5C3EH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eH00
2ZTCA 1PYSB 2E2HH 4R4OA 2R6GA 1TWAH 2E2IH 3I4NH 4DR5L 1VS0A 1P16A 1QVGA 2IT1A 2EQSA 4LNQA 4KHPL 2R93G 1SLJA 4C2MH 2KBNA 4LFAL 1QZHA 1I5FA 2ZTDA 4BBRG 1EOVA 1IBKL 3TRZA 5JJIA 4ME3A 4AYBG 5LMNQ 4YWKA 4X65Q 4QJFA 5C0XJ 1EIFA 3TS0A 3F2BA 4WJ4A 2HIXA 1XPOA 1PHJA 2AWNA 3RLNA 5LMNL 5M5WH 3GTLH 2OQ0A 2AKWB 2JA8H 4TQUS 4HJ5A 4YHHQ 4GN3B 4PZ7A 2WFWA 4BY7H 3HOUG 5C44H 4DK3C 2CWAA 2RHQB 4HJ8A 4A4IA 4GOPA 4UP8A 4NXNL 3K8AA 3I4OA 1UE6A 1A63A 1X3FA 2MO0A 4OXPA 1EQQA 3BZCA 4JI0L 1Q1BA 4LF9Q 3GTQH 1MKHA 1X3EA 4DV6Q 2AWOA 3S16H 1DGSA 1V9PA 3FHWA 4P72A 1A0IA 4PZ8A 3CCQA 4A3CH 1HNWQ 4BA2I 3M4QA 1CUKA 2I5LX 3CCVA 2YYZA 3HOXG 2OCEA 4O2DA 4JBJA 4HIKA 3HKZE 1LTLA 3TEHB 5JJKA 4LF9L 1FVIA 3GTPH 5M3FH 2E2JH 1U0LA 2KCTA 3T1HQ 2OWOA 4DNIA 1UE1A 5M3MH 1YJWA 1ASZA 3HOWG 1I6HH 1KC8C 3GTMH 2UUAQ 4BBSG 2XGTA 4OWWB 2ES2A 1JE5A 4A75A 2K75A 4JI3Q 4GNXB 4O0AA 1HZAA 4DR2L 4DV5L 3TS2A 4A3BH 2F4VQ 1BBWA 4MTNA 3PUWA 3T1YQ 2JA7H 1SRUA 1YNXA 3HFZB 3PF5A 4C3IH 3OTOQ 3M4OH 4LF6Q 2JA6H 2E5LQ 2NZHA 2UUBL 3S2DH 3CMEA 4AH6A 1PH2A 5FJ8G 2WAQG 4JI4Q 1M90C 1PH3A 3T1YL 4QIWE 4DUYQ 5HY6A 2VY3A 4DV2L 1OTCA 4LF6L 3CMAA 1KRSA 5BR8Q 4DKAC 2E5LL 2UU9Q 1VQFA 1Y14B 3HOYH 4L5RC 2B63H 4B3SL 4DR7L 3GTGH 1YBYA 1HNZQ 5AJ3Q 2R7ZG 4A3EG 1Z9FA 3GO5A 2ID0A 3KOJA 4JI7L 1IBMQ 4R4CA 4JI5Q 1VQ5A 1PYBA 1L2FA 3TREA 3CCSA 3RN2A 1VQDA 2BH8A 3PUXA 1O7IA 1GO3E 1FJGL 1N36L 4B3RQ 5AJ3L 3BJUA 2NN6I 1XPUA 2VQFQ 3M4PA 4BXXG 3H0GH 4BY1G 4OX9Q 2YTYA 5EAYA 1L1OC 1TXYA 4A93H 2JA5G 2Q2HA 3K81C 1VQPA 5IYDH 2MQHA 3GTOH 1EQRA 4IFDJ 2K4KA 4A3KG 3A0JA 5IYBH 4DR1Q 1VQMA 1C7YA 1V43A 1YJNA 1UE7A 1X55A 1CKMA 4YY3Q 4IPHA 1J5EQ 1NJIC 2HQLA 2NVXH 2UXCQ 2PQAB 3UDFA 1OXVA 1CSPA 2Y0SE 4DR1L 4A76A 3BZKA 4JV5Q 2IHEA 3NBHB 1I3QH 4PG3A 4H02A 4A3LG 1VQIA 1NMGA 4YY3L 2HT1A 3UDXA 4JBMA 1N32Q 1L0WA 4X66Q 4AYBE 3J81j 1IBLQ 2R92G 1WYDA 3HOZG 3VDYA 3ER0A 4DV1Q 1BVSA 1XNRQ 1NBWA 4X64L 3K7UC 2YV5A 2YU9H 2R93H 2PMZE 1G6PA 1LUZA 1L1OB 4DV4L 2VS1A 4DR3L 4BBRH 1RL2A 3EN2A 2D62A 1OXTA 2NVQH 1P8LA 1VQ4A 1VQ8A 3CCEA 2HHHQ 1Q12A 3ULLA 1X65A 3S1QH 2UXBQ 4JI8Q 3PCOB 2I5HA 4XTCS 4EQ5A 1YVCA 1VQ9A 2Q2TA 3J81i 4P75A 4IPDA 5GAGC 4IJHA 1WJJA 2N3SA 1N34L 4IPGA 3A5ZB 3HOUH 3KF6A 4DUZQ 4LFAQ 1G51A 3JAMc 1IBKQ 3PO2G 2R7FA 2JEAI 1CKNA 1UEBA 1E7ZA 2XTIA 3E9IA 4IFDI 2EIFA 1QUQA 3KDFA 3G4SA 4LFCQ 3M7NA 1GD7A 5M5XH 3M3YH 4DUZL 5IE8A 3CCMA 3FKIG 4QL5A 1YIJA 3HOXH 3EBEA 3DLLA 1XNQL 4LFCL 1PH8A 3CQZH 4DV0Q 2Q2UA 4DAYB 1UWVA 2JE6I 2OTJA 3M85A 1VQ6A 1IYJB 3W1BA 5IP7G 1D7QA 2A1AA 5GQOA 4LF4Q 1S40A 4A3JG 4BBSH 4NXNQ 1IXRA 1V1QA 4DV0L 1VQNA 4LUVA 4JI0Q 3KLWA 4MNOA 2ZM6Q 1K9MC 3H3VH 5FLMG 4A3FG 1HZCA 3PUZA 4GNXC 2IX0A 2BA1A 2H5XA 1KL9A 4POFA 2OQKA 4LF4L 4JI6Q 1XMOL 2MNAA 4JI1L 3Q8DA 2ZM6L 1EYGA 1VCIA 4LF8L 1NE3A 1VQCA 3L7ZC 1EUJA 3CAMA 5FJ8H 1I94L 1Q81C 3CD6A 1NMFA 2VL6A 3GTKH 4DAMA 4JI6L 1H95A 1Y1WG 5GROA 3J7ZC 4R4QA 1SE8A 4JCVE 4X62L 1Y1VG 1X9NA 1KD1C 1UE5A 3CC2A 1FL0A 3TQYA 4DR2Q 4A3DG 4GKJQ 3W1GA 4DV5Q 2K5VA 4A3EH 1YZ6A 2LXKA 2PI2A 4JOIC 2R7ZH 2WB1E 3KF8B 4L5QA 1HZ9A 1J6QA 3UE1A 5M5YH 1KIXA 2UUBQ 4GKJL 4P73A 2VW9A 3F8TA 1Q1EA 1QVFA 4JBKA 4P74A 3H3VI 5JEAJ 1A62A 1S3OA 5IT9c 4DV2Q 2Z6KC 3STBD 2VQEL 5GAHC 1HH2P 2JA5H 4YCVA 4XIGS 3MEFA 4GLVB 4B3SQ 1PH4A 4DR7Q 2NVTH 4K0KL 3AYHB 1TWFH 4HJAA 1LM0A 1PH5A 2NVYH 4DV3L 1X3GA 4GLAC 4A3KH 4JI7Q 4LUZA 5C3EH 5LMUL 2VUMG 2UXDQ 3RR5A 1CSQA 2RHSB 1Q8KA 4LFBQ 4OO1G 1LYLA 4DV7Q 1YITA 3PIPA 3RN5A 1N36Q 3U4VA 1FJGQ 3WWVA 1YHQA 2I0QA 3KYHC 4BY7G 2KHJA 4AIMA 2ZTEA 3PSIA 2K14A 2UXDL 5C0XG 3S15H 4A3LH 1VQOA 1E1TA 4LFBL 4DV7L 4AQYL 2R92H 3S1RH 3LGJA 4GNXA 3HOVG 1T9HA 4IO9A 1EIYB 2UUCQ 3D0FA 5IYCG 4FDBA 3CW2C 1PV4A 1VQAA 5ELNA 2GVBA 3FP9A 4GS3A 4NPSA 4APVA 1YEZA 1ASYA 4JI2L 2Z0SA 1R9TH 4R4IA 2FXQA 2Q2IA 3W5OA 3UDGA 2UUCL 2K50A 1IZ6A 4A3MH 1C0AA 3ERSX 1GVPA 4DR6L 1HR0W 3ULJA 2BH2A 1Q82C 3HKZG 2D0PA 2ZJPA 4KI0A 4IPCA 2NN6G 4GKKL 4JYAL 3J80c 1PVOA 4UY8C 1W3SA 1QZGA 2WP8J 2KHIA 4JOIA 4X64Q 3CC7A 2ASBA 4YWLA 2JQOA 3K0XA 4DV4Q 4DR3Q 4QQBX 3PO2H 4LF7Q 1WI5A 1WOCA 3I7FA 2JA6G 3RLOA 3GDEA 2CFMA 1TWGH 1WCMG 4A3GG 1YI2A 3JAMi 4HIDA 3S24A 1PFSA 3GD7A 2LSSA 3CPWA 4WJ3M 4B3TQ 3FKIH 3MXNB 3STBC 1GM5A 4LF7L 3AEVA 1PH9A 1VQLA 5IY0A 3PUYA 2BA0A 1Q7YC 1JMCA 4MZ9A 3U50C 3OYYA 3PV0A 4K0KQ 5IP9G 2QA4A 1N34Q 2D0OA 4B3TL 3PO3G 4L5SA 5IP7H 2VNUD 3CCJA 4YCWA 2IX1A 3B6YA 1SN8A 3CCRA 2NZOA 2LXJA 3A74A 2VZAA 3CPFA 1YHBA 3M9BA 2PQAA 4GOPC 4A3IG 5JJLA 5FLMH 4A3FH 1VQBA 1JJ2A 3HKSA 1E22A 1AE2A 1VQEA 4LWCA 3S14H 1X6OA 4POGA 2GVAA 2JEBI 1B70B 1XPRA 1VQ7A 2V1CC 1E3PA 4C3JH 1XNQQ 1HJPA 4R4TA 3K80C 1GKHA 2JK8A 3OW2A 1L1OA 1Y1WH 3I2ZA 4OWTB 3CCUA 1Y1VH 2K5HA 3F2CA 1BKBA 1MIUA 1YHAA 4JBWA 2YTXA 1XMQL 4HJ9A 5J3BA 1K0RA 3I4MG 3HOWH 4IFDG 5C4XG 4GOPB 1KQSA 1K8GA 1XMOQ 1YJ9A 4R1JA 1VQGA 3JC66 4JI1Q 4Y7NH 2HIVA 2PI2E 2DUDA 2WAQE 3AFPA 2F52A 2Y0SG 3D31A 5GAEC 1I94Q 4LF8Q 4Y52H 1AH9A 4JG2A 1I50H 1KAWA 4IOAA 1MJCA 1JJGA 1N8RC 4HIMA 4GN4B 4X62Q 4UP7A 2IHFA 4P71A 2ZJQA 4PZ6A 2RF4A 5C4JH 4KHZA 2F3IA 3J81c 5FLXc 4RMFA 3E0EA 3SGIA 4C3HH 3PF4A 5K36G 1G291 2VUMH 1Q46A 4J15A 2A8VA 1Z47A 3PUVA 4IOCA 1Q86C 1K73C 4X65L 1M1KC 4X6AH 4BA1I 1HZBA 2ATWA 1SMXA 3S1NH 3IRBA 4KLKA 4UP9A 1SR3A 3I4NG 3K7AH 4OWXB 3U4ZA 5LMNW 4NXMQ 2VQEQ 3S2HH 4YHHL 2B3GA 2ZJRA 3HOVH 3BU2A 3EIVA 2MO1A 4BXXH 4DV3Q 4BY1H 5IYCH 1QVCA 3KJOA 3RNUA 5HGQA 4NXML 5LMUQ 4YWMA 2JA9A 1B7YB 4L5TA 3F2DA 3AFQA 4B3MQ 4QY7A 1HNWL 1EWIA 4DV6L 3KFUA 3UE0A 4PMWA 3PIOA 4GLXA 1W2BA 1A8VA 4B3ML 2JA8G 3F1ZA 5DLQE 2K5NA 4AQYQ 3KJPA 1VQJA 4LF5Q 4HIOA 2KCMA 3RZOH 3NEMA 5IWAQ 3T1HL 3S1MH 4JC0A 5C44G 4OO1I 1VQHA 2ALYB 3J80i 3RLFA 2UUAL 1HR0Q 1BBUA 4OONA 1EFWA 3L0OA 4ALPA 2AMCB 4JI2Q 5IYDG 4LF5L 5C0XI 2GN5A 4JI3L 5IWAL 3L2PA 1SROA 1WCMH 5E7NA 2C35B 2YTVA 1JB7A 4A3GH 2I5MX 4A3CG 2F4VL 1K8AC 1K83H 2L15A 3HOZH 4DR6Q 5ELOA 3RZDH 1HR0L 4EX5A 3OTOL 2RCNA 3NENA 2JJQA 5M3FG 2OTLA 4UPAA 4GKKQ 4JYAQ 4JI4L 5IP9H 3CXCA 1N33Q 5M3MG 4DUYL 1N9WA 2IY5B 3UDIA 1KHIA 3PO3H 5BR8L 2K52A 1PH1A 2UU9L 3G71A 2PNHA 4IJLA 4A3IH 3J7A5 1K3RA 1HNZL 3CP0A 4DPGA 2AHOB 2CKZB 3ULPA 1JJCB 3A5UA 1XJVA 1N33L 4A3BG 1IBML 4JI5L 2JA7G 3ZJYC 1TWHH 1IL2A 3G48A 2WB1G 1WFQA 2CCZA 4B3RL 3CF5A 1KXLA 1NY4A 3E9HA 1B8AA 2EXDA 1NTGA 4YCUA 2QGQA 4DR4Q 2VQFL 2CWPA 1MJEA 2Z6KA 1OXXK 5C3EG 4OX9L 1JT8A 1E24A 2E8GA 3HOYG 1OXSC 3PGZA 5JEAG 1S72A 5H1SE 3CCLA 2B63G 3S17H 3I55A 4HJ7A 1D8LA 4DR4L 1AE3A 2N49A 4NB3A 1XTDA 3KF6B 1U5KA 3I4MH 2N78A 1C9OA 1RIPA 3GTJH 3NELA 5C4XH 3DM3A 1CKNB 4A3JH 1J5EL 2UXCL 1OXUA 3H15A 1QUQB 3KDFB 4TVAB 1KRTA 4JV5L 2N8NA 4GN5A 2QEXA 2KENA 2B29A 4DK6C 3CC4A 3H0GG 4KHPQ 4LW1A 1HNXQ 1N32L 2DGYA 4A93G 1TWCH 1SFOH 4X66L 1PH7A 1IBLL 1X56A 2CQOA 2R7DA 3G6EA 4DV1L 1XMQQ 1XNRL 1X54A 5IYBG 3U58A 2A19A 4A3MG 1VQKA 1HNXL 5GADC 2MFIA 4QGUA 1CKOA 1PH6A 2HHHL 4DR5Q 1FGUA 1PA6A 4A3DH 3ICEA 4JI8L 2UXBL 4LUOA 4RG1A 1E1OA 3I56A 3AQQA
chains in the Genus database with same CATH superfamily
2ZTCA 3I4NH 2F03A 5ELBA 2E2HB 1TWAB 4LNQA 2BDNA 1Y69U 2RSNA 1SLJA 2NYZD 4HCEA 1QZHA 2PZUA 3TRZA 4BBRG 5I2YA 4EQNA 4F87A 5JJIA 4IUPA 3D6WA 1AZPA 3BYYB 4FXKC 4QF4A 5ELCA 5C0XJ 3NTIA 5E4XA 1HTLD 4RKLA 2HIXA 1XPOA 4KV6A 4WRDA 3KBGA 3F2UA 1SYCA 2JA8H 4YHHQ 4GN3B 1FYCA 4DK3C 4HJ8A 4NXNL 3S1NB 4OXPA 1JICA 1L0XB 1RTOA 1F2YA 4DV6Q 1NUCA 1A0IA 4PZ8A 2F0WA 3S16B 3GTQB 1CUKA 3A56A 2OCEA 1KTKA 5JJKA 3TEHB 1FVIA 5M9OA 2KCTA 1QWYA 3HOWG 1KC8C 3GTMH 3Q24A 1HXYD 1QE6A 3IL8A 2XGTA 4OWWB 1MSHA 4FF3A 2CVRA 3HKZB 5CV5A 5HURA 1U9RA 4ZLTF 3TS2A 4MTNA 2EDGA 2DN8A 3PUWA 2KECA 1YNXA 3PF5A 4RGNA 2JA7H 3RZOB 3ERQA 1IL8A 4A3BB 4N8X1 2NZHA 2E5LQ 3CMEA 1HUMA 4KY6A 3W2DA 4C3IB 1M90C 2I46A 4DUYQ 2E5LL 2EY2A 3HOYH 1Y14B 4L5RC 3RZDB 1Z9FA 4S3SA 4R4CA 2B2YA 1G2TA 1VQ5A 3TREA 1L2FA 1H9SA 4X3KA 4F8MA 1O7IA 1GO3E 4QMGA 2VQFQ 1S5BD 5EAYA 2Q2HA 2MQHA 4IFDJ 2K32A 4A3KG 2G9HD 3DXJC 3CKIB 2B2TC 1DM0B 3SK6A 4TKOB 5KNDA 1OXVA 1CSPA 2Y0SE 2F4IA 4A76A 4JV5Q 1F9PA 1LT4D 2IHEA 5CV6A 2NVXB 4FF1A 1VMPA 4H02A 4IUVA 4PG3A 5E3FA 3RUZA 5FLXL 2HT1A 4MN3A 1I3QB 1M8AA 2NBFA 3K6OA 4X64L 3K7UC 1BO0A 2YU9H 2R93H 1LUZA 2L5TA 3HOZG 3BYTB 2DJGC 2PQEA 5JOBA 3ULLA 1FGBD 1TWCB 5JPMC 4JI8Q 2UXBQ 4AYBB 2H4OA 4G57A 3PCOB 1ZYRC 4FP5D 4XTCS 2KCNA 2Q2TA 2PMZB 4P75A 1SNQA 2RKSA 2K5WA 4HSPA 2VXWA 2GA4B 2N3SA 2F0HA 1PFBA 3JAMc 1IBKQ 2JEAI 1CKNA 4RGOS 1YNJC 1Y8PB 1QUQA 1STAA 3SEBA 3G7LA 5EPLA 2L0CA 1TU2B 4XQJA 5M5XB 3EBEA 3DLLA 4ME5A 1WTOA 2XVSA 2Q2UA 4DAYB 2JE6I 1BBXC 2OTJA 3H94A 3CQZB 3W1BA 5IP7G 5GQOA 1STBA 4ZCKA 3BDLA 2TMPA 4IUQA 5FOBB 1S40A 1IXRA 4ZQ3A 4BBSH 1K9MC 1Q90A 2NTSA 4CJ0B 2JA8B 4GNXC 1HQRD 4JI6Q 5IGFA 2MNAA 1PRTF 3Q8DA 5LHY1 2QW7A 5FJ8H 1EUJA 1I94L 1KNAA 3CD6A 1Q81C 2VL6A 3GTKH 2EYHA 4JI6L 1H95A 4R4QA 4X62L 4JCVE 1Y1VG 1C4QA 1SJED 4DV5Q 2K5VA 2R7ZH 4JOIC 3D6CA 1WD0A 3KF8B 3I4LA 4A3EB 3UE1A 5M5YH 1CT1D 4P73A 2VW9A 1PYWD 1QVFA 4P74A 5JEAJ 1A62A 4DV2Q 2F0DA 2R3ZA 2JA7B 4YCVA 2XRQD 4B3SQ 1PH4A 4FO2A 4R9WA 1TWFH 1LM0A 3A55A 2NVYH 1PH5A 5L37A 4GLAC 4JI7Q 4LUZA 1EU3A 1ZYRD 3T56B 2NVTB 1FR3A 1CSQA 1WTWA 2A74C 5JVG3 3PIPA 3RN5A 1FJGQ 2KHJA 3PSIA 2XRSD 5CYUA 2B2UC 1E1TA 1O78A 1YNJD 2MHVA 4M1UB 2R92H 2E2DC 3TP7A 1TR5A 1VQAA 2PW7A 5ELNA 3MVVA 4GS3A 4APVA 2FXQA 2K50A 3D4DA 1IZ6A 4KKUA 4A3MH 2LFNA 1HR0W 2ICEC 1Q82C 3HKZG 2ZJPA 