA 2NZOA 2F4VL 1K8GA 2VNUD 2D0OA 3CMAA 5GAHC 5HY6A 4A3MG 4IPGA 1OXTA 1BBWA 1ASYA 1CKNA 1UEBA 2YTYA 5IP9G 3GTMH 2LSSA 5IYCH 1PYSB 5J3BA 4GOPB 1XNRL 2JA7H 4A3IG 1TXYA 4IOAA 4X66L 3I4NG 1YZ6A 3PO3H 4Y52H 2RHQB 2OQKA 4JI5L 4JI0L 1WCMH 1E22A 4HJ7A 2OTLA 4LF6Q 3CCMA 1LM0A 1GVPA 3I4OA 4QY7A 3G4SA 4TQUS 4LF8L 5LMNW 1W2BA 1S72A 3KFUA 2UXDL 3CCRA 2NVXH 4NXMQ 1KRTA 4A93G 3HOWH 2R6GA 3KDFB 4IFDG 1XJVA 2AMCB 4DV5L 1K8AC 3H15A 1VQCA 4DR4L 3BJUA 2KCTA 1K3RA 1L1OA 3UDFA 1PH3A 3CC2A 1YBYA 1FJGQ 2IHFA 2R92H 4A3LG 4X65Q 4DUYL 4X62L 3G6EA 4LUZA 3M7NA 3AYHB 4B3ML 2LXKA 1HR0L 1CKOA 4JI7Q 3HOUH 4NXNQ 3L0OA 3TS0A 2F3IA 2ZM6Q 1I94Q 2A8VA 1IBKQ 5ELOA 1VQ9A 3S1RH 5C0XI 4AQYQ 4P74A 1B8AA 4A3BG 2D0PA 4LFCL 4GKJL 4TVAB 1Y1WH 4X64Q 4DK6C 4DUZQ 1PH6A 4A3CG 2UU9Q 4A3FG 1QVFA 4YHHQ 1V1QA 3UE0A 5FLMH 1K73C 3A5UA 4APVA 1N34Q 3KF8B 3CMEA 1CUKA 1XTDA 1VQOA 5JEAJ 4R4TA 4K0KL 3RN5A 4L5RC 2IY5B 1VS0A 3M9BA 4A3DH 4R4QA 1VQNA 3I4MH 2VL6A 3W1GA 2A19A 4DR1Q 1N8RC 1QUQB 3S2DH 1KC8C 4UP8A 1GM5A 1PVOA 4BY1H 3K80C 3KF6A 1XMOQ 3CXCA 4PZ6A 3T1HQ 4LFAQ 3E9HA 2WP8J 1NMFA 4GNXB 4JC0A 3ERSX 3EN2A 1KL9A 4DAYB 5GAEC 3UDGA 2WFWA 4GKKL 1EOVA 1OXSC 2PNHA 4QIWE 5C0XG 1X9NA 2UUAQ 4B3TQ 4LF5Q 4DKAC 4JCVE 2Z0SA 1I3QH 1U0LA 2Q2HA 4A3JG 1K0RA 2D62A 1J5EQ 4LF9Q 1R9TH 3K81C 3S1NH 5FLXc 4JI8Q 4A3IH 3D31A 2Q2IA 1O7IA 1NJIC 3W1BA 1PH4A 3BZCA 4IPHA 4C3HH 4DV4Q 1D8LA 4L5SA 1EIFA 1Q81C 3CF5A 4KI0A 4DV6Q 3HOWG 1EFWA 3KJPA 3TS2A 4C3IH 4HJ9A 2IT1A 1BBUA 4HJ8A 1EQRA 3CW2C 3U4VA 1PFSA 1N36Q 1TWAH 4LNQA 4A93H 1W3SA 2OTJA 4POFA 1QUQA 1GKHA 1N9WA 3JC66 4LF7L 2F52A 4JOIC 1S3OA 5ELNA 4QGUA 4JI1L 3M4PA 1HZ9A 2VQEQ 2YTVA 1SFOH 4GN3B 1AE3A 3HKZG 2EQSA 4IPDA 3PCOB 4UP9A 1IBLQ 5M3MG 1Q86C 4HIMA 3PIPA 2V1CC 4O0AA 1RL2A 1B7YB 2I5MX 1NMGA 4P75A 1KXLA 2ATWA 1HZCA 4R4CA 2YV5A 4KHZA 4NXML 1HNXQ 1WFQA 3K7UC 4IJLA 4DNIA 1FGUA 2L15A 1MJEA 4WJ4A 5JJIA 4DR2Q 4OX9Q 3KJOA 4LUOA 1YNXA 1FJGL 4JV5Q 1C7YA 1V9PA 2JK8A 2GN5A 4A76A 1VQ4A 1PHJA 4C2MH 4DK3C 1YHBA 4BY1G 4OO1I 2RF4A 4IOCA 4O2DA 2H5XA 3J80c 1I94L 1L1OC 4PZ7A 1IBKL 2NN6G 1HNZQ 1VQLA 5EAYA 2BH2A 4DV3L 4AQYL 4DV7Q 4HIKA 3KYHC 2E5LQ 4LF4L 1PH2A 3UDXA 4X64L 3ULPA 4DUZL 4YWLA 3PUYA 1JJ2A 2CWAA 1SRUA 1DGSA 2CKZB 3TQYA 4DV0Q 3T1YL 2UXBQ 3JAMc 2N78A 4A3JH 1N34L 1VQKA 2PI2E 4QL5A 4EX5A 5LMUQ 2BA1A 2ZTCA 3UDIA 1I5FA 2UUCL 5M5XH 2JJQA 2UUBQ 2UXCL 2PMZE 3HKSA 3M4QA 3NEMA 2IHEA 4C3JH 5IWAQ 1SROA 2KHIA 4DR1L 4JI6L 4JBWA 5JJLA 4B3SQ 2Q2TA 1HNWQ 1MIUA 1FVIA 2WB1G 3J7A5 1VQJA 2I0QA 1VQGA 4OO1G 3PUVA 4LFAL 3RLOA 4OONA 1GD7A 2VQFQ 1IL2A 3S14H 5C44H 5AJ3L 1G51A 3SGIA 5JJKA 1EUJA 4AYBG 2VS1A 2ZJQA 4R1JA 2UUAL 2KHJA 1C0AA 4B3TL 4LF5L 3GTQH 3HOVH 3J81j 2QEXA 2WAQG 3MXNB 5BR8L 1JMCA 4H02A 4LF9L 3HOXH 1E1TA 1UE6A 4DV1Q 1YVCA 4J15A 2ASBA 1EQQA 1EYGA 2JA7G 5IP7G 2NVTH 1HH2P 3CCVA 1M1KC 3BZKA 3STBD 3E0EA 1Q8KA 5M3MH 1E7ZA 4MTNA 3EIVA 4JYAL 4HJAA 4IFDJ 2ALYB 2JE6I 4GOPA 3MEFA 3M4OH 5IYDG 1X3GA 3GDEA 3F2CA 1YHQA 1N33Q 1OXXK 2R93G 1NE3A 1X3EA 2BH8A 3J81c 1EWIA 1KRSA 1N36L 2K5VA 3I55A 1VQ7A 2R7ZG 5IT9c 3M3YH 4X6AH 2PQAB 1K83H 2ZTDA 4FDBA 1KQSA 4BA1I 2JA5G 4ME3A 4DR3L 2YU9H 1A63A 1KHIA 3PF5A 1YHAA 3OTOQ 2MFIA 3PO3G 5JEAG 3PUZA 4LFBL 3CQZH 1B70B 2OQ0A 3KDFA 3RZOH 1VQAA 4JBJA 5FJ8H 2MNAA 2VUMH 2Y0SG 1IBLL 1IZ6A 2MO0A 1HJPA 4NB3A 3J80i 3AQQA 3FKIG 3B6YA 4JI3Q 3S24A 4OWTB 1XNQL 2AWNA 3PF4A 5LMNL 3ICEA 4AH6A 2VZAA 2WAQE 4BBSH 3L7ZC 1SN8A 2AKWB 2K5HA 4GLXA 3TRZA 4A3BH 1XNRQ 3H0GH 1D7QA 1VQ5A 1A0IA 3WWVA 3CPFA 4NPSA 4MZ9A 4OX9L 3JAMi 1XPOA 4JI0Q 4DR7L 1L0WA 2KCMA 4LF8Q 3HFZB 1Z47A 1PH9A 4GN4B 1XPRA 1V43A 1NTGA 1H95A 2HIVA 3D0FA 5C44G 2JA9A 4JI4L 1E24A 1WI5A 1YJWA 1Q82C 1KD1C 1G6PA 1P8LA 4DV7L 4UPAA 4HIOA 2E5LL 4POGA 2CQOA 2HQLA 1GO3E 2K14A 3PIOA 3HOVG 2VW9A 2LXJA 2JEAI 3PUWA 1TWHH 2RCNA 2QA4A 4DUYQ 1NBWA 3F2DA 4DV0L 2Z6KC 3HOXG 2HT1A 2UXBL 4B3MQ 4GNXA 3FP9A 1PH7A 3S15H 2UUBL 2I5HA 3I7FA 5IP7H
chains in the Genus database with same CATH superfamily
3AFQA 4LF6L 1I4QA 1U9RA 2PNRC 4K8IA 3E9IA 4ILWA 3HEJA 1SR3A 4GKJQ 3FRPB 4A3DB 3S2DB 2VQFL 2RDGA 1IKMA 5IYDH 3IRBA 5DNFA 2EDGA 4IALA 3GV6A 1L0YB 2B2WA 2Q2UA 4K0KQ 3FHWA 4KHPQ 1SMYD 4X65L 2F03A 3I4LA 1GHJA 1CKNB 5JEAH 3TZDA 3HRZC 2O5JC 1S5FD 5A35A 3FKIH 5IYBH 3H3VC 3VDYA 1VQHA 3GD7A 4BBSG 3PGZA 1D6EC 1CK1A 1N33L 4JI2Q 4XQNA 3H0GG 1VQFA 4YHHL 2OWOA 1CHPD 1DCZA 3NE5B 3J81L 3N52A 3RR5A 1M90C 4C3IB 1X3PA 3CPWA 5C3WA 1TWAB 2EXZA 1C8CA 1NY4A 1OO9B 1CT1D 3LWUA 4P72A 1BCPD 1G6ZA 1XMOL 2IX1A 3KBXA 4BA2I 1JICA 3NK9A 1PH1A 4R4IA 4I7AA 2KHSA 4KD4A 1J5EL 3S1QH 1Q90A 4YCUA 2AHOB 4JVZA 1STGA 4X3TA 5H1SE 1O80A 1VQEA 1SMXA 2B63H 2K5QA 2CFMA 2R7FA 4ABNA 4U673 1J8IA 2NZ1D 2JA6G 2K05A 3CRKC 4DV6L 2FXQA 3CCEA 4RMFA 1SNPA 4M1UB 4DK0A 4O42A 1TWFH 4KMUC 3K5MA 3GTGH 2HDMA 5C3XA 4RCNA 4YY3Q 1UE7A 3PO2H 1SXTA 1TIID 2K5DA 1MBYA 5M5YH 1PA6A 1JE5A 3GP7A 3NWSA 4LMQD 3MXNA 1NSNS 2X6GA 2B8FA 2NUCA 3IFDA 1VQBA 3NELA 4GNXC 4ZUIA 1VCIA 1HUMA 5GROA 1V1OA 2ES2A 4X66Q 1LTRD 4MTKA 2L12A 1J6QA 5C3EG 2L1BA 1K3BC 1MD2D 1KDBA 1D5ZC 1HCZA 5CMDA 3CP0A 1KLUD 4A3EG 1EY5A 4ALPA 4GN5A 5C0XJ 5EPKA 4RCOA 1ENAA 4K6LA 2HIXA 2BDOA 1MKHA 1RCVD 2HUGA 1GUNA 1VQ6A 3F8TA 1K9MC 4NKLA 3RLFA 3QG1A 2NVYH 4X62Q 3H3VH 3M4OB 5HGQA 3G71A 1MHWC 2Y0SE 1K83B 4JYAQ 4R4OA 3GTGB 1WTOA 1DD2A 2Z9HA 3GTJH 2IW3A 1STNA 3RZDH 1G8ZD 2VUMB 2HHHL 2VY3A 4DR3Q 2XNAC 1TWGH 1OTCA 2EYLA 3CHBD 3SK5A 3H09A 4N8FA 4A3BB 1YJ9A 4A3KH 2ZJPA 5CV7A 1AH9A 2Q8TA 1SDFA 4CKEA 1PZID 2GVBA 1CA5A 1XNQQ 1CQVA 2PW5A 5LMNQ 1GOZA 1BVSA 1EOTA 3E0JA 3GTOH 4LUVA 2NZHA 3TP5A 4KLKA 4IUTA 4HSPA 2G9HD 2N49A 5KRUA 3I4MG 4DR7Q 1LUZA 1TWCH 3SE0A 3W5OA 2FHTA 1XPUA 1LTAD 3ITPA 1TU2B 3KUPA 2OXPA 3GO5A 5E4WC 4JOIA 1FNUA 2B2VC 2DN8A 1I4PA 4B3RL 1EY7A 2BE5C 1K8GA 3J7AF 4IPGA 2E74C 1BBWA 1F77A 3ZYYX 1PTOC 3GTJB 2QW7A 1PYSB 5J3BA 5IYCH 2MUYA 4A3IG 2E76C 1YZ6A 5C4JB 2LY7A 2TSSA 2EYPA 4JI0L 2H1EA 1WCMH 4Q5VA 4LF6Q 4C3HG 3G4SA 4QY7A 3VR6A 2JA5B 1S72A 3OWFA 1FNWA 2NVXH 4NXMQ 3PO3B 4K8JA 4FNFA 4DV5L 1XJVA 1XWEA 1EYCA 4A3KB 3EFXD 3UDFA 1FJGQ 4A3LG 3NBHA 4IUVA 3K0YA 4C1NK 4X65Q 4DUYL 1K28A 3NXWA 1ZKOA 5CV6A 2R3ZA 4LUZA 3M7NA 1XXGA 3HOUH 5C4XB 1LTTD 3TS0A 4UAIA 2A8VA 1I6VC 2A68D 4HSVA 1TS3A 4X64Q 5DAUA 1PH6A 2O4XA 4A3FG 1QVFA 4YHHQ 4BBRB 4ZK9B 3K5NA 3M4YA 1VS0A 2LS01 4R4QA 4DR1Q 3I91A 4G7OC 1XMOQ 4PZ6A 5KNCA 4GNXB 3OMCA 3EN2A 2NN6H 3UDGA 3PQIA 1OXSC 1WCMB 1X9NA 2Q2HA 4A3JG 2QEJC 2D62A 1J5EQ 2KA7A 1STHA 5FLXc 1B4OA 4I65A 4ULLA 1QNKA 3C1EA 4KY6A 4DGZA 1PH4A 1LT3D 4IPHA 1GUGA 4E6IA 1Q81C 4KI0A 4DV6Q 3HOWG 1EFWA 4HJ8A 3I72A 4POFA 2SNMA 1GKHA 4CJ0B 4LF7L 5M9OA 1Y1VB 2EY1A 3HKZG 3VR2A 3PCOB 3K59A 1PTOH 3AU7A 1IBLQ 5M3MG 3OW7A 2V1CC 1B7YB 3E5SA 1F2YA 2EOTA 3S17B 1IW7D 1BNZA 5JJIA 3BYTB 4FXDA 4WJ4A 5BN3A 1TY2A 3QOJA 4OX9Q 3H91A 2SDFA 5DM73 1V9PA 4A76A 1VQ4A 4C2MH 3R2IA 3K6OA 4IOCA 2CH4W 1IKLA 1W6KA 3TDQA 1L1OC 5LL6S 1IBKL 2PW7A 2BH2A 3QB3A 1BXTA 4BS9A 3D4WA 5C0XH 2JYOA 3ULPA 4YWLA 2CWAA 3OIQA 2M00A 1DGSA 1S5CD 2CKZB 5KNBA 4QMGA 2JP1A 4JBKA 4QL5A 2BA1A 2UXCL 1WD1A 2UUBQ 2P5ZX 1KNEA 4C3JH 4FF1A 4JBWA 2K6AA 3J7A5 4C1NI 1GD7A 4C3IG 4N9PA 4K5XA 1EUJA 2VS1A 3VYSA 4LF5L 1PDQA 3GTQH 2F0WA 5HURA 3HOXH 4PQXA 4L8JA 2NWGA 4XQQA 1E7ZA 5CV5A 4CDCC 1F2MA 3GV3A 5IYDG 2AUKA 1LACA 3F2CA 1YHQA 1OXXK 1NE3A 2BH8A 1N36L 1EWIA 2F0JA 3DWPA 3HGBA 5EPLA 2YU9H 1KHIA 1B9NA 2A6ED 2MFIA 5DEHA 5JEAG 3MFGA 3PUZA 1B70B 2PZTA 4RA8A 3BDLA 3EVQA 5G3LF 1IZ6A 1HJPA 4NB3A 1QOHA 3AQQA 3FKIG 3B6YA 4OWTB 2AWNA 4IURA 2D2CC 4GLXA 4G57A 5JJZA 3OSOA 2K33A 1A0IA 2PQEA 3J7YW 1EEID 2XWJB 2NTTA 4PMCA 4JI0Q 3P1HA 3GTQB 1HHVA 2KCMA 5C4HA 4GN4B 2HIVA 4OO1H 1B53A 1G6PA 1YJWA 1KD1C 2DNEA 5NUCA 3OOCA 4POGA 1GO3E 4K2LA 1MSGA 5L37A 2JEAI 3S1RB 1TWHH 4DUYQ 3F2DA 3A7LA 5T1GA 3S15H 2XIWA 4DAYA 1HUNA 1EZ6A 5IIFA 3I7FA 5IP7H 1E2VA 1TS2A 4IUNA 2CH4A 5KEEA 3MZ5A 1JORA 3STBC 1SYBA 4F87A 4WJWA 1E1OA 3G6JB 2GVAA 2JEBI 3UE1A 3T53B 4OXPA 3PO2G 4FXGC 4DV1L 5TSSA 5FJ8G 2A5HA 2VUMG 3R8BA 1CSQA 1RTNA 2RDFA 1R9TB 1Z9FA 2ZM6L 2F0NA 4A3IB 4CDDC 1L2FA 1SJHD 1XX8A 3ND8A 4A3BG 4J8QA 4C3HB 1H9KA 2UU9L 1UEAB 1KTKA 1RKNA 1JWSD 3TBIB 4KN4C 5DLQE 4GS3A 4GOPC 4TKOB 3Q8DA 4AYBB 5DM63 2KCCA 2DJGC 1L1OB 2CW0D 3M85A 3SEBA 1LYLA 2WAQB 3KLRA 3T1HL 2K4KA 5I6WA 4GLVB 3S15B 2EPBA 5BN4A 4JI3L 3CCQA 3S16H 5GQOA 5C5LA 2D9UA 2MHVA 1WD0A 2AQ1B 2LMCB 4LF7Q 4OWXB 1SYEA 3GTKH 1YJNA 5IE8A 3CC4A 3TSSA 1LTBD 5KGUA 3R93A 3GTPH 3QR8A 1PH5A 4BXXH 2R7DA 4MNOA 3KLWA 4UY8C 4MHEA 4DR5Q 4BY7H 2KVMA 4RGOS 4DV4L 1QJOA 1HA5A 1V1PB 1X3FA 1DZ1A 2I5LX 2F0MA 2K75A 3I73A 4M8AA 3Q22A 4RAUC 2WKDA 4A3GH 5K36H 3OYYA 4P2CB 4UHVA 1QVCA 2IX0A 1IBMQ 1HPCA 3U58A 4NP5A 4RGMA 1H9JA 5E4XA 5IGBA 3TEHB 5CC4A 4A3KG 2WB1E 1TS5A 1AZQA 4A3JB 3E6ZX 4FP5D 2F4VQ 1I6HH 5C4XG 2BA0A 2JA8H 4HIDA 3CCSA 1SE2A 3URYA 2QGQA 5EPJA 2UXCQ 5C44B 4FF3A 2RKSA 2A1AA 2Z4IA 2DUDA 3HOVB 3P7JA 1ASZA 3SR1A 4BBRG 3H94A 1WTWA 1PRTD 2UXDQ 4P73A 2PQAA 3GTPB 5M3FH 3RD4A 1JQYD 4DPGA 1EL0A 1G2SA 2NVTB 1D2BA 1E0BA 