5C3EH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eH00
3HOZH 4A3JH 1VQ6A 3HFZB 2BA1A 1SN8A 4B3MQ 2IX1A 2JA8H 4DV5L 1IBKL 3UDIA 3J80c 4OONA 1NBWA 1PYBA 5GQOA 3CCJA 5M5YH 1XPOA 1VCIA 2K5HA 2L15A 4A3CG 4YCVA 1UEBA 4PMWA 1YZ6A 3PUVA 3RLFA 4DR1L 2N49A 3F2BA 4HIKA 4LF9Q 3RZDH 4DR1Q 4DR6L 1EWIA 2LXJA 3J81c 3K7AH 5GAEC 1WFQA 4HJ5A 1YNXA 1K73C 1KQSA 1CSQA 5ELOA 4LFBQ 1W2BA 3GO5A 1P16A 3HOWG 3S1MH 3Q8DA 4JBWA 4MTNA 4UP7A 4APVA 2KHJA 1N9WA 3CQZH 1HNWL 4HIDA 3HOVH 4JOIA 1OXXK 3ZJYC 4A4IA 5C4XH 2HHHQ 1SRUA 2MFIA 3GTLH 4B3RL 3VDYA 2KENA 3H3VI 1SR3A 4LFCL 2ES2A 3HOUG 3DLLA 3OTOL 1N36Q 5IP7H 4A3FG 3AQQA 4JOIC 3CMEA 1XMQL 1S3OA 4GKJL 3LGJA 2K5NA 4POGA 1HNZL 1XMQQ 2NN6G 2QGQA 2NN6I 1LYLA 4XIGS 2K4KA 4DAMA 4DV6Q 4JG2A 3CCLA 4A3BG 1WI5A 1CKOA 1V1QA 4JI2Q 3RR5A 4DV0L 2V1CC 2D0OA 3TREA 1GKHA 4DV0Q 4B3SL 2R6GA 4GOPB 2VZAA 2WB1E 4YCWA 4P72A 2GN5A 1OTCA 4HJ9A 1VQNA 4A3LG 4JI5L 1TWCH 4A3DH 2RF4A 4JI5Q 2C35B 1OXUA 3PSIA 3ULJA 4C3JH 4EX5A 5C44H 1NJIC 1CKMA 4LF8Q 2LSSA 2ZTDA 1AE3A 4UP9A 2KCTA 4DR3L 4GKJQ 4PG3A 2CFMA 4HJ7A 2B63G 4LFAQ 4B3TQ 2KCMA 1YJNA 3M9BA 4MNOA 1WJJA 1PH1A 3TS2A 2Q2HA 4LW1A 4RG1A 5BR8Q 1RIPA 3HOZG 1RL2A 1Z47A 2JK8A 1KC8C 3I4NG 2ZTEA 4QL5A 4R4OA 3S2HH 4DV2L 5M3MG 3HOXH 1VQPA 4JI6L 1YHAA 2F3IA 2IX0A 1TWFH 2WAQG 4LF5L 5IYBH 1VQLA 3PO3G 2UU9Q 2I5MX 4A3CH 3UE0A 5DLQE 5GADC 2ZJPA 2UU9L 4QY7A 1B7YB 3D0FA 2OQ0A 2YU9H 4JBKA 1N34L 2A19A 1VQKA 2VQFL 2KBNA 1I3QH 1VQIA 4LF4L 4HJ8A 1IL2A 2BA0A 2CCZA 4QIWE 5FLMG 4X66Q 2E5LQ 4LNQA 4GKKQ 3I4NH 4X66L 4A93G 2K75A 4GLAC 2VUMH 4DUZQ 3PO2G 1YIJA 1MIUA 2ZM6Q 5M3MH 3HOXG 1A63A 3CCRA 3PUXA 4K0KL 3PUWA 1KHIA 5M5WH 2I5HA 4PZ8A 1KXLA 2AWNA 1Y14B 3S1QH 5C4XG 1NE3A 1U5KA 1TWAH 1K8GA 4ME3A 4X64L 2HIVA 4R4IA 4RMFA 4YCUA 2CQOA 3HOYH 1Q1BA 4MZ9A 1M1KC 4AH6A 4YWKA 3G4SA 1MJCA 1CSPA 5C44G 5LMUL 5FLMH 3NBHB 3H3VH 3M7NA 4P73A 1KL9A 4A3EH 4LWCA 4B3ML 4A93H 1K3RA 3GTJH 4JI8Q 3PIOA 1PYSB 4A3GG 2QA4A 4GNXC 4DV5Q 3UDFA 3KF8B 1TWGH 4DR5Q 1L1OC 5FLXc 4DUYQ 4DR5L 4C3IH 4GLXA 3A5ZB 2GVAA 4DAYB 1C9OA 2UXDQ 1NMGA 1NMFA 1UWVA 1N8RC 4Y7NH 4O0AA 1EQRA 1JJGA 1E7ZA 2ATWA 2B63H 3GDEA 3S14H 4DV3L 1L2FA 1JMCA 1JE5A 2NVYH 2Z6KC 3UE1A 4KHPL 1Q12A 5IT9c 4OO1I 2Q2TA 4GOPC 4R4CA 4X65Q 3KDFB 3F1ZA 1XJVA 2YTXA 4DR4L 1Q86C 2ZJRA 3ICEA 1HNXL 4DNIA 3BZCA 1QVCA 3S1RH 1IBKQ 2HIXA 3NENA 1GVPA 3G71A 1LM0A 4NB3A 1VQHA 4BY7H 2AKWB 4A76A 3ERSX 1PH8A 1BBUA 2CKZB 3OYYA 1AH9A 2R93G 2JA9A 2JE6I 4DV4Q 4DV4L 3EBEA 1WCMG 1YITA 2VNUD 4DR6Q 4JI7Q 2E8GA 5C3EG 2AMCB 3CP0A 4LF6Q 1VQ4A 1OXTA 2K5VA 4A3JG 3JC66 2MO0A 4OWWB 4WJ3M 1FJGQ 2VQEL 4FDBA 2PI2A 3GTOH 3CC7A 1HNWQ 2R7FA 4JI0L 4YWLA 1FGUA 1XMOL 3KDFA 2HHHL 2OWOA 1B8AA 5IWAL 4AYBG 1YBYA 1S40A 2UUBL 1PVOA 1VQCA 4LFCQ 2IY5B 1PH2A 5IWAQ 1WYDA 3CAMA 3OTOQ 1XNRQ 1WCMH 1DGSA 2ALYB 3U4VA 1UE1A 1PH9A 2UXCQ 5JJLA 2PNHA 5C3EH 3PIPA 1IBLL 2JA5H 4OX9L 1VQJA 4X62Q 3GTPH 4P74A 1Q1EA 3SGIA 2N8NA 3NEMA 1E22A 5IP9G 4B3SQ 3RLNA 5EAYA 4JI4L 3UDGA 1YJ9A 2NZOA 4AQYL 2PMZE 3F2CA 2EIFA 4DKAC 4NXML 4BXXG 1X3FA 3JAMc 2VQFQ 1X55A 3HOYG 2E2HH 3GTQH 4GN5A 1VQEA 4DR3Q 3T1YL 4YHHQ 3H15A 3F2DA 3CPFA 3TEHB 2N78A 3CCUA 3TRZA 2ZM6L 2Y0SE 2HT1A 1VS0A 5E7NA 2IHEA 3K8AA 1Y1VG 1QUQA 2CWPA 2GVBA 4IFDI 2D62A 4IOAA 4POFA 1GD7A 3ULLA 3CPWA 2YTVA 4PZ7A 4J15A 2JQOA 1CUKA 1X65A 1KRTA 5AJ3Q 3A5UA 1XNQL 2WB1G 4OXPA 1VQMA 1KRSA 2PI2E 1Q7YC 4IO9A 3D31A 1BBWA 3F8TA 1EOVA 3BU2A 3NELA 4UPAA 3CCSA 2Z0SA 3HKZE 1I6HH 2UXBQ 4QGUA 3CCEA 4P71A 4TVAB 1VQOA 5IY0A 4R1JA 2UXBL 1IXRA 4R4QA 3RNUA 4BBSG 4LF4Q 2AWOA 3CCQA 3S15H 3PGZA 1GM5A 4JBJA 1N32Q 4EQ5A 1X9NA 4GN4B 4JI3Q 4NXNQ 3CW2C 5H1SE 2CWAA 3KOJA 4LUVA 1V43A 5C0XG 5M3FH 3MXNB 4DUYL 4DUZL 3AEVA 1EIFA 3I4MH 1KD1C 4JCVE 4AYBE 1HZCA 2MQHA 2XGTA 4LUZA 3K81C 4IPGA 5JEAJ 4DK6C 4A3MH 3W1BA 3JAMi 2F4VL 1NY4A 1QZGA 1L1OB 4QQBX 4A3KG 2F4VQ 3HOVG 4Y52H 5IE8A 2K52A 4GNXB 4A3IH 4KHPQ 5HY6A 1OXVA 1P8LA 2WAQE 1S72A 1KIXA 1W3SA 1R9TH 1E1TA 4L5QA 4IJLA 1PV4A 4IPCA 1C0AA 4JBMA 3KF6B 5GAHC 3UDXA 2NVQH 1G291 2JEBI 4JI2L 2OQKA 3I2ZA 1EYGA 2DUDA 3AFPA 4IJHA 1HNXQ 3W5OA 3G6EA 4GOPA 2I0QA 3I55A 3KFUA 2R92H 2ASBA 2WFWA 2UUCL 2Q2IA 3WWVA 5ELNA 2UUCQ 5FJ8G 3CMAA 4TQUS 3U4ZA 4DV7L 1Y1WH 1CKNA 2NVXH 4DV7Q 1VQ5A 5JJIA 3M3YH 3J80i 4BA1I 2OTJA 3STBD 3CXCA 1K9MC 5IYDH 1LTLA 5HGQA 1IBMQ 2Y0SG 4DPGA 1ASZA 5BR8L 1O7IA 4DR2Q 2VY3A 3PO2H 2JA7G 3S2DH 5JJKA 3CCMA 3CF5A 1GO3E 1PH3A 2OTLA 4GS3A 1HZ9A 5C4JH 3CC2A 3HOWH 4LFBL 3H0GG 2VQEQ 3U58A 5K36G 3E9IA 5GAGC 4JV5Q 2JJQA 5M3FG 1JJCB 1XPUA 2HQLA 1XMOQ 4GLVB 5GROA 2QEXA 3I7FA 1VQ8A 1B70B 2JEAI 3GD7A 2R7ZH 3IRBA 2EXDA 4KHZA 4O2DA 3W1GA 1YHBA 2H5XA 4P75A 3AYHB 4BXXH 4C2MH 1MKHA 3HKSA 2E2IH 3I56A 1SLJA 4X62L 1HNZQ 4A3BH 1I94L 4DR7L 4DV6L 1HZAA 1TWHH 4C3HH 4IOCA 1AE2A 1BVSA 1HJPA 4L5SA 1HZBA 3KYHC 3OW2A 4H02A 4JI4Q 1XPRA 1EUJA 4AQYQ 4X6AH 1H95A 4JI1Q 5M5XH 4A3IG 2PQAB 4OWXB 3TQYA 4A3DG 2UUAL 1VQDA 1Q82C 2UUAQ 1E24A 1A0IA 2Q2UA 2UUBQ 1JT8A 3S16H 3B6YA 4A75A 3PV0A 3T1YQ 2K14A 1UE6A 1X6OA 3K7UC 1PHJA 1QZHA 3E9HA 4GN3B 1A62A 1K83H 2UXCL 4WJ4A 1PFSA 1IYJB 3BZKA 4OX9Q 4UY8C 1G51A 1X54A 3GTMH 3RLOA 1KAWA 4BBRG 1OXSC 1X3GA 1N33L 2ID0A 1Q46A 2ZJQA 1HR0L 3HOUH 3J7A5 1EQQA 2R7ZG 3M4PA 2IT1A 4LF9L 4IPHA 1TXYA 2YYZA 3HKZG 1MJEA 1HH2P 4YHHL 4OO1G 3L2PA 1L1OA 1WOCA 3U50C 1PA6A 4JI3L 3H0GH 1PH7A 5J3BA 1Y1VH 4HIMA 1V9PA 3FKIG 2XTIA 2F52A 4YWMA 3T1HQ 1C7YA 3T1HL 1X56A 2JA6H 4K0KQ 1QVFA 3S24A 4QJFA 2R7DA 3STBC 2IHFA 5AJ3L 3M85A 2DGYA 3M4QA 3TS0A 4BY7G 3I4OA 1N36L 4BBSH 2JA5G 1J5EQ 3RN5A 5IP7G 4A3FH 1J5EL 3ULPA 1JB7A 1I5FA 1VQ9A 4HIOA 1N32L 4LF6L 2LXKA 3K80C 4JI8L 4BY1H 1LUZA 4NXNL 2JA8G 