3MC0B 4IPCA 1S5ED 3EJIA 1PVOA 1W3SA 2ASBA 3CC7A 3H91A 4DV4Q 1ET9A 4DR3Q 3HG9A 4C3IG 1WOCA 1HFNA 1R4PB 2CFMA 5J39A 1WCMG 4A3GG 3JAMi 1PFSA 4B3TQ 2YU9B 5IY0A 5EQ0A 2HCCA 4MZ9A 1JMCA 1F2MA 1LT6D 2QA4A 1N34Q 4B3TL 4L5SA 2VNUD 4OHJA 3CPFA 2LXJA 4A3IG 4K6DA 2F0OA 3VYRA 1GUWA 4K2LA 5JJLA 1MBYA 3TSSA 1LABA 3SVMA 1X6OA 4POGA 2GVAA 3QIAA 1QNKA 4MHEA 2F0SA 1GOZA 4BWGB 1SBBB 2NUCA 4HTHA 1HCZA 3I70A 1SJHD 1TY0A 2JK8A 3OW2A 1Y1WH 2PW5A 4OWTB 2K5HA 4H7BA 1FNVA 5E4WC 4JK1C 1K0RA 1EWCA 3D4WA 3HOWH 2SOBA 1KQSA 4RAUC 1XMOQ 1KLUD 4JI1Q 1VQGA 4XYQA 2HIVA 2PI2E 1TS4A 4BBSB 1SNOA 3U9SA 2IHFA 4P71A 1I50B 4KKSA 2IX3A 5EKKA 4KHZA 5FLXc 1XXGA 4RMFA 3PF4A 2WAQB 1SYBA 4R8NA 1A2UA 3GTKB 2B2YC 2K7VA 4J15A 1I4PA 4C3HB 3PUVA 3E0JA 1CZWA 4PNYA 1Q86C 1M1KC 1SMYD 2ATWA 1BCPC 3JAME 3EVQA 5C0XH 3I4NG 3K7AH 5LMNW 2VQEQ 1ICWA 1JR0D 2MO1A 2A73B 4DV3Q 5IYCH 3KJOA 5HGQA 3S9WA 3FPPA 4UHVA 1HNWL 2PYKA 3OWFA 1EWIA 3KFUA 3GP7A 3UE0A 4DNTB 3PIOA 2K28A 1W2BA 5DM73 2NVYB 3BVMA 1H9SB 3F1ZA 2JA8G 2K5NA 1F77A 4NP5A 4AQYQ 2NN6H 4HIOA 2A69C 3T1HL 2F0EA 3RLFA 3NWSA 1EFWA 1TQOA 4ALPA 4JI2Q 4WJWA 1JOOA 2EYOA 3L2PA 5E7NA 1JB7A 3QJYA 2R92B 1K8AC 3HOZH 4DR6Q 4HEDA 1V8QA 4EX5A 2L1BA 1K83B 3DWAA 4JYAQ 1Y8NB 3UDIA 1SYFA 1I6VC 3Q0AA 3J7A5 1HNZL 1WTVA 2F0GA 3IAYA 3LWUA 1DCZA 2JA7G 1TWHH 5KGUA 3E5SA 2EYFA 4TRDA 5I6YA 4K8JA 3CF5A 1KXLA 3E9HA 2QGQA 1D1IA 1B3AA 1O7LA 4XYOA 2RDGA 2IW3A 1E24A 3HOYG 3S17H 3P20A 4CDDC 4RGTA 1XTDA 2M2LA 3I4MH 2ZT9C 1ML0D 4IFDH 1CKNB 1J5EL 2PZWA 3H15A 3GTJB 1QUQB 2N8NA 2RDFA 4GN5A 4DK6C 1EYDA 4LW1A 1N32L 1ENCA 4N9TA 4X66L 1IBLL 1X56A 1U4PA 2R7DA 3G6EA 4DV1L 1F2ZA 1B1ZA 5IT9L 1G91A 1CKOA 2HHHL 1Y1WB 1F9SA 1FGUA 4RGMA 5IGCA 3ICEA 4LUOA 3R8BA 3N6RA 2E2HH 4R4OA 1TWAH 2EPBA 2FMMA 2Z1CA 2E2IH 1NNXA 4Z9CB 1P16A 5FKAC 1QVGA 2IT1A 2EQSA 1PDQA 2NZ1D 2R93G 1EQVA 4LFAL 1I5FA 2ZTDA 4I7AA 4OIJA 4R8IA 4C2MB 2KEEA 3FRPB 1LTAD 1PHJA 1MI2A 3RLNA 2AKWB 4TQUS 4HJ5A 4DAVA 4XDXA 4DAYA 2JP1A 3K59A 3R2TA 3E6ZX 1VF5C 4GOPA 1TVXA 4WORA 3K8AA 1UE6A 5DAUA 3V05A 3S16H 3GTQH 2K01A 3K7AB 1MKHA 1V9PA 4A3CH 4BA2I 3M4QA 1WVLA 3HRZC 2YYZA 4HIKA 1LTLA 1CTMA 2L11A 1SDFA 4KJNA 3EQLC 2OWOA 4RWSC 5M3MH 1IKMA 2UUAQ 3U9OA 4BBSG 2ES2A 1JE5A 1RF2D 4A75A 4JI3Q 2MP1A 4A3BH 2F4VQ 1DYQA 3NHHA 4ZRZA 3HFZB 3IFTA 4IQZA 4C3IH 3M4OH 4N8FA 3NSWA 1A3VA 5FJ8G 1GUOA 2WAQG 5FLXE 4JI4Q 3T4AC 5HY6A 5C3WA 5BR8Q 2B2VA 2LMCB 1VQFA 1O80A 5JEAH 4DR7L 1KNEA 4QB4A 2R7ZG 4RCOA 1IBMQ 4JI5Q 3GTGB 3P75A 3CCSA 3PUXA 1NCVA 1N36L 1X3QA 3BJUA 1XPUA 1A15A 3M4PA 2YTYA 3D3RA 1TXYA 4A93H 4KJOA 3K81C 2B2WA 2KJXA 2QF7A 1VQPA 1B50A 4FF2A 3V2TA 5IYBH 1EEID 1C7YA 1UE7A 3M4YA 4P2CB 3VYSA 1X55A 4YY3Q 1NJIC 2NVXH 2MJ8A 1I3QH 3J81L 1VQIA 1EY8A 1D5MC 4YY3L 4EQPA 3I4MB 5KEEA 2R92G 1WYDA 3VDYA 3P7JA 1BVSA 1K28A 2G5DA 3QO2A 2PPBC 2VS1A 1RL2A 2D62A 1P8LA 1VQ4A 1SNPA 2DNCA 2NVQB 3FEWX 3PQIA 2J7ZA 4KKTA 2I5HA 2E76C 1IW7D 4IJHA 3T53B 1FNWA 3KF6A 4DUZQ 1G51A 5C4ZA 2R7FA 1K8MA 3OIPA 2Z6BA 4FNFA 3E9IA 1E7ZA 2K05A 1LTGD 2EIFA 4LFCQ 3KDFA 3M7NA 2E2IB 5M5XH 1I4HA 2K04A 4DUZL 5IE8A 3CCMA 1LTTD 4QL5A 3M3YB 1B4OA 5BN4A 5DEHA 1BXTA 1H9KA 1XNQL 4LFCL 3CQZH 3L3OC 2O5JC 2WACA 3M85A 1VQ6A 1IYJB 5IGDA 2B39A 1B9NA 4NXNQ 1PFMA 1HRJA 1VQNA 4NMZA 3H3VH 1JOKA 1WTXA 3PUZA 3ONAB 2DY8A 1F2LA 1NR2A 3QR8A 4LF8L 2MGSA 1GXDC 3KK7A 2K1BA 1Y1WG 1SE8A 1W6KA 3DEPA 1X9NA 2F0VA 4KN7C 3CC2A 1FL0A 4A3EH 2LXKA 1SNMA 2K33A 3BG3A 5M3MB 5CV7A 5KNBA 1Q1EA 1A6XA 5IT9c 3STBD 3NTKA 5C5MA 5GAHC 2JA5H 3KLRA 4GLVB 3MZ5A 4J1MA 4DF7A 2WB1B 3M4OB 2NVTH 2X6LA 2JN4A 1X3GA 3W3AA 3K57A 4XT3B 2UXDQ 1TS3A 2RHSB 3C2PA 5C3EB 1LYLA 2L9HA 2O2LD 4RKBA 2X6GA 3TMEA 4DV7Q 3U4VA 1RD9D 4BS9A 4AIMA 2IPKD 2UXDL 5C0XG 4A3LH 3TN2A 4M8AA 1UUPA 3P1HA 4DV7L 3NBIA 3S1RH 1EIYB 5IYCG 4DXGA 3HGBA 3CW2C 1F9RA 1BDOA 1YEZA 1R9TH 2Q2IA 3W5OA 4A93B 4QCLA 2A6ED 2LY7A 3ERSX 1H9JA 3ULJA 4B9XA 2NN6G 4GKKL 4UY8C 1BCPF 3H6MA 3ZYYX 4X64Q 2KHIA 4YWLA 4L63B 4QQBX 1WI5A 3A8JE 4MTKA 5C3XA 3RLOA 3A7LA 3I91A 2F0QA 1TWGB 2F3WA 2BA0A 2EYLA 3SR1A 4DU9A 1SYGA 1STEA 2RSOA 2HDLA 4X3UA 1XWEA 1SN8A 3B6YA 3CCRA 4GOPC 1HPCA 5FLMH 4A3FH 1JJ2A 3S14H 1AE2A 5EBCA 3H3VC 1E3PA 4C3JH 4IUTA 1HJPA 3M7GA 5C6AA 1JWMD 1Z6HA 1ILPA 2CW0D 4R4TA 3K80C 3I2ZA 3CCUA 3MHBA 1MHWC 5EJWA 5J3BA 4KMUC 3I3CA 3I4MG 1LT5D 4CDEC 4IFDG 4GOPB 2RA4A 1K8GA 4R1JA 2KEDA 2DUDA 3D31A 3C1EA 1ICFB 4O1NA 1I94Q 1B2TA 4JG2A 1I50H 1KAWA 1PFNA 4Y7NB 4IOAA 1MJCA 1T5EA 2CH4W 4HIMA 4X62Q 1G8ZD 2BOSA 1B44D 2K03A 2B2VC 2RF4A 4CBVA 4EVOA 2F3IA 4J8QA 2J0TD 1CI3M 5EBDA 3J81c 4C3HH 1G291 1RDPD 1Q46A 3NQIA 1GJXA 1UAPA 4X65L 4OO1H 1H9RA 5KRUA 2KQ3A 3ND9A 4UP9A 4OWXB 4NXMQ 3U4ZA 2ZJRA 2N88A 1QVCA 4NXML 4CJ1B 4L5TA 4FXGC 3AFQA 4B3MQ 4QY7A 4H44C 3BZDB 1WTPA 1AZQA 4FYDA 1L0YB 3KLSA 4X3SA 5FO7B 2JA5B 2O4XA 4B3ML 1F9QA 1VQJA 4JC0A 1C48A 4IUUA 1GHJA 4OONA 5C0XI 2BE5C 1SROA 2C35B 2V4DA 4A3CG 1K83H 3S1RB 1LO5D 2ZXOA 5ELFA 3OTOL 1RCVD 2RCNA 3EROA 2EY6A 5IP9H 5M3MG 3MAQA 1R9TB 1BOSA 2UU9L 4GZYC 1IKLA 2KUMA 5COYA 1QG7A 1K3RA 1SMYC 1U4MA 4DNRB 4DPGA 5J22A 2CKZB 1XJVA 3A5UA 1V1PA 4A3BG 5IT9E 2EY1A 3IKJA 4ZUIA 3ZJYC 1IL2A 3G48A 1K3BC 2WB1G 2CCZA 1LT3D 1EY5A 4B3RL 4HCSA 2Z6KA 1HFGA 5C3EG 5I9PA 4OX9L 1JT8A 2EVBA 3EFXD 5JEAG 1S72A 5H1SE 4HJ7A 1D8LA 3KF6B 2N78A 3OHXC 5EKLA 3GTJH 3NELA 5C4XH 2UXCL 1TS5A 2ZXRA 1TKWB 4PV1C 3KDFB 4TVAB 3CC4A 2KENA 2K6AA 1CFMA 4FVMA 4JPBW 4ZYSA 4A3FB 4A93G 5KYIA 5BN3A 4DXFA 1LV9A 5C4HA 1SFOH 3S14B 1PZID 5I4DA 1XNRL 1D6EC 4C3JB 5IYBG 3N52A 1VQKA 4HN7A 3TP8A 4LJZC 3MXNA 2MFIA 4L6TB 1PH6A 2A6HC 5JPNC 4DR5Q 4RG1A 1E1OA 1PYSB 5CMDA 4A3DB 2R6GA 2EOTA 4DR5L 3AU7A 1VS0A 3ND8A 2G9DA 2BE5D 1JB3A 1BR9A 1DOKA 4C2MH 2C9OA 3A8IE 1EOVA 1EEFD 3NTHA 2MUYA 4AYBG 2WINB 3BDCA 4QJFA 3TS0A 1JWUD 3A7AB 1SYDA 3H09A 3GTLH 5M5WH 3Q22A 4PZ7A 1QOHA 2WFWA 2EJMA 2CWAA 3GV6A 1GUNA 4BY7B 4UP8A 4PMBA 1E2WA 5C44B 1X3FA 2MO0A 1EQQA 4JI0L 4RA8A 1CK1A 1Q1BA 4IALA 4LF9Q 4FXDA 1X3EA 1HNWQ 2AWOA 5IYDH 1DGSA 4P72A 3FHWA 2VB3X 3CHBD 2XIWA 2I5LX 1KAAA 3CCVA 2A68D 2Q8IB 3HKZE 1Q8IA 4LF9L 5M3FH 2E2JH 1D5XC 3T1HQ 1QILA 2MPMA 1PZKD 1YJWA 4RHSA 1WD1A 3TP6A 4OGQC 2F0TA 1I6HB 2K75A 4CGYB 1SE2A 4DR2L 4O0AA 1HZAA 1BBWA 1YNNC 5KNCA 5EPKA 1E2VA 4PMCA 2UUBL 2I07B 3J81E 4ODGA 2JA6B 1PH3A 3C46A 1STNA 2VY3A 1OTCA 1LTSD 3CMAA 5G3LD 2E74C 1SE4A 2A6HD 5EGTA 3OW7A 1STYA 3GTGH 1HNZQ 3X3MA 5AJ3Q 4A3EG 2ID0A 3KOJA 1PYBA 3RN2A 1VQDA 4LK1C 5ISRA 5AJ3L 2RQXA 3H0GH 3O13A 3NWTA 2JA5G 1CQVA 2K4KA 4DR1Q 3GQBA 1V43A 1CKMA 4IPHA 1J5EQ 2HQLA 4QUCA 1LACA 2JSOA 4DR1L 5IODA 4A3LG 1NMGA 1N32Q 2SNSA 3K5NA 4LAAA 1L0WA 4X66Q 1RKNA 4AYBE 1IBLQ 5T1IA 4C1NI 5C4XB 3ER0A 4DV1Q 1EZ6A 2YV5A 4TSSA 4F7XA 2PMZE 1G6PA 2DNEA 2Y0SB 2NVQH 5JVH3 1VQ8A 3CCEA 2HHHQ 1Q12A 4BBRB 1X65A 1SFOB 1CQFA 4EQ5A 3S1QB 5TSSA 1YVCA 2P5ZX 4YIJA 1U4LA 4ULLA 1QB5D 4IPGA 4EGVA 3SXHA 1ILQA 3A5ZB 4RH6A 3HOUH 4DFAA 4LFAQ 1YNND 4ZK9B 3OSOA 1UEBA 2XTIA 1PRTB 3G4SA 4C1NK 3M3YH 2BCOA 3MXGA 1MSGA 1XTCD 2F0UA 1YIJA 3HOXH 2EJFC 1BNZA 1E0BA 2XWJB 1UWVA 2XNAC 1KLGD 1JCKB 4WFN3 1HHVA 1UNSA 2A1AA 2B2TA 4LF4Q 4LUVA 1ENAA 3KLWA 4MNOA 5DNFA 2ZM6Q 5FLMG 5M5WB 4A3FG 1HZCA 3GTLB 2BA1A 4POFA 4LF4L 2HDMA 4C3JG 3CU7A 3C1FA 2ZM6L 1VCIA 1VQCA 4O42A 4DAMA 5CORA 5GROA 3I90A 3DUZA 1WTHA 1KD1C 4A3DG 4GKJQ 5M3FB 3J7AV 2E2JB 1IW7C 1EY9A 1I4RA 1PXUA 4L5QA 2LS01 4GKJL 1PRTD 4JBKA 1SNDA 5IOCA 4QUFA 3H3VI 1S3OA 3G6JB 2Z6KC 1CZGA 5D65A 4K2KA 4XIGS 3HS0C 4CDFC 4DR7Q 4DA2A 4HJAA 4C3HG 5C3EH 1HA6A 5LMUL 5CC4A 1NR4A 2L12A 4FF4A 4LFBQ 4OO1G 3BVGA 1N36Q 3WWVA 1EY7A 2I0QA 1V1PB 3KYHC 4H13C 4BY7G 2J4XA 4QIWB 4LFBL 4RHRA 3S15B 3LGJA 4GNXA 1T9HA 4IO9A 1SNCA 2WIIB 4FDBA 2KOLA 3H0GB 3FP9A 1ASYA 2Z0SA 4R4IA 3UDGA 3EA6A 3NUCA 1C0AA 1GVPA 2IL8A 2JXMB 2TSSA 2D0PA 3MTSA 1PTOH 1BQQT 2WP8J 4JOIA 3MFGA 2JQOA 3K0XA 5ELEA 5A2QL 3PO2H 2JA6G 3GDEA 5A35A 1TWGH 1YI2A 4HIDA 3S24A 3T51B 2LSSA 4CDCC 3OPOA 3FKIH 3MXNB 3STBC 3OIQA 3OWEB 4CJ2C 3PUYA 2PCFB 3K5LA 1PH9A 3U50C 3OYYA 4HSVA 1EYCA 3I72A 2Z8LA 5IP9G 2F0FA 2D0OA 3V96A 3QOJA 4I65A 3L9AX 2IX1A 4K5WA 1ESRA 2M00A 1H9MA 2PQAA 2N55A 1BUVT 1JQYD 2EYPA 1VQBA 3NBHA 3HKSA 3PMFA 2F0KA 2KA7A 1V1OA 2B2UA 3D8GA 3T13A 1Y8OB 1HUNA 1B70B 3HOUB 1NSNS 1XPRA 1AFPA 1XNQQ 1X3PA 1LTID 4NDXA 1S5DD 1LTRD 1L1OA 5KIXA 1YHAA 4JBWA 2YTXA 4B08A 1XMQL 3HOXB 2A6EC 5JJZA 4NKLA 3FVQA 5C4XG 2F1MA 3SE0A 1PLFA 5KYLA 4V190 1STHA 4Y7NH 1W6JA 1WTRA 2L4NA 1DOLA 2WAQE 4LF8Q 1D1KA 2Y0SG 5JAVA 5GAEC 3NQTA 4Y52H 1AH9A 2ENBA 1N8RC 4GN4B 4Q5VA 1A3TA 3LX0A 1TS2A 2QDBA 3LNNA 3SGIA 5C4JB 5K36G 3IFDA 1ENFA 2VUMH 2A8VA 1Z47A 1K73C 2PZTA 4X6AH 4BA1I 1HZBA 3DMUA 1SMXA 1ZXTA 4KLKA 4YHHL 1GUSA 2KVMA 2B3GA 2AUJD 1CHPD 3HOVH 3S2HB 3EIVA 1KDCA 1KDAA 4KN4C 2PNRC 4IZ8A 3I73A 4YWMA 2JA9A 1B7YB 3F2DA 4BY1B 1S5FD 2CW0C 1QNUA 4DV6L 4PMWA 2Z4HA 4GLXA 3A54A 1A8VA 3TP5A 5G3LF 5DLQE 1D2BA 2M9VA 3RD4A 4LF5Q 1O7YA 3DWQA 3NEMA 4C56C 5IWAQ 4OO1I 1PTOC 2AQ3B 1VQHA 1VF7A 3S1MB 1HR0Q 1BBUA 2RBMA 3L0OA 4LF5L 5IYDG 5EPJA 3T16A 5IWAL 2I5MX 2NWGA 2L15A 5D3DA 3FDTA 2F0NA 1HR0L 1WCMB 1EWHA 4A3GB 2CQAA 4K14A 2JJQA 2F3VA 5M3FG 2OTLA 4UPAA 4GKKQ 2FHTA 3CXCA 4DUYL 1KHIA 3PO3H 1RTNA 1DJRD 2K52A 3FPUB 1PH1A 2F0PA 5CV9A 4IJLA 3CP0A 2AHOB 1EU4A 3MXPA 3DWPA 1PTOB 4XXEA 4A3IB 4IUNA 1G6ZA 3AB9A 1WFQA 3PO2B 4YCUA 5LL6X 2EXDA 4DN4M 1NTGA 4DR4Q 2B8GA 2VQFL 5IGGA 1MJEA 1AEXA 4V0BA 3PGZA 3FKIB 4DR4L 3QWNA 2A5HA 1SYEA 