3AFPA 4DR4Q 4A3MH 1FL0A 5M3MB 5IYCG 3FVQA 5IP9H 2Z6BA 2E2HH 3D6CA 1I50H 1SEBD 3AB9A 1HR0Q 3I4NH 4PMWA 2NB0A 3SK8A 5AFWA 1WCMG 1V8QA 5A2QE 4GZYC 2C35B 3NUCA 1Y69U 1RDPD 5G3LD 1F2LA 4FF4A 2ZJRA 1AE2A 1XMQL 1E3PA 3CQZB 3RZOB 1JR0D 3PSIA 3R3OA 1C4QA 3ULLA 3J81i 1FR3A 1ZEQX 2EE1A 4QJFA 2JSOA 2KEDA 3MFYA 3VR3A 1SLJA 3T56B 3RNUA 1PH8A 3HOUG 4P71A 2JA8B 3RN2A 4DV2L 2JQOA 4YCVA 3PUXA 2E75C 1OXUA 2XTIA 3D3RA 2ZXPA 3VYRA 1Y1VG 1N32L 3TMEA 2B29A 5FLXE 3OMGA 4DAVA 5M3FB 2BCOA 1Z6HA 2AWOA 3CC7A 1ZYRD 5E3FA 3OTOL 3U9OA 3K58A 4DR6L 4IUQA 1SNDA 2TMPA 4Y7NH 1ILPA 1Q1BA 3SXHA 3HG9A 1ESRA 4X3KA 1ASYA 1CKNA 4GOPB 1XNRL 2B8GA 4V190 2RHQB 1B2TA 4CBVA 1YNNC 4JI5L 4HJ7A 3CCMA 1LM0A 1GVPA 3I4OA 4WFN3 3PIP3 4TQUS 4LF8L 4KKTA 1W2BA 4RH6A 5IODA 3KFUA 2R6GA 4IFDG 2AMCB 1PFBA 2FMMA 3H15A 1VQCA 4DU9A 2KCTA 4DK1A 2A73B 1BQQT 3NQTA 1PH3A 1YBYA 2IHFA 2R92H 1EYAA 3FKIB 5ELDA 2MP1A 1CKOA 4ZCKA 2ZM6Q 1I94Q 3HS0C 1VQ9A 4AQYQ 4ZYSA 4LFCL 3TP8A 4TVAB 2DNCA 5I2XA 4OGQC 4DUZQ 4A3CG 2UU9Q 2B2YC 1TVXA 2HQEA 1V1QA 2B2UA 1PXUA 3KF8B 1C48A 4Z9CB 1VQOA 4R4TA 1IL8A 3W1GA 4FVMA 1H9SB 4BY1H 2K28A 2WACA 3T1HQ 4LFAQ 2K1BA 2WP8J 3S1QB 1LTSD 3ERSX 1F9RA 4GKKL 1EOVA 5C0XG 2PNHA 3K57A 3C3LA 4JCVE 2B63B 4OIKA 4LF9Q 3K81C 5F2DA 3S1NH 3MVVA 5EQ0A 3D31A 1QB5D 2Q2IA 3W1BA 3BZCA 1O7LA 1RF2D 1TWFB 2HD3A 1D8LA 4DV4Q 2R92B 5JPMC 3EJIA 1EY4A 3CF5A 1O78A 3KJPA 1BBUA 3WOFA 4LNQA 4DN4M 2C5CA 3PO2B 3VYUA 3DEPA 2DY7A 4CJ2C 1N9WA 5M5YB 2F52A 1S3OA 4JI1L 2RDHA 1HZ9A 3MWYW 4UDUC 1SFOH 4GN3B 2FJ2A 3VR4A 5COYA 4UP9A 1SAPA 2OT2A 4QUCA 3N6RA 5ELFA 4O0AA 1RL2A 2F0UA 3MEHA 4IQZA 1HZCA 2FFKB 4R4CA 1W6JA 3NBIA 1B1ZA 3RUZA 1S5DD 3K7UC 1MJEA 1FGUA 2L15A 4I7ZC 3KJOA 4LUOA 3I70A 2QF7A 1EQVA 4DK3C 2ZXRA 3TP7A 3A55A 3BYYB 2NVYB 3J80c 3DWAA 3MXUA 1CTMA 5A2QL 4LF4L 4DV7Q 4HIKA 2E5LQ 1VF7A 2Z1CA 3UDXA 5CV8A 4IZ8A 1YNJC 3Q6SA 2UXBQ 1SE3A 1N34L 3T4AC 5FK9C 3DUZA 2KEEA 3UDIA 2ZTCA 4LAAA 1I5FA 4EX5A 5M5XH 2UUCL 3RZDB 5C6AA 3NEMA 2IHEA 1SROA 4JI6L 2VB2X 1TWGB 4XT1B 5EBDA 1FVIA 3CU7A 2I0QA 1VQGA 4OO1G 4OONA 2EYHA 2V4DA 2VQFQ 1IL2A 1RHPA 1HTLD 1WTHA 2XRQD 4KK7A 2A69C 4AYBG 5JJKA 2M9VA 2ZJQA 4OHJA 2UUAL 2H4OA 4B3TL 5CV4A 2DJFC 2QEXA 2B2TC 2WAQG 4ID6A 3BDCA 4LK1C 5CORA 1CHQD 5IP7G 5FLXL 3GTOB 1UUPA 1HH2P 4IUUA 3CCVA 1TKWB 1GUWA 4KD3A 2JE6I 1TWCB 3W2DA 1X3GA 1PTOF 1N33Q 4EGVA 1PMRA 1KRSA 3I55A 3M3YH 4X6AH 5IT9c 4ZLTF 4HCSA 4FYDA 1A63A 2PZWA 2RSNA 3OTOQ 1NNXA 1MSHA 3S9WA 1VQAA 4JBJA 4ZQ3A 3P75A 3S24A 1H9RA 1NAPA 5C5MA 1STEA 3QOLA 2WAQE 4BBSH 4KJNA 3A8KE 1XNRQ 2QDLA 3H0GH 1D7QA 1VQ5A 4DFAA 4KN7C 1MGSA 4KHVA 2NVXB 1XPOA 4OEMB 2MPMA 4EQNA 5IGDA 5EGTA 1TS4A 3K5LA 4LF8Q 1ET9A 3HFZB 5E1FA 3D6WA 1F2ZA 1V43A 1NTGA 1J9OA 1H95A 5C44G 3NWTA 2OEOA 4JI4L 1WI5A 3HOUB 1SYDA 2FMCA 4B9XA 4HIOA 2CQOA 2F0QA 4S3SA 2K14A 3HOVG 2PMZB 5IGCA 4XQJA 2QA4A 1NBWA 4DV0L 1DOKA 3QWNA 4GNXA 2EJMA 1VMCA 2X69A 3C2PA 3CRLC 2JA6H 1DOMA 4XTCS 3MTSA 3K8AA 1F9SA 1KDAA 3WOEA 4RHRA 3A56A 4G7ZC 4L63B 5EKKA 4J1MA 4CDFC 1X6OA 4DAMA 5E7NA 1GJXA 1HRJA 4X3UA 3MXPA 1JC7A 1SNMA 3U9SA 3QJYA 1IXRA 1T5EA 3CCJA 3EBEA 4JI7L 1I4RA 2PI2A 3LWEA 3D8GA 4F88A 4JW0A 1UE5A 1VF5C 5GAGC 2JA8G 1A8VA 1EIYB 1B9MA 1EU3A 1X56A 4OWWB 1DOLA 2D5DA 1ILQA 1HR0W 3HKZE 1YIJA 2N3SA 1JB7A 4RG1A 3A5ZB 4YWMA 5IGEA 5C3EH 2E2IH 1H9MA 1PLFA 2HCIA 2KENA 4ZKBB 2F0LA 1SYGA 1ICWA 1JJCB 3FPUB 5JPNC 5M3FG 4A3EH 4IFDI 4DAPA 5J39A 1PRTC 1PTOB 2HHHQ 1OXVA 1G91A 5LHY1 2K01A 2RQXA 4JI1Q 1BOSA 1YEZA 1UWVA 3ZJYC 4TRDA 4JI8L 2MQHA 1CSPA 3T51B 3K7AH 5ELCA 3L2PA 4QUFA 4A4IA 1TQOA 1PZKD 1O7ZA 4C2MB 2YTXA 1VQDA 3KF6B 1LABA 2NTSA 2B2VA 4RFBA 2Y0SB 2CVRA 5KNDA 3CCLA 4B9WA 3CD6A 3LGJA 3DM1A 3R2TA 1SMYC 4B3RQ 2JXMB 4LF4Q 1B44D 5IYBG 3SVMA 4C3JB 5BN5A 3SDZA 2NVQH 4HCEA 3AEVA 3JAME 5JVG3 1E2WA 4DR2L 1RIPA 2UUCQ 5EKLA 2EXDA 3ULJA 4HJ5A 5CV9A 4KHPL 4JI6Q 1BKBA 1LLRD 2BE5D 3F2BA 4UP7A 1ZYRC 2B2WC 3HOXB 1RD9D 4KKSA 3TREA 2XVSA 3A74A 4K5WA 4DV5Q 1BCPC 4HEDA 3BU2A 3K0XA 4JI2L 1WTXA 4XT3B 3HOZH 3Q24A 2F0DA 3F1ZA 1JT8A 4L5TA 3NP8A 3HOYH 1X54A 4DXGA 2B63G 2XSCA 2XWBB 4HMIA 5IWAL 2YU9B 2OF1A 4QF4A 3MA2B 3EA6A 1FNVA 5LL6X 3S2HH 1S4ZA 1E2ZA 1HZBA 2K52A 1ONLA 2K5NA 1VQ8A 1Q46A 2WV6D 2R92G 1D1KA 5ISRA 3V2TA 4A3LH 3ER0A 1WTPA 2VB3X 3DM3A 3X3NA 1P16A 2YYZA 3S1MH 1YI2A 1WTRA 1Q7YC 1SE8A 4PNYA 1ENCA 2PZUA 4A3FH 3RLNA 1G291 3NTIA 1U4PA 3IFTA 4CKBA 2ICIA 3G7LA 1PV4A 1A2UA 4YY3L 2K50A 2G9DA 2RVLA 1YITA 1QVGA 3PMFA 1JE4A 1EU4A 1KNAA 1TWHB 3KOJA 4FF2A 4JI4Q 1D1IA 2WINB 3HOZB 1A2TA 2K7VA 1X55A 2NZOA 1O7YA 1EWCA 5GAHC 5HY6A 1OXTA 4RWSC 1UEBA 2YTYA 4F7XA 3GTMH 3I90A 3S2HB 1TXYA 4X66L 1D5MC 3QO2A 4Y52H 2Z8LA 1WVLA 2OTLA 4U68A 2M2LA 1II3A 5LMNW 1PRTB 4ZKCB 1HXYD 3W3AA 2HCCA 3CCRA 1SNOA 1KRTA 3HOWH 3KDFB 1EY8A 3O13A 2Q8IB 1L1OA 3BS1A 3CC2A 1MI2A 3BDOA 5I9PA 4OELB 1D5XC 1SYCA 1QG7A 4X62L 3AYHB 2LXKA 4JI7Q 3L0OA 2L11A 3OWEB 2NYZD 1SBBB 2AQ3B 3J80E 1IBKQ 2O2LD 1GUTA 1VDZA 1B8AA 4P74A 1GUOA 1Y1WH 1LV9A 1HA6A 4DK6C 5FOBB 1JB3A 5FLMH 1GXDC 1K73C 3A5UA 4APVA 3BVZA 1XTDA 3CMEA 2WKCA 3RN5A 3S16B 3M9BA 1V1PA 3S2DH 4A3DH 1QUQB 1PVOA 3GTKB 1GM5A 1S5ED 3SHLA 3LNNA 3CXCA 3E9HA 3IL8A 3TZUA 4WRDA 2L0CA 1KL9A 2AQ2B 2JN4A 3ND9A 4LF5Q 4DKAC 4BY7B 1I3QH 1U0LA 1LT6D 3CKIB 4RKLA 1K0RA 1JCKB 5J22A 4IN3A 4JI8Q 1ICFB 1LO5D 1O7IA 1NJIC 2EYFA 3VA5A 4A3GB 4TSSA 4L5SA 4CDEC 1BCPB 1EIFA 1SSOA 1R4PB 5IGGA 2N88A 3TS2A 4C3IH 2IT1A 3CW2C 1N36Q 3U4VA 1T5XD 5IT9E 1TWAH 4A93H 1W3SA 2OTJA 1PFMA 3V96A 1AW7A 1QUQA 3JC66 4CGYB 4JOIC 1Y1WB 3M4PA 1I6HB 1Y8NB 2IX3A 1EFID 2F0EA 2F3VA 4HIMA 1Q86C 1ET6A 1NR4A 1CI3M 2I5MX 1KXLA 1F9PA 2ATWA 2YV5A 4HAEA 4KHZA 1QCBD 4NXML 2A68C 4V0BA 4DR2Q 2X6LA 3SK4A 3DHQA 2LFNA 4RKBA 2A6HD 4BWGB 3TP6A 1FJGL 1C7YA 2JK8A 2GN5A 4A3MB 1YHBA 1I3QB 1EEFD 2RF4A 4X3SA 2E2HB 1I50B 4K14A 1VQLA 4PZ7A 2NN6G 1CZWA 5EAYA 3I4NB 4DV3L 3KYHC 4X64L 2NBFA 2O5IC 2MJ8A 4XYQA 3T1YL 3I8ZA 3JAMc 1VQKA 2PI2E 4A93B 1STBA 2JJQA 2PMZE 2F0FA 5IWAQ 4DR1L 4ZRZA 1UAPA 4QIWB 2Q2TA 1Y8PB 2L9HA 1AZPA 1QWYA 3RLOA 5IOCA 3S14H 3T13A 5AJ3L 1UNSA 3SGIA 4R1JA 3MXNB 5BR8L 1JMCA 4H02A 3NTHA 1XYIA 1E1TA 1UE6A 4DV1Q 1YVCA 2ASBA 2SEBD 3RMHA 1EYGA 3EROA 1SNCA 3TN2A 1M1KC 1K8MA 4F8MA 3BZKA 3STBD 2PPBC 1M8AA 4MTNA 1JOKA 4IFDJ 2ALYB 4GOPA 4XXEA 3DMUA 3NQIA 3M4OH 2F0GA 1LT4D 1X3EA 3J81c 4NMZA 1K83H 2ZTDA 1BDOA 4BA1I 4Y7NB 1IW7C 4ME3A 5JVH3 1YHAA 1Q3LA 2K04A 4LFBL 2OQ0A 5KYLA 4EQOA 5FJ8H 2N55A 2MNAA 2VUMH 2Y0SG 1IBLL 2KJXA 1ESFA 4ODGA 3J80i 4JI3Q 5D3DA 4DNRB 1CZGA 1I4GA 2VZAA 1SN8A 2AKWB 4A3BH 3WWVA 1NR2A 3E3XA 4NPSA 4MZ9A 4OX9L 3Q0AA 3S14B 1DJRD 4C3JG 1JWMD 2MGSA 3T16A 1QE6A 1XPRA 2F4IA 3KF8A 1K8OA 1E24A 3J80L 4OL7A 4UPAA 5T1IA 2HQLA 1BBXC 2K03A 1NCVA 2VW9A 2WIIB 1H9SA 3PUWA 2RCNA 3BG3A 2Z6KC 1EYDA 4EVOA 3HOXG 1GUSA 4G7HC 2FINB 3WDNA 3MC0B 1B50A 4PV1C 1PH7A 2UUBL 3MXGA 2ZT9C 2DY8A 2I5HA 2JA7H 1AEXA 4KJOA 1A62A 2EZVA 3D4DA 1G2TA 1JWUD 1M4VA 5C4JH 1CM9A 1VQMA 4BY1B 2AUJD 4LWCA 2R7ZH 4EQPA 3DLLA 1IYJB 2E2DC 4DNTB 4IO9A 2JA5H 4XIGS 2I46A 2I07B 3GTLH 2RHSB 4HMJA 2R61A 1T9HA 1Y14B 4L5QA 3A0JA 3PO3H 4JG2A 4NXNL 2GA4B 1Q8IA 3U4ZA 2A6EC 1ML0D 3S1NB 4N8X1 4XDXA 1LTGD 1AP0A 3I2ZA 2Z4HA 2B3GA 2EYOA 3PIO3 3H3VI 5C4XH 5JAVA 3PV0A 3J7ZC 3OW2A 2WB1B 4K5VA 2XGTA 2J0TD 5IT9L 3M7GA 1FD7D 4QQBX 3QIAA 2QILA 4ZUJA 1LTLA 2L55A 4IJHA 1SNQA 3NBHB 4BBRH 3BZDB 1XMQQ 5IGFA 1RODA 1SFOB 3KLSX 3H6MA 2JA7B 1U5KA 3DXJC 2BOSA 3NENA 5IY0A 1JOOA 5M5WH 1EY0A 2KCNA 2L4NA 3HOZG 3HP3A 5GADC 3HOYG 1I4HA 4K6DA 4DV2Q 2R7ZB 4KY7A 3U50C 2IJ0A 2R93H 2KQ3A 4YCWA 1R4QB 2IPKD 4H44C 1KAAA 2IL8A 4YWKA 3GTLB 1N32Q 1U4RA 1EY9A 3I56A 2VXWA 3DWQA 4QB4A 5K5PA 4CJ1B 3DEOA 2ID0A 4HR7B 2F0HA 2EVBA 4J6HA 2XN9C 3CAMA 2VQEL 3VA7A 1CA6A 4KV6A 4DR6Q 1X32A 1S40A 5CBAE 1DONA 1QILA 4LW1A 2BDNA 3L3OC 4DV3Q 2ZTEA 4AYBE 5M5XB 1RTOA 2OCEA 1Y1VH 1MJCA 1Q12A 1SYFA 2CWPA 2KBNA 4H7BA 1HNXL 2SOBA 4N9TA 3T1YQ 3LX0A 5JOBA 1PYBA 1B3AA 3UI2A 1JJGA 4IPCA 3Q23A 2F0OA 2EIFA 4JI5Q 1EZ8A 4JV5L 1A3TA 3CCUA 4JBMA 2CCZA 3S17H 1IHZA 5M5WB 2MO1A 2F0TA 1Y8OB 1WOCA 4EQ5A 1SE4A 1A3UA 2Q8RE 1TR5A 2CW0C 5AJ3Q 1HNZL 3C1FA 2EJFC 1KAWA 1Q1EA 2R93B 1WJJA 2DGYA 1QZGA 4YIJA 5BR8Q 4IUPA 1VQIA 1YNND 4LJZC 4WJ3M 2IWHA 4AIMA 4FXKC 5LMUL 2B2YA 4BXXG 3M3YB 4BY7G 4B3SL 1HNWL 2ZXOA 1L0XB 4LFCQ 2E2JH 1UE1A 5KIXA 1QZHA 3GQBA 1U4LA 1WYDA 1KIXA 4IFDH 1PFNA 1HQMC 4A3GG 5K36G 2N8NA 5D3IB 4PMBA 1BO0A 4LFBQ 4A75A 2LKVA 4BBSB 2EYJA 4PG3A 2NN6I 3H0GB 1CKMA 4DR5L 1C9OA 4MN3A 1Y1WG 4GKKQ 3AMUA 5FLMG 2EY6A 4A3CH 1PYWD 1ZXTA 1NUCA 2E8GA 3G48A 4ZAIA 4PZ8A 4A3DG 4R9WA 1IBML 2QKIC 1VQPA 1X65A 4GLAC 1VMPA 2Z6KA 1HZAA 5EJWA 1EIGA 1S5BD 2F4VL 2VNUD 2D0OA 3A8IE 3CMAA 4A3MG 4R8IA 3EQLC 3F2UA 1IYVA 5IP9G 2LSSA 4ME5A 2E2JB 4IOAA 2JA6B 2B39A 3I4NG 2OQKA 1E22A 2L5TA 4H13C 1A6XA 1WTQA 1EY6A 2UXDL 1KDCA 1STYA 4A93G 4L6TB 1K8AC 4DR4L 2J7ZA 3OIPA 3BJUA 1K3RA 3KK7A 1RJTA 2KOLA 3G6EA 3MAQA 4B3ML 1HR0L 1HFNA 3OHXC 3FPPA 4JK1C 4NXNQ 2F3IA 4B08A 1BR9A 1PRTF 5ELOA 3A8JE 3VYTA 3S1RH 5C0XI 3NHHA 2RCFA 2D0PA 