4R4TA 1XTDA 1Q81C 2BH2A 3PO3H 2B29A 3S17H 2A1AA 2WP8J 1FJGL 4PZ6A 1FVIA 4BBRH 1E1OA 1QVGA 2OCEA 2RCNA 4JI0Q 3BJUA 3DM3A 4BA2I 4LF7L 2N3SA 4HJAA 4LF7Q 4KI0A 4ALPA 4GNXA 4B3RQ 3GTKH 1EFWA 1IBML 1J6QA 4XTCS 4B3TL 4DR2L 4LFAL 2B3GA 1YVCA 3PCOB 2MNAA 2VUMG 1SROA 4X65L 3A0JA 1G6PA 1EIYB 4DR4Q 3L7ZC 1A8VA 1NTGA 1UE7A 3FP9A 3G48A 4JI6Q 4KLKA 3ER0A 4LF5Q 2R92G 3I4MG 1X3EA 4IFDJ 5FJ8H 2VS1A 1VQGA 2K50A 5C0XJ 1Y1WG 1VQ7A 4JC0A 4NXMQ 1U0LA 3KJOA 2VW9A 4LF8L 1SMXA 4UP8A 2PQAA 4YY3Q 3CCVA 5LMNW 2YTYA 1PH6A 1HR0W 3J7ZC 2JA7H 4LUOA 4YY3L 4NPSA 3CD6A 3FKIH 3PUYA 1YI2A 4JI7L 3PF4A 3M4OH 3MEFA 2YV5A 4L5RC 2JA6G 1SE8A 1QUQB 4L5TA 1UE5A 2AHOB 4DK3C 3KJPA 5C0XI 4A3MG 1JJ2A 1FL0A 4JV5L 1Z9FA 3L0OA 3RN2A 4A3KH 4DV2Q 4A3LH 2ZTCA 1L0WA 4X64Q 1XNQQ 3K0XA 4AIMA 1VQBA 3KF6A 2RHQB 3KLWA 5JEAG 5IYCH 1ASYA 3EIVA 3PUZA 1YHQA 3EN2A 1N34Q 5LMUQ 1VQFA 2RHSB 2D0PA 1D8LA 4OWTB 1PH5A 1XNRL 2R93H 4BY1G 4DV1Q 1M90C 1E3PA 3FHWA 4DV1L 1IBLQ 1IZ6A 1Q8KA 1I94Q 2VL6A 3E0EA 4A3EG 2NZHA 2E5LL 1SFOH 4DR7Q 4GKKL 4IFDG 1YEZA 3PF5A 4A3GH 5IP9H 3J81i 4IPDA 2E2JH 2Z6KA 1N33Q 4JYAL 5IYBG 1BKBA 3A74A 2A8VA 5LMNQ 4JYAQ 2KHIA 1HR0Q 2FXQA 4JI1L 2UXDL 5LMNL 1T9HA 2EQSA 1I50H 1PH4A 3GTGH 5IYCG 1VQAA 1K0RA 2MO1A 1CKNB 2BH8A 3AFQA 5IYDG 1K8AC 4DV3Q 1YJWA 3S1NH 2I5LX 1D7QA 3CC4A 3RZOH 2NVTH 3J81j
chains in the Genus database with same CATH superfamily
2VUMB 1TR5A 4DV5L 1U4LA 2R92B 1KLUD 4OONA 3NP8A 1PYBA 5NUCA 2L15A 2K5HA 1PZKD 4PMWA 1YZ6A 3DXJC 4DF7A 1SYGA 3F2BA 5ISRA 3P7JA 1PFBA 4DR6L 1EWIA 2LXJA 1K73C 5GAEC 1WFQA 4G57A 4IUVA 5IGFA 4HJ5A 3GTLB 4A93B 1IYUA 3GO5A 2B2YC 5I9PA 4CHTB 5IOCA 3HOWG 5KNBA 1Z6HA 1Y8PB 2OF1A 3D4DA 1N9WA 3S1MB 4HEDA 3BG3A 3CQZH 4LAAA 3NXWA 3HOVH 1A2UA 5C4XH 3TP7A 3QWNA 4ZUIA 4LFCL 1GHKA 1GHJA 1XX8A 5IP7H 3CMEA 3FRPB 2NVXB 4POGA 5JAVA 2NN6G 2NN6I 1PZJD 5FO8B 5I6WA 4DV6Q 4JG2A 1K3BC 3E0JA 2V1CC 1EFID 1S5DD 3I4LA 1I6VC 2R6GA 1NR4A 2WB1E 5COYA 3Q24A 1CI3M 4A3LG 1F2LA 4JI5Q 4KV6A 4JW0A 5C44H 2E75C 3FPPA 5FLXE 4LFAQ 1JC7A 2KCMA 1PYWD 1YJNA 4MNOA 2F03A 1RL2A 1T5XD 4MN3A 2ZTEA 1AEXA 2E76C 2AQ3B 4R4OA 1WTVA 3HOXH 4LF5L 1VQPA 1H9KA 4IUTA 5IYBH 1XYIA 5HGTA 2I5MX 4A3CH 1TWCB 3UE0A 3ITPA 1TS5A 2UU9L 3OPOA 4QY7A 2OQ0A 2EYPA 1QILA 2A19A 3PIO3 4F8MA 2F1MA 2KBNA 5JOBA 2VQFL 1VQIA 1WCMB 1JOKA 3SK8A 1EY9A 2KOLA 4QIWE 2CCZA 2E5LQ 4X66L 2K75A 2VUMH 2IL8A 1MIUA 2AQ2B 4K0KL 5M5WH 5CV4A 4PZ8A 1BCPF 1NE3A 4ME3A 1U4RA 1HUNA 3HOYH 1Q1BA 1M1KC 5I2YA 2QEJC 1ZEQX 4K5VA 1CSPA 4RAUC 4PQXA 4A3FB 3A8JE 4CDDC 1Q90A 1SSOA 3K7AB 4I7AA 2EY6A 4A3GG 2JN4A 5BN5A 3UDFA 1TWGH 2WACA 4L63B 3DMUA 4RGMA 3QOLA 2XN9C 1C9OA 1NMGA 3N52A 1CZWA 2IPKD 3OMGA 3D4RA 4O0AA 1HFNA 1NCVA 1E7ZA 2ATWA 4IUQA 3S14H 1L2FA 1JE5A 2NVYH 5IGGA 3GTKB 3NE5B 4MIUA 4R4CA 3KDFB 3F1ZA 4RA8A 3VYUA 1XJVA 1A3VA 2RSNA 4DR4L 4KY7A 4IFDH 4DNIA 1IBKQ 3G71A 1H9RA 1VQHA 2LKVA 4BY7H 1X32A 5CGKA 1HA6A 1BBUA 3OYYA 5E3FA 1NAPA 1AH9A 4BBSB 2E2JB 2VNUD 1LTGD 2E8GA 1MHWC 4LF6Q 2H1EA 4CBVA 4MTKA 4A3JG 3JC66 2MO0A 1TWAB 2B8FA 1FJGQ 1WTPA 5JVH3 2B39A 3A7AB 1LV9A 3NWSA 4OHJA 5ELDA 2TSSA 2HHHL 1B8AA 2UUBL 2L55A 4RGNA 5IWAQ 1WYDA 3OTOQ 1WCMH 4L6TB 1QB5D 1PH9A 5JJLA 5C3EH 3SK6A 1LACA 1JORA 1HA5A 4DFAA 5KIXA 1VQJA 4OX9L 4X62Q 2WB1B 1EQTA 4P74A 2QDLA 1MSHA 2N8NA 2Z9HA 3RMHA 1XTCD 1LTRD 3RLNA 3SDZA 2F0HA 1ZYRC 3F2CA 3GTMB 2Q8IB 5I6YA 1Z7TA 3D8GA 1CA6A 2VQFQ 1X55A 3GTQH 3PO2B 1EOTA 1K8MA 1VQEA 4DR3Q 4LJZC 4DXGA 3CCUA 3VYRA 3H0GB 5E7NA 2F4IA 4IFDI 3DEPA 1GD7A 1MSGA 3CPWA 1QNUA 2BDOA 1ICWA 2NBFA 2WB1G 4ZQ3A 1EOVA 3NELA 1I6HH 4QGUA 3CCEA 1IXRA 5ELBA 3CCQA 2Q8TA 3V05A 1N32Q 2X6GA 4GN4B 2F0EA 2CWAA 3KOJA 1F9QA 3I4MH 4DUYL 1EIFA 1D5MC 1HZCA 2XGTA 3KK7A 3LX0A 5JVG3 4IPGA 1BOSA 3W1BA 3JAMi 2F4VL 1QZGA 1L1OB 1ET6A 4A3KG 1EWHA 4Y52H 5IE8A 4A3IH 3S2DB 1QNKA 1OXVA 1P8LA 1S72A 1B9NA 1KIXA 2GA4B 1E1TA 4L5QA 1TS3A 1HFGA 1M8AA 1V8QA 1C0AA 1DONA 3UDXA 2BOSA 1G291 2NVQH 1MGSA 3AFPA 1HNXQ 3W5OA 2R92H 3D4WA 2Q2IA 4OEMB 3WWVA 4ZYSA 1ILQA 3OHXC 4DV7L 1G2TA 2NVQB 1Y1WH 5IGDA 1TKWB 1Y8OB 2K7VA 1IBMQ 5C4ZA 5A2QL 4DR2Q 2VY3A 3HOWB 3CCMA 1JOOA 2SNMA 2OTLA 3GTGB 3CC2A 5CC4A 3E9IA 2F0GA 2HQLA 2QEXA 1VQ8A 1BQQT 1CT1D 2EXDA 4O2DA 2F0DA 3W1GA 2H5XA 4H0LC 4P75A 2JA5B 1F2ZA 4C2MH 1MKHA 2E2IH 1I6HB 2A6EC 5EBCA 1I94L 4DR7L 4DV6L 4J6HA 4HR7B 1CQVA 1KNAA 1AE2A 3OW7A 4L5SA 1HZBA 3KYHC 2LMCB 1BCPB 1A2TA 4AQYQ 4JI1Q 2D5DA 5D65A 1HXYD 3N6RA 4OWXB 1LT4D 5C4XB 2NUCA 3A8KE 2UUAQ 4ZK9B 3FKIB 1A0IA 3GP7A 3PV0A 5BN3A 2K14A 1X6OA 1PHJA 1I4RA 4Q0FA 2UXCL 4WJ4A 1LT6D 1IYJB 4UY8C 5EGTA 3GTMH 1STNA 5ELCA 4BBRG 4CGYB 5DM63 3ZYYX 1WTRA 4MHEA 1PTOD 1N33L 3M3YB 2EE1A 3FVQA 2NTSA 2R61A 4CDCC 3BYYB 2EYJA 2RKSA 2R7ZG 4LF9L 4IPHA 1MJEA 1L0XB 1S5ED 2NWGA 4NKLA 1QCBD 4IUPA 2R3ZA 2QILA 3IAYA 3FKIG 3OWEB 2F52A 4YWMA 2H4OA 2PZUA 3S1NB 3S24A 4CDFC 3M4OB 5FOBB 5AJ3L 3M85A 3TS0A 3KLSX 1N36L 1EY0A 1HQMC 4A3GB 1I4QA 1I5FA 5AFWA 2LXKA 4G4KA 4JI8L 4NXNL 1GJXA 1XTDA 2NYZD 2A1AA 2WP8J 1A3UA 4BBRH 3BS1A 5EJWA 1E1OA 2F0IA 3BZDB 3HP3A 1G8ZD 2HD3A 4JI0Q 2WKDA 5JPNC 3NQTA 2JXMB 4B3RQ 2F0QA 2K01A 1V1PA 3MHBA 2HDLA 3O13A 4LFAL 2MNAA 1QOHA 3PCOB 1SROA 4X65L 2O2LD 4HMIA 4DR4Q 1DOLA 1NTGA 3FP9A 1E0BA 1A15A 1ILPA 1IYVA 4IFDJ 3R2IA 1VQGA 1W6JA 1AW7A 5FK9C 5LL6X 2RVLA 4JC0A 1U0LA 4LF8L 4YY3Q 4XQJA 4K6DA 3J7ZC 4NPSA 2XRSD 1SNOA 4JI7L 2JA6G 2EXZA 4A3DB 3J80E 1TU2B 1JE4A 1BO0A 3NQIA 4A3KH 4DV2Q 3LWUA 3SVMA 1VQBA 2K04A 3MZ5A 5IYCH 4DXFA 1YHQA 1WTWA 2EY2A 1VQFA 1DD2A 2D0PA 3UI2A 4DV1Q 3FHWA 1IBLQ 1HCZA 3E0EA 3W2DA 2SNSA 4IFDG 4LMQD 3PF5A 1N33Q 4J8QA 1YNJD 1BKBA 2X6LA 3A74A 5LMNQ 2ZXRA 4OIKA 1VQAA 2CVRA 4I65A 