1SXTA 4XQNA 1K8OA 1C9OA 1RIPA 3DM3A 1HTPA 1JORA 4JV5L 4A3JB 2QEXA 2B29A 3H0GG 2HD3A 1T5XD 1CM9A 5FO8B 1EFID 3DM1A 5IGEA 2AQ2B 3VA7A 1PH7A 2CQOA 1AP0A 1PZJD 4UDUC 3U58A 2A19A 1VDZA 3I8ZA 2EXZA 4QGUA 5E1FA 2D9UA 1Q3LA 4PQXA 3FMCA 1PA6A 4JW0A 5AFWA 4A3DH 2UXBL 4JI8L 1I4GA 4KHPQ 1EOTA 1PTOD 4N9PA 4KHPL 3I4NB 5FO9B 2KBNA 5FK9C 1IBKL 4ME3A 2OF1A 5LMNQ 2D2CC 2FINB 4YWKA 4X65Q 1RHPA 1EIFA 3F2BA 4WJ4A 4JVZA 1XX8A 2AWNA 4U68A 4KK7A 5LMNL 2OQ0A 1AN8A 4OEMB 2VUMB 4BY7H 3HOUG 3E3XA 4ILWA 5C44H 2RHQB 4A4IA 3OMCA 5IIFA 5CV4A 1GUTA 3I4OA 3VR6A 3MWYW 4KTAA 1A63A 4NW2A 3BZCA 2B2WC 2DJFC 4KD3A 3J80L 4G4KA 3CCQA 3AMUA 4K6LA 2ICIA 3HOXG 3HOVB 4O2DA 4JBJA 2EY5A 3GTPH 4CKBA 2Q8RE 1EY4A 1U0LA 3PIP3 4CKEA 3ITPA 4DNIA 1UE1A 2WV6D 1ASZA 1I6HH 3I56A 3HP3A 3K5OA 3GTMB 4K5XA 4GNXB 4DV5L 3NK9A 3T1YQ 1BF4A 1SRUA 5T1GA 3OTOQ 3S2DH 4LF6Q 3SK4A 2RDHA 1Z7TA 3VR3A 2JA6H 3GV3A 4AH6A 1PH2A 4Q0FA 2NTTA 3T1YL 4QIWE 3SHLA 1R4QB 5CBEE 4DV2L 4LF6L 1KRSA 1SEBD 3NP8A 4DKAC 2UU9Q 1PMRA 2B63H 1EY6A 4J6HA 4B3SL 1YBYA 3HOYB 5I6WA 3GO5A 3OOCA 4JI7L 2LKVA 2BH8A 3K0YA 1FJGL 4B3RQ 2X69A 2NN6I 2Z4IA 2KHSA 4BXXG 2XWBB 4BY1G 4OX9Q 1L1OC 1JE4A 4MIUA 1EYAA 4ZKCB 3GTOH 1EQRA 3A0JA 3Q6SA 1VQMA 2A68C 1YJNA 3MXUA 1RODA 3R3OA 2UXCQ 4G7HC 2PQAB 1CHQD 1E2ZA 3UDFA 4DAPA 3BZKA 2F0LA 3NBHB 1DD2A 3HZXA 4OELB 3UDXA 4JBMA 3J81j 1XNRQ 1NBWA 1TT2A 2Q8TA 3R93A 1A3UA 2F0MA 1L1OB 4DV4L 4DR3L 4BBRH 3EN2A 1RJTA 1OXTA 3TZDA 2R93B 1S4ZA 3CRLC 3S1QH 4HMIA 4KD4A 2SEBD 2IWHA 4IN3A 5K36H 1EQTA 2OEOA 4CKCA 1VQ9A 1I4QA 3KBXA 3DEOA 3J81i 4IPDA 5GAGC 2L55A 1WJJA 4L8JA 1N34L 1ET6A 4HR7B 4DGZA 3VYUA 1ZEQX 1QCBD 4EQOA 3PO2G 4IFDI 3WOEA 3X3NA 2PO4A 1FNUA 1GD7A 1SAPA 3FKIG 1K0SA 1PH8A 3HEJA 1IHZA 4DV0Q 1DONA 3RMHA 1I4XA 1D7QA 2C5CA 4A3JG 1V1QA 4DV0L 4JI0Q 1O7ZA 5CR3A 3DHQA 2IX0A 2H5XA 5D3IB 1KL9A 2OQKA 1XMOL 4JI1L 1EYGA 1IYUA 1NE3A 3BDOA 3L7ZC 3CAMA 3K5MA 2QDLA 1NMFA 5DM63 3PIO3 1M4VA 2FJ2A 1EZ8A 3J7ZC 2AUKA 1UE5A 3TQYA 4DR2Q 3VYTA 3W1GA 3GTPB 3MEHA 1YZ6A 2PI2A 3WDNA 3TBIB 2K5QA 2WB1E 2R7ZB 1HZ9A 1J6QA 5IGBA 1KABA 3Q23A 2EZVA 1KIXA 2UUBQ 3F8TA 4K8IA 5M5YB 1S5CD 4ZUJA 2VQEL 5D14A 1HH2P 2FFKB 1UEAB 3MEFA 2AQ1B 3S2DB 3AYHB 3URYA 5A2QE 4A3KH 4DV3L 2O5IC 2DY7A 2KCCA 2VUMG 1TWFB 2K5DA 3RR5A 1Q8KA 2WKCA 1YITA 2XSCA 3QB3A 1YHQA 1BCPB 2B63B 4KHVA 2ZTEA 2K14A 3S15H 1VQOA 5K5PA 5F2DA 4AQYL 1DZ1A 2Z9HA 1G2SA 2EYMA 3OMGA 3HOVG 4DK0A 1B9MA 2UUCQ 3D0FA 1STGA 4RCNA 1PV4A 3MA2B 2GVBA 4JI2L 4HAEA 4NPSA 1J9OA 2UUCL 4IURA 4G7OC 3GTOB 4DR6L 3SDZA 2BH2A 4A3MB 1B3QA 4KI0A 4JYAL 3J80c 1QZGA 4LMQD 2QCPX 4LF7Q 1HA5A 1TY2A 3I7FA 4RFBA 1PRTC 3QG1A 3A8KE 2B8FA 1MGSA 3GD7A 3CPWA 4ID6A 4WJ3M 4LF7L 1GUGA 3TZUA 1GM5A 3BVZA 2HCIA 3AEVA 5CGKA 1Q7YC 1VQLA 1SSOA 4OIKA 2NB0A 3PV0A 4K0KQ 2R61A 1BCPD 3PO3G 5IP7H 3CCJA 4YCWA 5CV8A 4K0KL 2NZOA 3A74A 2VZAA 1YHBA 3M9BA 3SK5A 3MFYA 2BDOA 1PTOF 1E22A 4LWCA 1VQEA 2CH4A 2JEBI 1VQ7A 3BS1A 2V1CC 3CRKC 1MD2D 2QEJC 1QJOA 1GKHA 1EIHA 1Y1VH 1ESFA 3F2CA 1BKBA 1MIUA 1NAPA 1JC7A 1A2TA 4HJ9A 3SK8A 1OO9B 2A69D 2RVLA 5I9OA 1JWSD 1YJ9A 2IJ0A 3JC66 5HGTA 3HOWB 2OT2A 3AFPA 1EL0A 2F52A 1HQMC 2FMCA 1EIGA 3TDQA 1JJGA 2ZJQA 4UP7A 1LTBD 4PZ6A 3J7AF 5C4JH 3E0EA 4CHTB 5BN5A 1GHKA 2EJGC 4KY5A 4IOCA 2QKIC 1AW7A 3S1NH 2F0IA 3IRBA 1SR3A 3NE5B 2H1EA 4I7ZC 3S2HH 1X32A 1FD7D 4ZAIA 3BU2A 2ZXPA 4BXXH 4BY1H 2EYJA 3RNUA 5LMUQ 1U4RA 3C3LA 4ZKBB 4H0LC 4ABNA 1C8CA 1TIID 3UI2A 1LLRD 2F0JA 4A3KB 4E6IA 3KJPA 1CA6A 2KCMA 2RCFA 3RZOH 3S1MH 2XN9C 1J8IA 5C44G 4G7ZC 3PO3B 2ALYB 3J80i 3VR4A 2UUAL 3KF8A 2SNMA 2AMCB 1IYVA 2GN5A 4JI3L 3J7YW 1DOMA 1WCMH 4A3GH 2YTVA 2F4VL 4K5VA 5ELOA 3VR2A 2EE1A 3RZDH 1WTQA 3JAML 3NENA 3NPPA 3HOZB 2SDFA 1II3A 4JI4L 4X3TA 1N33Q 2IY5B 1N9WA 1SE3A 5BR8L 4XT1B 3G71A 4UAIA 4XQQA 2JYOA 1ZKOA 2PNHA 4A3IH 4DK1A 4KY7A 5EKIA 1N33L 3ULPA 1JJCB 5J1ZA 3R2IA 1EY0A 1IBML 4JI5L 1D5ZC 2QILA 2VB2X 1TWHB 1NY4A 1B8AA 4U673 3K58A 4OL7A 2CWPA 1ONLA 5CBAE 1OXXK 3D4RA 3KLSX 5C5LA 2E8GA 1OXSC 2D5DA 2B63G 3CCLA 3I55A 1AE3A 5LL6S 2N49A 4NB3A 3S17B 1U5KA 2CHBD 5I2XA 3NXWA 4A3JH 1OXUA 1KRTA 2OXPA 1XYIA 4B9WA 3LWEA 5ELDA 1HNXQ 2DGYA 1TWCH 1XMQQ 1DXMA 1X54A 2HQEA 3VA5A 2HUGA 3VR5A 4A3MG 1HNXL 5GADC 1JOQA 3KUPA 1B53A 4F88A 1CA5A 3WOFA 3J80E 5NUCA 1KDBA 1Y1VB 4HMJA 2E75C 3QOLA 1VMCA 3AQQA 2WKDA
chains in the Genus database with same CATH topology
2ZTCA 1PYSB 2E2HH 4R4OA 2R6GA 1TWAH 2E2IH 3I4NH 4DR5L 1VS0A 1P16A 1QVGA 2IT1A 2EQSA 4LNQA 4KHPL 2R93G 1SLJA 4C2MH 2KBNA 4LFAL 1QZHA 1I5FA 2ZTDA 4BBRG 1EOVA 1IBKL 3TRZA 5JJIA 4ME3A 4AYBG 5LMNQ 4YWKA 4X65Q 4QJFA 5C0XJ 1EIFA 3TS0A 3F2BA 4WJ4A 2HIXA 1XPOA 1PHJA 2AWNA 3RLNA 5LMNL 5M5WH 3GTLH 2OQ0A 2AKWB 2JA8H 4TQUS 4HJ5A 4YHHQ 4GN3B 4PZ7A 2WFWA 4BY7H 3HOUG 5C44H 4DK3C 2CWAA 2RHQB 4HJ8A 4A4IA 4GOPA 4UP8A 4NXNL 3K8AA 3I4OA 1UE6A 1A63A 1X3FA 2MO0A 4OXPA 1EQQA 3BZCA 4JI0L 1Q1BA 4LF9Q 3GTQH 1MKHA 1X3EA 4DV6Q 2AWOA 3S16H 1DGSA 1V9PA 3FHWA 4P72A 1A0IA 4PZ8A 3CCQA 4A3CH 1HNWQ 4BA2I 3M4QA 1CUKA 2I5LX 3CCVA 2YYZA 3HOXG 2OCEA 4O2DA 4JBJA 4HIKA 3HKZE 1LTLA 3TEHB 5JJKA 4LF9L 1FVIA 3GTPH 5M3FH 2E2JH 1U0LA 2KCTA 3T1HQ 2OWOA 4DNIA 1UE1A 5M3MH 1YJWA 1ASZA 3HOWG 1I6HH 1KC8C 3GTMH 2UUAQ 4BBSG 2XGTA 4OWWB 2ES2A 1JE5A 4A75A 2K75A 4JI3Q 4GNXB 4O0AA 1HZAA 4DR2L 4DV5L 3TS2A 4A3BH 2F4VQ 1BBWA 4MTNA 3PUWA 3T1YQ 2JA7H 1SRUA 1YNXA 3HFZB 3PF5A 4C3IH 3OTOQ 3M4OH 4LF6Q 2JA6H 2E5LQ 2NZHA 2UUBL 3S2DH 3CMEA 4AH6A 1PH2A 5FJ8G 2WAQG 4JI4Q 1M90C 1PH3A 3T1YL 4QIWE 4DUYQ 5HY6A 2VY3A 4DV2L 1OTCA 4LF6L 3CMAA 1KRSA 5BR8Q 4DKAC 2E5LL 2UU9Q 1VQFA 1Y14B 3HOYH 4L5RC 2B63H 4B3SL 4DR7L 3GTGH 1YBYA 1HNZQ 5AJ3Q 2R7ZG 4A3EG 1Z9FA 3GO5A 2ID0A 3KOJA 4JI7L 1IBMQ 4R4CA 4JI5Q 1VQ5A 1PYBA 1L2FA 3TREA 3CCSA 3RN2A 1VQDA 2BH8A 3PUXA 1O7IA 1GO3E 1FJGL 1N36L 4B3RQ 5AJ3L 3BJUA 2NN6I 1XPUA 2VQFQ 3M4PA 4BXXG 3H0GH 4BY1G 4OX9Q 2YTYA 5EAYA 1L1OC 1TXYA 4A93H 2JA5G 2Q2HA 3K81C 1VQPA 5IYDH 2MQHA 3GTOH 1EQRA 4IFDJ 2K4KA 4A3KG 3A0JA 5IYBH 4DR1Q 1VQMA 1C7YA 1V43A 1YJNA 1UE7A 1X55A 1CKMA 4YY3Q 4IPHA 1J5EQ 1NJIC 2HQLA 2NVXH 2UXCQ 2PQAB 3UDFA 1OXVA 1CSPA 2Y0SE 4DR1L 4A76A 3BZKA 4JV5Q 2IHEA 3NBHB 1I3QH 4PG3A 4H02A 4A3LG 1VQIA 1NMGA 4YY3L 2HT1A 3UDXA 4JBMA 1N32Q 1L0WA 4X66Q 4AYBE 3J81j 1IBLQ 2R92G 1WYDA 3HOZG 3VDYA 3ER0A 4DV1Q 1BVSA 1XNRQ 1NBWA 4X64L 3K7UC 2YV5A 2YU9H 2R93H 2PMZE 1G6PA 1LUZA 1L1OB 4DV4L 2VS1A 4DR3L 4BBRH 1RL2A 3EN2A 2D62A 1OXTA 2NVQH 1P8LA 1VQ4A 1VQ8A 3CCEA 2HHHQ 1Q12A 3ULLA 1X65A 3S1QH 2UXBQ 4JI8Q 3PCOB 2I5HA 4XTCS 4EQ5A 1YVCA 1VQ9A 2Q2TA 3J81i 4P75A 4IPDA 5GAGC 4IJHA 1WJJA 2N3SA 1N34L 4IPGA 3A5ZB 3HOUH 3KF6A 4DUZQ 4LFAQ 1G51A 3JAMc 1IBKQ 3PO2G 2R7FA 2JEAI 1CKNA 1UEBA 1E7ZA 2XTIA 3E9IA 4IFDI 2EIFA 1QUQA 3KDFA 3G4SA 4LFCQ 3M7NA 1GD7A 5M5XH 3M3YH 4DUZL 5IE8A 3CCMA 3FKIG 4QL5A 1YIJA 3HOXH 3EBEA 3DLLA 1XNQL 4LFCL 1PH8A 3CQZH 4DV0Q 2Q2UA 4DAYB 1UWVA 2JE6I 2OTJA 3M85A 1VQ6A 1IYJB 3W1BA 5IP7G 1D7QA 2A1AA 5GQOA 4LF4Q 1S40A 4A3JG 4BBSH 4NXNQ 1IXRA 1V1QA 4DV0L 1VQNA 4LUVA 4JI0Q 3KLWA 4MNOA 2ZM6Q 1K9MC 3H3VH 5FLMG 4A3FG 1HZCA 3PUZA 4GNXC 2IX0A 2BA1A 2H5XA 1KL9A 4POFA 2OQKA 4LF4L 4JI6Q 1XMOL 2MNAA 4JI1L 3Q8DA 2ZM6L 1EYGA 1VCIA 4LF8L 1NE3A 1VQCA 3L7ZC 1EUJA 3CAMA 5FJ8H 1I94L 1Q81C 3CD6A 1NMFA 2VL6A 3GTKH 4DAMA 4JI6L 1H95A 1Y1WG 5GROA 3J7ZC 4R4QA 1SE8A 4JCVE 4X62L 1Y1VG 1X9NA 1KD1C 1UE5A 3CC2A 1FL0A 3TQYA 4DR2Q 4A3DG 4GKJQ 3W1GA 4DV5Q 2K5VA 4A3EH 1YZ6A 2LXKA 2PI2A 4JOIC 2R7ZH 2WB1E 3KF8B 4L5QA 1HZ9A 1J6QA 3UE1A 5M5YH 1KIXA 2UUBQ 4GKJL 4P73A 2VW9A 3F8TA 1Q1EA 1QVFA 4JBKA 4P74A 3H3VI 5JEAJ 1A62A 1S3OA 5IT9c 4DV2Q 2Z6KC 3STBD 2VQEL 5GAHC 1HH2P 2JA5H 4YCVA 4XIGS 3MEFA 4GLVB 4B3SQ 1PH4A 4DR7Q 2NVTH 4K0KL 3AYHB 1TWFH 4HJAA 1LM0A 1PH5A 2NVYH 4DV3L 1X3GA 4GLAC 4A3KH 4JI7Q 4LUZA 5C3EH 5LMUL 2VUMG 2UXDQ 3RR5A 1CSQA 2RHSB 1Q8KA 4LFBQ 4OO1G 1LYLA 4DV7Q 1YITA 3PIPA 3RN5A 1N36Q 3U4VA 1FJGQ 3WWVA 1YHQA 2I0QA 3KYHC 4BY7G 2KHJA 4AIMA 2ZTEA 3PSIA 2K14A 2UXDL 5C0XG 3S15H 4A3LH 1VQOA 1E1TA 4LFBL 4DV7L 4AQYL 2R92H 3S1RH 3LGJA 4GNXA 3HOVG 1T9HA 4IO9A 1EIYB 2UUCQ 3D0FA 5IYCG 4FDBA 3CW2C 1PV4A 1VQAA 5ELNA 2GVBA 3FP9A 4GS3A 4NPSA 4APVA 1YEZA 1ASYA 4JI2L 2Z0SA 1R9TH 4R4IA 2FXQA 2Q2IA 3W5OA 3UDGA 2UUCL 2K50A 1IZ6A 4A3MH 1C0AA 3ERSX 1GVPA 4DR6L 1HR0W 3ULJA 2BH2A 1Q82C 3HKZG 2D0PA 2ZJPA 4KI0A 4IPCA 2NN6G 4GKKL 4JYAL 3J80c 1PVOA 4UY8C 1W3SA 1QZGA 2WP8J 2KHIA 4JOIA 4X64Q 3CC7A 2ASBA 4YWLA 2JQOA 3K0XA 4DV4Q 4DR3Q 4QQBX 3PO2H 4LF7Q 1WI5A 1WOCA 3I7FA 2JA6G 3RLOA 3GDEA 2CFMA 1TWGH 1WCMG 4A3GG 1YI2A 3JAMi 4HIDA 3S24A 1PFSA 3GD7A 2LSSA 3CPWA 4WJ3M 4B3TQ 3FKIH 3MXNB 3STBC 1GM5A 4LF7L 3AEVA 1PH9A 1VQLA 5IY0A 3PUYA 2BA0A 1Q7YC 1JMCA 4MZ9A 3U50C 3OYYA 3PV0A 4K0KQ 5IP9G 2QA4A 1N34Q 2D0OA 4B3TL 3PO3G 4L5SA 5IP7H 2VNUD 3CCJA 4YCWA 2IX1A 3B6YA 1SN8A 3CCRA 2NZOA 2LXJA 3A74A 2VZAA 3CPFA 1YHBA 3M9BA 2PQAA 4GOPC 4A3IG 5JJLA 5FLMH 4A3FH 1VQBA 1JJ2A 3HKSA 1E22A 1AE2A 1VQEA 4LWCA 3S14H 1X6OA 4POGA 2GVAA 2JEBI 1B70B 1XPRA 1VQ7A 2V1CC 1E3PA 4C3JH 1XNQQ 1HJPA 4R4TA 3K80C 1GKHA 2JK8A 3OW2A 1L1OA 1Y1WH 3I2ZA 4OWTB 3CCUA 1Y1VH 2K5HA 3F2CA 1BKBA 1MIUA 1YHAA 4JBWA 2YTXA 1XMQL 4HJ9A 5J3BA 1K0RA 3I4MG 3HOWH 4IFDG 5C4XG 4GOPB 1KQSA 1K8GA 1XMOQ 1YJ9A 4R1JA 1VQGA 3JC66 4JI1Q 4Y7NH 2HIVA 2PI2E 2DUDA 2WAQE 3AFPA 2F52A 2Y0SG 3D31A 5GAEC 1I94Q 4LF8Q 4Y52H 1AH9A 4JG2A 1I50H 1KAWA 4IOAA 1MJCA 1JJGA 1N8RC 4HIMA 4GN4B 4X62Q 4UP7A 2IHFA 4P71A 2ZJQA 4PZ6A 