5C3EB 5CYUA 4GKJL 1F9QA 3FDTA 1TY0A 5EKIA 4RHSA 2E2IB 1EQTA 1LTID 5I9OA 3UE0A 3NTKA 4A3EB 1EWHA 1N34Q 1CUKA 5JEAJ 4K0KL 2IY5B 4L5RC 2F1MA 3I4MH 1VQNA 2VL6A 1N8RC 2A19A 2A6HC 1BF4A 1KC8C 4UP8A 5HGTA 3K80C 3KF6A 2B2TA 1HTPA 1DXMA 1NMFA 4JC0A 5CBEE 2RSOA 4DAYB 5GAEC 1YNJD 2WFWA 3K7AB 4CKCA 1PTOD 4OIJA 4QIWE 2UUAQ 4B3TQ 2F0KA 2SNSA 2Z0SA 5ELEA 1DM0B 1R9TH 3A54A 2CQAA 4A3IH 3L9AX 1KABA 1U4MA 4JPBW 5FO7B 3FEWX 1IYUA 4C3HH 4WORA 2ICEC 5I2YA 5FO8B 2A69D 2F0IA 3A7AB 4R8NA 4NDXA 3J81E 4HJ9A 2F0VA 1EQRA 3NSWA 5CR3A 1PFSA 5FKAC 4DA2A 5ELNA 4QGUA 4K2KA 2VQEQ 2YTVA 3BVGA 1AE3A 2PYKA 2NVQB 2EQSA 4IPDA 1A3VA 2QCPX 4C56C 2QDBA 1ENFA 3PIPA 1BCPF 5FO9B 4P75A 1NMGA 4RGTA 1I4XA 5ELBA 3I4MB 1HNXQ 1WFQA 4IJLA 4DNIA 4HTHA 3V05A 4DXFA 1AFPA 5J1ZA 4G4KA 1YNXA 3IAYA 2PO4A 2C9OA 4JV5Q 3MHBA 1LT5D 1PHJA 4BY1G 4NW2A 4OO1I 2EY5A 4O2DA 2H5XA 1I94L 1HNZQ 1EIHA 4AQYL 2F0SA 2CHBD 3HOYB 5I6YA 1PH2A 4XYOA 4DUZL 5I4DA 3PUYA 2EYMA 1JJ2A 1SRUA 3TQYA 4DV0Q 1JOQA 2N78A 4A3JH 3IKJA 3SK6A 5LMUQ 2A74C 2RBMA 3P20A 3HKSA 3KBGA 3M4QA 2KHIA 5JJLA 4B3SQ 1HNWQ 1MIUA 2EY2A 2B2UC 5D14A 2WB1G 4KKUA 5KYIA 1VQJA 3PUVA 4LFAL 1K0SA 5C44H 2PCFB 1G51A 2RA4A 1AN8A 1Z7TA 4HN7A 2KHJA 1C0AA 3S1MB 4MIUA 3HOVH 3J81j 3D4RA 3ONAB 4CHTB 2F3WA 2XRSD 4LF9L 1XTCD 1WTVA 1KLGD 4J15A 3NPPA 1EQQA 3HZXA 2JA7G 4A3FB 2NVTH 1FGBD 4O1NA 3E0EA 1Q8KA 5D65A 5M3MH 4QCLA 4JYAL 3EIVA 4HJAA 3K5OA 3VR5A 3X3MA 3MEFA 2ENBA 3GDEA 2J4XA 3BVMA 2K5WA 2KUMA 1VQ7A 2R7ZG 2K5VA 2F0PA 3KLSA 3FMCA 2PQAB 4FDBA 1KQSA 1HQRD 2JA5G 4DR3L 4FO2A 3PF5A 1DYQA 1SJED 4DF7A 3PO3G 1GHKA 3CQZH 3RZOH 3KDFA 1CFMA 3GTMB 1B3QA 2KECA 2MO0A 3C46A 1XNQL 3J7AV 3PF4A 5LMNL 2HDLA 3ICEA 4AH6A 1BUVT 3L7ZC 1A15A 2K5HA 3TRZA 3OPOA 1FYCA 3CPFA 3JAMi 3HOWB 1TT2A 4DR7L 4Q0FA 5EBCA 1L0WA 4KY5A 1HFGA 1Z47A 1PH9A 4KTAA 4RGNA 3I3CA 4H0LC 3D0FA 2JA9A 3ERQA 1Q82C 3HKZB 1P8LA 4DV7L 2E5LL 1STAA 3PIOA 1X3QA 5CGKA 1CQFA 2LXJA 1PZJD 2EJGC 2K32A 2HT1A 2UXBL 2G5DA 5C4ZA 4B3MQ 3FP9A 3JAML 1QNUA 2R93G
chains in the Genus database with same CATH topology
3AFQA 4LF6L 1A62A 3E9IA 4GKJQ 1SR3A 2JA6H 3STBC 2VQFL 5C4JH 1VQMA 4XTCS 1E1OA 5IYDH 4JBKA 3IRBA 3K8AA 4LWCA 2R7ZH 2GVAA 2JEBI 3UE1A 3DLLA 1IYJB 2Q2UA 4K0KQ 3FHWA 4DAMA 1X6OA 4XIGS 4IO9A 2JA5H 5E7NA 4KHPQ 4X65L 3GTLH 4OXPA 2RHSB 3PO2G 1T9HA 1IXRA 1Y14B 1CKNB 3A0JA 3EBEA 4JG2A 4L5QA 5FJ8G 4NXNL 3CCJA 2PI2A 4JI7L 2VUMG 1CSQA 3U4ZA 1Z9FA 2ZM6L 1L2FA 3I2ZA 1UE5A 3FKIH 5IYBH 3VDYA 2B3GA 1VQHA 3GD7A 5GAGC 4BBSG 3PGZA 2JA8G 3H3VI 1A8VA 5C4XH 1EIYB 1X56A 4OWWB 4JI2Q 2UU9L 3PV0A 3H0GG 3J7ZC 1N33L 1VQFA 4YHHL 2OWOA 3OW2A 1HR0W 3HKZE 2XGTA 2N3SA 1YIJA 4RG1A 3RR5A 1JB7A 3A5ZB 5DLQE 1M90C 4GS3A 4QQBX 4YWMA 3CPWA 5C3EH 4GOPC 3Q8DA 1LTLA 1NY4A 2E2IH 1L1OB 4IJHA 2KENA 4P72A 3M85A 3NBHB 1LYLA 4BBRH 1JJCB 5M3FG 4A3EH 1XMOL 1XMQQ 4IFDI 3T1HL 2IX1A 2K4KA 4GLVB 4BA2I 4JI3L 3CCQA 1U5KA 1PH1A 5GQOA 4R4IA 2HHHQ 1OXVA 3S16H 4LF7Q 3NENA 4OWXB 3GTKH 5IY0A 5M5WH 1YJNA 4JI1Q 5IE8A 3CC4A 1YEZA 1J5EL 3HOZG 3S1QH 4YCUA 1UWVA 3ZJYC 3GTPH 4JI8L 5GADC 2MQHA 4DV1L 1CSPA 3HOYG 2AHOB 1PH5A 3K7AH 4BXXH 5H1SE 2R7DA 4MNOA 3L2PA 3KLWA 4DV2Q 1VQEA 4UY8C 3U50C 1SMXA 2B63H 2R93H 4YCWA 4DR5Q 4BY7H 2CFMA 2R7FA 4DV4L 2JA6G 4A4IA 1X3FA 4YWKA 2I5LX 2K75A 4DV6L 1N32Q 2YTXA 1VQDA 2FXQA 3CCEA 3KF6B 4RMFA 3I56A 4A3GH 3OYYA 1TWFH 2ID0A 3GTGH 1QVCA 3CCLA 2IX0A 1IBMQ 4YY3Q 3U58A 3CAMA 2VQEL 3CD6A 3TEHB 3LGJA 1UE7A 4A3KG 4DR6Q 2WB1E 3PO2H 1S40A 4B3RQ 4LW1A 5M5YH 1JE5A 4DV3Q 1PA6A 4LF4Q 2ZTEA 5IYBG 4AYBE 2F4VQ 2OCEA 1VQBA 1Y1VH 1MJCA 1Q12A 3NELA 4GNXC 1I6HH 2NVQH 5C4XG 2CWPA 2KBNA 3AEVA 2BA0A 1HNXL 2JA8H 3T1YQ 1VCIA 3CCSA 4HIDA 5GROA 2ES2A 4DR2L 1PYBA 1RIPA 4X66Q 2QGQA 2UUCQ 2UXCQ 1JJGA 4IPCA 1J6QA 2EXDA 5C3EG 2A1AA 3ULJA 2EIFA 4HJ5A 4JI5Q 4KHPL 4JV5L 2DUDA 3CCUA 1BKBA 2CCZA 4JBMA 4JI6Q 3S17H 1ASZA 2MO1A 3CP0A 4BBRG 4A3EG 1WOCA 4EQ5A 3F2BA 4UP7A 2UXDQ 4P73A 4ALPA 2PQAA 4GN5A 5M3FH 5C0XJ 5AJ3Q 1HNZL 4DPGA 3TREA 3A74A 4DV5Q 2HIXA 3AFPA 1KAWA 4DR4Q 4A3MH 1Q1EA 1MKHA 1FL0A 1WJJA 2DGYA 3BU2A 3K0XA 1VQ6A 3F8TA 5IYCG 3RLFA 5BR8Q 1QZGA 1K9MC 4JI2L 1VQIA 5IP9H 2NVYH 4X62Q 2E2HH 3H3VH 4WJ3M 1I50H 5HGQA 1HR0Q 3I4NH 4PMWA 4AIMA 3G71A 5LMUL 3HOZH 3F1ZA 4BXXG 1JT8A 1WCMG 4L5TA 3HOYH 2Y0SE 1X54A 2C35B 2B63G 4BY7G 4JYAQ 5IWAL 4R4OA 4B3SL 1HNWL 2ZJRA 3GTJH 4LFCQ 2E2JH 1UE1A 1AE2A 1XMQL 1QZHA 1E3PA 3S2HH 1HZBA 1WYDA 1KIXA 3PSIA 3RZDH 2K52A 2K5NA 4A3GG 2HHHL 5K36G 2VY3A 3ULLA 3J81i 1VQ8A 1Q46A 2N8NA 4DR3Q 4QJFA 2R92G 1TWGH 1OTCA 1SLJA 4A3LH 3ER0A 3RNUA 1PH8A 3HOUG 4LFBQ 4P71A 4A75A 3DM3A 3RN2A 1YJ9A 4PG3A 4A3KH 2NN6I 2ZJPA 1P16A 1CKMA 4DV2L 1AH9A 2JQOA 2YYZA 3S1MH 4YCVA 2GVBA 3PUXA 1YI2A 2XTIA 1OXUA 4DR5L 1C9OA 1Y1WG 1XNQQ 4GKKQ 1Y1VG 5LMNQ 1Q7YC 1BVSA 1SE8A 1N32L 2B29A 5FLMG 4A3CH 3GTOH 4A3FH 3RLNA 4LUVA 2NZHA 1G291 4KLKA 2E8GA 2N49A 3G48A 2AWOA 4PZ8A 1PV4A 3CC7A 3I4MG 4A3DG 4DR7Q 1IBML 4YY3L 1LUZA 1TWCH 2K50A 1VQPA 3OTOL 1X65A 3W5OA 1YITA 1QVGA 4GLAC 1XPUA 4DR6L 3GO5A 4JOIA 2Z6KA 3KOJA 1HZAA 4B3RL 4JI4Q 4Y7NH 1X55A 1Q1BA 2NZOA 2F4VL 1K8GA 2VNUD 2D0OA 3CMAA 5GAHC 5HY6A 4A3MG 4IPGA 1OXTA 1BBWA 1ASYA 1CKNA 1UEBA 2YTYA 5IP9G 3GTMH 2LSSA 5IYCH 1PYSB 5J3BA 4GOPB 1XNRL 2JA7H 4A3IG 1TXYA 4IOAA 4X66L 3I4NG 1YZ6A 3PO3H 4Y52H 2RHQB 2OQKA 4JI5L 4JI0L 1WCMH 1E22A 4HJ7A 2OTLA 4LF6Q 3CCMA 1LM0A 1GVPA 3I4OA 4QY7A 3G4SA 4TQUS 4LF8L 5LMNW 1W2BA 1S72A 3KFUA 2UXDL 3CCRA 2NVXH 4NXMQ 1KRTA 4A93G 3HOWH 2R6GA 3KDFB 4IFDG 1XJVA 2AMCB 4DV5L 1K8AC 3H15A 1VQCA 4DR4L 3BJUA 2KCTA 1K3RA 1L1OA 3UDFA 1PH3A 3CC2A 1YBYA 1FJGQ 2IHFA 2R92H 4A3LG 4X65Q 4DUYL 4X62L 3G6EA 4LUZA 3M7NA 3AYHB 4B3ML 2LXKA 1HR0L 1CKOA 4JI7Q 3HOUH 4NXNQ 3L0OA 3TS0A 2F3IA 2ZM6Q 1I94Q 2A8VA 1IBKQ 5ELOA 1VQ9A 3S1RH 5C0XI 4AQYQ 4P74A 1B8AA 4A3BG 2D0PA 4LFCL 4GKJL 4TVAB 1Y1WH 4X64Q 4DK6C 4DUZQ 1PH6A 4A3CG 2UU9Q 4A3FG 1QVFA 4YHHQ 1V1QA 3UE0A 5FLMH 1K73C 3A5UA 4APVA 1N34Q 3KF8B 3CMEA 1CUKA 1XTDA 1VQOA 5JEAJ 4R4TA 4K0KL 3RN5A 4L5RC 2IY5B 1VS0A 3M9BA 4A3DH 4R4QA 1VQNA 3I4MH 2VL6A 3W1GA 2A19A 4DR1Q 1N8RC 1QUQB 3S2DH 1KC8C 4UP8A 1GM5A 1PVOA 4BY1H 3K80C 3KF6A 1XMOQ 3CXCA 4PZ6A 3T1HQ 4LFAQ 3E9HA 2WP8J 1NMFA 4GNXB 4JC0A 3ERSX 3EN2A 1KL9A 4DAYB 5GAEC 3UDGA 2WFWA 4GKKL 1EOVA 1OXSC 2PNHA 4QIWE 5C0XG 1X9NA 2UUAQ 4B3TQ 4LF5Q 4DKAC 4JCVE 2Z0SA 1I3QH 1U0LA 2Q2HA 4A3JG 1K0RA 2D62A 1J5EQ 4LF9Q 1R9TH 3K81C 3S1NH 5FLXc 4JI8Q 4A3IH 3D31A 2Q2IA 1O7IA 1NJIC 3W1BA 1PH4A 3BZCA 4IPHA 4C3HH 4DV4Q 1D8LA 4L5SA 1EIFA 1Q81C 3CF5A 4KI0A 4DV6Q 3HOWG 1EFWA 3KJPA 3TS2A 4C3IH 4HJ9A 2IT1A 1BBUA 4HJ8A 1EQRA 3CW2C 3U4VA 1PFSA 1N36Q 1TWAH 4LNQA 4A93H 1W3SA 2OTJA 4POFA 1QUQA 1GKHA 1N9WA 3JC66 4LF7L 2F52A 4JOIC 1S3OA 5ELNA 4QGUA 4JI1L 3M4PA 1HZ9A 2VQEQ 2YTVA 1SFOH 4GN3B 1AE3A 3HKZG 2EQSA 4IPDA 3PCOB 4UP9A 1IBLQ 5M3MG 1Q86C 4HIMA 3PIPA 2V1CC 4O0AA 1RL2A 1B7YB 2I5MX 1NMGA 4P75A 1KXLA 2ATWA 1HZCA 4R4CA 2YV5A 4KHZA 4NXML 1HNXQ 1WFQA 3K7UC 4IJLA 4DNIA 1FGUA 2L15A 1MJEA 4WJ4A 5JJIA 4DR2Q 4OX9Q 3KJOA 4LUOA 1YNXA 1FJGL 4JV5Q 1C7YA 1V9PA 2JK8A 2GN5A 4A76A 1VQ4A 1PHJA 4C2MH 4DK3C 1YHBA 4BY1G 4OO1I 2RF4A 4IOCA 4O2DA 2H5XA 3J80c 1I94L 1L1OC 4PZ7A 1IBKL 2NN6G 1HNZQ 1VQLA 5EAYA 2BH2A 4DV3L 4AQYL 4DV7Q 4HIKA 3KYHC 2E5LQ 4LF4L 1PH2A 3UDXA 4X64L 3ULPA 4DUZL 4YWLA 3PUYA 1JJ2A 2CWAA 1SRUA 1DGSA 2CKZB 3TQYA 4DV0Q 3T1YL 2UXBQ 3JAMc 2N78A 4A3JH 1N34L 1VQKA 2PI2E 4QL5A 4EX5A 5LMUQ 2BA1A 2ZTCA 3UDIA 1I5FA 2UUCL 5M5XH 2JJQA 2UUBQ 2UXCL 2PMZE 3HKSA 3M4QA 3NEMA 2IHEA 4C3JH 5IWAQ 1SROA 2KHIA 4DR1L 4JI6L 4JBWA 5JJLA 4B3SQ 2Q2TA 1HNWQ 1MIUA 1FVIA 2WB1G 3J7A5 1VQJA 2I0QA 1VQGA 4OO1G 3PUVA 4LFAL 3RLOA 4OONA 1GD7A 2VQFQ 1IL2A 3S14H 5C44H 5AJ3L 1G51A 3SGIA 5JJKA 1EUJA 4AYBG 2VS1A 2ZJQA 4R1JA 2UUAL 2KHJA 1C0AA 4B3TL 4LF5L 3GTQH 3HOVH 3J81j 2QEXA 2WAQG 3MXNB 5BR8L 1JMCA 4H02A 4LF9L 3HOXH 1E1TA 1UE6A 4DV1Q 1YVCA 4J15A 2ASBA 1EQQA 1EYGA 2JA7G 5IP7G 2NVTH 1HH2P 3CCVA 1M1KC 3BZKA 3STBD 3E0EA 1Q8KA 5M3MH 1E7ZA 4MTNA 3EIVA 4JYAL 4HJAA 4IFDJ 2ALYB 2JE6I 4GOPA 3MEFA 3M4OH 5IYDG 1X3GA 3GDEA 3F2CA 1YHQA 1N33Q 1OXXK 2R93G 1NE3A 1X3EA 2BH8A 3J81c 1EWIA 1KRSA 1N36L 2K5VA 3I55A 1VQ7A 2R7ZG 5IT9c 3M3YH 4X6AH 2PQAB 1K83H 2ZTDA 4FDBA 1KQSA 4BA1I 2JA5G 4ME3A 4DR3L 2YU9H 1A63A 1KHIA 3PF5A 1YHAA 3OTOQ 2MFIA 3PO3G 5JEAG 3PUZA 4LFBL 3CQZH 1B70B 2OQ0A 3KDFA 3RZOH 1VQAA 4JBJA 5FJ8H 2MNAA 2VUMH 2Y0SG 1IBLL 1IZ6A 2MO0A 1HJPA 4NB3A 3J80i 3AQQA 3FKIG 3B6YA 4JI3Q 3S24A 4OWTB 1XNQL 2AWNA 3PF4A 5LMNL 3ICEA 4AH6A 2VZAA 2WAQE 4BBSH 3L7ZC 1SN8A 2AKWB 2K5HA 4GLXA 3TRZA 4A3BH 1XNRQ 3H0GH 1D7QA 1VQ5A 1A0IA 3WWVA 3CPFA 4NPSA 4MZ9A 4OX9L 3JAMi 1XPOA 4JI0Q 4DR7L 1L0WA 2KCMA 4LF8Q 3HFZB 1Z47A 1PH9A 4GN4B 1XPRA 1V43A 1NTGA 1H95A 2HIVA 3D0FA 5C44G 2JA9A 4JI4L 1E24A 1WI5A 1YJWA 1Q82C 1KD1C 1G6PA 1P8LA 4DV7L 4UPAA 4HIOA 2E5LL 4POGA 2CQOA 2HQLA 1GO3E 2K14A 3PIOA 3HOVG 2VW9A 2LXJA 2JEAI 3PUWA 1TWHH 2RCNA 2QA4A 4DUYQ 1NBWA 3F2DA 4DV0L 2Z6KC 3HOXG 2HT1A 2UXBL 4B3MQ 4GNXA 3FP9A 1PH7A 3S15H 2UUBL 2I5HA 3I7FA 