4WFN3 1K83B 3S1RB 2MO1A 4O1NA 1YJWA 3S1NH 2I5LX 1FNVA 1DZ1A 1DCZA 1JB3A 3J81j 3F2UA 1SN8A 3TSSA 2JA8H 4V0BA 4EQPA 5J22A 3WDNA 1CHPD 1X3QA 3UDIA 3J80c 2AUKA 1XPOA 4IALA 4A3CG 4B9XA 3A56A 3RLFA 2N49A 2F3WA 4WRDA 3RZDH 4H44C 3S2HB 1TS4A 3J81c 2NN6H 3ONAB 2QW7A 4LFBQ 1RTNA 1W2BA 1DOKA 3S1MH 3E5SA 3Q8DA 2CQAA 1CTMA 2F0PA 1HNWL 1EY4A 5G3LD 4V190 4JOIA 1OXXK 3ZJYC 2HHHQ 1K0SA 2MFIA 3GTLH 4B3RL 2L1BA 4YIJA 3HOUG 1BCPD 4XT1B 5M3MB 1XMQL 4KTAA 4GKJQ 4XIGS 1LYLA 2K4KA 4DAMA 4FF4A 5HURA 1CKOA 3I72A 1KABA 1GKHA 1Y8NB 4GOPB 1OTCA 4P72A 3SK5A 3G7LA 2Z4IA 1VQNA 4JI5L 2B2TA 4A3DH 1OXUA 1LTSD 3PSIA 3ULJA 1TWFB 5JEAH 1AE3A 4UP9A 4DR3L 4PG3A 2CFMA 4B3TQ 2ICEC 1WJJA 4RG1A 1RIPA 2JK8A 1KC8C 1CHQD 1BDOA 2ZT9C 5M3MG 4JI6L 3PO3G 1YHAA 1TWFH 5CBEE 5FLXL 5GADC 2ZJPA 4JBKA 3GTPB 3IL8A 5L37A 2XRQD 1IL2A 4X66Q 1C8CA 4GKKQ 3HKZB 4A93G 4GLAC 3H94A 2ZM6Q 1EEID 2EYOA 3PUWA 1KHIA 4CKBA 1Y14B 2EY5A 4N8FA 5C4XG 1U5KA 4XXEA 4RMFA 4YCUA 2B2VA 4AYBB 2CQOA 4MZ9A 3G4SA 1R4PB 3NBHB 1PZID 3M7NA 4KKSA 1KL9A 3GTJH 5T1GA 1O78A 3MWYW 1PYSB 5A35A 3KF8B 2R93B 4DK0A 2WV6D 4GLXA 3J7AF 3SHLA 2GVAA 2UXDQ 1STEA 1HUMA 1NMFA 1N8RC 1VMCA 4F88A 1JJGA 2B63H 4NMZA 2C5CA 4DV3L 3EJIA 1JMCA 2Z6KC 1Q12A 5IT9c 2Q2TA 4GOPC 5C5LA 4ZLTF 1Q86C 2NVTB 3ICEA 1J8IA 3FEWX 1QVCA 3A54A 3S1RH 1GVPA 2A69C 3VR2A 3BVZA 2R93G 2RA4A 1CM9A 4DV4L 1WCMG 3C3LA 1YITA 4HN7A 1PFNA 3HGBA 4PV1C 2K5VA 1IL8A 2M9VA 4FDBA 3CRLC 2A6HD 2WIIB 4JI0L 1B44D 1FGUA 1XMOL 3SR1A 2OWOA 1PVOA 1ET9A 1PH2A 2SDFA 1XNRQ 4QUFA 3U4VA 2ALYB 2KQ3A 1YNJC 3S17B 3TMEA 4Y7NB 2JA5H 1FNUA 3VA5A 4C3IB 1O7LA 3NEMA 3GTJB 5D3IB 4JI4L 1GXDC 1JR0D 4BXXG 3EQLC 3VR5A 3T51B 3R93A 1NUCA 3Q22A 4GN5A 2EDGA 3T1YL 2JA6B 4PMCA 3TEHB 3Q0AA 1ONLA 4FF2A 2PO4A 3L9AX 1Y1VG 1QUQA 2CWPA 4IOAA 2D62A 5EKIA 4POFA 3ULLA 4KKTA 1LO5D 4KN7C 4ZKCB 1LTAD 3BDOA 1X65A 4C3HB 5AJ3Q 2HCIA 5KEEA 3D31A 3F8TA 3BU2A 3R3OA 2J4XA 3FDTA 5EBDA 2Z0SA 3HKZE 3CCSA 4JK1C 4TVAB 1U4MA 5CYUA 3A55A 4R4QA 4BBSG 4LF4Q 1GM5A 4C1NK 2EYFA 1GUOA 4EQ5A 4RWSC 4JI3Q 4NXNQ 5H1SE 4DUZL 1V43A 4L8JA 4AYBE 1KD1C 4RCOA 2KHSA 4A3MH 1UUPA 5JEAJ 4DK6C 1NY4A 2HQEA 3NTKA 4CJ0B 1KDCA 3WOFA 5HY6A 3CHBD 2XNAC 2WAQE 1EIGA 3DM1A 4RKBA 3LNNA 5GAHC 4C3HG 1SE4A 3I2ZA 1DOMA 2AUJD 4IJHA 1GUNA 3G6EA 4GOPA 2I0QA 1LTTD 3I55A 2PZTA 2IX3A 2Z6BA 3K57A 3CU7A 2B2WA 1BNZA 4EQOA 4DV7Q 1SYEA 1UNSA 3CXCA 1LTLA 4DAYA 2Y0SG 4A3IB 3S2DH 2JA7G 1ML0D 4EGVA 3CF5A 1PH3A 1SYFA 1O80A 5C4JH 3H0GG 5GAGC 3VYTA 5C0XH 4K8JA 4UHVA 2L12A 1HRJA 4KHZA 1II3A 3HKSA 1SYBA 4RHRA 3G6JB 1HNZQ 4A3BH 2JA8B 1HZAA 1TWHH 2C9OA 1AFPA 4IOCA 1HJPA 2L9HA 2BE5C 4H02A 2RBMA 1B53A 1I4XA 5M5XH 1AZPA 4A3IG 2UUAL 2VB3X 1Q82C 1V1OA 2J0TD 2UUBQ 2Q2UA 3B6YA 3T1YQ 3K7UC 1BBXC 1QZHA 1K83H 1EWCA 2I07B 1G51A 2MPMA 3DEOA 1K28A 1KAWA 4QF4A 4FF1A 1WTQA 1B1ZA 2A6ED 4DNRB 1SAPA 3CRKC 2EOTA 5FO7B 1Y1WB 3HOUH 3NPPA 5IGEA 3M4PA 2EYHA 3HKZG 1HH2P 5C3WA 4OO1G 3U50C 1WOCA 5K36H 4HIMA 5EPJA 3BVGA 2Q8RE 2JA6H 2L0CA 1QVFA 3R2TA 3C46A 1IHZA 2R7DA 3R8BA 3T16A 5K5PA 5F2DA 2VXWA 3ERQA 3NTIA 4IQZA 1ICFB 2F0FA 1TVXA 4BBSH 2JA5G 1J5EQ 1IKLA 5IP7G 3I4MB 2DY8A 1W6KA 4X3UA 4DGZA 1DJRD 3K80C 4BY1H 5J1ZA 2EJMA 1Q81C 3S17H 4HSVA 1HPCA 4PZ6A 2OCEA 4M1UB 5M5WB 2MGSA 2WINB 3DM3A 3I3CA 2ZXPA 4LF7L 4U673 2N3SA 4X3TA 4KI0A 2N55A 4ID6A 3GTKH 1EFWA 1J6QA 1RKNA 4XTCS 1SNMA 3C1EA 3VR3A 3I73A 1RODA 1G6PA 4OGQC 4ZUJA 4OO1H 4DNTB 1A8VA 1UE7A 4BBRB 3I4MG 3H09A 1X3EA 2VS1A 5IODA 4KJNA 5C0XJ 1RCVD 2D9UA 4NXMQ 3J81E 1KNEA 1HQRD 2B2UA 3KJOA 1BCPC 4UP8A 2PQAA 3QO2A 4ULLA 1HR0W 2YTYA 3HOZG 1B50A 2EJFC 1YI2A 4L5RC 3H3VI 5CV9A 1ENAA 1QUQB 4DK3C 1QWYA 4A3MG 1JJ2A 1FL0A 3TBIB 4FF3A 1EIHA 1E2VA 1XNQQ 1ZKOA 3KF6A 4M8AA 3MA2B 2BE5D 2RHQB 4N9TA 3EIVA 1S5BD 2Z8LA 1B4OA 2OT2A 1CFMA 1D8LA 2DJGC 3MVVA 1M90C 4DV1L 5KYLA 1Q8KA 1I94Q 2E5LL 4DR7Q 2F0SA 1FGBD 1DYQA 4X3KA 2E2JH 4JYAL 2A8VA 2KHIA 1HHVA 2FXQA 3P75A 3MXPA 5IYCG 1B2TA 4FXDA 3DWPA 1H9JA 4QIWB 3AFQA 4IZ8A 2EZVA 3H91A 4OIJA 2OXPA 2NVTH 1S5FD 1Y1VB 4RH6A 3S9WA 3HOZH 1VQ6A 3I4NB 4B3MQ 2MJ8A 2IX1A 2L4NA 2PMZB 2E2IB 1SBBB 4ZRZA 4K8IA 1NBWA 4XQQA 4P2CB 2DN8A 1VCIA 4KY6A 4A3BB 3RUZA 4NP5A 1LLRD 4C2MB 1TWGB 4HIKA 4LF9Q 4DR1Q 4EQNA 3OWFA 1VQ9A 2QDBA 3K7AH 2G5DA 2PNRC 3QG1A 1I50B 1O7ZA 4MTNA 3IFDA 4UP7A 4APVA 2KHJA 5KYIA 3OMCA 1LABA 2LFNA 4FXGC 3TP8A 4HIDA 5M3FB 2MP1A 1SRUA 3VDYA 2KENA 1SR3A 2ES2A 3MXGA 3OIPA 3DLLA 4WORA 1N36Q 3AQQA 4JOIC 4KD3A 4GKJL 1S3OA 3LGJA 1XMQQ 2QGQA 1KTKA 3SEBA 4R8NA 1WI5A 4A3BG 1V1QA 4JI2Q 3DUZA 3KF8A 3RR5A 3PIP3 2F0MA 4DV0Q 1STBA 4C1NI 2GN5A 2KCCA 4HJ9A 5ELEA 2K03A 4A3JB 2RF4A 4C3JH 4EX5A 2O5IC 3SE0A 1CKMA 3RZOB 5E4XA 2LSSA 2KCTA 3K5MA 2JA7B 3J81L 2B63G 1H95A 5BR8Q 4LW1A 1LT5D 3DWAA 3S2HH 2IX0A 5C44B 2WAQG 1VQLA 2PQEA 4G7HC 2K1BA 1D5XC 3D6WA 2KUMA 3NBIA 3MXUA 5DLQE 4H7BA 1B7YB 4HMJA 1N34L 1F9SA 2F0VA 1I3QH 1EY7A 1B3QA 1LTID 4LF4L 1F2MA 2BA0A 4LNQA 3I4NH 3PO2G 4DUZQ 5M3MH 3PUXA 3SK4A 2I5HA 1KXLA 2X69A 2A6HC 3S1QH 3T13A 2HIVA 4KMUC 4R4IA 3IKJA 2IJ0A 2G9HD 5TSSA 1UAPA 4YWKA 1MJCA 1VMPA 2ENBA 3GTQB 5C44G 5LMUL 5FLMH 1WD0A 3HZXA 1STHA 4KN4C 4P73A 4A3EH 4B3ML 4A93H 3FMCA 4JI8Q 2F0TA 2SEBD 1EYCA 2DJFC 2QA4A 4DV5Q 2A69D 3RZDB 1FD7D 1L1OC 5FLXc 4DUYQ 4GZYC 4DR5L 4C3IH 3EROA 4DAYB 5FKAC 3K0YA 4Y7NH 1L0YB 1Q3LA 2A68D 3OSOA 3FPUB 3UE1A 1VDZA 1EYDA 2VB2X 4X65Q 4QUCA 1YNNC 3C2PA 1LTBD 3NWTA 1HNXL 3BZCA 1F9RA 3NSWA 1LM0A 4NB3A 3TP6A 1STGA 4A76A 2PW5A 1IKMA 1PH8A 2CKZB 4DV4Q 3JAML 3EBEA 5CV6A 3AMUA 1SFOB 5G3LF 4JI7Q 3L3OC 2AMCB 5IIFA 1VQ4A 1SXTA 2DY7A 3GQBA 4E6IA 3H3VC 2B8GA 1NNXA 3GTOH 1HNWQ 3KDFA 1ESRA 2IY5B 4AYBG 1YBYA 5IT9L 3HS0C 