2RF4A 5C4JH 4KHZA 2F3IA 3J81c 5FLXc 4RMFA 3E0EA 3SGIA 4C3HH 3PF4A 5K36G 1G291 2VUMH 1Q46A 4J15A 2A8VA 1Z47A 3PUVA 4IOCA 1Q86C 1K73C 4X65L 1M1KC 4X6AH 4BA1I 1HZBA 2ATWA 1SMXA 3S1NH 3IRBA 4KLKA 4UP9A 1SR3A 3I4NG 3K7AH 4OWXB 3U4ZA 5LMNW 4NXMQ 2VQEQ 3S2HH 4YHHL 2B3GA 2ZJRA 3HOVH 3BU2A 3EIVA 2MO1A 4BXXH 4DV3Q 4BY1H 5IYCH 1QVCA 3KJOA 3RNUA 5HGQA 4NXML 5LMUQ 4YWMA 2JA9A 1B7YB 4L5TA 3F2DA 3AFQA 4B3MQ 4QY7A 1HNWL 1EWIA 4DV6L 3KFUA 3UE0A 4PMWA 3PIOA 4GLXA 1W2BA 1A8VA 4B3ML 2JA8G 3F1ZA 5DLQE 2K5NA 4AQYQ 3KJPA 1VQJA 4LF5Q 4HIOA 2KCMA 3RZOH 3NEMA 5IWAQ 3T1HL 3S1MH 4JC0A 5C44G 4OO1I 1VQHA 2ALYB 3J80i 3RLFA 2UUAL 1HR0Q 1BBUA 4OONA 1EFWA 3L0OA 4ALPA 2AMCB 4JI2Q 5IYDG 4LF5L 5C0XI 2GN5A 4JI3L 5IWAL 3L2PA 1SROA 1WCMH 5E7NA 2C35B 2YTVA 1JB7A 4A3GH 2I5MX 4A3CG 2F4VL 1K8AC 1K83H 2L15A 3HOZH 4DR6Q 5ELOA 3RZDH 1HR0L 4EX5A 3OTOL 2RCNA 3NENA 2JJQA 5M3FG 2OTLA 4UPAA 4GKKQ 4JYAQ 4JI4L 5IP9H 3CXCA 1N33Q 5M3MG 4DUYL 1N9WA 2IY5B 3UDIA 1KHIA 3PO3H 5BR8L 2K52A 1PH1A 2UU9L 3G71A 2PNHA 4IJLA 4A3IH 3J7A5 1K3RA 1HNZL 3CP0A 4DPGA 2AHOB 2CKZB 3ULPA 1JJCB 3A5UA 1XJVA 1N33L 4A3BG 1IBML 4JI5L 2JA7G 3ZJYC 1TWHH 1IL2A 3G48A 2WB1G 1WFQA 2CCZA 4B3RL 3CF5A 1KXLA 1NY4A 3E9HA 1B8AA 2EXDA 1NTGA 4YCUA 2QGQA 4DR4Q 2VQFL 2CWPA 1MJEA 2Z6KA 1OXXK 5C3EG 4OX9L 1JT8A 1E24A 2E8GA 3HOYG 1OXSC 3PGZA 5JEAG 1S72A 5H1SE 3CCLA 2B63G 3S17H 3I55A 4HJ7A 1D8LA 4DR4L 1AE3A 2N49A 4NB3A 1XTDA 3KF6B 1U5KA 3I4MH 2N78A 1C9OA 1RIPA 3GTJH 3NELA 5C4XH 3DM3A 1CKNB 4A3JH 1J5EL 2UXCL 1OXUA 3H15A 1QUQB 3KDFB 4TVAB 1KRTA 4JV5L 2N8NA 4GN5A 2QEXA 2KENA 2B29A 4DK6C 3CC4A 3H0GG 4KHPQ 4LW1A 1HNXQ 1N32L 2DGYA 4A93G 1TWCH 1SFOH 4X66L 1PH7A 1IBLL 1X56A 2CQOA 2R7DA 3G6EA 4DV1L 1XMQQ 1XNRL 1X54A 5IYBG 3U58A 2A19A 4A3MG 1VQKA 1HNXL 5GADC 2MFIA 4QGUA 1CKOA 1PH6A 2HHHL 4DR5Q 1FGUA 1PA6A 4A3DH 3ICEA 4JI8L 2UXBL 4LUOA 4RG1A 1E1OA 3I56A 3AQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTC A;  1PYS B;  2E2H H;  4R4O A;  2R6G A;  1TWA H;  2E2I H;  3I4N H;  4DR5 L;  1VS0 A;  1P16 A;  1QVG A;  2IT1 A;  2EQS A;  4LNQ A;  4KHP L;  2R93 G;  1SLJ A;  4C2M H;  2KBN A;  4LFA L;  1QZH A;  1I5F A;  2ZTD A;  4BBR G;  1EOV A;  1IBK L;  3TRZ A;  5JJI A;  4ME3 A;  4AYB G;  5LMN Q;  4YWK A;  4X65 Q;  4QJF A;  5C0X J;  1EIF A;  3TS0 A;  3F2B A;  4WJ4 A;  2HIX A;  1XPO A;  1PHJ A;  2AWN A;  3RLN A;  5LMN L;  5M5W H;  3GTL H;  2OQ0 A;  2AKW B;  2JA8 H;  4TQU S;  4HJ5 A;  4YHH Q;  4GN3 B;  4PZ7 A;  2WFW A;  4BY7 H;  3HOU G;  5C44 H;  4DK3 C;  2CWA A;  2RHQ B;  4HJ8 A;  4A4I A;  4GOP A;  4UP8 A;  4NXN L;  3K8A A;  3I4O A;  1UE6 A;  1A63 A;  1X3F A;  2MO0 A;  4OXP A;  1EQQ A;  3BZC A;  4JI0 L;  1Q1B A;  4LF9 Q;  3GTQ H;  1MKH A;  1X3E A;  4DV6 Q;  2AWO A;  3S16 H;  1DGS A;  1V9P A;  3FHW A;  4P72 A;  1A0I A;  4PZ8 A;  3CCQ A;  4A3C H;  1HNW Q;  4BA2 I;  3M4Q A;  1CUK A;  2I5L X;  3CCV A;  2YYZ A;  3HOX G;  2OCE A;  4O2D A;  4JBJ A;  4HIK A;  3HKZ E;  1LTL A;  3TEH B;  5JJK A;  4LF9 L;  1FVI A;  3GTP H;  5M3F H;  2E2J H;  1U0L A;  2KCT A;  3T1H Q;  2OWO A;  4DNI A;  1UE1 A;  5M3M H;  1YJW A;  1ASZ A;  3HOW G;  1I6H H;  1KC8 C;  3GTM H;  2UUA Q;  4BBS G;  2XGT A;  4OWW B;  2ES2 A;  1JE5 A;  4A75 A;  2K75 A;  4JI3 Q;  4GNX B;  4O0A A;  1HZA A;  4DR2 L;  4DV5 L;  3TS2 A;  4A3B H;  2F4V Q;  1BBW A;  4MTN A;  3PUW A;  3T1Y Q;  2JA7 H;  1SRU A;  1YNX A;  3HFZ B;  3PF5 A;  4C3I H;  3OTO Q;  3M4O H;  4LF6 Q;  2JA6 H;  2E5L Q;  2NZH A;  2UUB L;  3S2D H;  3CME A;  4AH6 A;  1PH2 A;  5FJ8 G;  2WAQ G;  4JI4 Q;  1M90 C;  1PH3 A;  3T1Y L;  4QIW E;  4DUY Q;  5HY6 A;  2VY3 A;  4DV2 L;  1OTC A;  4LF6 L;  3CMA A;  1KRS A;  5BR8 Q;  4DKA C;  2E5L L;  2UU9 Q;  1VQF A;  1Y14 B;  3HOY H;  4L5R C;  2B63 H;  4B3S L;  4DR7 L;  3GTG H;  1YBY A;  1HNZ Q;  5AJ3 Q;  2R7Z G;  4A3E G;  1Z9F A;  3GO5 A;  2ID0 A;  3KOJ A;  4JI7 L;  1IBM Q;  4R4C A;  4JI5 Q;  1VQ5 A;  1PYB A;  1L2F A;  3TRE A;  3CCS A;  3RN2 A;  1VQD A;  2BH8 A;  3PUX A;  1O7I A;  1GO3 E;  1FJG L;  1N36 L;  4B3R Q;  5AJ3 L;  3BJU A;  2NN6 I;  1XPU A;  2VQF Q;  3M4P A;  4BXX G;  3H0G H;  4BY1 G;  4OX9 Q;  2YTY A;  5EAY A;  1L1O C;  1TXY A;  4A93 H;  2JA5 G;  2Q2H A;  3K81 C;  1VQP A;  5IYD H;  2MQH A;  3GTO H;  1EQR A;  4IFD J;  2K4K A;  4A3K G;  3A0J A;  5IYB H;  4DR1 Q;  1VQM A;  1C7Y A;  1V43 A;  1YJN A;  1UE7 A;  1X55 A;  1CKM A;  4YY3 Q;  4IPH A;  1J5E Q;  1NJI C;  2HQL A;  2NVX H;  2UXC Q;  2PQA B;  3UDF A;  1OXV A;  1CSP A;  2Y0S E;  4DR1 L;  4A76 A;  3BZK A;  4JV5 Q;  2IHE A;  3NBH B;  1I3Q H;  4PG3 A;  4H02 A;  4A3L G;  1VQI A;  1NMG A;  4YY3 L;  2HT1 A;  3UDX A;  4JBM A;  1N32 Q;  1L0W A;  4X66 Q;  4AYB E;  3J81 j;  1IBL Q;  2R92 G;  1WYD A;  3HOZ G;  3VDY A;  3ER0 A;  4DV1 Q;  1BVS A;  1XNR Q;  1NBW A;  4X64 L;  3K7U C;  2YV5 A;  2YU9 H;  2R93 H;  2PMZ E;  1G6P A;  1LUZ A;  1L1O B;  4DV4 L;  2VS1 A;  4DR3 L;  4BBR H;  1RL2 A;  3EN2 A;  2D62 A;  1OXT A;  2NVQ H;  1P8L A;  1VQ4 A;  1VQ8 A;  3CCE A;  2HHH Q;  1Q12 A;  3ULL A;  1X65 A;  3S1Q H;  2UXB Q;  4JI8 Q;  3PCO B;  2I5H A;  4XTC S;  4EQ5 A;  1YVC A;  1VQ9 A;  2Q2T A;  3J81 i;  4P75 A;  4IPD A;  5GAG C;  4IJH A;  1WJJ A;  2N3S A;  1N34 L;  4IPG A;  3A5Z B;  3HOU H;  3KF6 A;  4DUZ Q;  4LFA Q;  1G51 A;  3JAM c;  1IBK Q;  3PO2 G;  2R7F A;  2JEA I;  1CKN A;  1UEB A;  1E7Z A;  2XTI A;  3E9I A;  4IFD I;  2EIF A;  1QUQ A;  3KDF A;  3G4S A;  4LFC Q;  3M7N A;  1GD7 A;  5M5X H;  3M3Y H;  4DUZ L;  5IE8 A;  3CCM A;  3FKI G;  4QL5 A;  1YIJ A;  3HOX H;  3EBE A;  3DLL A;  1XNQ L;  4LFC L;  1PH8 A;  3CQZ H;  4DV0 Q;  2Q2U A;  4DAY B;  1UWV A;  2JE6 I;  2OTJ A;  3M85 A;  1VQ6 A;  1IYJ B;  3W1B A;  5IP7 G;  1D7Q A;  2A1A A;  5GQO A;  4LF4 Q;  1S40 A;  4A3J G;  4BBS H;  4NXN Q;  1IXR A;  1V1Q A;  4DV0 L;  1VQN A;  4LUV A;  4JI0 Q;  3KLW A;  4MNO A;  2ZM6 Q;  1K9M C;  3H3V H;  5FLM G;  4A3F G;  1HZC A;  3PUZ A;  4GNX C;  2IX0 A;  2BA1 A;  2H5X A;  1KL9 A;  4POF A;  2OQK A;  4LF4 L;  4JI6 Q;  1XMO L;  2MNA A;  4JI1 L;  3Q8D A;  2ZM6 L;  1EYG A;  1VCI A;  4LF8 L;  1NE3 A;  1VQC A;  3L7Z C;  1EUJ A;  3CAM A;  5FJ8 H;  1I94 L;  1Q81 C;  3CD6 A;  1NMF A;  2VL6 A;  3GTK H;  4DAM A;  4JI6 L;  1H95 A;  1Y1W G;  5GRO A;  3J7Z C;  4R4Q A;  1SE8 A;  4JCV E;  4X62 L;  1Y1V G;  1X9N A;  1KD1 C;  1UE5 A;  3CC2 A;  1FL0 A;  3TQY A;  4DR2 Q;  4A3D G;  4GKJ Q;  3W1G A;  4DV5 Q;  2K5V A;  4A3E H;  1YZ6 A;  2LXK A;  2PI2 A;  4JOI C;  2R7Z H;  2WB1 E;  3KF8 B;  4L5Q A;  1HZ9 A;  1J6Q A;  3UE1 A;  5M5Y H;  1KIX A;  2UUB Q;  4GKJ L;  4P73 A;  2VW9 A;  3F8T A;  1Q1E A;  1QVF A;  4JBK A;  4P74 A;  3H3V I;  5JEA J;  1A62 A;  1S3O A;  5IT9 c;  4DV2 Q;  2Z6K C;  3STB D;  2VQE L;  5GAH C;  1HH2 P;  2JA5 H;  4YCV A;  4XIG S;  3MEF A;  4GLV B;  4B3S Q;  1PH4 A;  4DR7 Q;  2NVT H;  4K0K L;  3AYH B;  1TWF H;  4HJA A;  1LM0 A;  1PH5 A;  2NVY H;  4DV3 L;  1X3G A;  4GLA C;  4A3K H;  4JI7 Q;  4LUZ A;  5C3E H;  5LMU L;  2VUM G;  2UXD Q;  3RR5 A;  1CSQ A;  2RHS B;  1Q8K A;  4LFB Q;  4OO1 G;  1LYL A;  4DV7 Q;  1YIT A;  3PIP A;  3RN5 A;  1N36 Q;  3U4V A;  1FJG Q;  3WWV A;  1YHQ A;  2I0Q A;  3KYH C;  4BY7 G;  2KHJ A;  4AIM A;  2ZTE A;  3PSI A;  2K14 A;  2UXD L;  5C0X G;  3S15 H;  4A3L H;  1VQO A;  1E1T A;  4LFB L;  4DV7 L;  4AQY L;  2R92 H;  3S1R H;  3LGJ A;  4GNX A;  3HOV G;  1T9H A;  4IO9 A;  1EIY B;  2UUC Q;  3D0F A;  5IYC G;  4FDB A;  3CW2 C;  1PV4 A;  1VQA A;  5ELN A;  2GVB A;  3FP9 A;  4GS3 A;  4NPS A;  4APV A;  1YEZ A;  1ASY A;  4JI2 L;  2Z0S A;  1R9T H;  4R4I A;  2FXQ A;  2Q2I A;  3W5O A;  3UDG A;  2UUC L;  2K50 A;  1IZ6 A;  4A3M H;  1C0A A;  3ERS X;  1GVP A;  4DR6 L;  1HR0 W;  3ULJ A;  2BH2 A;  1Q82 C;  3HKZ G;  2D0P A;  2ZJP A;  4KI0 A;  4IPC A;  2NN6 G;  4GKK L;  4JYA L;  3J80 c;  1PVO A;  4UY8 C;  1W3S A;  1QZG A;  2WP8 J;  2KHI A;  4JOI A;  4X64 Q;  3CC7 A;  2ASB A;  4YWL A;  2JQO A;  3K0X A;  4DV4 Q;  4DR3 Q;  4QQB X;  3PO2 H;  4LF7 Q;  1WI5 A;  1WOC A;  3I7F A;  2JA6 G;  3RLO A;  3GDE A;  2CFM A;  1TWG H;  1WCM G;  4A3G G;  1YI2 A;  3JAM i;  4HID A;  3S24 A;  1PFS A;  3GD7 A;  2LSS A;  3CPW A;  4WJ3 M;  4B3T Q;  3FKI H;  3MXN B;  3STB C;  1GM5 A;  4LF7 L;  3AEV A;  1PH9 A;  1VQL A;  5IY0 A;  3PUY A;  2BA0 A;  1Q7Y C;  1JMC A;  4MZ9 A;  3U50 C;  3OYY A;  3PV0 A;  4K0K Q;  5IP9 G;  2QA4 A;  1N34 Q;  2D0O A;  4B3T L;  3PO3 G;  4L5S A;  5IP7 H;  2VNU D;  3CCJ A;  4YCW A;  2IX1 A;  3B6Y A;  1SN8 A;  3CCR A;  2NZO A;  2LXJ A;  3A74 A;  2VZA A;  3CPF A;  1YHB A;  3M9B A;  2PQA A;  4GOP C;  4A3I G;  5JJL A;  5FLM H;  4A3F H;  1VQB A;  1JJ2 A;  3HKS A;  1E22 A;  1AE2 A;  1VQE A;  4LWC A;  3S14 H;  1X6O A;  4POG A;  2GVA A;  2JEB I;  1B70 B;  1XPR A;  1VQ7 A;  2V1C C;  1E3P A;  4C3J H;  1XNQ Q;  1HJP A;  4R4T A;  3K80 C;  1GKH A;  2JK8 A;  3OW2 A;  1L1O A;  1Y1W H;  3I2Z A;  4OWT B;  3CCU A;  1Y1V H;  2K5H A;  3F2C A;  1BKB A;  1MIU A;  1YHA A;  4JBW A;  2YTX A;  1XMQ L;  4HJ9 A;  5J3B A;  1K0R A;  3I4M G;  3HOW H;  4IFD G;  5C4X G;  4GOP B;  1KQS A;  1K8G A;  1XMO Q;  1YJ9 A;  4R1J A;  1VQG A;  3JC6 6;  4JI1 Q;  4Y7N H;  2HIV A;  2PI2 E;  2DUD A;  2WAQ E;  3AFP A;  2F52 A;  2Y0S G;  3D31 A;  5GAE C;  1I94 Q;  4LF8 Q;  4Y52 H;  1AH9 A;  4JG2 A;  1I50 H;  1KAW A;  4IOA A;  1MJC A;  1JJG A;  