5IP7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFQ A;  4LF6 L;  1A62 A;  3E9I A;  4GKJ Q;  1SR3 A;  2JA6 H;  3STB C;  2VQF L;  5C4J H;  1VQM A;  4XTC S;  1E1O A;  5IYD H;  4JBK A;  3IRB A;  3K8A A;  4LWC A;  2R7Z H;  2GVA A;  2JEB I;  3UE1 A;  3DLL A;  1IYJ B;  2Q2U A;  4K0K Q;  3FHW A;  4DAM A;  1X6O A;  4XIG S;  4IO9 A;  2JA5 H;  5E7N A;  4KHP Q;  4X65 L;  3GTL H;  4OXP A;  2RHS B;  3PO2 G;  1T9H A;  1IXR A;  1Y14 B;  1CKN B;  3A0J A;  3EBE A;  4JG2 A;  4L5Q A;  5FJ8 G;  4NXN L;  3CCJ A;  2PI2 A;  4JI7 L;  2VUM G;  1CSQ A;  3U4Z A;  1Z9F A;  2ZM6 L;  1L2F A;  3I2Z A;  1UE5 A;  3FKI H;  5IYB H;  3VDY A;  2B3G A;  1VQH A;  3GD7 A;  5GAG C;  4BBS G;  3PGZ A;  2JA8 G;  3H3V I;  1A8V A;  5C4X H;  1EIY B;  1X56 A;  4OWW B;  4JI2 Q;  2UU9 L;  3PV0 A;  3H0G G;  3J7Z C;  1N33 L;  1VQF A;  4YHH L;  2OWO A;  3OW2 A;  1HR0 W;  3HKZ E;  2XGT A;  2N3S A;  1YIJ A;  4RG1 A;  3RR5 A;  1JB7 A;  3A5Z B;  5DLQ E;  1M90 C;  4GS3 A;  4QQB X;  4YWM A;  3CPW A;  5C3E H;  4GOP C;  3Q8D A;  1LTL A;  1NY4 A;  2E2I H;  1L1O B;  4IJH A;  2KEN A;  4P72 A;  3M85 A;  3NBH B;  1LYL A;  4BBR H;  1JJC B;  5M3F G;  4A3E H;  1XMO L;  1XMQ Q;  4IFD I;  3T1H L;  2IX1 A;  2K4K A;  4GLV B;  4BA2 I;  4JI3 L;  3CCQ A;  1U5K A;  1PH1 A;  5GQO A;  4R4I A;  2HHH Q;  1OXV A;  3S16 H;  4LF7 Q;  3NEN A;  4OWX B;  3GTK H;  5IY0 A;  5M5W H;  1YJN A;  4JI1 Q;  5IE8 A;  3CC4 A;  1YEZ A;  1J5E L;  3HOZ G;  3S1Q H;  4YCU A;  1UWV A;  3ZJY C;  3GTP H;  4JI8 L;  5GAD C;  2MQH A;  4DV1 L;  1CSP A;  3HOY G;  2AHO B;  1PH5 A;  3K7A H;  4BXX H;  5H1S E;  2R7D A;  4MNO A;  3L2P A;  3KLW A;  4DV2 Q;  1VQE A;  4UY8 C;  3U50 C;  1SMX A;  2B63 H;  2R93 H;  4YCW A;  4DR5 Q;  4BY7 H;  2CFM A;  2R7F A;  4DV4 L;  2JA6 G;  4A4I A;  1X3F A;  4YWK A;  2I5L X;  2K75 A;  4DV6 L;  1N32 Q;  2YTX A;  1VQD A;  2FXQ A;  3CCE A;  3KF6 B;  4RMF A;  3I56 A;  4A3G H;  3OYY A;  1TWF H;  2ID0 A;  3GTG H;  1QVC A;  3CCL A;  2IX0 A;  1IBM Q;  4YY3 Q;  3U58 A;  3CAM A;  2VQE L;  3CD6 A;  3TEH B;  3LGJ A;  1UE7 A;  4A3K G;  4DR6 Q;  2WB1 E;  3PO2 H;  1S40 A;  4B3R Q;  4LW1 A;  5M5Y H;  1JE5 A;  4DV3 Q;  1PA6 A;  4LF4 Q;  2ZTE A;  5IYB G;  4AYB E;  2F4V Q;  2OCE A;  1VQB A;  1Y1V H;  1MJC A;  1Q12 A;  3NEL A;  4GNX C;  1I6H H;  2NVQ H;  5C4X G;  2CWP A;  2KBN A;  3AEV A;  2BA0 A;  1HNX L;  2JA8 H;  3T1Y Q;  1VCI A;  3CCS A;  4HID A;  5GRO A;  2ES2 A;  4DR2 L;  1PYB A;  1RIP A;  4X66 Q;  2QGQ A;  2UUC Q;  2UXC Q;  1JJG A;  4IPC A;  1J6Q A;  2EXD A;  5C3E G;  2A1A A;  3ULJ A;  2EIF A;  4HJ5 A;  4JI5 Q;  4KHP L;  4JV5 L;  2DUD A;  3CCU A;  1BKB A;  2CCZ A;  4JBM A;  4JI6 Q;  3S17 H;  1ASZ A;  2MO1 A;  3CP0 A;  4BBR G;  4A3E G;  1WOC A;  4EQ5 A;  3F2B A;  4UP7 A;  2UXD Q;  4P73 A;  4ALP A;  2PQA A;  4GN5 A;  5M3F H;  5C0X J;  5AJ3 Q;  1HNZ L;  4DPG A;  3TRE A;  3A74 A;  4DV5 Q;  2HIX A;  3AFP A;  1KAW A;  4DR4 Q;  4A3M H;  1Q1E A;  1MKH A;  1FL0 A;  1WJJ A;  2DGY A;  3BU2 A;  3K0X A;  1VQ6 A;  3F8T A;  5IYC G;  3RLF A;  5BR8 Q;  1QZG A;  1K9M C;  4JI2 L;  1VQI A;  5IP9 H;  2NVY H;  4X62 Q;  2E2H H;  3H3V H;  4WJ3 M;  1I50 H;  5HGQ A;  1HR0 Q;  3I4N H;  4PMW A;  4AIM A;  3G71 A;  5LMU L;  3HOZ H;  3F1Z A;  4BXX G;  1JT8 A;  1WCM G;  4L5T A;  3HOY H;  2Y0S E;  1X54 A;  2C35 B;  2B63 G;  4BY7 G;  4JYA Q;  5IWA L;  4R4O A;  4B3S L;  1HNW L;  2ZJR A;  3GTJ H;  4LFC Q;  2E2J H;  1UE1 A;  1AE2 A;  1XMQ L;  1QZH A;  1E3P A;  3S2H H;  1HZB A;  1WYD A;  1KIX A;  3PSI A;  3RZD H;  2K52 A;  2K5N A;  4A3G G;  2HHH L;  5K36 G;  2VY3 A;  3ULL A;  3J81 i;  1VQ8 A;  1Q46 A;  2N8N A;  4DR3 Q;  4QJF A;  2R92 G;  1TWG H;  1OTC A;  1SLJ A;  4A3L H;  3ER0 A;  3RNU A;  1PH8 A;  3HOU G;  4LFB Q;  4P71 A;  4A75 A;  3DM3 A;  3RN2 A;  1YJ9 A;  4PG3 A;  4A3K H;  2NN6 I;  2ZJP A;  1P16 A;  1CKM A;  4DV2 L;  1AH9 A;  2JQO A;  2YYZ A;  3S1M H;  4YCV A;  2GVB A;  3PUX A;  1YI2 A;  2XTI A;  1OXU A;  4DR5 L;  1C9O A;  1Y1W G;  1XNQ Q;  4GKK Q;  1Y1V G;  5LMN Q;  1Q7Y C;  1BVS A;  1SE8 A;  1N32 L;  2B29 A;  5FLM G;  4A3C H;  3GTO H;  4A3F H;  3RLN A;  4LUV A;  2NZH A;  1G29 1;  4KLK A;  2E8G A;  2N49 A;  3G48 A;  2AWO A;  4PZ8 A;  1PV4 A;  3CC7 A;  3I4M G;  4A3D G;  4DR7 Q;  1IBM L;  4YY3 L;  1LUZ A;  1TWC H;  2K50 A;  1VQP A;  3OTO L;  1X65 A;  3W5O A;  1YIT A;  1QVG A;  4GLA C;  1XPU A;  4DR6 L;  3GO5 A;  4JOI A;  2Z6K A;  3KOJ A;  1HZA A;  4B3R L;  4JI4 Q;  4Y7N H;  1X55 A;  1Q1B A;  2NZO A;  2F4V L;  1K8G A;  2VNU D;  2D0O A;  3CMA A;  5GAH C;  5HY6 A;  4A3M G;  4IPG A;  1OXT A;  1BBW A;  1ASY A;  1CKN A;  1UEB A;  2YTY A;  5IP9 G;  3GTM H;  2LSS A;  5IYC H;  1PYS B;  5J3B A;  4GOP B;  1XNR L;  2JA7 H;  4A3I G;  1TXY A;  4IOA A;  4X66 L;  3I4N G;  1YZ6 A;  3PO3 H;  4Y52 H;  2RHQ B;  2OQK A;  4JI5 L;  4JI0 L;  1WCM H;  1E22 A;  4HJ7 A;  2OTL A;  4LF6 Q;  3CCM A;  1LM0 A;  1GVP A;  3I4O A;  4QY7 A;  3G4S A;  4TQU S;  4LF8 L;  5LMN W;  1W2B A;  1S72 A;  3KFU A;  2UXD L;  3CCR A;  2NVX H;  4NXM Q;  1KRT A;  4A93 G;  3HOW H;  2R6G A;  3KDF B;  4IFD G;  1XJV A;  2AMC B;  4DV5 L;  1K8A C;  3H15 A;  1VQC A;  4DR4 L;  3BJU A;  2KCT A;  1K3R A;  1L1O A;  3UDF A;  1PH3 A;  3CC2 A;  1YBY A;  1FJG Q;  2IHF A;  2R92 H;  4A3L G;  4X65 Q;  4DUY L;  4X62 L;  3G6E A;  4LUZ A;  3M7N A;  3AYH B;  4B3M L;  2LXK A;  1HR0 L;  1CKO A;  4JI7 Q;  3HOU H;  4NXN Q;  3L0O A;  3TS0 A;  2F3I A;  2ZM6 Q;  1I94 Q;  2A8V A;  1IBK Q;  5ELO A;  1VQ9 A;  3S1R H;  5C0X I;  4AQY Q;  4P74 A;  1B8A A;  4A3B G;  2D0P A;  4LFC L;  4GKJ L;  4TVA B;  1Y1W H;  4X64 Q;  4DK6 C;  4DUZ Q;  1PH6 A;  4A3C G;  2UU9 Q;  4A3F G;  1QVF A;  4YHH Q;  1V1Q A;  3UE0 A;  5FLM H;  1K73 C;  3A5U A;  4APV A;  1N34 Q;  3KF8 B;  3CME A;  1CUK A;  1XTD A;  1VQO A;  5JEA J;  4R4T A;  4K0K L;  3RN5 A;  4L5R C;  2IY5 B;  1VS0 A;  3M9B A;  4A3D H;  4R4Q A;  1VQN A;  3I4M H;  2VL6 A;  3W1G A;  2A19 A;  4DR1 Q;  1N8R C;  1QUQ B;  3S2D H;  1KC8 C;  4UP8 A;  1GM5 A;  1PVO A;  4BY1 H;  3K80 C;  3KF6 A;  1XMO Q;  3CXC A;  4PZ6 A;  3T1H Q;  4LFA Q;  3E9H A;  2WP8 J;  1NMF A;  4GNX B;  4JC0 A;  3ERS X;  3EN2 A;  1KL9 A;  4DAY B;  5GAE C;  3UDG A;  2WFW A;  4GKK L;  1EOV A;  1OXS C;  2PNH A;  4QIW E;  5C0X G;  1X9N A;  2UUA Q;  4B3T Q;  4LF5 Q;  4DKA C;  4JCV E;  2Z0S A;  1I3Q H;  1U0L A;  2Q2H A;  4A3J G;  1K0R A;  2D62 A;  1J5E Q;  4LF9 Q;  1R9T H;  3K81 C;  3S1N H;  5FLX c;  4JI8 Q;  4A3I H;  3D31 A;  2Q2I A;  1O7I A;  1NJI C;  3W1B A;  1PH4 A;  3BZC A;  4IPH A;  4C3H H;  4DV4 Q;  1D8L A;  4L5S A;  1EIF A;  1Q81 C;  3CF5 A;  4KI0 A;  4DV6 Q;  3HOW G;  1EFW A;  3KJP A;  3TS2 A;  4C3I H;  4HJ9 A;  2IT1 A;  1BBU A;  4HJ8 A;  1EQR A;  3CW2 C;  3U4V A;  1PFS A;  1N36 Q;  1TWA H;  4LNQ A;  4A93 H;  1W3S A;  2OTJ A;  4POF A;  1QUQ A;  1GKH A;  1N9W A;  3JC6 6;  4LF7 L;  2F52 A;  4JOI C;  1S3O A;  5ELN A;  4QGU A;  4JI1 L;  3M4P A;  1HZ9 A;  2VQE Q;  2YTV A;  1SFO H;  4GN3 B;  1AE3 A;  3HKZ G;  2EQS A;  4IPD A;  3PCO B;  4UP9 A;  1IBL Q;  5M3M G;  1Q86 C;  4HIM A;  3PIP A;  2V1C C;  4O0A A;  1RL2 A;  1B7Y B;  2I5M X;  1NMG A;  4P75 A;  1KXL A;  2ATW A;  1HZC A;  4R4C A;  2YV5 A;  4KHZ A;  4NXM L;  1HNX Q;  1WFQ A;  3K7U C;  4IJL A;  4DNI A;  1FGU A;  2L15 A;  1MJE A;  4WJ4 A;  5JJI A;  4DR2 Q;  4OX9 Q;  3KJO A;  4LUO A;  1YNX A;  1FJG L;  4JV5 Q;  1C7Y A;  1V9P A;  2JK8 A;  2GN5 A;  4A76 A;  1VQ4 A;  1PHJ A;  4C2M H;  4DK3 C;  1YHB A;  4BY1 G;  4OO1 I;  2RF4 A;  4IOC A;  4O2D A;  2H5X A;  3J80 c;  1I94 L;  1L1O C;  4PZ7 A;  1IBK L;  2NN6 G;  1HNZ Q;  1VQL A;  5EAY A;  2BH2 A;  4DV3 L;  4AQY L;  4DV7 Q;  4HIK A;  3KYH C;  2E5L Q;  4LF4 L;  1PH2 A;  3UDX A;  4X64 L;  3ULP A;  4DUZ L;  4YWL A;  3PUY A;  1JJ2 A;  2CWA A;  1SRU A;  1DGS A;  2CKZ B;  3TQY A;  4DV0 Q;  3T1Y L;  2UXB Q;  3JAM c;  2N78 A;  4A3J H;  1N34 L;  1VQK A;  2PI2 E;  4QL5 A;  4EX5 A;  5LMU Q;  2BA1 A;  2ZTC A;  3UDI A;  1I5F A;  2UUC L;  5M5X H;  2JJQ A;  2UUB Q;  2UXC L;  2PMZ E;  3HKS A;  3M4Q A;  3NEM A;  2IHE A;  4C3J H;  5IWA Q;  1SRO A;  2KHI A;  4DR1 L;  4JI6 L;  4JBW A;  5JJL A;  4B3S Q;  2Q2T A;  1HNW Q;  1MIU A;  1FVI A;  2WB1 G;  3J7A 5;  1VQJ A;  2I0Q A;  1VQG A;  4OO1 G;  3PUV A;  4LFA L;  3RLO A;  4OON A;  1GD7 A;  2VQF Q;  1IL2 A;  3S14 H;  5C44 H;  5AJ3 L;  1G51 A;  3SGI A;  5JJK A;  1EUJ A;  4AYB G;  2VS1 A;  2ZJQ A;  4R1J A;  2UUA L;  2KHJ A;  1C0A A;  4B3T L;  4LF5 L;  3GTQ H;  3HOV H;  3J81 j;  2QEX A;  2WAQ G;  3MXN B;  5BR8 L;  1JMC A;  4H02 A;  4LF9 L;  3HOX H;  1E1T A;  1UE6 A;  4DV1 Q;  1YVC A;  4J15 A;  2ASB A;  1EQQ A;  1EYG A;  2JA7 G;  5IP7 G;  2NVT H;  1HH2 P;  3CCV A;  1M1K C;  3BZK A;  3STB D;  3E0E A;  1Q8K A;  5M3M H;  1E7Z A;  4MTN A;  3EIV A;  4JYA L;  4HJA A;  4IFD J;  2ALY B;  2JE6 I;  4GOP A;  3MEF A;  3M4O H;  5IYD G;  1X3G A;  3GDE A;  3F2C A;  1YHQ A;  1N33 Q;  1OXX