3S14B 2SOBA 1UE1A 2PNHA 3PIPA 1IBLL 4BY1B 1Q1EA 3SGIA 2QF7A 1TY2A 1E22A 3K58A 5IP9G 4B3SQ 1G6ZA 5EAYA 2NZ1D 3AB9A 4RGTA 1YJ9A 2NZOA 4AQYL 3VR6A 2EIFA 5A2QE 2RDHA 4NXML 2F0NA 1X3FA 1LT3D 1V1PB 3I90A 3PQIA 2E2HH 3HOYG 1G2SA 4F87A 3H15A 3F2DA 2Z1CA 5KNDA 4C3JB 5LHY1 3TRZA 2RSOA 2A5HA 3K8AA 3T56B 2GVBA 1VF5C 1RF2D 2YTVA 4PZ7A 5KGUA 1CUKA 1XNQL 2M00A 1KRSA 3MC0B 1Q7YC 3VR4A 2HCCA 4UPAA 2UXBQ 4XT3B 4R1JA 1O7YA 2L11A 2AWOA 4JBJA 2R7ZB 3BDLA 3ND8A 1X9NA 2A74C 5M3FH 3MXNB 1A3TA 2K5DA 4DA2A 1NR2A 4TRDA 4Z9CB 4X3SA 2LY7A 3QOJA 3HOVG 3T53B 2K52A 4FVMA 3S1QB 3E6ZX 2K5WA 4IJLA 1PV4A 4IPCA 3VYSA 4ZKBB 4JBMA 2K28A 3HG9A 2JEBI 3D3RA 4J1MA 2FMMA 2MUYA 1ZYRD 2DUDA 2XWBB 1HTLD 4C3IG 1CZGA 1HTPA 2UUCL 1EY5A 4HAEA 5FJ8G 2FMCA 1F2YA 4RKLA 3U4ZA 2IW3A 2EJGC 5JJZA 2NB0A 4OELB 3M3YH 3J80i 4BA1I 5D14A 3STBD 1K9MC 4ME5A 3BYTB 4DPGA 1ASZA 3PO2H 1O7IA 5C4JB 3HOVB 4XYOA 1KLGD 5K36G 1WTHA 1WTXA 4JV5Q 3C1FA 5M3FG 1MBYA 5DNFA 2F0LA 1XPUA 3I7FA 1B70B 3GD7A 2R7ZH 3IRBA 4KJOA 1YHBA 3AYHB 2F0OA 3I56A 4X62L 3OOCA 2XIWA 4FXKC 3HEJA 4K6LA 3OW2A 4ODGA 1TY0A 1XPRA 1EY6A 1D1KA 1EUJA 4X6AH 4RGOS 2PQAB 3TQYA 4A3DG 3DWQA 4PNYA 1I4HA 3HRZC 1E24A 5DEHA 1JT8A 3S16H 4A75A 5C4HA 4I7ZC 5IGCA 4GN3B 1A62A 1PFSA 2I46A 5EPKA 3BZKA 5M9OA 3MTSA 4BY7B 2F3VA 5CV7A 2ID0A 1HR0L 3MFGA 2FHTA 1EQQA 1FR3A 1JWMD 3BDCA 1EQVA 3NTHA 1TXYA 4YHHL 5I2XA 3URYA 1PA6A 1GUWA 1T5EA 3H0GH 2V4DA 4IN3A 3T1HQ 1V9PA 2XTIA 4A3KB 3I70A 1X56A 4K0KQ 4B08A 4S3SA 2EYLA 2IHFA 4IUNA 1WTOA 4BY7G 3I4OA 4ABNA 3ND9A 1H9SA 4A3FH 1J5EL 3ULPA 5BN4A 1JB7A 3J7AV 3D6CA 4K2LA 1H9MA 1LUZA 2JA8G 2BH2A 5C3EB 4H13C 4OL7A 4FP5D 1FVIA 1QVGA 3BJUA 1XXGA 4HJAA 4LF7Q 4ALPA 3E3XA 1IBML 2OEOA 4DR2L 5KNCA 3Q6SA 4N9PA 1YVCA 2VUMG 1SE3A 1STYA 2Z4HA 5KRUA 1EIYB 1PRTB 5CV5A 1QG7A 1FYCA 2R92G 4LF5Q 1PDQA 1EYAA 5FJ8H 2B2VC 2K50A 4QCLA 4DU9A 1PTOC 3NHHA 1Y1WG 1VQ7A 2BCOA 3NUCA 1PRTF 4K5WA 5D3DA 1SMXA 3AU7A 1PH6A 1EU3A 2F0WA 4DK1A 5LMNW 3CD6A 4LUOA 3V96A 2KVMA 3PUYA 4NW2A 3PF4A 3M4OH 2CW0D 4PMBA 5E1FA 3M7GA 1Z9FA 3KBXA 3MFYA 2ZTCA 4XQNA 3K0XA 4AIMA 3EVQA 1TWHB 2K6AA 3KLWA 4KD4A 5JEAG 1ASYA 3EN2A 5LMUQ 2RHSB 2R93H 4BY1G 3MEHA 1E3PA 1S4ZA 1IZ6A 2NZHA 4GKKL 3GV6A 1YEZA 5C3XA 3MXNA 4IPDA 1F9PA 4JYAQ 1HR0Q 1RHPA 3JAME 1PLFA 3GTGH 3HOYB 1KDAA 1K0RA 2KEEA 2DNEA 1K8AC 4ILWA 4C3JG 1D7QA 3RZOH 2BDNA 4DN4M 4LK1C 4A3JH 3HFZB 4K5XA 2BA1A 4RFBA 2NVYB 3BVMA 3P20A 1IBKL 1KAAA 4NDXA 3Q23A 3CCJA 5GQOA 3P1HA 5M5YH 3QJYA 3KBGA 4YCVA 1RDPD 4C56C 1UEBA 3PUVA 4DR1L 1IW7C 1KQSA 1ZXTA 1YNXA 1B9MA 1CSQA 5ELOA 1E2ZA 1EU4A 1P16A 4JBWA 3CKIB 4A3MB 3S16B 1D6EC 4HTHA 4A4IA 1D2BA 3OTOL 4A3FG 2K5NA 4ZAIA 1HNZL 1ENFA 3CCLA 4IUUA 2PPBC 3U9OA 4DV0L 2D0OA 4HSPA 3TREA 1D1IA 4B3SL 2QKIC 2VZAA 2K05A 4YCWA 5EPLA 2RDGA 4HCEA 1TWCH 2C35B 4LF8Q 2KCNA 1NJIC 1PMRA 3HOXB 2ZTDA 3CQZB 1F77A 2KECA 1I4PA 4F7XA 4HJ7A 3M9BA 1PH1A 3TS2A 2Q2HA 1Z47A 2EVBA 4JPBW 3I4NG 4QL5A 4R9WA 1JOQA 4DV2L 2TMPA 2E2DC 2F3IA 2JSOA 1STAA 2UU9Q 4K14A 4G7ZC 1JCKB 2YU9H 3D0FA 3S15B 1VQKA 1X3PA 1Q8IA 3X3MA 1SNCA 4HJ8A 5FLMG 4FNFA 1YIJA 4CKCA 3HOXG 1A63A 3CCRA 4WJWA 2ICIA 1MD2D 3IFTA 1GUSA 2AWNA 1K8GA 1TWAH 4X64L 1JWUD 1CK1A 4KHVA 1FNWA 4AH6A 2QCPX 2EY1A 5CORA 3K59A 3H3VH 2RQXA 4CJ2C 2K32A 4LWCA 1K3RA 3PIOA 4GNXC 1XWEA 2J7ZA 4DR5Q 1VF7A 3M4YA 5EKLA 3A5ZB 2KJXA 1JWSD 1UWVA 1WVLA 1EQRA 1SYDA 1AN8A 3GDEA 4KHPL 2ZXOA 5DM73 4OO1I 3K6OA 3OIQA 1E2WA 2B63B 3QIAA 2YTXA 2PYKA 1JQYD 2ZJRA 3NBHA 2WAQB 2HIXA 3NENA 1PXUA 2P5ZX 2AKWB 3ERSX 2F0UA 1EZ6A 1DM0B 2JA9A 2JE6I 3VA7A 1Y69U 2EYMA 4DR6Q 4CJ1B 2HDMA 5C3EG 3CP0A 2DNCA 1OXTA 4OWWB 4WJ3M 2Y0SB 2VQEL 1AZQA 2PI2A 3CC7A 2R7FA 4YWLA 1U4PA 3QR8A 1ESFA 1S40A 5IWAL 1SMYC 1VQCA 4LFCQ 3CAMA 1DGSA 1NSNS 2UXCQ 1G91A 3PO3B 4KK7A 3GTPH 3TDQA 4A3EB 2K5QA 5IGBA 3UDGA 3RD4A 2PMZE 2B2TC 1J9OA 4U68A 1C48A 5CBAE 3GV3A 1EZ8A 4DKAC 1JICA 5DAUA 1TS2A 3X3NA 3JAMc 1YNND 1U9RA 2B2WC 4ZCKA 4YHHQ 3CPFA 2N78A 2ZM6L 2Y0SE 2HT1A 1VS0A 2D2CC 2CW0C 2IHEA 2FJ2A 2A68C 2WKCA 3KUPA 4J15A 1I3QB 2JQOA 3A5UA 1KRTA 5JJKA 4OXPA 1VQMA 2PI2E 4IO9A 1BBWA 1CA5A 4P71A 1VQOA 1CQFA 5IY0A 2UXBL 3RNUA 1QJOA 2YU9B 3S15H 3PGZA 3CW2C 5C0XG 4LUVA 1GOZA 1D5ZC 4O42A 3AEVA 4JCVE 2MQHA 4LUZA 3DHQA 3K81C 4RHSA 1A6XA 4KY5A 2HUGA 4QQBX 2F4VQ 1SDFA 4GNXB 4KHPQ 1W3SA 1R9TH 1SEBD 1PTOF 3KF6B 3EFXD 1QE6A 1R4QB 4JI2L 2OQKA 1EYGA 2CH4W 4B9WA 1PFMA 5EKKA 5JPMC 3H6MA 3KFUA 2XSCA 2ASBA 2A73B 2WFWA 4TSSA 5ELNA 2XWJB 1H9SB 2UUCQ 3CMAA 4TQUS 4QMGA 1BR9A 1CKNA 2NVXH 1VQ5A 5C5MA 5JJIA 2B2UC 2OTJA 1TIID 1SMYD 1AP0A 5IYDH 5HGQA 2G9DA 2RCFA 4FO2A 5BR8L 3LWEA 1K8OA 2N88A 1GO3E 2CHBD 4K2KA 2JP1A 2NTTA 1HZ9A 4GS3A 3HOWH 4LFBL 2VQEQ 4IURA 2L5TA 3U58A 4CDEC 2JJQA 3PMFA 1RD9D 1JJCB 2JYOA 2XVSA 5FO9B 2MHVA 4GLVB 1XMOQ 5GROA 2O4XA 2JEAI 4BS9A 4XYQA 4HCSA 2F0KA 4DAVA 5I9OA 4EVOA 4BXXH 1DXMA 1SLJA 4XDXA 5M5YB 1MI2A 1TT2A 2RDFA 4C3HH 2IWHA 1BVSA 1PRTD 3HOZB 2FFKB 4JI4Q 3TN2A 1R9TB 1PTOH 3NK9A 1RTOA 3TZDA 4RCNA 1VQDA 2M2LA 1UE6A 5T1IA 2E2HB 1SE2A 3E9HA 4OX9Q 1X54A 3RLOA 5CR3A 1OXSC 1X3GA 1GUGA 1Q46A 1GUTA 3SXHA 2ZJQA 3J7A5 2FINB 2B2YA 2CH4A 4BWGB 2IT1A 2YYZA 3L2PA 1L1OA 4JI3L 1PH7A 2KEDA 5J3BA 1SNDA 1Y1VH 1C7YA 3V2TA 3T1HL 4QB4A 3K5OA 4QJFA 1M4VA 5C6AA 2AQ1B 3STBC 1B3AA 2PCFB 3J7YW 2DGYA 3M4QA 3TZUA 1BUVT 1OO9B 4JVZA 5CMDA 3RN5A 1S5CD 5LL6S 1ENCA 4HIOA 3QB3A 1N32L 4LF6L 3A7LA 4R4TA 3PO3H 4UDUC 2B29A 3WOEA 1FJGL 1SNQA 1SJHD 4TKOB 2RCNA 4R8IA 4BA2I 3MAQA 2KA7A 4UAIA 4GNXA 3KLSA 4N8X1 3KLRA 1SYCA 4B3TL 2B3GA 3A8IE 3A0JA 4CKEA 2O5JC 3L7ZC 3G48A 4JI6Q 4KLKA 3ER0A 1BXTA 1EL0A 3K5NA 4G7OC 2VW9A 1WD1A 5IT9E 2LS01 3W3AA 1EY8A 1KDBA 3CCVA 4FYDA 2JA7H 4YY3L 3FKIH 3I91A 3U9SA 3MEFA 1C4QA 2YV5A 5CV8A 1RJTA 1SE8A 4L5TA 1UE5A 2AHOB 3KJPA 5C0XI 1I4GA 2E74C 1PTOB 4JV5L 3L0OA 3RN2A 4A3LH 1L0WA 4X64Q 1SJED 1TQOA 3J80L 4KKUA 1IW7D 1PRTC 2K33A 3HOUB 3PUZA 3GTOB 2F0JA 1EEFD 1N34Q 1PH5A 4OWTB 1SNPA 1XNRL 4DAPA 5I4DA 2VL6A 4A3EG 1SFOH 5J39A 4A3GH 5IP9H 3J81i 5ELFA 2Z6KA 2PZWA 3EA6A 5E4WC 5IYBG 3K5LA 3TP5A 2UXDL 2PW7A 4JI1L 1UEAB 5LMNL 1T9HA 2EQSA 1I50H 2EPBA 3T4AC 1PH4A 1BF4A 3I8ZA 5EQ0A 1CKNB 2BH8A 5IYDG 4DV3Q 5M5XB 3CC4A 4Q5VA