1N8R C;  4HIM A;  4GN4 B;  4X62 Q;  4UP7 A;  2IHF A;  4P71 A;  2ZJQ A;  4PZ6 A;  2RF4 A;  5C4J H;  4KHZ A;  2F3I A;  3J81 c;  5FLX c;  4RMF A;  3E0E A;  3SGI A;  4C3H H;  3PF4 A;  5K36 G;  1G29 1;  2VUM H;  1Q46 A;  4J15 A;  2A8V A;  1Z47 A;  3PUV A;  4IOC A;  1Q86 C;  1K73 C;  4X65 L;  1M1K C;  4X6A H;  4BA1 I;  1HZB A;  2ATW A;  1SMX A;  3S1N H;  3IRB A;  4KLK A;  4UP9 A;  1SR3 A;  3I4N G;  3K7A H;  4OWX B;  3U4Z A;  5LMN W;  4NXM Q;  2VQE Q;  3S2H H;  4YHH L;  2B3G A;  2ZJR A;  3HOV H;  3BU2 A;  3EIV A;  2MO1 A;  4BXX H;  4DV3 Q;  4BY1 H;  5IYC H;  1QVC A;  3KJO A;  3RNU A;  5HGQ A;  4NXM L;  5LMU Q;  4YWM A;  2JA9 A;  1B7Y B;  4L5T A;  3F2D A;  3AFQ A;  4B3M Q;  4QY7 A;  1HNW L;  1EWI A;  4DV6 L;  3KFU A;  3UE0 A;  4PMW A;  3PIO A;  4GLX A;  1W2B A;  1A8V A;  4B3M L;  2JA8 G;  3F1Z A;  5DLQ E;  2K5N A;  4AQY Q;  3KJP A;  1VQJ A;  4LF5 Q;  4HIO A;  2KCM A;  3RZO H;  3NEM A;  5IWA Q;  3T1H L;  3S1M H;  4JC0 A;  5C44 G;  4OO1 I;  1VQH A;  2ALY B;  3J80 i;  3RLF A;  2UUA L;  1HR0 Q;  1BBU A;  4OON A;  1EFW A;  3L0O A;  4ALP A;  2AMC B;  4JI2 Q;  5IYD G;  4LF5 L;  5C0X I;  2GN5 A;  4JI3 L;  5IWA L;  3L2P A;  1SRO A;  1WCM H;  5E7N A;  2C35 B;  2YTV A;  1JB7 A;  4A3G H;  2I5M X;  4A3C G;  2F4V L;  1K8A C;  1K83 H;  2L15 A;  3HOZ H;  4DR6 Q;  5ELO A;  3RZD H;  1HR0 L;  4EX5 A;  3OTO L;  2RCN A;  3NEN A;  2JJQ A;  5M3F G;  2OTL A;  4UPA A;  4GKK Q;  4JYA Q;  4JI4 L;  5IP9 H;  3CXC A;  1N33 Q;  5M3M G;  4DUY L;  1N9W A;  2IY5 B;  3UDI A;  1KHI A;  3PO3 H;  5BR8 L;  2K52 A;  1PH1 A;  2UU9 L;  3G71 A;  2PNH A;  4IJL A;  4A3I H;  3J7A 5;  1K3R A;  1HNZ L;  3CP0 A;  4DPG A;  2AHO B;  2CKZ B;  3ULP A;  1JJC B;  3A5U A;  1XJV A;  1N33 L;  4A3B G;  1IBM L;  4JI5 L;  2JA7 G;  3ZJY C;  1TWH H;  1IL2 A;  3G48 A;  2WB1 G;  1WFQ A;  2CCZ A;  4B3R L;  3CF5 A;  1KXL A;  1NY4 A;  3E9H A;  1B8A A;  2EXD A;  1NTG A;  4YCU A;  2QGQ A;  4DR4 Q;  2VQF L;  2CWP A;  1MJE A;  2Z6K A;  1OXX K;  5C3E G;  4OX9 L;  1JT8 A;  1E24 A;  2E8G A;  3HOY G;  1OXS C;  3PGZ A;  5JEA G;  1S72 A;  5H1S E;  3CCL A;  2B63 G;  3S17 H;  3I55 A;  4HJ7 A;  1D8L A;  4DR4 L;  1AE3 A;  2N49 A;  4NB3 A;  1XTD A;  3KF6 B;  1U5K A;  3I4M H;  2N78 A;  1C9O A;  1RIP A;  3GTJ H;  3NEL A;  5C4X H;  3DM3 A;  1CKN B;  4A3J H;  1J5E L;  2UXC L;  1OXU A;  3H15 A;  1QUQ B;  3KDF B;  4TVA B;  1KRT A;  4JV5 L;  2N8N A;  4GN5 A;  2QEX A;  2KEN A;  2B29 A;  4DK6 C;  3CC4 A;  3H0G G;  4KHP Q;  4LW1 A;  1HNX Q;  1N32 L;  2DGY A;  4A93 G;  1TWC H;  1SFO H;  4X66 L;  1PH7 A;  1IBL L;  1X56 A;  2CQO A;  2R7D A;  3G6E A;  4DV1 L;  1XMQ Q;  1XNR L;  1X54 A;  5IYB G;  3U58 A;  2A19 A;  4A3M G;  1VQK A;  1HNX L;  5GAD C;  2MFI A;  4QGU A;  1CKO A;  1PH6 A;  2HHH L;  4DR5 Q;  1FGU A;  1PA6 A;  4A3D H;  3ICE A;  4JI8 L;  2UXB L;  4LUO A;  4RG1 A;  1E1O A;  3I56 A;  3AQQ A; 
#chains in the Genus database with same CATH topology
 2ZTC A;  3I4N H;  2F03 A;  5ELB A;  2E2H B;  1TWA B;  4LNQ A;  2BDN A;  1Y69 U;  2RSN A;  1SLJ A;  2NYZ D;  4HCE A;  1QZH A;  2PZU A;  3TRZ A;  4BBR G;  5I2Y A;  4EQN A;  4F87 A;  5JJI A;  4IUP A;  3D6W A;  1AZP A;  3BYY B;  4FXK C;  4QF4 A;  5ELC A;  5C0X J;  3NTI A;  5E4X A;  1HTL D;  4RKL A;  2HIX A;  1XPO A;  4KV6 A;  4WRD A;  3KBG A;  3F2U A;  1SYC A;  2JA8 H;  4YHH Q;  4GN3 B;  1FYC A;  4DK3 C;  4HJ8 A;  4NXN L;  3S1N B;  4OXP A;  1JIC A;  1L0X B;  1RTO A;  1F2Y A;  4DV6 Q;  1NUC A;  1A0I A;  4PZ8 A;  2F0W A;  3S16 B;  3GTQ B;  1CUK A;  3A56 A;  2OCE A;  1KTK A;  5JJK A;  3TEH B;  1FVI A;  5M9O A;  2KCT A;  1QWY A;  3HOW G;  1KC8 C;  3GTM H;  3Q24 A;  1HXY D;  1QE6 A;  3IL8 A;  2XGT A;  4OWW B;  1MSH A;  4FF3 A;  2CVR A;  3HKZ B;  5CV5 A;  5HUR A;  1U9R A;  4ZLT F;  3TS2 A;  4MTN A;  2EDG A;  2DN8 A;  3PUW A;  2KEC A;  1YNX A;  3PF5 A;  4RGN A;  2JA7 H;  3RZO B;  3ERQ A;  1IL8 A;  4A3B B;  4N8X 1;  2NZH A;  2E5L Q;  3CME A;  1HUM A;  4KY6 A;  3W2D A;  4C3I B;  1M90 C;  2I46 A;  4DUY Q;  2E5L L;  2EY2 A;  3HOY H;  1Y14 B;  4L5R C;  3RZD B;  1Z9F A;  4S3S A;  4R4C A;  2B2Y A;  1G2T A;  1VQ5 A;  3TRE A;  1L2F A;  1H9S A;  4X3K A;  4F8M A;  1O7I A;  1GO3 E;  4QMG A;  2VQF Q;  1S5B D;  5EAY A;  2Q2H A;  2MQH A;  4IFD J;  2K32 A;  4A3K G;  2G9H D;  3DXJ C;  3CKI B;  2B2T C;  1DM0 B;  3SK6 A;  4TKO B;  5KND A;  1OXV A;  1CSP A;  2Y0S E;  2F4I A;  4A76 A;  4JV5 Q;  1F9P A;  1LT4 D;  2IHE A;  5CV6 A;  2NVX B;  4FF1 A;  1VMP A;  4H02 A;  4IUV A;  4PG3 A;  5E3F A;  3RUZ A;  5FLX L;  2HT1 A;  4MN3 A;  1I3Q B;  1M8A A;  2NBF A;  3K6O A;  4X64 L;  3K7U C;  1BO0 A;  2YU9 H;  2R93 H;  1LUZ A;  2L5T A;  3HOZ G;  3BYT B;  2DJG C;  2PQE A;  5JOB A;  3ULL A;  1FGB D;  1TWC B;  5JPM C;  4JI8 Q;  2UXB Q;  4AYB B;  2H4O A;  4G57 A;  3PCO B;  1ZYR C;  4FP5 D;  4XTC S;  2KCN A;  2Q2T A;  2PMZ B;  4P75 A;  1SNQ A;  2RKS A;  2K5W A;  4HSP A;  2VXW A;  2GA4 B;  2N3S A;  2F0H A;  1PFB A;  3JAM c;  1IBK Q;  2JEA I;  1CKN A;  4RGO S;  1YNJ C;  1Y8P B;  1QUQ A;  1STA A;  3SEB A;  3G7L A;  5EPL A;  2L0C A;  1TU2 B;  4XQJ A;  5M5X B;  3EBE A;  3DLL A;  4ME5 A;  1WTO A;  2XVS A;  2Q2U A;  4DAY B;  2JE6 I;  1BBX C;  2OTJ A;  3H94 A;  3CQZ B;  3W1B A;  5IP7 G;  5GQO A;  1STB A;  4ZCK A;  3BDL A;  2TMP A;  4IUQ A;  5FOB B;  1S40 A;  1IXR A;  4ZQ3 A;  4BBS H;  1K9M C;  1Q90 A;  2NTS A;  4CJ0 B;  2JA8 B;  4GNX C;  1HQR D;  4JI6 Q;  5IGF A;  2MNA A;  1PRT F;  3Q8D A;  5LHY 1;  2QW7 A;  5FJ8 H;  1EUJ A;  1I94 L;  1KNA A;  3CD6 A;  1Q81 C;  2VL6 A;  3GTK H;  2EYH A;  4JI6 L;  1H95 A;  4R4Q A;  4X62 L;  4JCV E;  1Y1V G;  1C4Q A;  1SJE D;  4DV5 Q;  2K5V A;  2R7Z H;  4JOI C;  3D6C A;  1WD0 A;  3KF8 B;  3I4L A;  4A3E B;  3UE1 A;  5M5Y H;  1CT1 D;  4P73 A;  2VW9 A;  1PYW D;  1QVF A;  4P74 A;  5JEA J;  1A62 A;  4DV2 Q;  2F0D A;  2R3Z A;  2JA7 B;  4YCV A;  2XRQ D;  4B3S Q;  1PH4 A;  4FO2 A;  4R9W A;  1TWF H;  1LM0 A;  3A55 A;  2NVY H;  1PH5 A;  5L37 A;  4GLA C;  4JI7 Q;  4LUZ A;  1EU3 A;  1ZYR D;  3T56 B;  2NVT B;  1FR3 A;  1CSQ A;  1WTW A;  2A74 C;  5JVG 3;  3PIP A;  3RN5 A;  1FJG Q;  2KHJ A;  3PSI A;  2XRS D;  5CYU A;  2B2U C;  1E1T A;  1O78 A;  1YNJ D;  2MHV A;  4M1U B;  2R92 H;  2E2D C;  3TP7 A;  1TR5 A;  1VQA A;  2PW7 A;  5ELN A;  3MVV A;  4GS3 A;  4APV A;  2FXQ A;  2K50 A;  3D4D A;  1IZ6 A;  4KKU A;  4A3M H;  2LFN A;  1HR0 W;  2ICE C;  1Q82 C;  3HKZ G;  2ZJP A;  3MC0 B;  4IPC A;  1S5E D;  3EJI A;  1PVO A;  1W3S A;  2ASB A;  3CC7 A;  3H91 A;  4DV4 Q;  1ET9 A;  4DR3 Q;  3HG9 A;  4C3I G;  1WOC A;  1HFN A;  1R4P B;  2CFM A;  5J39 A;  1WCM G;  4A3G G;  3JAM i;  1PFS A;  4B3T Q;  2YU9 B;  5IY0 A;  5EQ0 A;  2HCC A;  4MZ9 A;  1JMC A;  1F2M A;  1LT6 D;  2QA4 A;  1N34 Q;  4B3T L;  4L5S A;  2VNU D;  4OHJ A;  3CPF A;  2LXJ A;  4A3I G;  4K6D A;  2F0O A;  3VYR A;  1GUW A;  4K2L A;  5JJL A;  1MBY A;  3TSS A;  1LAB A;  3SVM A;  1X6O A;  4POG A;  2GVA A;  3QIA A;  1QNK A;  4MHE A;  2F0S A;  1GOZ A;  4BWG B;  1SBB B;  2NUC A;  4HTH A;  1HCZ A;  3I70 A;  1SJH D;  1TY0 A;  2JK8 A;  3OW2 A;  1Y1W H;  2PW5 A;  4OWT B;  2K5H A;  4H7B A;  1FNV A;  5E4W C;  4JK1 C;  1K0R A;  1EWC A;  3D4W A;  3HOW H;  2SOB A;  1KQS A;  4RAU C;  1XMO Q;  1KLU D;  4JI1 Q;  1VQG A;  4XYQ A;  2HIV A;  2PI2 E;  1TS4 A;  4BBS B;  1SNO A;  3U9S A;  2IHF A;  4P71 A;  1I50 B;  4KKS A;  2IX3 A;  5EKK A;  4KHZ A;  5FLX c;  1XXG A;  4RMF A;  3PF4 A;  2WAQ B;  1SYB A;  4R8N A;  1A2U A;  3GTK B;  2B2Y C;  2K7V A;  4J15 A;  1I4P A;  4C3H B;  3PUV A;  3E0J A;  1CZW A;  4PNY A;  1Q86 C;  1M1K C;  1SMY D;  2ATW A;  1BCP C;  3JAM E;  3EVQ A;  5C0X H;  3I4N G;  3K7A H;  5LMN W;  2VQE Q;  1ICW A;  1JR0 D;  2MO1 A;  2A73 B;  4DV3 Q;  5IYC H;  3KJO A;  5HGQ A;  3S9W A;  3FPP A;  4UHV A;  1HNW L;  2PYK A;  3OWF A;  1EWI A;  3KFU A;  3GP7 A;  3UE0 A;  4DNT B;  3PIO A;  2K28 A;  1W2B A;  5DM7 3;  2NVY B;  3BVM A;  1H9S B;  3F1Z A;  2JA8 G;  2K5N A;  1F77 A;  4NP5 A;  4AQY Q;  2NN6 H;  4HIO A;  2A69 C;  3T1H L;  2F0E A;  3RLF A;  3NWS A;  1EFW A;  1TQO A;  4ALP A;  4JI2 Q;  4WJW A;  1JOO A;  2EYO A;  3L2P A;  5E7N A;  1JB7 A;  3QJY A;  2R92 B;  1K8A C;  3HOZ H;  4DR6 Q;  4HED A;  1V8Q A;  4EX5 A;  2L1B A;  1K83 B;  3DWA A;  4JYA Q;  1Y8N B;  3UDI A;  1SYF A;  1I6V C;  3Q0A A;  3J7A 5;  1HNZ L;  1WTV A;  2F0G A;  3IAY A;  3LWU A;  1DCZ A;  2JA7 G;  1TWH H;  5KGU A;  3E5S A;  2EYF A;  4TRD A;  5I6Y A;  4K8J A;  3CF5 A;  1KXL A;  3E9H A;  2QGQ A;  1D1I A;  1B3A A;  1O7L A;  4XYO A;  2RDG A;  2IW3 A;  1E24 A;  3HOY G;  3S17 H;  3P20 A;  4CDD C;  4RGT A;  1XTD A;  2M2L A;  3I4M H;  2ZT9 C;  1ML0 D;  4IFD H;  1CKN B;  1J5E L;  2PZW A;  3H15 A;  3GTJ B;  1QUQ B;  2N8N A;  2RDF A;  4GN5 A;  4DK6 C;  1EYD A;  4LW1 A;  1N32 L;  1ENC A;  4N9T A;  4X66 L;  1IBL L;  1X56 A;  1U4P A;  2R7D A;  3G6E A;  4DV1 L;  1F2Z A;  1B1Z A;  5IT9 L;  1G91 A;  1CKO A;  2HHH L;  1Y1W B;  1F9S A;  1FGU A;  4RGM A;  5IGC A;  3ICE A;  4LUO A;  3R8B A;  3N6R A;  2E2H H;  4R4O A;  1TWA H;  2EPB A;  2FMM A;  2Z1C A;  2E2I H;  1NNX A;  4Z9C B;  1P16 A;  5FKA C;  1QVG A;  2IT1 A;  2EQS A;  1PDQ A;  2NZ1 D;  2R93 G;  1EQV A;  4LFA L;  1I5F A;  2ZTD A;  4I7A A;  4OIJ A;  4R8I A;  4C2M B;  2KEE A;  3FRP B;  