K;  2R93 G;  1NE3 A;  1X3E A;  2BH8 A;  3J81 c;  1EWI A;  1KRS A;  1N36 L;  2K5V A;  3I55 A;  1VQ7 A;  2R7Z G;  5IT9 c;  3M3Y H;  4X6A H;  2PQA B;  1K83 H;  2ZTD A;  4FDB A;  1KQS A;  4BA1 I;  2JA5 G;  4ME3 A;  4DR3 L;  2YU9 H;  1A63 A;  1KHI A;  3PF5 A;  1YHA A;  3OTO Q;  2MFI A;  3PO3 G;  5JEA G;  3PUZ A;  4LFB L;  3CQZ H;  1B70 B;  2OQ0 A;  3KDF A;  3RZO H;  1VQA A;  4JBJ A;  5FJ8 H;  2MNA A;  2VUM H;  2Y0S G;  1IBL L;  1IZ6 A;  2MO0 A;  1HJP A;  4NB3 A;  3J80 i;  3AQQ A;  3FKI G;  3B6Y A;  4JI3 Q;  3S24 A;  4OWT B;  1XNQ L;  2AWN A;  3PF4 A;  5LMN L;  3ICE A;  4AH6 A;  2VZA A;  2WAQ E;  4BBS H;  3L7Z C;  1SN8 A;  2AKW B;  2K5H A;  4GLX A;  3TRZ A;  4A3B H;  1XNR Q;  3H0G H;  1D7Q A;  1VQ5 A;  1A0I A;  3WWV A;  3CPF A;  4NPS A;  4MZ9 A;  4OX9 L;  3JAM i;  1XPO A;  4JI0 Q;  4DR7 L;  1L0W A;  2KCM A;  4LF8 Q;  3HFZ B;  1Z47 A;  1PH9 A;  4GN4 B;  1XPR A;  1V43 A;  1NTG A;  1H95 A;  2HIV A;  3D0F A;  5C44 G;  2JA9 A;  4JI4 L;  1E24 A;  1WI5 A;  1YJW A;  1Q82 C;  1KD1 C;  1G6P A;  1P8L A;  4DV7 L;  4UPA A;  4HIO A;  2E5L L;  4POG A;  2CQO A;  2HQL A;  1GO3 E;  2K14 A;  3PIO A;  3HOV G;  2VW9 A;  2LXJ A;  2JEA I;  3PUW A;  1TWH H;  2RCN A;  2QA4 A;  4DUY Q;  1NBW A;  3F2D A;  4DV0 L;  2Z6K C;  3HOX G;  2HT1 A;  2UXB L;  4B3M Q;  4GNX A;  3FP9 A;  1PH7 A;  3S15 H;  2UUB L;  2I5H A;  3I7F A;  5IP7 H; 
#chains in the Genus database with same CATH topology
 3AFQ A;  4LF6 L;  1I4Q A;  1U9R A;  2PNR C;  4K8I A;  3E9I A;  4ILW A;  3HEJ A;  1SR3 A;  4GKJ Q;  3FRP B;  4A3D B;  3S2D B;  2VQF L;  2RDG A;  1IKM A;  5IYD H;  3IRB A;  5DNF A;  2EDG A;  4IAL A;  3GV6 A;  1L0Y B;  2B2W A;  2Q2U A;  4K0K Q;  3FHW A;  4KHP Q;  1SMY D;  4X65 L;  2F03 A;  3I4L A;  1GHJ A;  1CKN B;  5JEA H;  3TZD A;  3HRZ C;  2O5J C;  1S5F D;  5A35 A;  3FKI H;  5IYB H;  3H3V C;  3VDY A;  1VQH A;  3GD7 A;  4BBS G;  3PGZ A;  1D6E C;  1CK1 A;  1N33 L;  4JI2 Q;  4XQN A;  3H0G G;  1VQF A;  4YHH L;  2OWO A;  1CHP D;  1DCZ A;  3NE5 B;  3J81 L;  3N52 A;  3RR5 A;  1M90 C;  4C3I B;  1X3P A;  3CPW A;  5C3W A;  1TWA B;  2EXZ A;  1C8C A;  1NY4 A;  1OO9 B;  1CT1 D;  3LWU A;  4P72 A;  1BCP D;  1G6Z A;  1XMO L;  2IX1 A;  3KBX A;  4BA2 I;  1JIC A;  3NK9 A;  1PH1 A;  4R4I A;  4I7A A;  2KHS A;  4KD4 A;  1J5E L;  3S1Q H;  1Q90 A;  4YCU A;  2AHO B;  4JVZ A;  1STG A;  4X3T A;  5H1S E;  1O80 A;  1VQE A;  1SMX A;  2B63 H;  2K5Q A;  2CFM A;  2R7F A;  4ABN A;  4U67 3;  1J8I A;  2NZ1 D;  2JA6 G;  2K05 A;  3CRK C;  4DV6 L;  2FXQ A;  3CCE A;  4RMF A;  1SNP A;  4M1U B;  4DK0 A;  4O42 A;  1TWF H;  4KMU C;  3K5M A;  3GTG H;  2HDM A;  5C3X A;  4RCN A;  4YY3 Q;  1UE7 A;  3PO2 H;  1SXT A;  1TII D;  2K5D A;  1MBY A;  5M5Y H;  1PA6 A;  1JE5 A;  3GP7 A;  3NWS A;  4LMQ D;  3MXN A;  1NSN S;  2X6G A;  2B8F A;  2NUC A;  3IFD A;  1VQB A;  3NEL A;  4GNX C;  4ZUI A;  1VCI A;  1HUM A;  5GRO A;  1V1O A;  2ES2 A;  4X66 Q;  1LTR D;  4MTK A;  2L12 A;  1J6Q A;  5C3E G;  2L1B A;  1K3B C;  1MD2 D;  1KDB A;  1D5Z C;  1HCZ A;  5CMD A;  3CP0 A;  1KLU D;  4A3E G;  1EY5 A;  4ALP A;  4GN5 A;  5C0X J;  5EPK A;  4RCO A;  1ENA A;  4K6L A;  2HIX A;  2BDO A;  1MKH A;  1RCV D;  2HUG A;  1GUN A;  1VQ6 A;  3F8T A;  1K9M C;  4NKL A;  3RLF A;  3QG1 A;  2NVY H;  4X62 Q;  3H3V H;  3M4O B;  5HGQ A;  3G71 A;  1MHW C;  2Y0S E;  1K83 B;  4JYA Q;  4R4O A;  3GTG B;  1WTO A;  1DD2 A;  2Z9H A;  3GTJ H;  2IW3 A;  1STN A;  3RZD H;  1G8Z D;  2VUM B;  2HHH L;  2VY3 A;  4DR3 Q;  2XNA C;  1TWG H;  1OTC A;  2EYL A;  3CHB D;  3SK5 A;  3H09 A;  4N8F A;  4A3B B;  1YJ9 A;  4A3K H;  2ZJP A;  5CV7 A;  1AH9 A;  2Q8T A;  1SDF A;  4CKE A;  1PZI D;  2GVB A;  1CA5 A;  1XNQ Q;  1CQV A;  2PW5 A;  5LMN Q;  1GOZ A;  1BVS A;  1EOT A;  3E0J A;  3GTO H;  4LUV A;  2NZH A;  3TP5 A;  4KLK A;  4IUT A;  4HSP A;  2G9H D;  2N49 A;  5KRU A;  3I4M G;  4DR7 Q;  1LUZ A;  1TWC H;  3SE0 A;  3W5O A;  2FHT A;  1XPU A;  1LTA D;  3ITP A;  1TU2 B;  3KUP A;  2OXP A;  3GO5 A;  5E4W C;  4JOI A;  1FNU A;  2B2V C;  2DN8 A;  1I4P A;  4B3R L;  1EY7 A;  2BE5 C;  1K8G A;  3J7A F;  4IPG A;  2E74 C;  1BBW A;  1F77 A;  3ZYY X;  1PTO C;  3GTJ B;  2QW7 A;  1PYS B;  5J3B A;  5IYC H;  2MUY A;  4A3I G;  2E76 C;  1YZ6 A;  5C4J B;  2LY7 A;  2TSS A;  2EYP A;  4JI0 L;  2H1E A;  1WCM H;  4Q5V A;  4LF6 Q;  4C3H G;  3G4S A;  4QY7 A;  3VR6 A;  2JA5 B;  1S72 A;  3OWF A;  1FNW A;  2NVX H;  4NXM Q;  3PO3 B;  4K8J A;  4FNF A;  4DV5 L;  1XJV A;  1XWE A;  1EYC A;  4A3K B;  3EFX D;  3UDF A;  1FJG Q;  4A3L G;  3NBH A;  4IUV A;  3K0Y A;  4C1N K;  4X65 Q;  4DUY L;  1K28 A;  3NXW A;  1ZKO A;  5CV6 A;  2R3Z A;  4LUZ A;  3M7N A;  1XXG A;  3HOU H;  5C4X B;  1LTT D;  3TS0 A;  4UAI A;  2A8V A;  1I6V C;  2A68 D;  4HSV A;  1TS3 A;  4X64 Q;  5DAU A;  1PH6 A;  2O4X A;  4A3F G;  1QVF A;  4YHH Q;  4BBR B;  4ZK9 B;  3K5N A;  3M4Y A;  1VS0 A;  2LS0 1;  4R4Q A;  4DR1 Q;  3I91 A;  4G7O C;  1XMO Q;  4PZ6 A;  5KNC A;  4GNX B;  3OMC A;  3EN2 A;  2NN6 H;  3UDG A;  3PQI A;  1OXS C;  1WCM B;  1X9N A;  2Q2H A;  4A3J G;  2QEJ C;  2D62 A;  1J5E Q;  2KA7 A;  1STH A;  5FLX c;  1B4O A;  4I65 A;  4ULL A;  1QNK A;  3C1E A;  4KY6 A;  4DGZ A;  1PH4 A;  1LT3 D;  4IPH A;  1GUG A;  4E6I A;  1Q81 C;  4KI0 A;  4DV6 Q;  3HOW G;  1EFW A;  4HJ8 A;  3I72 A;  4POF A;  2SNM A;  1GKH A;  4CJ0 B;  4LF7 L;  5M9O A;  1Y1V B;  2EY1 A;  3HKZ G;  3VR2 A;  3PCO B;  3K59 A;  1PTO H;  3AU7 A;  1IBL Q;  5M3M G;  3OW7 A;  2V1C C;  1B7Y B;  3E5S A;  1F2Y A;  2EOT A;  3S17 B;  1IW7 D;  1BNZ A;  5JJI A;  3BYT B;  4FXD A;  4WJ4 A;  5BN3 A;  1TY2 A;  3QOJ A;  4OX9 Q;  3H91 A;  2SDF A;  5DM7 3;  1V9P A;  4A76 A;  1VQ4 A;  4C2M H;  3R2I A;  3K6O A;  4IOC A;  2CH4 W;  1IKL A;  1W6K A;  3TDQ A;  1L1O C;  5LL6 S;  1IBK L;  2PW7 A;  2BH2 A;  3QB3 A;  1BXT A;  4BS9 A;  3D4W A;  5C0X H;  2JYO A;  3ULP A;  4YWL A;  2CWA A;  3OIQ A;  2M00 A;  1DGS A;  1S5C D;  2CKZ B;  5KNB A;  4QMG A;  2JP1 A;  4JBK A;  4QL5 A;  2BA1 A;  2UXC L;  1WD1 A;  2UUB Q;  2P5Z X;  1KNE A;  4C3J H;  4FF1 A;  4JBW A;  2K6A A;  3J7A 5;  4C1N I;  1GD7 A;  4C3I G;  4N9P A;  4K5X A;  1EUJ A;  2VS1 A;  3VYS A;  4LF5 L;  1PDQ A;  3GTQ H;  2F0W A;  5HUR A;  3HOX H;  4PQX A;  4L8J A;  2NWG A;  4XQQ A;  1E7Z A;  5CV5 A;  4CDC C;  1F2M A;  3GV3 A;  5IYD G;  2AUK A;  1LAC A;  3F2C A;  1YHQ A;  1OXX K;  1NE3 A;  2BH8 A;  1N36 L;  1EWI A;  2F0J A;  3DWP A;  3HGB A;  5EPL A;  2YU9 H;  1KHI A;  1B9N A;  2A6E D;  2MFI A;  5DEH A;  5JEA G;  3MFG A;  3PUZ A;  1B70 B;  2PZT A;  4RA8 A;  3BDL A;  3EVQ A;  5G3L F;  1IZ6 A;  1HJP A;  4NB3 A;  1QOH A;  3AQQ A;  3FKI G;  3B6Y A;  4OWT B;  2AWN A;  4IUR A;  2D2C C;  4GLX A;  4G57 A;  5JJZ A;  3OSO A;  2K33 A;  1A0I A;  2PQE A;  3J7Y W;  1EEI D;  2XWJ B;  2NTT A;  4PMC A;  4JI0 Q;  3P1H A;  3GTQ B;  1HHV A;  2KCM A;  5C4H A;  4GN4 B;  2HIV A;  4OO1 H;  1B53 A;  1G6P A;  1YJW A;  1KD1 C;  2DNE A;  5NUC A;  3OOC A;  4POG A;  1GO3 E;  4K2L A;  1MSG A;  5L37 A;  2JEA I;  3S1R B;  1TWH H;  4DUY Q;  3F2D A;  3A7L A;  5T1G A;  3S15 H;  2XIW A;  4DAY A;  1HUN A;  1EZ6 A;  5IIF A;  3I7F A;  5IP7 H;  1E2V A;  1TS2 A;  4IUN A;  2CH4 A;  5KEE A;  3MZ5 A;  1JOR A;  3STB C;  1SYB A;  4F87 A;  4WJW A;  1E1O A;  3G6J B;  2GVA A;  2JEB I;  3UE1 A;  3T53 B;  4OXP A;  3PO2 G;  4FXG C;  4DV1 L;  5TSS A;  5FJ8 G;  2A5H A;  2VUM G;  3R8B A;  1CSQ A;  1RTN A;  2RDF A;  1R9T B;  1Z9F A;  2ZM6 L;  2F0N A;  4A3I B;  4CDD C;  1L2F A;  1SJH D;  1XX8 A;  3ND8 A;  4A3B G;  4J8Q A;  4C3H B;  1H9K A;  2UU9 L;  1UEA B;  1KTK A;  1RKN A;  1JWS D;  3TBI B;  4KN4 C;  5DLQ E;  4GS3 A;  4GOP C;  4TKO B;  3Q8D A;  4AYB B;  5DM6 3;  2KCC A;  2DJG C;  1L1O B;  2CW0 D;  3M85 A;  3SEB A;  1LYL A;  2WAQ B;  3KLR A;  3T1H L;  2K4K A;  5I6W A;  4GLV B;  3S15 B;  2EPB A;  5BN4 A;  4JI3 L;  3CCQ A;  3S16 H;  5GQO A;  5C5L A;  2D9U A;  2MHV A;  1WD0 A;  2AQ1 B;  2LMC B;  4LF7 Q;  4OWX B;  1SYE A;  3GTK H;  1YJN A;  5IE8 A;  3CC4 A;  3TSS A;  1LTB D;  5KGU A;  3R93 A;  3GTP H;  3QR8 A;  1PH5 A;  4BXX H;  2R7D A;  4MNO A;  3KLW A;  4UY8 C;  4MHE A;  4DR5 Q;  4BY7 H;  2KVM A;  4RGO S;  4DV4 L;  1QJO A;  1HA5 A;  1V1P B;  1X3F A;  1DZ1 A;  2I5L X;  2F0M A;  2K75 A;  3I73 A;  4M8A A;  3Q22 A;  4RAU C;  2WKD A;  4A3G H;  5K36 H;  3OYY A;  4P2C B;  4UHV A;  1QVC A;  2IX0 A;  1IBM Q;  1HPC A;  3U58 A;  4NP5 A;  4RGM A;  1H9J A;  5E4X A;  5IGB A;  3TEH B;  5CC4 A;  4A3K G;  2WB1 E;  1TS5 A;  1AZQ A;  4A3J B;  3E6Z X;  4FP5 D;  2F4V Q;  1I6H H;  5C4X G;  2BA0 A;  2JA8 H;  4HID A;  3CCS A;  1SE2 A;  3URY A;  2QGQ A;  5EPJ A;  2UXC Q;  5C44 B;  4FF3 A;  2RKS A;  2A1A A;  2Z4I A;  2DUD A;  3HOV B;  3P7J A;  1ASZ A;  3SR1 A;  4BBR G;  3H94 A;  1WTW A;  1PRT D;  2UXD Q;  4P73 A;  2PQA A;  3GTP B;  5M3F H;  3RD4 A;  1JQY D;  4DPG A;  1EL0 A;  1G2S A;  2NVT B;  1D2B A;  1E0B A;  3AFP A;  