chains in the Genus database with same CATH topology
3HOZH 4A3JH 1VQ6A 3HFZB 2BA1A 1SN8A 4B3MQ 2IX1A 2JA8H 4DV5L 1IBKL 3UDIA 3J80c 4OONA 1NBWA 1PYBA 5GQOA 3CCJA 5M5YH 1XPOA 1VCIA 2K5HA 2L15A 4A3CG 4YCVA 1UEBA 4PMWA 1YZ6A 3PUVA 3RLFA 4DR1L 2N49A 3F2BA 4HIKA 4LF9Q 3RZDH 4DR1Q 4DR6L 1EWIA 2LXJA 3J81c 3K7AH 5GAEC 1WFQA 4HJ5A 1YNXA 1K73C 1KQSA 1CSQA 5ELOA 4LFBQ 1W2BA 3GO5A 1P16A 3HOWG 3S1MH 3Q8DA 4JBWA 4MTNA 4UP7A 4APVA 2KHJA 1N9WA 3CQZH 1HNWL 4HIDA 3HOVH 4JOIA 1OXXK 3ZJYC 4A4IA 5C4XH 2HHHQ 1SRUA 2MFIA 3GTLH 4B3RL 3VDYA 2KENA 3H3VI 1SR3A 4LFCL 2ES2A 3HOUG 3DLLA 3OTOL 1N36Q 5IP7H 4A3FG 3AQQA 4JOIC 3CMEA 1XMQL 1S3OA 4GKJL 3LGJA 2K5NA 4POGA 1HNZL 1XMQQ 2NN6G 2QGQA 2NN6I 1LYLA 4XIGS 2K4KA 4DAMA 4DV6Q 4JG2A 3CCLA 4A3BG 1WI5A 1CKOA 1V1QA 4JI2Q 3RR5A 4DV0L 2V1CC 2D0OA 3TREA 1GKHA 4DV0Q 4B3SL 2R6GA 4GOPB 2VZAA 2WB1E 4YCWA 4P72A 2GN5A 1OTCA 4HJ9A 1VQNA 4A3LG 4JI5L 1TWCH 4A3DH 2RF4A 4JI5Q 2C35B 1OXUA 3PSIA 3ULJA 4C3JH 4EX5A 5C44H 1NJIC 1CKMA 4LF8Q 2LSSA 2ZTDA 1AE3A 4UP9A 2KCTA 4DR3L 4GKJQ 4PG3A 2CFMA 4HJ7A 2B63G 4LFAQ 4B3TQ 2KCMA 1YJNA 3M9BA 4MNOA 1WJJA 1PH1A 3TS2A 2Q2HA 4LW1A 4RG1A 5BR8Q 1RIPA 3HOZG 1RL2A 1Z47A 2JK8A 1KC8C 3I4NG 2ZTEA 4QL5A 4R4OA 3S2HH 4DV2L 5M3MG 3HOXH 1VQPA 4JI6L 1YHAA 2F3IA 2IX0A 1TWFH 2WAQG 4LF5L 5IYBH 1VQLA 3PO3G 2UU9Q 2I5MX 4A3CH 3UE0A 5DLQE 5GADC 2ZJPA 2UU9L 4QY7A 1B7YB 3D0FA 2OQ0A 2YU9H 4JBKA 1N34L 2A19A 1VQKA 2VQFL 2KBNA 1I3QH 1VQIA 4LF4L 4HJ8A 1IL2A 2BA0A 2CCZA 4QIWE 5FLMG 4X66Q 2E5LQ 4LNQA 4GKKQ 3I4NH 4X66L 4A93G 2K75A 4GLAC 2VUMH 4DUZQ 3PO2G 1YIJA 1MIUA 2ZM6Q 5M3MH 3HOXG 1A63A 3CCRA 3PUXA 4K0KL 3PUWA 1KHIA 5M5WH 2I5HA 4PZ8A 1KXLA 2AWNA 1Y14B 3S1QH 5C4XG 1NE3A 1U5KA 1TWAH 1K8GA 4ME3A 4X64L 2HIVA 4R4IA 4RMFA 4YCUA 2CQOA 3HOYH 1Q1BA 4MZ9A 1M1KC 4AH6A 4YWKA 3G4SA 1MJCA 1CSPA 5C44G 5LMUL 5FLMH 3NBHB 3H3VH 3M7NA 4P73A 1KL9A 4A3EH 4LWCA 4B3ML 4A93H 1K3RA 3GTJH 4JI8Q 3PIOA 1PYSB 4A3GG 2QA4A 4GNXC 4DV5Q 3UDFA 3KF8B 1TWGH 4DR5Q 1L1OC 5FLXc 4DUYQ 4DR5L 4C3IH 4GLXA 3A5ZB 2GVAA 4DAYB 1C9OA 2UXDQ 1NMGA 1NMFA 1UWVA 1N8RC 4Y7NH 4O0AA 1EQRA 1JJGA 1E7ZA 2ATWA 2B63H 3GDEA 3S14H 4DV3L 1L2FA 1JMCA 1JE5A 2NVYH 2Z6KC 3UE1A 4KHPL 1Q12A 5IT9c 4OO1I 2Q2TA 4GOPC 4R4CA 4X65Q 3KDFB 3F1ZA 1XJVA 2YTXA 4DR4L 1Q86C 2ZJRA 3ICEA 1HNXL 4DNIA 3BZCA 1QVCA 3S1RH 1IBKQ 2HIXA 3NENA 1GVPA 3G71A 1LM0A 4NB3A 1VQHA 4BY7H 2AKWB 4A76A 3ERSX 1PH8A 1BBUA 2CKZB 3OYYA 1AH9A 2R93G 2JA9A 2JE6I 4DV4Q 4DV4L 3EBEA 1WCMG 1YITA 2VNUD 4DR6Q 4JI7Q 2E8GA 5C3EG 2AMCB 3CP0A 4LF6Q 1VQ4A 1OXTA 2K5VA 4A3JG 3JC66 2MO0A 4OWWB 4WJ3M 1FJGQ 2VQEL 4FDBA 2PI2A 3GTOH 3CC7A 1HNWQ 2R7FA 4JI0L 4YWLA 1FGUA 1XMOL 3KDFA 2HHHL 2OWOA 1B8AA 5IWAL 4AYBG 1YBYA 1S40A 2UUBL 1PVOA 1VQCA 4LFCQ 2IY5B 1PH2A 5IWAQ 1WYDA 3CAMA 3OTOQ 1XNRQ 1WCMH 1DGSA 2ALYB 3U4VA 1UE1A 1PH9A 2UXCQ 5JJLA 2PNHA 5C3EH 3PIPA 1IBLL 2JA5H 4OX9L 1VQJA 4X62Q 3GTPH 4P74A 1Q1EA 3SGIA 2N8NA 3NEMA 1E22A 5IP9G 4B3SQ 3RLNA 5EAYA 4JI4L 3UDGA 1YJ9A 2NZOA 4AQYL 2PMZE 3F2CA 2EIFA 4DKAC 4NXML 4BXXG 1X3FA 3JAMc 2VQFQ 1X55A 3HOYG 2E2HH 3GTQH 4GN5A 1VQEA 4DR3Q 3T1YL 4YHHQ 3H15A 3F2DA 3CPFA 3TEHB 2N78A 3CCUA 3TRZA 2ZM6L 2Y0SE 2HT1A 1VS0A 5E7NA 2IHEA 3K8AA 1Y1VG 1QUQA 2CWPA 2GVBA 4IFDI 2D62A 4IOAA 4POFA 1GD7A 3ULLA 3CPWA 2YTVA 4PZ7A 4J15A 2JQOA 1CUKA 1X65A 1KRTA 5AJ3Q 3A5UA 1XNQL 2WB1G 4OXPA 1VQMA 1KRSA 2PI2E 1Q7YC 4IO9A 3D31A 1BBWA 3F8TA 1EOVA 3BU2A 3NELA 4UPAA 3CCSA 2Z0SA 3HKZE 1I6HH 2UXBQ 4QGUA 3CCEA 4P71A 4TVAB 1VQOA 5IY0A 4R1JA 2UXBL 1IXRA 4R4QA 3RNUA 4BBSG 4LF4Q 2AWOA 3CCQA 3S15H 3PGZA 1GM5A 4JBJA 1N32Q 4EQ5A 1X9NA 4GN4B 4JI3Q 4NXNQ 3CW2C 5H1SE 2CWAA 3KOJA 4LUVA 1V43A 5C0XG 5M3FH 3MXNB 4DUYL 4DUZL 3AEVA 1EIFA 3I4MH 1KD1C 4JCVE 4AYBE 1HZCA 2MQHA 2XGTA 4LUZA 3K81C 4IPGA 5JEAJ 4DK6C 4A3MH 3W1BA 3JAMi 2F4VL 1NY4A 1QZGA 1L1OB 4QQBX 4A3KG 2F4VQ 3HOVG 4Y52H 5IE8A 2K52A 4GNXB 4A3IH 4KHPQ 5HY6A 1OXVA 1P8LA 2WAQE 1S72A 1KIXA 1W3SA 1R9TH 1E1TA 4L5QA 4IJLA 1PV4A 4IPCA 1C0AA 4JBMA 3KF6B 5GAHC 3UDXA 2NVQH 1G291 2JEBI 4JI2L 2OQKA 3I2ZA 1EYGA 2DUDA 3AFPA 4IJHA 1HNXQ 3W5OA 3G6EA 4GOPA 2I0QA 3I55A 3KFUA 2R92H 2ASBA 2WFWA 2UUCL 2Q2IA 3WWVA 5ELNA 2UUCQ 5FJ8G 3CMAA 4TQUS 3U4ZA 4DV7L 1Y1WH 1CKNA 2NVXH 4DV7Q 1VQ5A 5JJIA 3M3YH 3J80i 4BA1I 2OTJA 3STBD 3CXCA 1K9MC 5IYDH 1LTLA 5HGQA 1IBMQ 2Y0SG 4DPGA 1ASZA 5BR8L 1O7IA 4DR2Q 2VY3A 3PO2H 2JA7G 3S2DH 5JJKA 3CCMA 3CF5A 1GO3E 1PH3A 2OTLA 4GS3A 1HZ9A 5C4JH 3CC2A 3HOWH 4LFBL 3H0GG 2VQEQ 3U58A 5K36G 3E9IA 5GAGC 4JV5Q 2JJQA 5M3FG 1JJCB 1XPUA 2HQLA 1XMOQ 4GLVB 5GROA 2QEXA 3I7FA 1VQ8A 1B70B 2JEAI 3GD7A 2R7ZH 3IRBA 2EXDA 4KHZA 4O2DA 3W1GA 1YHBA 2H5XA 4P75A 3AYHB 4BXXH 4C2MH 1MKHA 3HKSA 2E2IH 3I56A 1SLJA 4X62L 1HNZQ 4A3BH 1I94L 4DR7L 4DV6L 1HZAA 1TWHH 4C3HH 4IOCA 1AE2A 1BVSA 1HJPA 4L5SA 1HZBA 3KYHC 3OW2A 4H02A 4JI4Q 1XPRA 1EUJA 4AQYQ 4X6AH 1H95A 4JI1Q 5M5XH 4A3IG 2PQAB 4OWXB 3TQYA 4A3DG 2UUAL 1VQDA 1Q82C 2UUAQ 1E24A 1A0IA 2Q2UA 2UUBQ 1JT8A 3S16H 3B6YA 4A75A 3PV0A 3T1YQ 2K14A 1UE6A 1X6OA 3K7UC 1PHJA 1QZHA 3E9HA 4GN3B 1A62A 1K83H 2UXCL 4WJ4A 1PFSA 1IYJB 3BZKA 4OX9Q 4UY8C 1G51A 1X54A 3GTMH 3RLOA 1KAWA 