1LTA D;  1PHJ A;  1MI2 A;  3RLN A;  2AKW B;  4TQU S;  4HJ5 A;  4DAV A;  4XDX A;  4DAY A;  2JP1 A;  3K59 A;  3R2T A;  3E6Z X;  1VF5 C;  4GOP A;  1TVX A;  4WOR A;  3K8A A;  1UE6 A;  5DAU A;  3V05 A;  3S16 H;  3GTQ H;  2K01 A;  3K7A B;  1MKH A;  1V9P A;  4A3C H;  4BA2 I;  3M4Q A;  1WVL A;  3HRZ C;  2YYZ A;  4HIK A;  1LTL A;  1CTM A;  2L11 A;  1SDF A;  4KJN A;  3EQL C;  2OWO A;  4RWS C;  5M3M H;  1IKM A;  2UUA Q;  3U9O A;  4BBS G;  2ES2 A;  1JE5 A;  1RF2 D;  4A75 A;  4JI3 Q;  2MP1 A;  4A3B H;  2F4V Q;  1DYQ A;  3NHH A;  4ZRZ A;  3HFZ B;  3IFT A;  4IQZ A;  4C3I H;  3M4O H;  4N8F A;  3NSW A;  1A3V A;  5FJ8 G;  1GUO A;  2WAQ G;  5FLX E;  4JI4 Q;  3T4A C;  5HY6 A;  5C3W A;  5BR8 Q;  2B2V A;  2LMC B;  1VQF A;  1O80 A;  5JEA H;  4DR7 L;  1KNE A;  4QB4 A;  2R7Z G;  4RCO A;  1IBM Q;  4JI5 Q;  3GTG B;  3P75 A;  3CCS A;  3PUX A;  1NCV A;  1N36 L;  1X3Q A;  3BJU A;  1XPU A;  1A15 A;  3M4P A;  2YTY A;  3D3R A;  1TXY A;  4A93 H;  4KJO A;  3K81 C;  2B2W A;  2KJX A;  2QF7 A;  1VQP A;  1B50 A;  4FF2 A;  3V2T A;  5IYB H;  1EEI D;  1C7Y A;  1UE7 A;  3M4Y A;  4P2C B;  3VYS A;  1X55 A;  4YY3 Q;  1NJI C;  2NVX H;  2MJ8 A;  1I3Q H;  3J81 L;  1VQI A;  1EY8 A;  1D5M C;  4YY3 L;  4EQP A;  3I4M B;  5KEE A;  2R92 G;  1WYD A;  3VDY A;  3P7J A;  1BVS A;  1K28 A;  2G5D A;  3QO2 A;  2PPB C;  2VS1 A;  1RL2 A;  2D62 A;  1P8L A;  1VQ4 A;  1SNP A;  2DNC A;  2NVQ B;  3FEW X;  3PQI A;  2J7Z A;  4KKT A;  2I5H A;  2E76 C;  1IW7 D;  4IJH A;  3T53 B;  1FNW A;  3KF6 A;  4DUZ Q;  1G51 A;  5C4Z A;  2R7F A;  1K8M A;  3OIP A;  2Z6B A;  4FNF A;  3E9I A;  1E7Z A;  2K05 A;  1LTG D;  2EIF A;  4LFC Q;  3KDF A;  3M7N A;  2E2I B;  5M5X H;  1I4H A;  2K04 A;  4DUZ L;  5IE8 A;  3CCM A;  1LTT D;  4QL5 A;  3M3Y B;  1B4O A;  5BN4 A;  5DEH A;  1BXT A;  1H9K A;  1XNQ L;  4LFC L;  3CQZ H;  3L3O C;  2O5J C;  2WAC A;  3M85 A;  1VQ6 A;  1IYJ B;  5IGD A;  2B39 A;  1B9N A;  4NXN Q;  1PFM A;  1HRJ A;  1VQN A;  4NMZ A;  3H3V H;  1JOK A;  1WTX A;  3PUZ A;  3ONA B;  2DY8 A;  1F2L A;  1NR2 A;  3QR8 A;  4LF8 L;  2MGS A;  1GXD C;  3KK7 A;  2K1B A;  1Y1W G;  1SE8 A;  1W6K A;  3DEP A;  1X9N A;  2F0V A;  4KN7 C;  3CC2 A;  1FL0 A;  4A3E H;  2LXK A;  1SNM A;  2K33 A;  3BG3 A;  5M3M B;  5CV7 A;  5KNB A;  1Q1E A;  1A6X A;  5IT9 c;  3STB D;  3NTK A;  5C5M A;  5GAH C;  2JA5 H;  3KLR A;  4GLV B;  3MZ5 A;  4J1M A;  4DF7 A;  2WB1 B;  3M4O B;  2NVT H;  2X6L A;  2JN4 A;  1X3G A;  3W3A A;  3K57 A;  4XT3 B;  2UXD Q;  1TS3 A;  2RHS B;  3C2P A;  5C3E B;  1LYL A;  2L9H A;  2O2L D;  4RKB A;  2X6G A;  3TME A;  4DV7 Q;  3U4V A;  1RD9 D;  4BS9 A;  4AIM A;  2IPK D;  2UXD L;  5C0X G;  4A3L H;  3TN2 A;  4M8A A;  1UUP A;  3P1H A;  4DV7 L;  3NBI A;  3S1R H;  1EIY B;  5IYC G;  4DXG A;  3HGB A;  3CW2 C;  1F9R A;  1BDO A;  1YEZ A;  1R9T H;  2Q2I A;  3W5O A;  4A93 B;  4QCL A;  2A6E D;  2LY7 A;  3ERS X;  1H9J A;  3ULJ A;  4B9X A;  2NN6 G;  4GKK L;  4UY8 C;  1BCP F;  3H6M A;  3ZYY X;  4X64 Q;  2KHI A;  4YWL A;  4L63 B;  4QQB X;  1WI5 A;  3A8J E;  4MTK A;  5C3X A;  3RLO A;  3A7L A;  3I91 A;  2F0Q A;  1TWG B;  2F3W A;  2BA0 A;  2EYL A;  3SR1 A;  4DU9 A;  1SYG A;  1STE A;  2RSO A;  2HDL A;  4X3U A;  1XWE A;  1SN8 A;  3B6Y A;  3CCR A;  4GOP C;  1HPC A;  5FLM H;  4A3F H;  1JJ2 A;  3S14 H;  1AE2 A;  5EBC A;  3H3V C;  1E3P A;  4C3J H;  4IUT A;  1HJP A;  3M7G A;  5C6A A;  1JWM D;  1Z6H A;  1ILP A;  2CW0 D;  4R4T A;  3K80 C;  3I2Z A;  3CCU A;  3MHB A;  1MHW C;  5EJW A;  5J3B A;  4KMU C;  3I3C A;  3I4M G;  1LT5 D;  4CDE C;  4IFD G;  4GOP B;  2RA4 A;  1K8G A;  4R1J A;  2KED A;  2DUD A;  3D31 A;  3C1E A;  1ICF B;  4O1N A;  1I94 Q;  1B2T A;  4JG2 A;  1I50 H;  1KAW A;  1PFN A;  4Y7N B;  4IOA A;  1MJC A;  1T5E A;  2CH4 W;  4HIM A;  4X62 Q;  1G8Z D;  2BOS A;  1B44 D;  2K03 A;  2B2V C;  2RF4 A;  4CBV A;  4EVO A;  2F3I A;  4J8Q A;  2J0T D;  1CI3 M;  5EBD A;  3J81 c;  4C3H H;  1G29 1;  1RDP D;  1Q46 A;  3NQI A;  1GJX A;  1UAP A;  4X65 L;  4OO1 H;  1H9R A;  5KRU A;  2KQ3 A;  3ND9 A;  4UP9 A;  4OWX B;  4NXM Q;  3U4Z A;  2ZJR A;  2N88 A;  1QVC A;  4NXM L;  4CJ1 B;  4L5T A;  4FXG C;  3AFQ A;  4B3M Q;  4QY7 A;  4H44 C;  3BZD B;  1WTP A;  1AZQ A;  4FYD A;  1L0Y B;  3KLS A;  4X3S A;  5FO7 B;  2JA5 B;  2O4X A;  4B3M L;  1F9Q A;  1VQJ A;  4JC0 A;  1C48 A;  4IUU A;  1GHJ A;  4OON A;  5C0X I;  2BE5 C;  1SRO A;  2C35 B;  2V4D A;  4A3C G;  1K83 H;  3S1R B;  1LO5 D;  2ZXO A;  5ELF A;  3OTO L;  1RCV D;  2RCN A;  3ERO A;  2EY6 A;  5IP9 H;  5M3M G;  3MAQ A;  1R9T B;  1BOS A;  2UU9 L;  4GZY C;  1IKL A;  2KUM A;  5COY A;  1QG7 A;  1K3R A;  1SMY C;  1U4M A;  4DNR B;  4DPG A;  5J22 A;  2CKZ B;  1XJV A;  3A5U A;  1V1P A;  4A3B G;  5IT9 E;  2EY1 A;  3IKJ A;  4ZUI A;  3ZJY C;  1IL2 A;  3G48 A;  1K3B C;  2WB1 G;  2CCZ A;  1LT3 D;  1EY5 A;  4B3R L;  4HCS A;  2Z6K A;  1HFG A;  5C3E G;  5I9P A;  4OX9 L;  1JT8 A;  2EVB A;  3EFX D;  5JEA G;  1S72 A;  5H1S E;  4HJ7 A;  1D8L A;  3KF6 B;  2N78 A;  3OHX C;  5EKL A;  3GTJ H;  3NEL A;  5C4X H;  2UXC L;  1TS5 A;  2ZXR A;  1TKW B;  4PV1 C;  3KDF B;  4TVA B;  3CC4 A;  2KEN A;  2K6A A;  1CFM A;  4FVM A;  4JPB W;  4ZYS A;  4A3F B;  4A93 G;  5KYI A;  5BN3 A;  4DXF A;  1LV9 A;  5C4H A;  1SFO H;  3S14 B;  1PZI D;  5I4D A;  1XNR L;  1D6E C;  4C3J B;  5IYB G;  3N52 A;  1VQK A;  4HN7 A;  3TP8 A;  4LJZ C;  3MXN A;  2MFI A;  4L6T B;  1PH6 A;  2A6H C;  5JPN C;  4DR5 Q;  4RG1 A;  1E1O A;  1PYS B;  5CMD A;  4A3D B;  2R6G A;  2EOT A;  4DR5 L;  3AU7 A;  1VS0 A;  3ND8 A;  2G9D A;  2BE5 D;  1JB3 A;  1BR9 A;  1DOK A;  4C2M H;  2C9O A;  3A8I E;  1EOV A;  1EEF D;  3NTH A;  2MUY A;  4AYB G;  2WIN B;  3BDC A;  4QJF A;  3TS0 A;  1JWU D;  3A7A B;  1SYD A;  3H09 A;  3GTL H;  5M5W H;  3Q22 A;  4PZ7 A;  1QOH A;  2WFW A;  2EJM A;  2CWA A;  3GV6 A;  1GUN A;  4BY7 B;  4UP8 A;  4PMB A;  1E2W A;  5C44 B;  1X3F A;  2MO0 A;  1EQQ A;  4JI0 L;  4RA8 A;  1CK1 A;  1Q1B A;  4IAL A;  4LF9 Q;  4FXD A;  1X3E A;  1HNW Q;  2AWO A;  5IYD H;  1DGS A;  4P72 A;  3FHW A;  2VB3 X;  3CHB D;  2XIW A;  2I5L X;  1KAA A;  3CCV A;  2A68 D;  2Q8I B;  3HKZ E;  1Q8I A;  4LF9 L;  5M3F H;  2E2J H;  1D5X C;  3T1H Q;  1QIL A;  2MPM A;  1PZK D;  1YJW A;  4RHS A;  1WD1 A;  3TP6 A;  4OGQ C;  2F0T A;  1I6H B;  2K75 A;  4CGY B;  1SE2 A;  4DR2 L;  4O0A A;  1HZA A;  1BBW A;  1YNN C;  5KNC A;  5EPK A;  1E2V A;  4PMC A;  2UUB L;  2I07 B;  3J81 E;  4ODG A;  2JA6 B;  1PH3 A;  3C46 A;  1STN A;  2VY3 A;  1OTC A;  1LTS D;  3CMA A;  5G3L D;  2E74 C;  1SE4 A;  2A6H D;  5EGT A;  3OW7 A;  1STY A;  3GTG H;  1HNZ Q;  3X3M A;  5AJ3 Q;  4A3E G;  2ID0 A;  3KOJ A;  1PYB A;  3RN2 A;  1VQD A;  4LK1 C;  5ISR A;  5AJ3 L;  2RQX A;  3H0G H;  3O13 A;  3NWT A;  2JA5 G;  1CQV A;  2K4K A;  4DR1 Q;  3GQB A;  1V43 A;  1CKM A;  4IPH A;  1J5E Q;  2HQL A;  4QUC A;  1LAC A;  2JSO A;  4DR1 L;  5IOD A;  4A3L G;  1NMG A;  1N32 Q;  2SNS A;  3K5N A;  4LAA A;  1L0W A;  4X66 Q;  1RKN A;  4AYB E;  1IBL Q;  5T1I A;  4C1N I;  5C4X B;  3ER0 A;  4DV1 Q;  1EZ6 A;  2YV5 A;  4TSS A;  4F7X A;  2PMZ E;  1G6P A;  2DNE A;  2Y0S B;  2NVQ H;  5JVH 3;  1VQ8 A;  3CCE A;  2HHH Q;  1Q12 A;  4BBR B;  1X65 A;  1SFO B;  1CQF A;  4EQ5 A;  3S1Q B;  5TSS A;  1YVC A;  2P5Z X;  4YIJ A;  1U4L A;  4ULL A;  1QB5 D;  4IPG A;  4EGV A;  3SXH A;  1ILQ A;  3A5Z B;  4RH6 A;  3HOU H;  4DFA A;  4LFA Q;  1YNN D;  4ZK9 B;  3OSO A;  1UEB A;  2XTI A;  1PRT B;  3G4S A;  4C1N K;  3M3Y H;  2BCO A;  3MXG A;  1MSG A;  1XTC D;  2F0U A;  1YIJ A;  3HOX H;  2EJF C;  1BNZ A;  1E0B A;  2XWJ B;  1UWV A;  2XNA C;  1KLG D;  1JCK B;  4WFN 3;  1HHV A;  1UNS A;  2A1A A;  2B2T A;  4LF4 Q;  4LUV A;  1ENA A;  3KLW A;  4MNO A;  5DNF A;  2ZM6 Q;  5FLM G;  5M5W B;  4A3F G;  1HZC A;  3GTL B;  2BA1 A;  4POF A;  4LF4 L;  2HDM A;  4C3J G;  3CU7 A;  3C1F A;  2ZM6 L;  1VCI A;  1VQC A;  4O42 A;  4DAM A;  5COR A;  5GRO A;  3I90 A;  3DUZ A;  1WTH A;  1KD1 C;  4A3D G;  4GKJ Q;  5M3F B;  3J7A V;  2E2J B;  1IW7 C;  1EY9 A;  1I4R A;  1PXU A;  4L5Q A;  2LS0 1;  4GKJ L;  1PRT D;  4JBK A;  1SND A;  5IOC A;  4QUF A;  3H3V I;  1S3O A;  3G6J B;  2Z6K C;  1CZG A;  5D65 A;  4K2K A;  4XIG S;  3HS0 C;  4CDF C;  4DR7 Q;  4DA2 A;  4HJA A;  4C3H G;  5C3E H;  1HA6 A;  5LMU L;  5CC4 A;  1NR4 A;  2L12 A;  4FF4 A;  4LFB Q;  4OO1 G;  3BVG A;  1N36 Q;  3WWV A;  1EY7 A;  2I0Q A;  1V1P B;  3KYH C;  4H13 C;  4BY7 G;  2J4X A;  4QIW B;  4LFB L;  4RHR A;  3S15 B;  3LGJ A;  4GNX A;  1T9H A;  4IO9 A;  1SNC A;  2WII B;  4FDB A;  2KOL A;  3H0G B;  3FP9 A;  1ASY A;  2Z0S A;  4R4I A;  3UDG A;  3EA6 A;  3NUC A;  1C0A A;  1GVP A;  2IL8 A;  2JXM B;  2TSS A;  2D0P A;  3MTS A;  1PTO H;  1BQQ T;  2WP8 J;  4JOI A;  3MFG A;  2JQO A;  3K0X A;  5ELE A;  5A2Q L;  3PO2 H;  2JA6 G;  3GDE A;  5A35 A;  1TWG H;  1YI2 A;  4HID A;  3S24 A;  3T51 B;  2LSS A;  4CDC C;  3OPO A;  3FKI H;  3MXN B;  3STB C;  3OIQ A;  3OWE B;  4CJ2 C;  3PUY A;  2PCF B;  3K5L A;  1PH9 A;  3U50 C;  3OYY A;  4HSV A;  1EYC A;  3I72 A;  2Z8L A;  5IP9 G;  2F0F A;  2D0O A;  3V96 A;  3QOJ A;  4I65 A;  3L9A X;  2IX1 A;  4K5W A;  1ESR A;  2M00 A;  1H9M A;  2PQA A;  2N55 A;  1BUV T;  1JQY D;  2EYP A;  1VQB A;  3NBH A;  3HKS A;  3PMF A;  2F0K A;  2KA7 A;  1V1O A;  2B2U A;  3D8G A;  3T13 A;  1Y8O