4DR4 Q;  4A3M H;  1FL0 A;  5M3M B;  5IYC G;  3FVQ A;  5IP9 H;  2Z6B A;  2E2H H;  3D6C A;  1I50 H;  1SEB D;  3AB9 A;  1HR0 Q;  3I4N H;  4PMW A;  2NB0 A;  3SK8 A;  5AFW A;  1WCM G;  1V8Q A;  5A2Q E;  4GZY C;  2C35 B;  3NUC A;  1Y69 U;  1RDP D;  5G3L D;  1F2L A;  4FF4 A;  2ZJR A;  1AE2 A;  1XMQ L;  1E3P A;  3CQZ B;  3RZO B;  1JR0 D;  3PSI A;  3R3O A;  1C4Q A;  3ULL A;  3J81 i;  1FR3 A;  1ZEQ X;  2EE1 A;  4QJF A;  2JSO A;  2KED A;  3MFY A;  3VR3 A;  1SLJ A;  3T56 B;  3RNU A;  1PH8 A;  3HOU G;  4P71 A;  2JA8 B;  3RN2 A;  4DV2 L;  2JQO A;  4YCV A;  3PUX A;  2E75 C;  1OXU A;  2XTI A;  3D3R A;  2ZXP A;  3VYR A;  1Y1V G;  1N32 L;  3TME A;  2B29 A;  5FLX E;  3OMG A;  4DAV A;  5M3F B;  2BCO A;  1Z6H A;  2AWO A;  3CC7 A;  1ZYR D;  5E3F A;  3OTO L;  3U9O A;  3K58 A;  4DR6 L;  4IUQ A;  1SND A;  2TMP A;  4Y7N H;  1ILP A;  1Q1B A;  3SXH A;  3HG9 A;  1ESR A;  4X3K A;  1ASY A;  1CKN A;  4GOP B;  1XNR L;  2B8G A;  4V19 0;  2RHQ B;  1B2T A;  4CBV A;  1YNN C;  4JI5 L;  4HJ7 A;  3CCM A;  1LM0 A;  1GVP A;  3I4O A;  4WFN 3;  3PIP 3;  4TQU S;  4LF8 L;  4KKT A;  1W2B A;  4RH6 A;  5IOD A;  3KFU A;  2R6G A;  4IFD G;  2AMC B;  1PFB A;  2FMM A;  3H15 A;  1VQC A;  4DU9 A;  2KCT A;  4DK1 A;  2A73 B;  1BQQ T;  3NQT A;  1PH3 A;  1YBY A;  2IHF A;  2R92 H;  1EYA A;  3FKI B;  5ELD A;  2MP1 A;  1CKO A;  4ZCK A;  2ZM6 Q;  1I94 Q;  3HS0 C;  1VQ9 A;  4AQY Q;  4ZYS A;  4LFC L;  3TP8 A;  4TVA B;  2DNC A;  5I2X A;  4OGQ C;  4DUZ Q;  4A3C G;  2UU9 Q;  2B2Y C;  1TVX A;  2HQE A;  1V1Q A;  2B2U A;  1PXU A;  3KF8 B;  1C48 A;  4Z9C B;  1VQO A;  4R4T A;  1IL8 A;  3W1G A;  4FVM A;  1H9S B;  4BY1 H;  2K28 A;  2WAC A;  3T1H Q;  4LFA Q;  2K1B A;  2WP8 J;  3S1Q B;  1LTS D;  3ERS X;  1F9R A;  4GKK L;  1EOV A;  5C0X G;  2PNH A;  3K57 A;  3C3L A;  4JCV E;  2B63 B;  4OIK A;  4LF9 Q;  3K81 C;  5F2D A;  3S1N H;  3MVV A;  5EQ0 A;  3D31 A;  1QB5 D;  2Q2I A;  3W1B A;  3BZC A;  1O7L A;  1RF2 D;  1TWF B;  2HD3 A;  1D8L A;  4DV4 Q;  2R92 B;  5JPM C;  3EJI A;  1EY4 A;  3CF5 A;  1O78 A;  3KJP A;  1BBU A;  3WOF A;  4LNQ A;  4DN4 M;  2C5C A;  3PO2 B;  3VYU A;  3DEP A;  2DY7 A;  4CJ2 C;  1N9W A;  5M5Y B;  2F52 A;  1S3O A;  4JI1 L;  2RDH A;  1HZ9 A;  3MWY W;  4UDU C;  1SFO H;  4GN3 B;  2FJ2 A;  3VR4 A;  5COY A;  4UP9 A;  1SAP A;  2OT2 A;  4QUC A;  3N6R A;  5ELF A;  4O0A A;  1RL2 A;  2F0U A;  3MEH A;  4IQZ A;  1HZC A;  2FFK B;  4R4C A;  1W6J A;  3NBI A;  1B1Z A;  3RUZ A;  1S5D D;  3K7U C;  1MJE A;  1FGU A;  2L15 A;  4I7Z C;  3KJO A;  4LUO A;  3I70 A;  2QF7 A;  1EQV A;  4DK3 C;  2ZXR A;  3TP7 A;  3A55 A;  3BYY B;  2NVY B;  3J80 c;  3DWA A;  3MXU A;  1CTM A;  5A2Q L;  4LF4 L;  4DV7 Q;  4HIK A;  2E5L Q;  1VF7 A;  2Z1C A;  3UDX A;  5CV8 A;  4IZ8 A;  1YNJ C;  3Q6S A;  2UXB Q;  1SE3 A;  1N34 L;  3T4A C;  5FK9 C;  3DUZ A;  2KEE A;  3UDI A;  2ZTC A;  4LAA A;  1I5F A;  4EX5 A;  5M5X H;  2UUC L;  3RZD B;  5C6A A;  3NEM A;  2IHE A;  1SRO A;  4JI6 L;  2VB2 X;  1TWG B;  4XT1 B;  5EBD A;  1FVI A;  3CU7 A;  2I0Q A;  1VQG A;  4OO1 G;  4OON A;  2EYH A;  2V4D A;  2VQF Q;  1IL2 A;  1RHP A;  1HTL D;  1WTH A;  2XRQ D;  4KK7 A;  2A69 C;  4AYB G;  5JJK A;  2M9V A;  2ZJQ A;  4OHJ A;  2UUA L;  2H4O A;  4B3T L;  5CV4 A;  2DJF C;  2QEX A;  2B2T C;  2WAQ G;  4ID6 A;  3BDC A;  4LK1 C;  5COR A;  1CHQ D;  5IP7 G;  5FLX L;  3GTO B;  1UUP A;  1HH2 P;  4IUU A;  3CCV A;  1TKW B;  1GUW A;  4KD3 A;  2JE6 I;  1TWC B;  3W2D A;  1X3G A;  1PTO F;  1N33 Q;  4EGV A;  1PMR A;  1KRS A;  3I55 A;  3M3Y H;  4X6A H;  5IT9 c;  4ZLT F;  4HCS A;  4FYD A;  1A63 A;  2PZW A;  2RSN A;  3OTO Q;  1NNX A;  1MSH A;  3S9W A;  1VQA A;  4JBJ A;  4ZQ3 A;  3P75 A;  3S24 A;  1H9R A;  1NAP A;  5C5M A;  1STE A;  3QOL A;  2WAQ E;  4BBS H;  4KJN A;  3A8K E;  1XNR Q;  2QDL A;  3H0G H;  1D7Q A;  1VQ5 A;  4DFA A;  4KN7 C;  1MGS A;  4KHV A;  2NVX B;  1XPO A;  4OEM B;  2MPM A;  4EQN A;  5IGD A;  5EGT A;  1TS4 A;  3K5L A;  4LF8 Q;  1ET9 A;  3HFZ B;  5E1F A;  3D6W A;  1F2Z A;  1V43 A;  1NTG A;  1J9O A;  1H95 A;  5C44 G;  3NWT A;  2OEO A;  4JI4 L;  1WI5 A;  3HOU B;  1SYD A;  2FMC A;  4B9X A;  4HIO A;  2CQO A;  2F0Q A;  4S3S A;  2K14 A;  3HOV G;  2PMZ B;  5IGC A;  4XQJ A;  2QA4 A;  1NBW A;  4DV0 L;  1DOK A;  3QWN A;  4GNX A;  2EJM A;  1VMC A;  2X69 A;  3C2P A;  3CRL C;  2JA6 H;  1DOM A;  4XTC S;  3MTS A;  3K8A A;  1F9S A;  1KDA A;  3WOE A;  4RHR A;  3A56 A;  4G7Z C;  4L63 B;  5EKK A;  4J1M A;  4CDF C;  1X6O A;  4DAM A;  5E7N A;  1GJX A;  1HRJ A;  4X3U A;  3MXP A;  1JC7 A;  1SNM A;  3U9S A;  3QJY A;  1IXR A;  1T5E A;  3CCJ A;  3EBE A;  4JI7 L;  1I4R A;  2PI2 A;  3LWE A;  3D8G A;  4F88 A;  4JW0 A;  1UE5 A;  1VF5 C;  5GAG C;  2JA8 G;  1A8V A;  1EIY B;  1B9M A;  1EU3 A;  1X56 A;  4OWW B;  1DOL A;  2D5D A;  1ILQ A;  1HR0 W;  3HKZ E;  1YIJ A;  2N3S A;  1JB7 A;  4RG1 A;  3A5Z B;  4YWM A;  5IGE A;  5C3E H;  2E2I H;  1H9M A;  1PLF A;  2HCI A;  2KEN A;  4ZKB B;  2F0L A;  1SYG A;  1ICW A;  1JJC B;  3FPU B;  5JPN C;  5M3F G;  4A3E H;  4IFD I;  4DAP A;  5J39 A;  1PRT C;  1PTO B;  2HHH Q;  1OXV A;  1G91 A;  5LHY 1;  2K01 A;  2RQX A;  4JI1 Q;  1BOS A;  1YEZ A;  1UWV A;  3ZJY C;  4TRD A;  4JI8 L;  2MQH A;  1CSP A;  3T51 B;  3K7A H;  5ELC A;  3L2P A;  4QUF A;  4A4I A;  1TQO A;  1PZK D;  1O7Z A;  4C2M B;  2YTX A;  1VQD A;  3KF6 B;  1LAB A;  2NTS A;  2B2V A;  4RFB A;  2Y0S B;  2CVR A;  5KND A;  3CCL A;  4B9W A;  3CD6 A;  3LGJ A;  3DM1 A;  3R2T A;  1SMY C;  4B3R Q;  2JXM B;  4LF4 Q;  1B44 D;  5IYB G;  3SVM A;  4C3J B;  5BN5 A;  3SDZ A;  2NVQ H;  4HCE A;  3AEV A;  3JAM E;  5JVG 3;  1E2W A;  4DR2 L;  1RIP A;  2UUC Q;  5EKL A;  2EXD A;  3ULJ A;  4HJ5 A;  5CV9 A;  4KHP L;  4JI6 Q;  1BKB A;  1LLR D;  2BE5 D;  3F2B A;  4UP7 A;  1ZYR C;  2B2W C;  3HOX B;  1RD9 D;  4KKS A;  3TRE A;  2XVS A;  3A74 A;  4K5W A;  4DV5 Q;  1BCP C;  4HED A;  3BU2 A;  3K0X A;  4JI2 L;  1WTX A;  4XT3 B;  3HOZ H;  3Q24 A;  2F0D A;  3F1Z A;  1JT8 A;  4L5T A;  3NP8 A;  3HOY H;  1X54 A;  4DXG A;  2B63 G;  2XSC A;  2XWB B;  4HMI A;  5IWA L;  2YU9 B;  2OF1 A;  4QF4 A;  3MA2 B;  3EA6 A;  1FNV A;  5LL6 X;  3S2H H;  1S4Z A;  1E2Z A;  1HZB A;  2K52 A;  1ONL A;  2K5N A;  1VQ8 A;  1Q46 A;  2WV6 D;  2R92 G;  1D1K A;  5ISR A;  3V2T A;  4A3L H;  3ER0 A;  1WTP A;  2VB3 X;  3DM3 A;  3X3N A;  1P16 A;  2YYZ A;  3S1M H;  1YI2 A;  1WTR A;  1Q7Y C;  1SE8 A;  4PNY A;  1ENC A;  2PZU A;  4A3F H;  3RLN A;  1G29 1;  3NTI A;  1U4P A;  3IFT A;  4CKB A;  2ICI A;  3G7L A;  1PV4 A;  1A2U A;  4YY3 L;  2K50 A;  2G9D A;  2RVL A;  1YIT A;  1QVG A;  3PMF A;  1JE4 A;  1EU4 A;  1KNA A;  1TWH B;  3KOJ A;  4FF2 A;  4JI4 Q;  1D1I A;  2WIN B;  3HOZ B;  1A2T A;  2K7V A;  1X55 A;  2NZO A;  1O7Y A;  1EWC A;  5GAH C;  5HY6 A;  1OXT A;  4RWS C;  1UEB A;  2YTY A;  4F7X A;  3GTM H;  3I90 A;  3S2H B;  1TXY A;  4X66 L;  1D5M C;  3QO2 A;  4Y52 H;  2Z8L A;  1WVL A;  2OTL A;  4U68 A;  2M2L A;  1II3 A;  5LMN W;  1PRT B;  4ZKC B;  1HXY D;  3W3A A;  2HCC A;  3CCR A;  1SNO A;  1KRT A;  3HOW H;  3KDF B;  1EY8 A;  3O13 A;  2Q8I B;  1L1O A;  3BS1 A;  3CC2 A;  1MI2 A;  3BDO A;  5I9P A;  4OEL B;  1D5X C;  1SYC A;  1QG7 A;  4X62 L;  3AYH B;  2LXK A;  4JI7 Q;  3L0O A;  2L11 A;  3OWE B;  2NYZ D;  1SBB B;  2AQ3 B;  3J80 E;  1IBK Q;  2O2L D;  1GUT A;  1VDZ A;  1B8A A;  4P74 A;  1GUO A;  1Y1W H;  1LV9 A;  1HA6 A;  4DK6 C;  5FOB B;  1JB3 A;  5FLM H;  1GXD C;  1K73 C;  3A5U A;  4APV A;  3BVZ A;  1XTD A;  3CME A;  2WKC A;  3RN5 A;  3S16 B;  3M9B A;  1V1P A;  3S2D H;  4A3D H;  1QUQ B;  1PVO A;  3GTK B;  1GM5 A;  1S5E D;  3SHL A;  3LNN A;  3CXC A;  3E9H A;  3IL8 A;  3TZU A;  4WRD A;  2L0C A;  1KL9 A;  2AQ2 B;  2JN4 A;  3ND9 A;  4LF5 Q;  4DKA C;  4BY7 B;  1I3Q H;  1U0L A;  1LT6 D;  3CKI B;  4RKL A;  1K0R A;  1JCK B;  5J22 A;  4IN3 A;  4JI8 Q;  1ICF B;  1LO5 D;  1O7I A;  1NJI C;  2EYF A;  3VA5 A;  4A3G B;  4TSS A;  4L5S A;  4CDE C;  1BCP B;  1EIF A;  1SSO A;  1R4P B;  5IGG A;  2N88 A;  3TS2 A;  4C3I H;  2IT1 A;  3CW2 C;  1N36 Q;  3U4V A;  1T5X D;  5IT9 E;  1TWA H;  4A93 H;  1W3S A;  2OTJ A;  1PFM A;  3V96 A;  1AW7 A;  1QUQ A;  3JC6 6;  4CGY B;  4JOI C;  1Y1W B;  3M4P A;  1I6H B;  1Y8N B;  2IX3 A;  1EFI D;  2F0E A;  2F3V A;  4HIM A;  1Q86 C;  1ET6 A;  1NR4 A;  1CI3 M;  2I5M X;  1KXL A;  1F9P A;  2ATW A;  2YV5 A;  4HAE A;  4KHZ A;  1QCB D;  4NXM L;  2A68 C;  4V0B A;  4DR2 Q;  2X6L A;  3SK4 A;  3DHQ A;  2LFN A;  4RKB A;  2A6H D;  4BWG B;  3TP6 A;  1FJG L;  1C7Y A;  2JK8 A;  2GN5 A;  4A3M B;  1YHB A;  1I3Q B;  1EEF D;  2RF4 A;  4X3S A;  2E2H B;  1I50 B;  4K14 A;  1VQL A;  4PZ7 A;  2NN6 G;  1CZW A;  5EAY A;  3I4N B;  4DV3 L;  3KYH C;  4X64 L;  2NBF A;  2O5I C;  2MJ8 A;  4XYQ A;  3T1Y L;  3I8Z A;  3JAM c;  1VQK A;  2PI2 E;  4A93 B;  1STB A;  2JJQ A;  2PMZ E;  2F0F A;  5IWA Q;  4DR1 L;  4ZRZ A;  1UAP A;  4QIW B;  2Q2T A;  1Y8P B;  2L9H A;  1AZP A;  