4BBRG 1OXSC 1X3GA 1N33L 2ID0A 1Q46A 2ZJQA 1HR0L 3HOUH 3J7A5 1EQQA 2R7ZG 3M4PA 2IT1A 4LF9L 4IPHA 1TXYA 2YYZA 3HKZG 1MJEA 1HH2P 4YHHL 4OO1G 3L2PA 1L1OA 1WOCA 3U50C 1PA6A 4JI3L 3H0GH 1PH7A 5J3BA 1Y1VH 4HIMA 1V9PA 3FKIG 2XTIA 2F52A 4YWMA 3T1HQ 1C7YA 3T1HL 1X56A 2JA6H 4K0KQ 1QVFA 3S24A 4QJFA 2R7DA 3STBC 2IHFA 5AJ3L 3M85A 2DGYA 3M4QA 3TS0A 4BY7G 3I4OA 1N36L 4BBSH 2JA5G 1J5EQ 3RN5A 5IP7G 4A3FH 1J5EL 3ULPA 1JB7A 1I5FA 1VQ9A 4HIOA 1N32L 4LF6L 2LXKA 3K80C 4JI8L 4BY1H 1LUZA 4NXNL 2JA8G 4R4TA 1XTDA 1Q81C 2BH2A 3PO3H 2B29A 3S17H 2A1AA 2WP8J 1FJGL 4PZ6A 1FVIA 4BBRH 1E1OA 1QVGA 2OCEA 2RCNA 4JI0Q 3BJUA 3DM3A 4BA2I 4LF7L 2N3SA 4HJAA 4LF7Q 4KI0A 4ALPA 4GNXA 4B3RQ 3GTKH 1EFWA 1IBML 1J6QA 4XTCS 4B3TL 4DR2L 4LFAL 2B3GA 1YVCA 3PCOB 2MNAA 2VUMG 1SROA 4X65L 3A0JA 1G6PA 1EIYB 4DR4Q 3L7ZC 1A8VA 1NTGA 1UE7A 3FP9A 3G48A 4JI6Q 4KLKA 3ER0A 4LF5Q 2R92G 3I4MG 1X3EA 4IFDJ 5FJ8H 2VS1A 1VQGA 2K50A 5C0XJ 1Y1WG 1VQ7A 4JC0A 4NXMQ 1U0LA 3KJOA 2VW9A 4LF8L 1SMXA 4UP8A 2PQAA 4YY3Q 3CCVA 5LMNW 2YTYA 1PH6A 1HR0W 3J7ZC 2JA7H 4LUOA 4YY3L 4NPSA 3CD6A 3FKIH 3PUYA 1YI2A 4JI7L 3PF4A 3M4OH 3MEFA 2YV5A 4L5RC 2JA6G 1SE8A 1QUQB 4L5TA 1UE5A 2AHOB 4DK3C 3KJPA 5C0XI 4A3MG 1JJ2A 1FL0A 4JV5L 1Z9FA 3L0OA 3RN2A 4A3KH 4DV2Q 4A3LH 2ZTCA 1L0WA 4X64Q 1XNQQ 3K0XA 4AIMA 1VQBA 3KF6A 2RHQB 3KLWA 5JEAG 5IYCH 1ASYA 3EIVA 3PUZA 1YHQA 3EN2A 1N34Q 5LMUQ 1VQFA 2RHSB 2D0PA 1D8LA 4OWTB 1PH5A 1XNRL 2R93H 4BY1G 4DV1Q 1M90C 1E3PA 3FHWA 4DV1L 1IBLQ 1IZ6A 1Q8KA 1I94Q 2VL6A 3E0EA 4A3EG 2NZHA 2E5LL 1SFOH 4DR7Q 4GKKL 4IFDG 1YEZA 3PF5A 4A3GH 5IP9H 3J81i 4IPDA 2E2JH 2Z6KA 1N33Q 4JYAL 5IYBG 1BKBA 3A74A 2A8VA 5LMNQ 4JYAQ 2KHIA 1HR0Q 2FXQA 4JI1L 2UXDL 5LMNL 1T9HA 2EQSA 1I50H 1PH4A 3GTGH 5IYCG 1VQAA 1K0RA 2MO1A 1CKNB 2BH8A 3AFQA 5IYDG 1K8AC 4DV3Q 1YJWA 3S1NH 2I5LX 1D7QA 3CC4A 3RZOH 2NVTH 3J81j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ H;  4A3J H;  1VQ6 A;  3HFZ B;  2BA1 A;  1SN8 A;  4B3M Q;  2IX1 A;  2JA8 H;  4DV5 L;  1IBK L;  3UDI A;  3J80 c;  4OON A;  1NBW A;  1PYB A;  5GQO A;  3CCJ A;  5M5Y H;  1XPO A;  1VCI A;  2K5H A;  2L15 A;  4A3C G;  4YCV A;  1UEB A;  4PMW A;  1YZ6 A;  3PUV A;  3RLF A;  4DR1 L;  2N49 A;  3F2B A;  4HIK A;  4LF9 Q;  3RZD H;  4DR1 Q;  4DR6 L;  1EWI A;  2LXJ A;  3J81 c;  3K7A H;  5GAE C;  1WFQ A;  4HJ5 A;  1YNX A;  1K73 C;  1KQS A;  1CSQ A;  5ELO A;  4LFB Q;  1W2B A;  3GO5 A;  1P16 A;  3HOW G;  3S1M H;  3Q8D A;  4JBW A;  4MTN A;  4UP7 A;  4APV A;  2KHJ A;  1N9W A;  3CQZ H;  1HNW L;  4HID A;  3HOV H;  4JOI A;  1OXX K;  3ZJY C;  4A4I A;  5C4X H;  2HHH Q;  1SRU A;  2MFI A;  3GTL H;  4B3R L;  3VDY A;  2KEN A;  3H3V I;  1SR3 A;  4LFC L;  2ES2 A;  3HOU G;  3DLL A;  3OTO L;  1N36 Q;  5IP7 H;  4A3F G;  3AQQ A;  4JOI C;  3CME A;  1XMQ L;  1S3O A;  4GKJ L;  3LGJ A;  2K5N A;  4POG A;  1HNZ L;  1XMQ Q;  2NN6 G;  2QGQ A;  2NN6 I;  1LYL A;  4XIG S;  2K4K A;  4DAM A;  4DV6 Q;  4JG2 A;  3CCL A;  4A3B G;  1WI5 A;  1CKO A;  1V1Q A;  4JI2 Q;  3RR5 A;  4DV0 L;  2V1C C;  2D0O A;  3TRE A;  1GKH A;  4DV0 Q;  4B3S L;  2R6G A;  4GOP B;  2VZA A;  2WB1 E;  4YCW A;  4P72 A;  2GN5 A;  1OTC A;  4HJ9 A;  1VQN A;  4A3L G;  4JI5 L;  1TWC H;  4A3D H;  2RF4 A;  4JI5 Q;  2C35 B;  1OXU A;  3PSI A;  3ULJ A;  4C3J H;  4EX5 A;  5C44 H;  1NJI C;  1CKM A;  4LF8 Q;  2LSS A;  2ZTD A;  1AE3 A;  4UP9 A;  2KCT A;  4DR3 L;  4GKJ Q;  4PG3 A;  2CFM A;  4HJ7 A;  2B63 G;  4LFA Q;  4B3T Q;  2KCM A;  1YJN A;  3M9B A;  4MNO A;  1WJJ A;  1PH1 A;  3TS2 A;  2Q2H A;  4LW1 A;  4RG1 A;  5BR8 Q;  1RIP A;  3HOZ G;  1RL2 A;  1Z47 A;  2JK8 A;  1KC8 C;  3I4N G;  2ZTE A;  4QL5 A;  4R4O A;  3S2H H;  4DV2 L;  5M3M G;  3HOX H;  1VQP A;  4JI6 L;  1YHA A;  2F3I A;  2IX0 A;  1TWF H;  2WAQ G;  4LF5 L;  5IYB H;  1VQL A;  3PO3 G;  2UU9 Q;  2I5M X;  4A3C H;  3UE0 A;  5DLQ E;  5GAD C;  2ZJP A;  2UU9 L;  4QY7 A;  1B7Y B;  3D0F A;  2OQ0 A;  2YU9 H;  4JBK A;  1N34 L;  2A19 A;  1VQK A;  2VQF L;  2KBN A;  1I3Q H;  1VQI A;  4LF4 L;  4HJ8 A;  1IL2 A;  2BA0 A;  2CCZ A;  4QIW E;  5FLM G;  4X66 Q;  2E5L Q;  4LNQ A;  4GKK Q;  3I4N H;  4X66 L;  4A93 G;  2K75 A;  4GLA C;  2VUM H;  4DUZ Q;  3PO2 G;  1YIJ A;  1MIU A;  2ZM6 Q;  5M3M H;  3HOX G;  1A63 A;  3CCR A;  3PUX A;  4K0K L;  3PUW A;  1KHI A;  5M5W H;  2I5H A;  4PZ8 A;  1KXL A;  2AWN A;  1Y14 B;  3S1Q H;  5C4X G;  1NE3 A;  1U5K A;  1TWA H;  1K8G A;  4ME3 A;  4X64 L;  2HIV A;  4R4I A;  4RMF A;  4YCU A;  2CQO A;  3HOY H;  1Q1B A;  4MZ9 A;  1M1K C;  4AH6 A;  4YWK A;  3G4S A;  1MJC A;  1CSP A;  5C44 G;  5LMU L;  5FLM H;  3NBH B;  3H3V H;  3M7N A;  4P73 A;  1KL9 A;  4A3E H;  4LWC A;  4B3M L;  4A93 H;  1K3R A;  3GTJ H;  4JI8 Q;  3PIO A;  1PYS B;  4A3G G;  2QA4 A;  4GNX C;  4DV5 Q;  3UDF A;  3KF8 B;  1TWG H;  4DR5 Q;  1L1O C;  5FLX c;  4DUY Q;  4DR5 L;  4C3I H;  4GLX A;  3A5Z B;  2GVA A;  4DAY B;  1C9O A;  2UXD Q;  1NMG A;  1NMF A;  1UWV A;  1N8R C;  4Y7N H;  4O0A A;  1EQR A;  1JJG A;  1E7Z A;  2ATW A;  2B63 H;  3GDE A;  3S14 H;  4DV3 L;  1L2F A;  1JMC A;  1JE5 A;  2NVY H;  2Z6K C;  3UE1 A;  4KHP L;  1Q12 A;  5IT9 c;  4OO1 I;  2Q2T A;  4GOP C;  4R4C A;  4X65 Q;  3KDF B;  3F1Z A;  1XJV A;  2YTX A;  4DR4 L;  1Q86 C;  2ZJR A;  3ICE A;  1HNX L;  4DNI A;  3BZC A;  1QVC A;  3S1R H;  1IBK Q;  2HIX A;  3NEN A;  1GVP A;  3G71 A;  1LM0 A;  4NB3 A;  1VQH A;  4BY7 H;  2AKW B;  4A76 A;  3ERS X;  1PH8 A;  1BBU A;  2CKZ B;  3OYY A;  1AH9 A;  2R93 G;  2JA9 A;  2JE6 I;  4DV4 Q;  4DV4 L;  3EBE A;  1WCM G;  1YIT A;  2VNU D;  4DR6 Q;  4JI7 Q;  2E8G A;  5C3E G;  2AMC B;  3CP0 A;  4LF6 Q;  1VQ4 A;  