B;  1HUN A;  1B70 B;  3HOU B;  1NSN S;  1XPR A;  1AFP A;  1XNQ Q;  1X3P A;  1LTI D;  4NDX A;  1S5D D;  1LTR D;  1L1O A;  5KIX A;  1YHA A;  4JBW A;  2YTX A;  4B08 A;  1XMQ L;  3HOX B;  2A6E C;  5JJZ A;  4NKL A;  3FVQ A;  5C4X G;  2F1M A;  3SE0 A;  1PLF A;  5KYL A;  4V19 0;  1STH A;  4Y7N H;  1W6J A;  1WTR A;  2L4N A;  1DOL A;  2WAQ E;  4LF8 Q;  1D1K A;  2Y0S G;  5JAV A;  5GAE C;  3NQT A;  4Y52 H;  1AH9 A;  2ENB A;  1N8R C;  4GN4 B;  4Q5V A;  1A3T A;  3LX0 A;  1TS2 A;  2QDB A;  3LNN A;  3SGI A;  5C4J B;  5K36 G;  3IFD A;  1ENF A;  2VUM H;  2A8V A;  1Z47 A;  1K73 C;  2PZT A;  4X6A H;  4BA1 I;  1HZB A;  3DMU A;  1SMX A;  1ZXT A;  4KLK A;  4YHH L;  1GUS A;  2KVM A;  2B3G A;  2AUJ D;  1CHP D;  3HOV H;  3S2H B;  3EIV A;  1KDC A;  1KDA A;  4KN4 C;  2PNR C;  4IZ8 A;  3I73 A;  4YWM A;  2JA9 A;  1B7Y B;  3F2D A;  4BY1 B;  1S5F D;  2CW0 C;  1QNU A;  4DV6 L;  4PMW A;  2Z4H A;  4GLX A;  3A54 A;  1A8V A;  3TP5 A;  5G3L F;  5DLQ E;  1D2B A;  2M9V A;  3RD4 A;  4LF5 Q;  1O7Y A;  3DWQ A;  3NEM A;  4C56 C;  5IWA Q;  4OO1 I;  1PTO C;  2AQ3 B;  1VQH A;  1VF7 A;  3S1M B;  1HR0 Q;  1BBU A;  2RBM A;  3L0O A;  4LF5 L;  5IYD G;  5EPJ A;  3T16 A;  5IWA L;  2I5M X;  2NWG A;  2L15 A;  5D3D A;  3FDT A;  2F0N A;  1HR0 L;  1WCM B;  1EWH A;  4A3G B;  2CQA A;  4K14 A;  2JJQ A;  2F3V A;  5M3F G;  2OTL A;  4UPA A;  4GKK Q;  2FHT A;  3CXC A;  4DUY L;  1KHI A;  3PO3 H;  1RTN A;  1DJR D;  2K52 A;  3FPU B;  1PH1 A;  2F0P A;  5CV9 A;  4IJL A;  3CP0 A;  2AHO B;  1EU4 A;  3MXP A;  3DWP A;  1PTO B;  4XXE A;  4A3I B;  4IUN A;  1G6Z A;  3AB9 A;  1WFQ A;  3PO2 B;  4YCU A;  5LL6 X;  2EXD A;  4DN4 M;  1NTG A;  4DR4 Q;  2B8G A;  2VQF L;  5IGG A;  1MJE A;  1AEX A;  4V0B A;  3PGZ A;  3FKI B;  4DR4 L;  3QWN A;  2A5H A;  1SYE A;  1SXT A;  4XQN A;  1K8O A;  1C9O A;  1RIP A;  3DM3 A;  1HTP A;  1JOR A;  4JV5 L;  4A3J B;  2QEX A;  2B29 A;  3H0G G;  2HD3 A;  1T5X D;  1CM9 A;  5FO8 B;  1EFI D;  3DM1 A;  5IGE A;  2AQ2 B;  3VA7 A;  1PH7 A;  2CQO A;  1AP0 A;  1PZJ D;  4UDU C;  3U58 A;  2A19 A;  1VDZ A;  3I8Z A;  2EXZ A;  4QGU A;  5E1F A;  2D9U A;  1Q3L A;  4PQX A;  3FMC A;  1PA6 A;  4JW0 A;  5AFW A;  4A3D H;  2UXB L;  4JI8 L;  1I4G A;  4KHP Q;  1EOT A;  1PTO D;  4N9P A;  4KHP L;  3I4N B;  5FO9 B;  2KBN A;  5FK9 C;  1IBK L;  4ME3 A;  2OF1 A;  5LMN Q;  2D2C C;  2FIN B;  4YWK A;  4X65 Q;  1RHP A;  1EIF A;  3F2B A;  4WJ4 A;  4JVZ A;  1XX8 A;  2AWN A;  4U68 A;  4KK7 A;  5LMN L;  2OQ0 A;  1AN8 A;  4OEM B;  2VUM B;  4BY7 H;  3HOU G;  3E3X A;  4ILW A;  5C44 H;  2RHQ B;  4A4I A;  3OMC A;  5IIF A;  5CV4 A;  1GUT A;  3I4O A;  3VR6 A;  3MWY W;  4KTA A;  1A63 A;  4NW2 A;  3BZC A;  2B2W C;  2DJF C;  4KD3 A;  3J80 L;  4G4K A;  3CCQ A;  3AMU A;  4K6L A;  2ICI A;  3HOX G;  3HOV B;  4O2D A;  4JBJ A;  2EY5 A;  3GTP H;  4CKB A;  2Q8R E;  1EY4 A;  1U0L A;  3PIP 3;  4CKE A;  3ITP A;  4DNI A;  1UE1 A;  2WV6 D;  1ASZ A;  1I6H H;  3I56 A;  3HP3 A;  3K5O A;  3GTM B;  4K5X A;  4GNX B;  4DV5 L;  3NK9 A;  3T1Y Q;  1BF4 A;  1SRU A;  5T1G A;  3OTO Q;  3S2D H;  4LF6 Q;  3SK4 A;  2RDH A;  1Z7T A;  3VR3 A;  2JA6 H;  3GV3 A;  4AH6 A;  1PH2 A;  4Q0F A;  2NTT A;  3T1Y L;  4QIW E;  3SHL A;  1R4Q B;  5CBE E;  4DV2 L;  4LF6 L;  1KRS A;  1SEB D;  3NP8 A;  4DKA C;  2UU9 Q;  1PMR A;  2B63 H;  1EY6 A;  4J6H A;  4B3S L;  1YBY A;  3HOY B;  5I6W A;  3GO5 A;  3OOC A;  4JI7 L;  2LKV A;  2BH8 A;  3K0Y A;  1FJG L;  4B3R Q;  2X69 A;  2NN6 I;  2Z4I A;  2KHS A;  4BXX G;  2XWB B;  4BY1 G;  4OX9 Q;  1L1O C;  1JE4 A;  4MIU A;  1EYA A;  4ZKC B;  3GTO H;  1EQR A;  3A0J A;  3Q6S A;  1VQM A;  2A68 C;  1YJN A;  3MXU A;  1ROD A;  3R3O A;  2UXC Q;  4G7H C;  2PQA B;  1CHQ D;  1E2Z A;  3UDF A;  4DAP A;  3BZK A;  2F0L A;  3NBH B;  1DD2 A;  3HZX A;  4OEL B;  3UDX A;  4JBM A;  3J81 j;  1XNR Q;  1NBW A;  1TT2 A;  2Q8T A;  3R93 A;  1A3U A;  2F0M A;  1L1O B;  4DV4 L;  4DR3 L;  4BBR H;  3EN2 A;  1RJT A;  1OXT A;  3TZD A;  2R93 B;  1S4Z A;  3CRL C;  3S1Q H;  4HMI A;  4KD4 A;  2SEB D;  2IWH A;  4IN3 A;  5K36 H;  1EQT A;  2OEO A;  4CKC A;  1VQ9 A;  1I4Q A;  3KBX A;  3DEO A;  3J81 i;  4IPD A;  5GAG C;  2L55 A;  1WJJ A;  4L8J A;  1N34 L;  1ET6 A;  4HR7 B;  4DGZ A;  3VYU A;  1ZEQ X;  1QCB D;  4EQO A;  3PO2 G;  4IFD I;  3WOE A;  3X3N A;  2PO4 A;  1FNU A;  1GD7 A;  1SAP A;  3FKI G;  1K0S A;  1PH8 A;  3HEJ A;  1IHZ A;  4DV0 Q;  1DON A;  3RMH A;  1I4X A;  1D7Q A;  2C5C A;  4A3J G;  1V1Q A;  4DV0 L;  4JI0 Q;  1O7Z A;  5CR3 A;  3DHQ A;  2IX0 A;  2H5X A;  5D3I B;  1KL9 A;  2OQK A;  1XMO L;  4JI1 L;  1EYG A;  1IYU A;  1NE3 A;  3BDO A;  3L7Z C;  3CAM A;  3K5M A;  2QDL A;  1NMF A;  5DM6 3;  3PIO 3;  1M4V A;  2FJ2 A;  1EZ8 A;  3J7Z C;  2AUK A;  1UE5 A;  3TQY A;  4DR2 Q;  3VYT A;  3W1G A;  3GTP B;  3MEH A;  1YZ6 A;  2PI2 A;  3WDN A;  3TBI B;  2K5Q A;  2WB1 E;  2R7Z B;  1HZ9 A;  1J6Q A;  5IGB A;  1KAB A;  3Q23 A;  2EZV A;  1KIX A;  2UUB Q;  3F8T A;  4K8I A;  5M5Y B;  1S5C D;  4ZUJ A;  2VQE L;  5D14 A;  1HH2 P;  2FFK B;  1UEA B;  3MEF A;  2AQ1 B;  3S2D B;  3AYH B;  3URY A;  5A2Q E;  4A3K H;  4DV3 L;  2O5I C;  2DY7 A;  2KCC A;  2VUM G;  1TWF B;  2K5D A;  3RR5 A;  1Q8K A;  2WKC A;  1YIT A;  2XSC A;  3QB3 A;  1YHQ A;  1BCP B;  2B63 B;  4KHV A;  2ZTE A;  2K14 A;  3S15 H;  1VQO A;  5K5P A;  5F2D A;  4AQY L;  1DZ1 A;  2Z9H A;  1G2S A;  2EYM A;  3OMG A;  3HOV G;  4DK0 A;  1B9M A;  2UUC Q;  3D0F A;  1STG A;  4RCN A;  1PV4 A;  3MA2 B;  2GVB A;  4JI2 L;  4HAE A;  4NPS A;  1J9O A;  2UUC L;  4IUR A;  4G7O C;  3GTO B;  4DR6 L;  3SDZ A;  2BH2 A;  4A3M B;  1B3Q A;  4KI0 A;  4JYA L;  3J80 c;  1QZG A;  4LMQ D;  2QCP X;  4LF7 Q;  1HA5 A;  1TY2 A;  3I7F A;  4RFB A;  1PRT C;  3QG1 A;  3A8K E;  2B8F A;  1MGS A;  3GD7 A;  3CPW A;  4ID6 A;  4WJ3 M;  4LF7 L;  1GUG A;  3TZU A;  1GM5 A;  3BVZ A;  2HCI A;  3AEV A;  5CGK A;  1Q7Y C;  1VQL A;  1SSO A;  4OIK A;  2NB0 A;  3PV0 A;  4K0K Q;  2R61 A;  1BCP D;  3PO3 G;  5IP7 H;  3CCJ A;  4YCW A;  5CV8 A;  4K0K L;  2NZO A;  3A74 A;  2VZA A;  1YHB A;  3M9B A;  3SK5 A;  3MFY A;  2BDO A;  1PTO F;  1E22 A;  4LWC A;  1VQE A;  2CH4 A;  2JEB I;  1VQ7 A;  3BS1 A;  2V1C C;  3CRK C;  1MD2 D;  2QEJ C;  1QJO A;  1GKH A;  1EIH A;  1Y1V H;  1ESF A;  3F2C A;  1BKB A;  1MIU A;  1NAP A;  1JC7 A;  1A2T A;  4HJ9 A;  3SK8 A;  1OO9 B;  2A69 D;  2RVL A;  5I9O A;  1JWS D;  1YJ9 A;  2IJ0 A;  3JC6 6;  5HGT A;  3HOW B;  2OT2 A;  3AFP A;  1EL0 A;  2F52 A;  1HQM C;  2FMC A;  1EIG A;  3TDQ A;  1JJG A;  2ZJQ A;  4UP7 A;  1LTB D;  4PZ6 A;  3J7A F;  5C4J H;  3E0E A;  4CHT B;  5BN5 A;  1GHK A;  2EJG C;  4KY5 A;  4IOC A;  2QKI C;  1AW7 A;  3S1N H;  2F0I A;  3IRB A;  1SR3 A;  3NE5 B;  2H1E A;  4I7Z C;  3S2H H;  1X32 A;  1FD7 D;  4ZAI A;  3BU2 A;  2ZXP A;  4BXX H;  4BY1 H;  2EYJ A;  3RNU A;  5LMU Q;  1U4R A;  3C3L A;  4ZKB B;  4H0L C;  4ABN A;  1C8C A;  1TII D;  3UI2 A;  1LLR D;  2F0J A;  4A3K B;  4E6I A;  3KJP A;  1CA6 A;  2KCM A;  2RCF A;  3RZO H;  3S1M H;  2XN9 C;  1J8I A;  5C44 G;  4G7Z C;  3PO3 B;  2ALY B;  3J80 i;  3VR4 A;  2UUA L;  3KF8 A;  2SNM A;  2AMC B;  1IYV A;  2GN5 A;  4JI3 L;  3J7Y W;  1DOM A;  1WCM H;  4A3G H;  2YTV A;  2F4V L;  4K5V A;  5ELO A;  3VR2 A;  2EE1 A;  3RZD H;  1WTQ A;  3JAM L;  3NEN A;  3NPP A;  3HOZ B;  2SDF A;  1II3 A;  4JI4 L;  4X3T A;  1N33 Q;  2IY5 B;  1N9W A;  1SE3 A;  5BR8 L;  4XT1 B;  3G71 A;  4UAI A;  4XQQ A;  2JYO A;  1ZKO A;  2PNH A;  4A3I H;  4DK1 A;  4KY7 A;  5EKI A;  1N33 L;  3ULP A;  1JJC B;  5J1Z A;  3R2I A;  1EY0 A;  1IBM L;  4JI5 L;  1D5Z C;  2QIL A;  2VB2 X;  1TWH B;  1NY4 A;  1B8A A;  4U67 3;  3K58 A;  4OL7 A;  2CWP A;  1ONL A;  5CBA E;  1OXX K;  3D4R A;  3KLS X;  5C5L A;  2E8G A;  1OXS C;  2D5D A;  2B63 G;  3CCL A;  3I55 A;  1AE3 A;  5LL6 S;  2N49 A;  4NB3 A;  3S17 B;  1U5K A;  2CHB D;  5I2X A;  3NXW A;  4A3J H;  1OXU A;  1KRT A;  2OXP A;  1XYI A;  4B9W A;  3LWE A;  5ELD A;  1HNX Q;  2DGY A;  1TWC H;  1XMQ Q;  1DXM A;  1X54 A;  2HQE A;  3VA5 A;  2HUG A;  3VR5 A;  4A3M G;  1HNX L;  5GAD C;  1JOQ A;  3KUP A;  1B53 A;  4F88 A;  1CA5 A;  3WOF A;  3J80 E;  5NUC A;  1KDB A;  1Y1V B;  4HMJ A;  2E75 C;  3QOL A;  1VMC A;  3AQQ A;  2WKD A; 
#chains in the Genus database with same CATH homology