1QWY A;  3RLO A;  5IOC A;  3S14 H;  3T13 A;  5AJ3 L;  1UNS A;  3SGI A;  4R1J A;  3MXN B;  5BR8 L;  1JMC A;  4H02 A;  3NTH A;  1XYI A;  1E1T A;  1UE6 A;  4DV1 Q;  1YVC A;  2ASB A;  2SEB D;  3RMH A;  1EYG A;  3ERO A;  1SNC A;  3TN2 A;  1M1K C;  1K8M A;  4F8M A;  3BZK A;  3STB D;  2PPB C;  1M8A A;  4MTN A;  1JOK A;  4IFD J;  2ALY B;  4GOP A;  4XXE A;  3DMU A;  3NQI A;  3M4O H;  2F0G A;  1LT4 D;  1X3E A;  3J81 c;  4NMZ A;  1K83 H;  2ZTD A;  1BDO A;  4BA1 I;  4Y7N B;  1IW7 C;  4ME3 A;  5JVH 3;  1YHA A;  1Q3L A;  2K04 A;  4LFB L;  2OQ0 A;  5KYL A;  4EQO A;  5FJ8 H;  2N55 A;  2MNA A;  2VUM H;  2Y0S G;  1IBL L;  2KJX A;  1ESF A;  4ODG A;  3J80 i;  4JI3 Q;  5D3D A;  4DNR B;  1CZG A;  1I4G A;  2VZA A;  1SN8 A;  2AKW B;  4A3B H;  3WWV A;  1NR2 A;  3E3X A;  4NPS A;  4MZ9 A;  4OX9 L;  3Q0A A;  3S14 B;  1DJR D;  4C3J G;  1JWM D;  2MGS A;  3T16 A;  1QE6 A;  1XPR A;  2F4I A;  3KF8 A;  1K8O A;  1E24 A;  3J80 L;  4OL7 A;  4UPA A;  5T1I A;  2HQL A;  1BBX C;  2K03 A;  1NCV A;  2VW9 A;  2WII B;  1H9S A;  3PUW A;  2RCN A;  3BG3 A;  2Z6K C;  1EYD A;  4EVO A;  3HOX G;  1GUS A;  4G7H C;  2FIN B;  3WDN A;  3MC0 B;  1B50 A;  4PV1 C;  1PH7 A;  2UUB L;  3MXG A;  2ZT9 C;  2DY8 A;  2I5H A;  2JA7 H;  1AEX A;  4KJO A;  1A62 A;  2EZV A;  3D4D A;  1G2T A;  1JWU D;  1M4V A;  5C4J H;  1CM9 A;  1VQM A;  4BY1 B;  2AUJ D;  4LWC A;  2R7Z H;  4EQP A;  3DLL A;  1IYJ B;  2E2D C;  4DNT B;  4IO9 A;  2JA5 H;  4XIG S;  2I46 A;  2I07 B;  3GTL H;  2RHS B;  4HMJ A;  2R61 A;  1T9H A;  1Y14 B;  4L5Q A;  3A0J A;  3PO3 H;  4JG2 A;  4NXN L;  2GA4 B;  1Q8I A;  3U4Z A;  2A6E C;  1ML0 D;  3S1N B;  4N8X 1;  4XDX A;  1LTG D;  1AP0 A;  3I2Z A;  2Z4H A;  2B3G A;  2EYO A;  3PIO 3;  3H3V I;  5C4X H;  5JAV A;  3PV0 A;  3J7Z C;  3OW2 A;  2WB1 B;  4K5V A;  2XGT A;  2J0T D;  5IT9 L;  3M7G A;  1FD7 D;  4QQB X;  3QIA A;  2QIL A;  4ZUJ A;  1LTL A;  2L55 A;  4IJH A;  1SNQ A;  3NBH B;  4BBR H;  3BZD B;  1XMQ Q;  5IGF A;  1ROD A;  1SFO B;  3KLS X;  3H6M A;  2JA7 B;  1U5K A;  3DXJ C;  2BOS A;  3NEN A;  5IY0 A;  1JOO A;  5M5W H;  1EY0 A;  2KCN A;  2L4N A;  3HOZ G;  3HP3 A;  5GAD C;  3HOY G;  1I4H A;  4K6D A;  4DV2 Q;  2R7Z B;  4KY7 A;  3U50 C;  2IJ0 A;  2R93 H;  2KQ3 A;  4YCW A;  1R4Q B;  2IPK D;  4H44 C;  1KAA A;  2IL8 A;  4YWK A;  3GTL B;  1N32 Q;  1U4R A;  1EY9 A;  3I56 A;  2VXW A;  3DWQ A;  4QB4 A;  5K5P A;  4CJ1 B;  3DEO A;  2ID0 A;  4HR7 B;  2F0H A;  2EVB A;  4J6H A;  2XN9 C;  3CAM A;  2VQE L;  3VA7 A;  1CA6 A;  4KV6 A;  4DR6 Q;  1X32 A;  1S40 A;  5CBA E;  1DON A;  1QIL A;  4LW1 A;  2BDN A;  3L3O C;  4DV3 Q;  2ZTE A;  4AYB E;  5M5X B;  1RTO A;  2OCE A;  1Y1V H;  1MJC A;  1Q12 A;  1SYF A;  2CWP A;  2KBN A;  4H7B A;  1HNX L;  2SOB A;  4N9T A;  3T1Y Q;  3LX0 A;  5JOB A;  1PYB A;  1B3A A;  3UI2 A;  1JJG A;  4IPC A;  3Q23 A;  2F0O A;  2EIF A;  4JI5 Q;  1EZ8 A;  4JV5 L;  1A3T A;  3CCU A;  4JBM A;  2CCZ A;  3S17 H;  1IHZ A;  5M5W B;  2MO1 A;  2F0T A;  1Y8O B;  1WOC A;  4EQ5 A;  1SE4 A;  1A3U A;  2Q8R E;  1TR5 A;  2CW0 C;  5AJ3 Q;  1HNZ L;  3C1F A;  2EJF C;  1KAW A;  1Q1E A;  2R93 B;  1WJJ A;  2DGY A;  1QZG A;  4YIJ A;  5BR8 Q;  4IUP A;  1VQI A;  1YNN D;  4LJZ C;  4WJ3 M;  2IWH A;  4AIM A;  4FXK C;  5LMU L;  2B2Y A;  4BXX G;  3M3Y B;  4BY7 G;  4B3S L;  1HNW L;  2ZXO A;  1L0X B;  4LFC Q;  2E2J H;  1UE1 A;  5KIX A;  1QZH A;  3GQB A;  1U4L A;  1WYD A;  1KIX A;  4IFD H;  1PFN A;  1HQM C;  4A3G G;  5K36 G;  2N8N A;  5D3I B;  4PMB A;  1BO0 A;  4LFB Q;  4A75 A;  2LKV A;  4BBS B;  2EYJ A;  4PG3 A;  2NN6 I;  3H0G B;  1CKM A;  4DR5 L;  1C9O A;  4MN3 A;  1Y1W G;  4GKK Q;  3AMU A;  5FLM G;  2EY6 A;  4A3C H;  1PYW D;  1ZXT A;  1NUC A;  2E8G A;  3G48 A;  4ZAI A;  4PZ8 A;  4A3D G;  4R9W A;  1IBM L;  2QKI C;  1VQP A;  1X65 A;  4GLA C;  1VMP A;  2Z6K A;  1HZA A;  5EJW A;  1EIG A;  1S5B D;  2F4V L;  2VNU D;  2D0O A;  3A8I E;  3CMA A;  4A3M G;  4R8I A;  3EQL C;  3F2U A;  1IYV A;  5IP9 G;  2LSS A;  4ME5 A;  2E2J B;  4IOA A;  2JA6 B;  2B39 A;  3I4N G;  2OQK A;  1E22 A;  2L5T A;  4H13 C;  1A6X A;  1WTQ A;  1EY6 A;  2UXD L;  1KDC A;  1STY A;  4A93 G;  4L6T B;  1K8A C;  4DR4 L;  2J7Z A;  3OIP A;  3BJU A;  1K3R A;  3KK7 A;  1RJT A;  2KOL A;  3G6E A;  3MAQ A;  4B3M L;  1HR0 L;  1HFN A;  3OHX C;  3FPP A;  4JK1 C;  4NXN Q;  2F3I A;  4B08 A;  1BR9 A;  1PRT F;  5ELO A;  3A8J E;  3VYT A;  3S1R H;  5C0X I;  3NHH A;  2RCF A;  2D0P A;  5C3E B;  5CYU A;  4GKJ L;  1F9Q A;  3FDT A;  1TY0 A;  5EKI A;  4RHS A;  2E2I B;  1EQT A;  1LTI D;  5I9O A;  3UE0 A;  3NTK A;  4A3E B;  1EWH A;  1N34 Q;  1CUK A;  5JEA J;  4K0K L;  2IY5 B;  4L5R C;  2F1M A;  3I4M H;  1VQN A;  2VL6 A;  1N8R C;  2A19 A;  2A6H C;  1BF4 A;  1KC8 C;  4UP8 A;  5HGT A;  3K80 C;  3KF6 A;  2B2T A;  1HTP A;  1DXM A;  1NMF A;  4JC0 A;  5CBE E;  2RSO A;  4DAY B;  5GAE C;  1YNJ D;  2WFW A;  3K7A B;  4CKC A;  1PTO D;  4OIJ A;  4QIW E;  2UUA Q;  4B3T Q;  2F0K A;  2SNS A;  2Z0S A;  5ELE A;  1DM0 B;  1R9T H;  3A54 A;  2CQA A;  4A3I H;  3L9A X;  1KAB A;  1U4M A;  4JPB W;  5FO7 B;  3FEW X;  1IYU A;  4C3H H;  4WOR A;  2ICE C;  5I2Y A;  5FO8 B;  2A69 D;  2F0I A;  3A7A B;  4R8N A;  4NDX A;  3J81 E;  4HJ9 A;  2F0V A;  1EQR A;  3NSW A;  5CR3 A;  1PFS A;  5FKA C;  4DA2 A;  5ELN A;  4QGU A;  4K2K A;  2VQE Q;  2YTV A;  3BVG A;  1AE3 A;  2PYK A;  2NVQ B;  2EQS A;  4IPD A;  1A3V A;  2QCP X;  4C56 C;  2QDB A;  1ENF A;  3PIP A;  1BCP F;  5FO9 B;  4P75 A;  1NMG A;  4RGT A;  1I4X A;  5ELB A;  3I4M B;  1HNX Q;  1WFQ A;  4IJL A;  4DNI A;  4HTH A;  3V05 A;  4DXF A;  1AFP A;  5J1Z A;  4G4K A;  1YNX A;  3IAY A;  2PO4 A;  2C9O A;  4JV5 Q;  3MHB A;  1LT5 D;  1PHJ A;  4BY1 G;  4NW2 A;  4OO1 I;  2EY5 A;  4O2D A;  2H5X A;  1I94 L;  1HNZ Q;  1EIH A;  4AQY L;  2F0S A;  2CHB D;  3HOY B;  5I6Y A;  1PH2 A;  4XYO A;  4DUZ L;  5I4D A;  3PUY A;  2EYM A;  1JJ2 A;  1SRU A;  3TQY A;  4DV0 Q;  1JOQ A;  2N78 A;  4A3J H;  3IKJ A;  3SK6 A;  5LMU Q;  2A74 C;  2RBM A;  3P20 A;  3HKS A;  3KBG A;  3M4Q A;  2KHI A;  5JJL A;  4B3S Q;  1HNW Q;  1MIU A;  2EY2 A;  2B2U C;  5D14 A;  2WB1 G;  4KKU A;  5KYI A;  1VQJ A;  3PUV A;  4LFA L;  1K0S A;  5C44 H;  2PCF B;  1G51 A;  2RA4 A;  1AN8 A;  1Z7T A;  4HN7 A;  2KHJ A;  1C0A A;  3S1M B;  4MIU A;  3HOV H;  3J81 j;  3D4R A;  3ONA B;  4CHT B;  2F3W A;  2XRS D;  4LF9 L;  1XTC D;  1WTV A;  1KLG D;  4J15 A;  3NPP A;  1EQQ A;  3HZX A;  2JA7 G;  4A3F B;  2NVT H;  1FGB D;  4O1N A;  3E0E A;  1Q8K A;  5D65 A;  5M3M H;  4QCL A;  4JYA L;  3EIV A;  4HJA A;  3K5O A;  3VR5 A;  3X3M A;  3MEF A;  2ENB A;  3GDE A;  2J4X A;  3BVM A;  2K5W A;  2KUM A;  1VQ7 A;  2R7Z G;  2K5V A;  2F0P A;  3KLS A;  3FMC A;  2PQA B;  4FDB A;  1KQS A;  1HQR D;  2JA5 G;  4DR3 L;  4FO2 A;  3PF5 A;  1DYQ A;  1SJE D;  4DF7 A;  3PO3 G;  1GHK A;  3CQZ H;  3RZO H;  3KDF A;  1CFM A;  3GTM B;  1B3Q A;  2KEC A;  2MO0 A;  3C46 A;  1XNQ L;  3J7A V;  3PF4 A;  5LMN L;  2HDL A;  3ICE A;  4AH6 A;  1BUV T;  3L7Z C;  1A15 A;  2K5H A;  3TRZ A;  3OPO A;  1FYC A;  3CPF A;  3JAM i;  3HOW B;  1TT2 A;  4DR7 L;  4Q0F A;  5EBC A;  1L0W A;  4KY5 A;  1HFG A;  1Z47 A;  1PH9 A;  4KTA A;  4RGN A;  3I3C A;  4H0L C;  3D0F A;  2JA9 A;  3ERQ A;  1Q82 C;  3HKZ B;  1P8L A;  4DV7 L;  2E5L L;  1STA A;  3PIO A;  1X3Q A;  5CGK A;  1CQF A;  2LXJ A;  1PZJ D;  2EJG C;  2K32 A;  2HT1 A;  2UXB L;  2G5D A;  5C4Z A;  4B3M Q;  3FP9 A;  3JAM L;  1QNU A;  2R93 G; 
#chains in the Genus database with same CATH homology
 3AFQ A;  4LF6 L;  1A62 A;  3E9I A;  4GKJ Q;  1SR3 A;  2JA6 H;  3STB C;  2VQF L;  5C4J H;  1VQM A;  4XTC S;  1E1O A;  5IYD H;  4JBK A;  3IRB A;  3K8A A;  4LWC A;  2R7Z H;  2GVA A;  2JEB I;  3UE1 A;  3DLL A;  1IYJ B;  2Q2U A;  4K0K Q;  3FHW A;  4DAM A;  1X6O A;  4XIG S;  4IO9 A;  2JA5 H;  5E7N A;  4KHP Q;  4X65 L;  3GTL H;  4OXP A;  2RHS B;  3PO2 G;  1T9H A;  1IXR A;  1Y14 B;  1CKN B;  3A0J A;  3EBE A;  4JG2 A;  4L5Q A;  5FJ8 G;  4NXN L;  3CCJ A;  2PI2 A;  4JI7 L;  2VUM G;  1CSQ A;  3U4Z A;  1Z9F A;  2ZM6 L;  1L2F A;  3I2Z A;  1UE5 A;  3FKI H;  5IYB H;  3VDY A;  2B3G A;  1VQH A;  3GD7 A;  5GAG C;  4BBS G;  3PGZ A;  2JA8 G;  3H3V I;  1A8V A;  5C4X H;  1EIY B;  1X56 A;  4OWW B;  4JI2 Q;  2UU9 L;  3PV0 A;  3H0G G;  3J7Z C;  1N33 L;  1VQF A;  4YHH L;  2OWO A;  3OW2 A;  1HR0 W;  3HKZ E;  2XGT A;  2N3S A;  1YIJ A;  4RG1 A;  3RR5 A;  1JB7 A;  3A5Z B;  5DLQ E;  1M90 C;  4GS3 A;  4QQB X;  4YWM A;  3CPW A;  5C3E H;  4GOP C;  3Q8D A;  1LTL A;  1NY4 A;  2E2I H;  1L1O B;  4IJH A;  2KEN A;  4P72 A;  3M85 A;  3NBH B;  1LYL A;  4BBR H;  1JJC B;  5M3F G;  4A3E H;  1XMO L;  1XMQ Q;  4IFD I;  3T1H L;  2IX1 A;  2K4K A;  4GLV B;  4BA2 I;  4JI3 L;  3CCQ A;  1U5K A;  1PH1 A;  5GQO A;  4R4I A;  2HHH Q;  1OXV A;  3S16 H;  4LF7 Q;  3NEN A;  4OWX B;  3GTK H;  5IY0 A;  5M5W H;  1YJN A;  4JI1 Q;  5IE8 A;  3CC4 A;  1YEZ A;  1J5E L;  3HOZ G;  