1OXT A;  2K5V A;  4A3J G;  3JC6 6;  2MO0 A;  4OWW B;  4WJ3 M;  1FJG Q;  2VQE L;  4FDB A;  2PI2 A;  3GTO H;  3CC7 A;  1HNW Q;  2R7F A;  4JI0 L;  4YWL A;  1FGU A;  1XMO L;  3KDF A;  2HHH L;  2OWO A;  1B8A A;  5IWA L;  4AYB G;  1YBY A;  1S40 A;  2UUB L;  1PVO A;  1VQC A;  4LFC Q;  2IY5 B;  1PH2 A;  5IWA Q;  1WYD A;  3CAM A;  3OTO Q;  1XNR Q;  1WCM H;  1DGS A;  2ALY B;  3U4V A;  1UE1 A;  1PH9 A;  2UXC Q;  5JJL A;  2PNH A;  5C3E H;  3PIP A;  1IBL L;  2JA5 H;  4OX9 L;  1VQJ A;  4X62 Q;  3GTP H;  4P74 A;  1Q1E A;  3SGI A;  2N8N A;  3NEM A;  1E22 A;  5IP9 G;  4B3S Q;  3RLN A;  5EAY A;  4JI4 L;  3UDG A;  1YJ9 A;  2NZO A;  4AQY L;  2PMZ E;  3F2C A;  2EIF A;  4DKA C;  4NXM L;  4BXX G;  1X3F A;  3JAM c;  2VQF Q;  1X55 A;  3HOY G;  2E2H H;  3GTQ H;  4GN5 A;  1VQE A;  4DR3 Q;  3T1Y L;  4YHH Q;  3H15 A;  3F2D A;  3CPF A;  3TEH B;  2N78 A;  3CCU A;  3TRZ A;  2ZM6 L;  2Y0S E;  2HT1 A;  1VS0 A;  5E7N A;  2IHE A;  3K8A A;  1Y1V G;  1QUQ A;  2CWP A;  2GVB A;  4IFD I;  2D62 A;  4IOA A;  4POF A;  1GD7 A;  3ULL A;  3CPW A;  2YTV A;  4PZ7 A;  4J15 A;  2JQO A;  1CUK A;  1X65 A;  1KRT A;  5AJ3 Q;  3A5U A;  1XNQ L;  2WB1 G;  4OXP A;  1VQM A;  1KRS A;  2PI2 E;  1Q7Y C;  4IO9 A;  3D31 A;  1BBW A;  3F8T A;  1EOV A;  3BU2 A;  3NEL A;  4UPA A;  3CCS A;  2Z0S A;  3HKZ E;  1I6H H;  2UXB Q;  4QGU A;  3CCE A;  4P71 A;  4TVA B;  1VQO A;  5IY0 A;  4R1J A;  2UXB L;  1IXR A;  4R4Q A;  3RNU A;  4BBS G;  4LF4 Q;  2AWO A;  3CCQ A;  3S15 H;  3PGZ A;  1GM5 A;  4JBJ A;  1N32 Q;  4EQ5 A;  1X9N A;  4GN4 B;  4JI3 Q;  4NXN Q;  3CW2 C;  5H1S E;  2CWA A;  3KOJ A;  4LUV A;  1V43 A;  5C0X G;  5M3F H;  3MXN B;  4DUY L;  4DUZ L;  3AEV A;  1EIF A;  3I4M H;  1KD1 C;  4JCV E;  4AYB E;  1HZC A;  2MQH A;  2XGT A;  4LUZ A;  3K81 C;  4IPG A;  5JEA J;  4DK6 C;  4A3M H;  3W1B A;  3JAM i;  2F4V L;  1NY4 A;  1QZG A;  1L1O B;  4QQB X;  4A3K G;  2F4V Q;  3HOV G;  4Y52 H;  5IE8 A;  2K52 A;  4GNX B;  4A3I H;  4KHP Q;  5HY6 A;  1OXV A;  1P8L A;  2WAQ E;  1S72 A;  1KIX A;  1W3S A;  1R9T H;  1E1T A;  4L5Q A;  4IJL A;  1PV4 A;  4IPC A;  1C0A A;  4JBM A;  3KF6 B;  5GAH C;  3UDX A;  2NVQ H;  1G29 1;  2JEB I;  4JI2 L;  2OQK A;  3I2Z A;  1EYG A;  2DUD A;  3AFP A;  4IJH A;  1HNX Q;  3W5O A;  3G6E A;  4GOP A;  2I0Q A;  3I55 A;  3KFU A;  2R92 H;  2ASB A;  2WFW A;  2UUC L;  2Q2I A;  3WWV A;  5ELN A;  2UUC Q;  5FJ8 G;  3CMA A;  4TQU S;  3U4Z A;  4DV7 L;  1Y1W H;  1CKN A;  2NVX H;  4DV7 Q;  1VQ5 A;  5JJI A;  3M3Y H;  3J80 i;  4BA1 I;  2OTJ A;  3STB D;  3CXC A;  1K9M C;  5IYD H;  1LTL A;  5HGQ A;  1IBM Q;  2Y0S G;  4DPG A;  1ASZ A;  5BR8 L;  1O7I A;  4DR2 Q;  2VY3 A;  3PO2 H;  2JA7 G;  3S2D H;  5JJK A;  3CCM A;  3CF5 A;  1GO3 E;  1PH3 A;  2OTL A;  4GS3 A;  1HZ9 A;  5C4J H;  3CC2 A;  3HOW H;  4LFB L;  3H0G G;  2VQE Q;  3U58 A;  5K36 G;  3E9I A;  5GAG C;  4JV5 Q;  2JJQ A;  5M3F G;  1JJC B;  1XPU A;  2HQL A;  1XMO Q;  4GLV B;  5GRO A;  2QEX A;  3I7F A;  1VQ8 A;  1B70 B;  2JEA I;  3GD7 A;  2R7Z H;  3IRB A;  2EXD A;  4KHZ A;  4O2D A;  3W1G A;  1YHB A;  2H5X A;  4P75 A;  3AYH B;  4BXX H;  4C2M H;  1MKH A;  3HKS A;  2E2I H;  3I56 A;  1SLJ A;  4X62 L;  1HNZ Q;  4A3B H;  1I94 L;  4DR7 L;  4DV6 L;  1HZA A;  1TWH H;  4C3H H;  4IOC A;  1AE2 A;  1BVS A;  1HJP A;  4L5S A;  1HZB A;  3KYH C;  3OW2 A;  4H02 A;  4JI4 Q;  1XPR A;  1EUJ A;  4AQY Q;  4X6A H;  1H95 A;  4JI1 Q;  5M5X H;  4A3I G;  2PQA B;  4OWX B;  3TQY A;  4A3D G;  2UUA L;  1VQD A;  1Q82 C;  2UUA Q;  1E24 A;  1A0I A;  2Q2U A;  2UUB Q;  1JT8 A;  3S16 H;  3B6Y A;  4A75 A;  3PV0 A;  3T1Y Q;  2K14 A;  1UE6 A;  1X6O A;  3K7U C;  1PHJ A;  1QZH A;  3E9H A;  4GN3 B;  1A62 A;  1K83 H;  2UXC L;  4WJ4 A;  1PFS A;  1IYJ B;  3BZK A;  4OX9 Q;  4UY8 C;  1G51 A;  1X54 A;  3GTM H;  3RLO A;  1KAW A;  4BBR G;  1OXS C;  1X3G A;  1N33 L;  2ID0 A;  1Q46 A;  2ZJQ A;  1HR0 L;  3HOU H;  3J7A 5;  1EQQ A;  2R7Z G;  3M4P A;  2IT1 A;  4LF9 L;  4IPH A;  1TXY A;  2YYZ A;  3HKZ G;  1MJE A;  1HH2 P;  4YHH L;  4OO1 G;  3L2P A;  1L1O A;  1WOC A;  3U50 C;  1PA6 A;  4JI3 L;  3H0G H;  1PH7 A;  5J3B A;  1Y1V H;  4HIM A;  1V9P A;  3FKI G;  2XTI A;  2F52 A;  4YWM A;  3T1H Q;  1C7Y A;  3T1H L;  1X56 A;  2JA6 H;  4K0K Q;  1QVF A;  3S24 A;  4QJF A;  2R7D A;  3STB C;  2IHF A;  5AJ3 L;  3M85 A;  2DGY A;  3M4Q A;  3TS0 A;  4BY7 G;  3I4O A;  1N36 L;  4BBS H;  2JA5 G;  1J5E Q;  3RN5 A;  5IP7 G;  4A3F H;  1J5E L;  3ULP A;  1JB7 A;  1I5F A;  1VQ9 A;  4HIO A;  1N32 L;  4LF6 L;  2LXK A;  3K80 C;  4JI8 L;  4BY1 H;  1LUZ A;  4NXN L;  2JA8 G;  4R4T A;  1XTD A;  1Q81 C;  2BH2 A;  3PO3 H;  2B29 A;  3S17 H;  2A1A A;  2WP8 J;  1FJG L;  4PZ6 A;  1FVI A;  4BBR H;  1E1O A;  1QVG A;  2OCE A;  2RCN A;  4JI0 Q;  3BJU A;  3DM3 A;  4BA2 I;  4LF7 L;  2N3S A;  4HJA A;  4LF7 Q;  4KI0 A;  4ALP A;  4GNX A;  4B3R Q;  3GTK H;  1EFW A;  1IBM L;  1J6Q A;  4XTC S;  4B3T L;  4DR2 L;  4LFA L;  2B3G A;  1YVC A;  3PCO B;  2MNA A;  2VUM G;  1SRO A;  4X65 L;  3A0J A;  1G6P A;  1EIY B;  4DR4 Q;  3L7Z C;  1A8V A;  1NTG A;  1UE7 A;  3FP9 A;  3G48 A;  4JI6 Q;  4KLK A;  3ER0 A;  4LF5 Q;  2R92 G;  3I4M G;  1X3E A;  4IFD J;  5FJ8 H;  2VS1 A;  1VQG A;  2K50 A;  5C0X J;  1Y1W G;  1VQ7 A;  4JC0 A;  4NXM Q;  1U0L A;  3KJO A;  2VW9 A;  4LF8 L;  1SMX A;  4UP8 A;  2PQA A;  4YY3 Q;  3CCV A;  5LMN W;  2YTY A;  1PH6 A;  1HR0 W;  3J7Z C;  2JA7 H;  4LUO A;  4YY3 L;  4NPS A;  3CD6 A;  3FKI H;  3PUY A;  1YI2 A;  4JI7 L;  3PF4 A;  3M4O H;  3MEF A;  2YV5 A;  4L5R C;  2JA6 G;  1SE8 A;  1QUQ B;  4L5T A;  1UE5 A;  2AHO B;  