 2ZTC A;  1PYS B;  2E2H H;  4R4O A;  2R6G A;  1TWA H;  2E2I H;  3I4N H;  4DR5 L;  1VS0 A;  1P16 A;  1QVG A;  2IT1 A;  2EQS A;  4LNQ A;  4KHP L;  2R93 G;  1SLJ A;  4C2M H;  2KBN A;  4LFA L;  1QZH A;  1I5F A;  2ZTD A;  4BBR G;  1EOV A;  1IBK L;  3TRZ A;  5JJI A;  4ME3 A;  4AYB G;  5LMN Q;  4YWK A;  4X65 Q;  4QJF A;  5C0X J;  1EIF A;  3TS0 A;  3F2B A;  4WJ4 A;  2HIX A;  1XPO A;  1PHJ A;  2AWN A;  3RLN A;  5LMN L;  5M5W H;  3GTL H;  2OQ0 A;  2AKW B;  2JA8 H;  4TQU S;  4HJ5 A;  4YHH Q;  4GN3 B;  4PZ7 A;  2WFW A;  4BY7 H;  3HOU G;  5C44 H;  4DK3 C;  2CWA A;  2RHQ B;  4HJ8 A;  4A4I A;  4GOP A;  4UP8 A;  4NXN L;  3K8A A;  3I4O A;  1UE6 A;  1A63 A;  1X3F A;  2MO0 A;  4OXP A;  1EQQ A;  3BZC A;  4JI0 L;  1Q1B A;  4LF9 Q;  3GTQ H;  1MKH A;  1X3E A;  4DV6 Q;  2AWO A;  3S16 H;  1DGS A;  1V9P A;  3FHW A;  4P72 A;  1A0I A;  4PZ8 A;  3CCQ A;  4A3C H;  1HNW Q;  4BA2 I;  3M4Q A;  1CUK A;  2I5L X;  3CCV A;  2YYZ A;  3HOX G;  2OCE A;  4O2D A;  4JBJ A;  4HIK A;  3HKZ E;  1LTL A;  3TEH B;  5JJK A;  4LF9 L;  1FVI A;  3GTP H;  5M3F H;  2E2J H;  1U0L A;  2KCT A;  3T1H Q;  2OWO A;  4DNI A;  1UE1 A;  5M3M H;  1YJW A;  1ASZ A;  3HOW G;  1I6H H;  1KC8 C;  3GTM H;  2UUA Q;  4BBS G;  2XGT A;  4OWW B;  2ES2 A;  1JE5 A;  4A75 A;  2K75 A;  4JI3 Q;  4GNX B;  4O0A A;  1HZA A;  4DR2 L;  4DV5 L;  3TS2 A;  4A3B H;  2F4V Q;  1BBW A;  4MTN A;  3PUW A;  3T1Y Q;  2JA7 H;  1SRU A;  1YNX A;  3HFZ B;  3PF5 A;  4C3I H;  3OTO Q;  3M4O H;  4LF6 Q;  2JA6 H;  2E5L Q;  2NZH A;  2UUB L;  3S2D H;  3CME A;  4AH6 A;  1PH2 A;  5FJ8 G;  2WAQ G;  4JI4 Q;  1M90 C;  1PH3 A;  3T1Y L;  4QIW E;  4DUY Q;  5HY6 A;  2VY3 A;  4DV2 L;  1OTC A;  4LF6 L;  3CMA A;  1KRS A;  5BR8 Q;  4DKA C;  2E5L L;  2UU9 Q;  1VQF A;  1Y14 B;  3HOY H;  4L5R C;  2B63 H;  4B3S L;  4DR7 L;  3GTG H;  1YBY A;  1HNZ Q;  5AJ3 Q;  2R7Z G;  4A3E G;  1Z9F A;  3GO5 A;  2ID0 A;  3KOJ A;  4JI7 L;  1IBM Q;  4R4C A;  4JI5 Q;  1VQ5 A;  1PYB A;  1L2F A;  3TRE A;  3CCS A;  3RN2 A;  1VQD A;  2BH8 A;  3PUX A;  1O7I A;  1GO3 E;  1FJG L;  1N36 L;  4B3R Q;  5AJ3 L;  3BJU A;  2NN6 I;  1XPU A;  2VQF Q;  3M4P A;  4BXX G;  3H0G H;  4BY1 G;  4OX9 Q;  2YTY A;  5EAY A;  1L1O C;  1TXY A;  4A93 H;  2JA5 G;  2Q2H A;  3K81 C;  1VQP A;  5IYD H;  2MQH A;  3GTO H;  1EQR A;  4IFD J;  2K4K A;  4A3K G;  3A0J A;  5IYB H;  4DR1 Q;  1VQM A;  1C7Y A;  1V43 A;  1YJN A;  1UE7 A;  1X55 A;  1CKM A;  4YY3 Q;  4IPH A;  1J5E Q;  1NJI C;  2HQL A;  2NVX H;  2UXC Q;  2PQA B;  3UDF A;  1OXV A;  1CSP A;  2Y0S E;  4DR1 L;  4A76 A;  3BZK A;  4JV5 Q;  2IHE A;  3NBH B;  1I3Q H;  4PG3 A;  4H02 A;  4A3L G;  1VQI A;  1NMG A;  4YY3 L;  2HT1 A;  3UDX A;  4JBM A;  1N32 Q;  1L0W A;  4X66 Q;  4AYB E;  3J81 j;  1IBL Q;  2R92 G;  1WYD A;  3HOZ G;  3VDY A;  3ER0 A;  4DV1 Q;  1BVS A;  1XNR Q;  1NBW A;  4X64 L;  3K7U C;  2YV5 A;  2YU9 H;  2R93 H;  2PMZ E;  1G6P A;  1LUZ A;  1L1O B;  4DV4 L;  2VS1 A;  4DR3 L;  4BBR H;  1RL2 A;  3EN2 A;  2D62 A;  1OXT A;  2NVQ H;  1P8L A;  1VQ4 A;  1VQ8 A;  3CCE A;  2HHH Q;  1Q12 A;  3ULL A;  1X65 A;  3S1Q H;  2UXB Q;  4JI8 Q;  3PCO B;  2I5H A;  4XTC S;  4EQ5 A;  1YVC A;  1VQ9 A;  2Q2T A;  3J81 i;  4P75 A;  4IPD A;  5GAG C;  4IJH A;  1WJJ A;  2N3S A;  1N34 L;  4IPG A;  3A5Z B;  3HOU H;  3KF6 A;  4DUZ Q;  4LFA Q;  1G51 A;  3JAM c;  1IBK Q;  3PO2 G;  2R7F A;  2JEA I;  1CKN A;  1UEB A;  1E7Z A;  2XTI A;  3E9I A;  4IFD I;  2EIF A;  1QUQ A;  3KDF A;  3G4S A;  4LFC Q;  3M7N A;  1GD7 A;  5M5X H;  3M3Y H;  4DUZ L;  5IE8 A;  3CCM A;  3FKI G;  4QL5 A;  1YIJ A;  3HOX H;  3EBE A;  3DLL A;  1XNQ L;  4LFC L;  1PH8 A;  3CQZ H;  4DV0 Q;  2Q2U A;  4DAY B;  1UWV A;  2JE6 I;  2OTJ A;  3M85 A;  1VQ6 A;  1IYJ B;  3W1B A;  5IP7 G;  1D7Q A;  2A1A A;  5GQO A;  4LF4 Q;  1S40 A;  4A3J G;  4BBS H;  4NXN Q;  1IXR A;  1V1Q A;  4DV0 L;  1VQN A;  4LUV A;  4JI0 Q;  3KLW A;  4MNO A;  2ZM6 Q;  1K9M C;  3H3V H;  5FLM G;  4A3F G;  1HZC A;  3PUZ A;  4GNX C;  2IX0 A;  2BA1 A;  2H5X A;  1KL9 A;  4POF A;  2OQK A;  4LF4 L;  4JI6 Q;  1XMO L;  2MNA A;  4JI1 L;  3Q8D A;  2ZM6 L;  1EYG A;  1VCI A;  4LF8 L;  1NE3 A;  1VQC A;  3L7Z C;  1EUJ A;  3CAM A;  5FJ8 H;  1I94 L;  1Q81 C;  3CD6 A;  1NMF A;  2VL6 A;  3GTK H;  4DAM A;  4JI6 L;  1H95 A;  1Y1W G;  5GRO A;  3J7Z C;  4R4Q A;  1SE8 A;  4JCV E;  4X62 L;  1Y1V G;  1X9N A;  1KD1 C;  1UE5 A;  3CC2 A;  1FL0 A;  3TQY A;  4DR2 Q;  4A3D G;  4GKJ Q;  3W1G A;  4DV5 Q;  2K5V A;  4A3E H;  1YZ6 A;  2LXK A;  2PI2 A;  4JOI C;  2R7Z H;  2WB1 E;  3KF8 B;  4L5Q A;  1HZ9 A;  1J6Q A;  3UE1 A;  5M5Y H;  1KIX A;  2UUB Q;  4GKJ L;  4P73 A;  2VW9 A;  3F8T A;  1Q1E A;  1QVF A;  4JBK A;  4P74 A;  3H3V I;  5JEA J;  1A62 A;  1S3O A;  5IT9 c;  4DV2 Q;  2Z6K C;  3STB D;  2VQE L;  5GAH C;  1HH2 P;  2JA5 H;  4YCV A;  4XIG S;  3MEF A;  4GLV B;  4B3S Q;  1PH4 A;  4DR7 Q;  2NVT H;  4K0K L;  3AYH B;  1TWF H;  4HJA A;  1LM0 A;  1PH5 A;  2NVY H;  4DV3 L;  1X3G A;  4GLA C;  4A3K H;  4JI7 Q;  4LUZ A;  5C3E H;  5LMU L;  2VUM G;  2UXD Q;  3RR5 A;  1CSQ A;  2RHS B;  1Q8K A;  4LFB Q;  4OO1 G;  1LYL A;  4DV7 Q;  1YIT A;  3PIP A;  3RN5 A;  1N36 Q;  3U4V A;  1FJG Q;  3WWV A;  1YHQ A;  2I0Q A;  3KYH C;  4BY7 G;  2KHJ A;  4AIM A;  2ZTE A;  3PSI A;  2K14 A;  2UXD L;  5C0X G;  3S15 H;  4A3L H;  1VQO A;  1E1T A;  4LFB L;  4DV7 L;  4AQY L;  2R92 H;  3S1R H;  3LGJ A;  4GNX A;  3HOV G;  1T9H A;  4IO9 A;  1EIY B;  2UUC Q;  3D0F A;  5IYC G;  4FDB A;  3CW2 C;  1PV4 A;  1VQA A;  5ELN A;  2GVB A;  3FP9 A;  4GS3 A;  4NPS A;  4APV A;  1YEZ A;  1ASY A;  4JI2 L;  2Z0S A;  1R9T H;  4R4I A;  2FXQ A;  2Q2I A;  3W5O A;  3UDG A;  2UUC L;  2K50 A;  1IZ6 A;  4A3M H;  1C0A A;  3ERS X;  1GVP A;  4DR6 L;  1HR0 W;  3ULJ A;  2BH2 A;  1Q82 C;  3HKZ G;  2D0P A;  2ZJP A;  4KI0 A;  4IPC A;  2NN6 G;  4GKK L;  4JYA L;  3J80 c;  1PVO A;  4UY8 C;  1W3S A;  1QZG A;  2WP8 J;  2KHI A;  4JOI A;  4X64 Q;  3CC7 A;  2ASB A;  4YWL A;  2JQO A;  3K0X A;  4DV4 Q;  4DR3 Q;  4QQB X;  3PO2 H;  4LF7 Q;  1WI5 A;  1WOC A;  3I7F A;  2JA6 G;  3RLO A;  3GDE A;  2CFM A;  1TWG H;  1WCM G;  4A3G G;  1YI2 A;  3JAM i;  4HID A;  3S24 A;  1PFS A;  3GD7 A;  2LSS A;  3CPW A;  4WJ3 M;  4B3T Q;  3FKI H;  3MXN B;  3STB C;  1GM5 A;  4LF7 L;  3AEV A;  1PH9 A;  1VQL A;  5IY0 A;  3PUY A;  2BA0 A;  1Q7Y C;  1JMC A;  4MZ9 A;  3U50 C;  3OYY A;  3PV0 A;  4K0K Q;  5IP9 G;  2QA4 A;  1N34 Q;  2D0O A;  4B3T L;  3PO3 G;  4L5S A;  5IP7 H;  2VNU D;  3CCJ A;  4YCW A;  2IX1 A;  3B6Y A;  1SN8 A;  3CCR A;  2NZO A;  2LXJ A;  3A74 A;  2VZA A;  3CPF A;  1YHB A;  3M9B A;  2PQA A;  4GOP C;  4A3I G;  5JJL A;  5FLM H;  4A3F H;  1VQB A;  1JJ2 A;  3HKS A;  1E22 A;  1AE2 A;  1VQE A;  4LWC A;  3S14 H;  1X6O A;  4POG A;  2GVA A;  2JEB I;  1B70 B;  1XPR A;  1VQ7 A;  2V1C C;  1E3P A;  4C3J H;  1XNQ Q;  1HJP A;  4R4T A;  3K80 C;  1GKH A;  2JK8 A;  3OW2 A;  1L1O A;  1Y1W H;  3I2Z A;  4OWT B;  3CCU A;  1Y1V H;  2K5H A;  3F2C A;  1BKB A;  1MIU A;  1YHA A;  4JBW A;  2YTX A;  1XMQ L;  4HJ9 A;  5J3B A;  1K0R A;  3I4M G;  3HOW H;  4IFD G;  5C4X G;  4GOP B;  1KQS A;  1K8G A;  1XMO Q;  1YJ9 A;  4R1J A;  1VQG A;  3JC6 6;  4JI1 Q;  4Y7N H;  2HIV A;  2PI2 E;  2DUD A;  2WAQ E;  3AFP A;  2F52 A;  2Y0S G;  3D31 A;  5GAE C;  1I94 Q;  4LF8 Q;  4Y52 H;  1AH9 A;  4JG2 A;  1I50 H;  1KAW A;  4IOA A;  1MJC A;  1JJG A;  1N8R C;  4HIM A;  4GN4 B;  4X62 Q;  4UP7 A;  2IHF A;  4P71 A;  2ZJQ A;  4PZ6 A;  2RF4 A;  5C4J H;  4KHZ A;  2F3I A;  3J81 c;  5FLX c;  4RMF A;  3E0E A;  3SGI A;  4C3H H;  3PF4 A;  5K36 G;  1G29 1;  2VUM H;  1Q46 A;  4J15 A;  2A8V A;  1Z47 A;  3PUV A;  4IOC A;  1Q86 C;  1K73 C;  4X65 L;  1M1K C;  4X6A H;  4BA1 I;  1HZB A;  2ATW A;  1SMX A;  3S1N H;  3IRB A;  4KLK A;  4UP9 A;  1SR3 A;  3I4N G;  3K7A H;  4OWX B;  3U4Z A;  5LMN W;  4NXM Q;  2VQE Q;  3S2H H;  4YHH L;  2B3G A;  2ZJR A;  3HOV H;  3BU2 A;  3EIV A;  2MO1 A;  4BXX H;  4DV3 Q;  4BY1 H;  5IYC H;  1QVC A;  3KJO A;  3RNU A;  5HGQ A;  4NXM L;  5LMU Q;  4YWM A;  2JA9 A;  1B7Y B;  4L5T A;  3F2D A;  3AFQ A;  4B3M Q;  4QY7 A;  1HNW L;  1EWI A;  4DV6 L;  3KFU A;  3UE0 A;  4PMW A;  3PIO A;  4GLX A;  1W2B A;  1A8V A;  4B3M L;  2JA8 G;  3F1Z A;  5DLQ E;  2K5N A;  4AQY Q;  3KJP A;  1VQJ A;  4LF5 Q;  4HIO A;  2KCM A;  3RZO H;  3NEM A;  5IWA Q;  3T1H L;  3S1M H;  4JC0 A;  5C44 G;  4OO1 I;  1VQH A;  2ALY B;  3J80 i;  3RLF A;  2UUA L;  1HR0 Q;  1BBU A;  4OON A;  1EFW A;  3L0O A;  4ALP A;  2AMC B;  4JI2 Q;  5IYD G;  4LF5 L;  5C0X I;  2GN5 A;  4JI3 L;  5IWA L;  3L2P A;  1SRO A;  1WCM H;  5E7N A;  2C35 B;  2YTV A;  1JB7 A;  4A3G H;  2I5M X;  4A3C G;  2F4V L;  1K8A C;  1K83 H;  2L15 A;  3HOZ H;  4DR6 Q;  5ELO A;  3RZD H;  1HR0 L;  4EX5 A;  3OTO L;  2RCN A;  3NEN A;  2JJQ A;  5M3F G;  2OTL A;  4UPA A;  4GKK Q;  4JYA Q;  4JI4 L;  5IP9 H;  3CXC A;  1N33 Q;  5M3M G;  4DUY L;  1N9W A;  2IY5 B;  3UDI A;  1KHI A;  3PO3 H;  5BR8 L;  2K52 A;  1PH1 A;  2UU9 L;  3G71 A;  2PNH A;  4IJL A;  4A3I H;  3J7A 5;  1K3R A;  1HNZ L;  3CP0 A;  4DPG A;  2AHO B;  2CKZ B;  3ULP A;  1JJC B;  3A5U A;  1XJV A;  1N33 L;  4A3B G;  1IBM L;  4JI5 L;  2JA7 G;  3ZJY C;  1TWH H;  1IL2 A;  3G48 A;  2WB1 G;  1WFQ A;  2CCZ A;  4B3R L;  3CF5 A;  1KXL A;  1NY4 A;  3E9H A;  1B8A A;  2EXD A;  1NTG A;  4YCU A;  2QGQ A;  4DR4 Q;  2VQF L;  2CWP A;  1MJE A;  2Z6K A;  1OXX K;  5C3E G;  4OX9 L;  1JT8 A;  1E24 A;  2E8G A;  3HOY G;  1OXS C;  3PGZ A;  5JEA G;  1S72 A;  5H1S E;  3CCL A;  2B63 G;  3S17 H;  3I55 A;  4HJ7 A;  1D8L A;  4DR4 L;  1AE3 A;  2N49 A;  4NB3 A;  1XTD A;  3KF6 B;  1U5K A;  3I4M H;  2N78 A;  1C9O A;  1RIP A;  3GTJ H;  3NEL A;  5C4X H;  3DM3 A;  1CKN B;  4A3J H;  1J5E L;  2UXC L;  1OXU A;  3H15 A;  1QUQ B;  3KDF B;  4TVA B;  1KRT A;  4JV5 L;  2N8N A;  4GN5 A;  2QEX A;  2KEN A;  2B29 A;  4DK6 C;  3CC4 A;  3H0G G;  4KHP Q;  4LW1 A;  1HNX Q;  1N32 L;  2DGY A;  4A93 G;  1TWC H;  1SFO H;  4X66 L;  1PH7 A;  1IBL L;  1X56 A;  2CQO A;  2R7D A;  3G6E A;  4DV1 L;  1XMQ Q;  1XNR L;  1X54 A;  5IYB G;  3U58 A;  2A19 A;  4A3M G;  1VQK A;  1HNX L;  5GAD C;  2MFI A;  4QGU A;  1CKO A;  1PH6 A;  2HHH L;  4DR5 Q;  1FGU A;  1PA6 A;  4A3D H;  3ICE A;  4JI8 L;  2UXB L;  4LUO A;  4RG1 A;  1E1O A;  3I56 A;  3AQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...