3S1Q H;  4YCU A;  1UWV A;  3ZJY C;  3GTP H;  4JI8 L;  5GAD C;  2MQH A;  4DV1 L;  1CSP A;  3HOY G;  2AHO B;  1PH5 A;  3K7A H;  4BXX H;  5H1S E;  2R7D A;  4MNO A;  3L2P A;  3KLW A;  4DV2 Q;  1VQE A;  4UY8 C;  3U50 C;  1SMX A;  2B63 H;  2R93 H;  4YCW A;  4DR5 Q;  4BY7 H;  2CFM A;  2R7F A;  4DV4 L;  2JA6 G;  4A4I A;  1X3F A;  4YWK A;  2I5L X;  2K75 A;  4DV6 L;  1N32 Q;  2YTX A;  1VQD A;  2FXQ A;  3CCE A;  3KF6 B;  4RMF A;  3I56 A;  4A3G H;  3OYY A;  1TWF H;  2ID0 A;  3GTG H;  1QVC A;  3CCL A;  2IX0 A;  1IBM Q;  4YY3 Q;  3U58 A;  3CAM A;  2VQE L;  3CD6 A;  3TEH B;  3LGJ A;  1UE7 A;  4A3K G;  4DR6 Q;  2WB1 E;  3PO2 H;  1S40 A;  4B3R Q;  4LW1 A;  5M5Y H;  1JE5 A;  4DV3 Q;  1PA6 A;  4LF4 Q;  2ZTE A;  5IYB G;  4AYB E;  2F4V Q;  2OCE A;  1VQB A;  1Y1V H;  1MJC A;  1Q12 A;  3NEL A;  4GNX C;  1I6H H;  2NVQ H;  5C4X G;  2CWP A;  2KBN A;  3AEV A;  2BA0 A;  1HNX L;  2JA8 H;  3T1Y Q;  1VCI A;  3CCS A;  4HID A;  5GRO A;  2ES2 A;  4DR2 L;  1PYB A;  1RIP A;  4X66 Q;  2QGQ A;  2UUC Q;  2UXC Q;  1JJG A;  4IPC A;  1J6Q A;  2EXD A;  5C3E G;  2A1A A;  3ULJ A;  2EIF A;  4HJ5 A;  4JI5 Q;  4KHP L;  4JV5 L;  2DUD A;  3CCU A;  1BKB A;  2CCZ A;  4JBM A;  4JI6 Q;  3S17 H;  1ASZ A;  2MO1 A;  3CP0 A;  4BBR G;  4A3E G;  1WOC A;  4EQ5 A;  3F2B A;  4UP7 A;  2UXD Q;  4P73 A;  4ALP A;  2PQA A;  4GN5 A;  5M3F H;  5C0X J;  5AJ3 Q;  1HNZ L;  4DPG A;  3TRE A;  3A74 A;  4DV5 Q;  2HIX A;  3AFP A;  1KAW A;  4DR4 Q;  4A3M H;  1Q1E A;  1MKH A;  1FL0 A;  1WJJ A;  2DGY A;  3BU2 A;  3K0X A;  1VQ6 A;  3F8T A;  5IYC G;  3RLF A;  5BR8 Q;  1QZG A;  1K9M C;  4JI2 L;  1VQI A;  5IP9 H;  2NVY H;  4X62 Q;  2E2H H;  3H3V H;  4WJ3 M;  1I50 H;  5HGQ A;  1HR0 Q;  3I4N H;  4PMW A;  4AIM A;  3G71 A;  5LMU L;  3HOZ H;  3F1Z A;  4BXX G;  1JT8 A;  1WCM G;  4L5T A;  3HOY H;  2Y0S E;  1X54 A;  2C35 B;  2B63 G;  4BY7 G;  4JYA Q;  5IWA L;  4R4O A;  4B3S L;  1HNW L;  2ZJR A;  3GTJ H;  4LFC Q;  2E2J H;  1UE1 A;  1AE2 A;  1XMQ L;  1QZH A;  1E3P A;  3S2H H;  1HZB A;  1WYD A;  1KIX A;  3PSI A;  3RZD H;  2K52 A;  2K5N A;  4A3G G;  2HHH L;  5K36 G;  2VY3 A;  3ULL A;  3J81 i;  1VQ8 A;  1Q46 A;  2N8N A;  4DR3 Q;  4QJF A;  2R92 G;  1TWG H;  1OTC A;  1SLJ A;  4A3L H;  3ER0 A;  3RNU A;  1PH8 A;  3HOU G;  4LFB Q;  4P71 A;  4A75 A;  3DM3 A;  3RN2 A;  1YJ9 A;  4PG3 A;  4A3K H;  2NN6 I;  2ZJP A;  1P16 A;  1CKM A;  4DV2 L;  1AH9 A;  2JQO A;  2YYZ A;  3S1M H;  4YCV A;  2GVB A;  3PUX A;  1YI2 A;  2XTI A;  1OXU A;  4DR5 L;  1C9O A;  1Y1W G;  1XNQ Q;  4GKK Q;  1Y1V G;  5LMN Q;  1Q7Y C;  1BVS A;  1SE8 A;  1N32 L;  2B29 A;  5FLM G;  4A3C H;  3GTO H;  4A3F H;  3RLN A;  4LUV A;  2NZH A;  1G29 1;  4KLK A;  2E8G A;  2N49 A;  3G48 A;  2AWO A;  4PZ8 A;  1PV4 A;  3CC7 A;  3I4M G;  4A3D G;  4DR7 Q;  1IBM L;  4YY3 L;  1LUZ A;  1TWC H;  2K50 A;  1VQP A;  3OTO L;  1X65 A;  3W5O A;  1YIT A;  1QVG A;  4GLA C;  1XPU A;  4DR6 L;  3GO5 A;  4JOI A;  2Z6K A;  3KOJ A;  1HZA A;  4B3R L;  4JI4 Q;  4Y7N H;  1X55 A;  1Q1B A;  2NZO A;  2F4V L;  1K8G A;  2VNU D;  2D0O A;  3CMA A;  5GAH C;  5HY6 A;  4A3M G;  4IPG A;  1OXT A;  1BBW A;  1ASY A;  1CKN A;  1UEB A;  2YTY A;  5IP9 G;  3GTM H;  2LSS A;  5IYC H;  1PYS B;  5J3B A;  4GOP B;  1XNR L;  2JA7 H;  4A3I G;  1TXY A;  4IOA A;  4X66 L;  3I4N G;  1YZ6 A;  3PO3 H;  4Y52 H;  2RHQ B;  2OQK A;  4JI5 L;  4JI0 L;  1WCM H;  1E22 A;  4HJ7 A;  2OTL A;  4LF6 Q;  3CCM A;  1LM0 A;  1GVP A;  3I4O A;  4QY7 A;  3G4S A;  4TQU S;  4LF8 L;  5LMN W;  1W2B A;  1S72 A;  3KFU A;  2UXD L;  3CCR A;  2NVX H;  4NXM Q;  1KRT A;  4A93 G;  3HOW H;  2R6G A;  3KDF B;  4IFD G;  1XJV A;  2AMC B;  4DV5 L;  1K8A C;  3H15 A;  1VQC A;  4DR4 L;  3BJU A;  2KCT A;  1K3R A;  1L1O A;  3UDF A;  1PH3 A;  3CC2 A;  1YBY A;  1FJG Q;  2IHF A;  2R92 H;  4A3L G;  4X65 Q;  4DUY L;  4X62 L;  3G6E A;  4LUZ A;  3M7N A;  3AYH B;  4B3M L;  2LXK A;  1HR0 L;  1CKO A;  4JI7 Q;  3HOU H;  4NXN Q;  3L0O A;  3TS0 A;  2F3I A;  2ZM6 Q;  1I94 Q;  2A8V A;  1IBK Q;  5ELO A;  1VQ9 A;  3S1R H;  5C0X I;  4AQY Q;  4P74 A;  1B8A A;  4A3B G;  2D0P A;  4LFC L;  4GKJ L;  4TVA B;  1Y1W H;  4X64 Q;  4DK6 C;  4DUZ Q;  1PH6 A;  4A3C G;  2UU9 Q;  4A3F G;  1QVF A;  4YHH Q;  1V1Q A;  3UE0 A;  5FLM H;  1K73 C;  3A5U A;  4APV A;  1N34 Q;  3KF8 B;  3CME A;  1CUK A;  1XTD A;  1VQO A;  5JEA J;  4R4T A;  4K0K L;  3RN5 A;  4L5R C;  2IY5 B;  1VS0 A;  3M9B A;  4A3D H;  4R4Q A;  1VQN A;  3I4M H;  2VL6 A;  3W1G A;  2A19 A;  4DR1 Q;  1N8R C;  1QUQ B;  3S2D H;  1KC8 C;  4UP8 A;  1GM5 A;  1PVO A;  4BY1 H;  3K80 C;  3KF6 A;  1XMO Q;  3CXC A;  4PZ6 A;  3T1H Q;  4LFA Q;  3E9H A;  2WP8 J;  1NMF A;  4GNX B;  4JC0 A;  3ERS X;  3EN2 A;  1KL9 A;  4DAY B;  5GAE C;  3UDG A;  2WFW A;  4GKK L;  1EOV A;  1OXS C;  2PNH A;  4QIW E;  5C0X G;  1X9N A;  2UUA Q;  4B3T Q;  4LF5 Q;  4DKA C;  4JCV E;  2Z0S A;  1I3Q H;  1U0L A;  2Q2H A;  4A3J G;  1K0R A;  2D62 A;  1J5E Q;  4LF9 Q;  1R9T H;  3K81 C;  3S1N H;  5FLX c;  4JI8 Q;  4A3I H;  3D31 A;  2Q2I A;  1O7I A;  1NJI C;  3W1B A;  1PH4 A;  3BZC A;  4IPH A;  4C3H H;  4DV4 Q;  1D8L A;  4L5S A;  1EIF A;  1Q81 C;  3CF5 A;  4KI0 A;  4DV6 Q;  3HOW G;  1EFW A;  3KJP A;  3TS2 A;  4C3I H;  4HJ9 A;  2IT1 A;  1BBU A;  4HJ8 A;  1EQR A;  3CW2 C;  3U4V A;  1PFS A;  1N36 Q;  1TWA H;  4LNQ A;  4A93 H;  1W3S A;  2OTJ A;  4POF A;  1QUQ A;  1GKH A;  1N9W A;  3JC6 6;  4LF7 L;  2F52 A;  4JOI C;  1S3O A;  5ELN A;  4QGU A;  4JI1 L;  3M4P A;  1HZ9 A;  2VQE Q;  2YTV A;  1SFO H;  4GN3 B;  1AE3 A;  3HKZ G;  2EQS A;  4IPD A;  3PCO B;  4UP9 A;  1IBL Q;  5M3M G;  1Q86 C;  4HIM A;  3PIP A;  2V1C C;  4O0A A;  1RL2 A;  1B7Y B;  2I5M X;  1NMG A;  4P75 A;  1KXL A;  2ATW A;  1HZC A;  4R4C A;  2YV5 A;  4KHZ A;  4NXM L;  1HNX Q;  1WFQ A;  3K7U C;  4IJL A;  4DNI A;  1FGU A;  2L15 A;  1MJE A;  4WJ4 A;  5JJI A;  4DR2 Q;  4OX9 Q;  3KJO A;  4LUO A;  1YNX A;  1FJG L;  4JV5 Q;  1C7Y A;  1V9P A;  2JK8 A;  2GN5 A;  4A76 A;  1VQ4 A;  1PHJ A;  4C2M H;  4DK3 C;  1YHB A;  4BY1 G;  4OO1 I;  2RF4 A;  4IOC A;  4O2D A;  2H5X A;  3J80 c;  1I94 L;  1L1O C;  4PZ7 A;  1IBK L;  2NN6 G;  1HNZ Q;  1VQL A;  5EAY A;  2BH2 A;  4DV3 L;  4AQY L;  4DV7 Q;  4HIK A;  3KYH C;  2E5L Q;  4LF4 L;  1PH2 A;  3UDX A;  4X64 L;  3ULP A;  4DUZ L;  4YWL A;  3PUY A;  1JJ2 A;  2CWA A;  1SRU A;  1DGS A;  2CKZ B;  3TQY A;  4DV0 Q;  3T1Y L;  2UXB Q;  3JAM c;  2N78 A;  4A3J H;  1N34 L;  1VQK A;  2PI2 E;  4QL5 A;  4EX5 A;  5LMU Q;  2BA1 A;  2ZTC A;  3UDI A;  1I5F A;  2UUC L;  5M5X H;  2JJQ A;  2UUB Q;  2UXC L;  2PMZ E;  3HKS A;  3M4Q A;  3NEM A;  2IHE A;  4C3J H;  5IWA Q;  1SRO A;  2KHI A;  4DR1 L;  4JI6 L;  4JBW A;  5JJL A;  4B3S Q;  2Q2T A;  1HNW Q;  1MIU A;  1FVI A;  2WB1 G;  3J7A 5;  1VQJ A;  2I0Q A;  1VQG A;  4OO1 G;  3PUV A;  4LFA L;  3RLO A;  4OON A;  1GD7 A;  2VQF Q;  1IL2 A;  3S14 H;  5C44 H;  5AJ3 L;  1G51 A;  3SGI A;  5JJK A;  1EUJ A;  4AYB G;  2VS1 A;  2ZJQ A;  4R1J A;  2UUA L;  2KHJ A;  1C0A A;  4B3T L;  4LF5 L;  3GTQ H;  3HOV H;  3J81 j;  2QEX A;  2WAQ G;  3MXN B;  5BR8 L;  1JMC A;  4H02 A;  4LF9 L;  3HOX H;  1E1T A;  1UE6 A;  4DV1 Q;  1YVC A;  4J15 A;  2ASB A;  1EQQ A;  1EYG A;  2JA7 G;  5IP7 G;  2NVT H;  1HH2 P;  3CCV A;  1M1K C;  3BZK A;  3STB D;  3E0E A;  1Q8K A;  5M3M H;  1E7Z A;  4MTN A;  3EIV A;  4JYA L;  4HJA A;  4IFD J;  2ALY B;  2JE6 I;  4GOP A;  3MEF A;  3M4O H;  5IYD G;  1X3G A;  3GDE A;  3F2C A;  1YHQ A;  1N33 Q;  1OXX K;  2R93 G;  1NE3 A;  1X3E A;  2BH8 A;  3J81 c;  1EWI A;  1KRS A;  1N36 L;  2K5V A;  3I55 A;  1VQ7 A;  2R7Z G;  5IT9 c;  3M3Y H;  4X6A H;  2PQA B;  1K83 H;  2ZTD A;  4FDB A;  1KQS A;  4BA1 I;  2JA5 G;  4ME3 A;  4DR3 L;  2YU9 H;  1A63 A;  1KHI A;  3PF5 A;  1YHA A;  3OTO Q;  2MFI A;  3PO3 G;  5JEA G;  3PUZ A;  4LFB L;  3CQZ H;  1B70 B;  2OQ0 A;  3KDF A;  3RZO H;  1VQA A;  4JBJ A;  5FJ8 H;  2MNA A;  2VUM H;  2Y0S G;  1IBL L;  1IZ6 A;  2MO0 A;  1HJP A;  4NB3 A;  3J80 i;  3AQQ A;  3FKI G;  3B6Y A;  4JI3 Q;  3S24 A;  4OWT B;  1XNQ L;  2AWN A;  3PF4 A;  5LMN L;  3ICE A;  4AH6 A;  2VZA A;  2WAQ E;  4BBS H;  3L7Z C;  1SN8 A;  2AKW B;  2K5H A;  4GLX A;  3TRZ A;  4A3B H;  1XNR Q;  3H0G H;  1D7Q A;  1VQ5 A;  1A0I A;  3WWV A;  3CPF A;  4NPS A;  4MZ9 A;  4OX9 L;  3JAM i;  1XPO A;  4JI0 Q;  4DR7 L;  1L0W A;  2KCM A;  4LF8 Q;  3HFZ B;  1Z47 A;  1PH9 A;  4GN4 B;  1XPR A;  1V43 A;  1NTG A;  1H95 A;  2HIV A;  3D0F A;  5C44 G;  2JA9 A;  4JI4 L;  1E24 A;  1WI5 A;  1YJW A;  1Q82 C;  1KD1 C;  1G6P A;  1P8L A;  4DV7 L;  4UPA A;  4HIO A;  2E5L L;  4POG A;  2CQO A;  2HQL A;  1GO3 E;  2K14 A;  3PIO A;  3HOV G;  2VW9 A;  2LXJ A;  2JEA I;  3PUW A;  1TWH H;  2RCN A;  2QA4 A;  4DUY Q;  1NBW A;  3F2D A;  4DV0 L;  2Z6K C;  3HOX G;  2HT1 A;  2UXB L;  4B3M Q;  4GNX A;  3FP9 A;  1PH7 A;  3S15 H;  2UUB L;  2I5H A;  3I7F A;  5IP7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...