4DK3 C;  3KJP A;  5C0X I;  4A3M G;  1JJ2 A;  1FL0 A;  4JV5 L;  1Z9F A;  3L0O A;  3RN2 A;  4A3K H;  4DV2 Q;  4A3L H;  2ZTC A;  1L0W A;  4X64 Q;  1XNQ Q;  3K0X A;  4AIM A;  1VQB A;  3KF6 A;  2RHQ B;  3KLW A;  5JEA G;  5IYC H;  1ASY A;  3EIV A;  3PUZ A;  1YHQ A;  3EN2 A;  1N34 Q;  5LMU Q;  1VQF A;  2RHS B;  2D0P A;  1D8L A;  4OWT B;  1PH5 A;  1XNR L;  2R93 H;  4BY1 G;  4DV1 Q;  1M90 C;  1E3P A;  3FHW A;  4DV1 L;  1IBL Q;  1IZ6 A;  1Q8K A;  1I94 Q;  2VL6 A;  3E0E A;  4A3E G;  2NZH A;  2E5L L;  1SFO H;  4DR7 Q;  4GKK L;  4IFD G;  1YEZ A;  3PF5 A;  4A3G H;  5IP9 H;  3J81 i;  4IPD A;  2E2J H;  2Z6K A;  1N33 Q;  4JYA L;  5IYB G;  1BKB A;  3A74 A;  2A8V A;  5LMN Q;  4JYA Q;  2KHI A;  1HR0 Q;  2FXQ A;  4JI1 L;  2UXD L;  5LMN L;  1T9H A;  2EQS A;  1I50 H;  1PH4 A;  3GTG H;  5IYC G;  1VQA A;  1K0R A;  2MO1 A;  1CKN B;  2BH8 A;  3AFQ A;  5IYD G;  1K8A C;  4DV3 Q;  1YJW A;  3S1N H;  2I5L X;  1D7Q A;  3CC4 A;  3RZO H;  2NVT H;  3J81 j; 
#chains in the Genus database with same CATH topology
 2VUM B;  1TR5 A;  4DV5 L;  1U4L A;  2R92 B;  1KLU D;  4OON A;  3NP8 A;  1PYB A;  5NUC A;  2L15 A;  2K5H A;  1PZK D;  4PMW A;  1YZ6 A;  3DXJ C;  4DF7 A;  1SYG A;  3F2B A;  5ISR A;  3P7J A;  1PFB A;  4DR6 L;  1EWI A;  2LXJ A;  1K73 C;  5GAE C;  1WFQ A;  4G57 A;  4IUV A;  5IGF A;  4HJ5 A;  3GTL B;  4A93 B;  1IYU A;  3GO5 A;  2B2Y C;  5I9P A;  4CHT B;  5IOC A;  3HOW G;  5KNB A;  1Z6H A;  1Y8P B;  2OF1 A;  3D4D A;  1N9W A;  3S1M B;  4HED A;  3BG3 A;  3CQZ H;  4LAA A;  3NXW A;  3HOV H;  1A2U A;  5C4X H;  3TP7 A;  3QWN A;  4ZUI A;  4LFC L;  1GHK A;  1GHJ A;  1XX8 A;  5IP7 H;  3CME A;  3FRP B;  2NVX B;  4POG A;  5JAV A;  2NN6 G;  2NN6 I;  1PZJ D;  5FO8 B;  5I6W A;  4DV6 Q;  4JG2 A;  1K3B C;  3E0J A;  2V1C C;  1EFI D;  1S5D D;  3I4L A;  1I6V C;  2R6G A;  1NR4 A;  2WB1 E;  5COY A;  3Q24 A;  1CI3 M;  4A3L G;  1F2L A;  4JI5 Q;  4KV6 A;  4JW0 A;  5C44 H;  2E75 C;  3FPP A;  5FLX E;  4LFA Q;  1JC7 A;  2KCM A;  1PYW D;  1YJN A;  4MNO A;  2F03 A;  1RL2 A;  1T5X D;  4MN3 A;  2ZTE A;  1AEX A;  2E76 C;  2AQ3 B;  4R4O A;  1WTV A;  3HOX H;  4LF5 L;  1VQP A;  1H9K A;  4IUT A;  5IYB H;  1XYI A;  5HGT A;  2I5M X;  4A3C H;  1TWC B;  3UE0 A;  3ITP A;  1TS5 A;  2UU9 L;  3OPO A;  4QY7 A;  2OQ0 A;  2EYP A;  1QIL A;  2A19 A;  3PIO 3;  4F8M A;  2F1M A;  2KBN A;  5JOB A;  2VQF L;  1VQI A;  1WCM B;  1JOK A;  3SK8 A;  1EY9 A;  2KOL A;  4QIW E;  2CCZ A;  2E5L Q;  4X66 L;  2K75 A;  2VUM H;  2IL8 A;  1MIU A;  2AQ2 B;  4K0K L;  5M5W H;  5CV4 A;  4PZ8 A;  1BCP F;  1NE3 A;  4ME3 A;  1U4R A;  1HUN A;  3HOY H;  1Q1B A;  1M1K C;  5I2Y A;  2QEJ C;  1ZEQ X;  4K5V A;  1CSP A;  4RAU C;  4PQX A;  4A3F B;  3A8J E;  4CDD C;  1Q90 A;  1SSO A;  3K7A B;  4I7A A;  2EY6 A;  4A3G G;  2JN4 A;  5BN5 A;  3UDF A;  1TWG H;  2WAC A;  4L63 B;  3DMU A;  4RGM A;  3QOL A;  2XN9 C;  1C9O A;  1NMG A;  3N52 A;  1CZW A;  2IPK D;  3OMG A;  3D4R A;  4O0A A;  1HFN A;  1NCV A;  1E7Z A;  2ATW A;  4IUQ A;  3S14 H;  1L2F A;  1JE5 A;  2NVY H;  5IGG A;  3GTK B;  3NE5 B;  4MIU A;  4R4C A;  3KDF B;  3F1Z A;  4RA8 A;  3VYU A;  1XJV A;  1A3V A;  2RSN A;  4DR4 L;  4KY7 A;  4IFD H;  4DNI A;  1IBK Q;  3G71 A;  1H9R A;  1VQH A;  2LKV A;  4BY7 H;  1X32 A;  5CGK A;  1HA6 A;  1BBU A;  3OYY A;  5E3F A;  1NAP A;  1AH9 A;  4BBS B;  2E2J B;  2VNU D;  1LTG D;  2E8G A;  1MHW C;  4LF6 Q;  2H1E A;  4CBV A;  4MTK A;  4A3J G;  3JC6 6;  2MO0 A;  1TWA B;  2B8F A;  1FJG Q;  1WTP A;  5JVH 3;  2B39 A;  3A7A B;  1LV9 A;  3NWS A;  4OHJ A;  5ELD A;  2TSS A;  2HHH L;  1B8A A;  2UUB L;  2L55 A;  4RGN A;  5IWA Q;  1WYD A;  3OTO Q;  1WCM H;  4L6T B;  1QB5 D;  1PH9 A;  5JJL A;  5C3E H;  3SK6 A;  1LAC A;  1JOR A;  1HA5 A;  4DFA A;  5KIX A;  1VQJ A;  4OX9 L;  4X62 Q;  2WB1 B;  1EQT A;  4P74 A;  2QDL A;  1MSH A;  2N8N A;  2Z9H A;  3RMH A;  1XTC D;  1LTR D;  3RLN A;  3SDZ A;  2F0H A;  1ZYR C;  3F2C A;  3GTM B;  2Q8I B;  5I6Y A;  1Z7T A;  3D8G A;  1CA6 A;  2VQF Q;  1X55 A;  3GTQ H;  3PO2 B;  1EOT A;  1K8M A;  1VQE A;  4DR3 Q;  4LJZ C;  4DXG A;  3CCU A;  3VYR A;  3H0G B;  5E7N A;  2F4I A;  4IFD I;  3DEP A;  1GD7 A;  1MSG A;  3CPW A;  1QNU A;  2BDO A;  1ICW A;  2NBF A;  2WB1 G;  4ZQ3 A;  1EOV A;  3NEL A;  1I6H H;  4QGU A;  3CCE A;  1IXR A;  5ELB A;  3CCQ A;  2Q8T A;  3V05 A;  1N32 Q;  2X6G A;  4GN4 B;  2F0E A;  2CWA A;  3KOJ A;  1F9Q A;  3I4M H;  4DUY L;  1EIF A;  1D5M C;  1HZC A;  2XGT A;  3KK7 A;  3LX0 A;  5JVG 3;  4IPG A;  1BOS A;  3W1B A;  3JAM i;  2F4V L;  1QZG A;  1L1O B;  1ET6 A;  4A3K G;  1EWH A;  4Y52 H;  5IE8 A;  4A3I H;  3S2D B;  1QNK A;  1OXV A;  1P8L A;  1S72 A;  1B9N A;  1KIX A;  2GA4 B;  1E1T A;  4L5Q A;  1TS3 A;  1HFG A;  1M8A A;  1V8Q A;  1C0A A;  1DON A;  3UDX A;  2BOS A;  1G29 1;  2NVQ H;  1MGS A;  3AFP A;  1HNX Q;  3W5O A;  2R92 H;  3D4W A;  2Q2I A;  4OEM B;  3WWV A;  4ZYS A;  1ILQ A;  3OHX C;  4DV7 L;  1G2T A;  2NVQ B;  1Y1W H;  5IGD A;  1TKW B;  1Y8O B;  2K7V A;  1IBM Q;  5C4Z A;  5A2Q L;  4DR2 Q;  2VY3 A;  3HOW B;  3CCM A;  1JOO A;  2SNM A;  2OTL A;  3GTG B;  3CC2 A;  5CC4 A;  3E9I A;  2F0G A;  2HQL A;  2QEX A;  1VQ8 A;  1BQQ T;  1CT1 D;  2EXD A;  4O2D A;  2F0D A;  3W1G A;  2H5X A;  4H0L C;  4P75 A;  2JA5 B;  1F2Z A;  4C2M H;  1MKH A;  2E2I H;  1I6H B;  2A6E C;  5EBC A;  1I94 L;  4DR7 L;  4DV6 L;  4J6H A;  4HR7 B;  1CQV A;  1KNA A;  1AE2 A;  3OW7 A;  4L5S A;  1HZB A;  3KYH C;  2LMC B;  1BCP B;  1A2T A;  4AQY Q;  4JI1 Q;  2D5D A;  5D65 A;  1HXY D;  3N6R A;  4OWX B;  1LT4 D;  5C4X B;  2NUC A;  3A8K E;  2UUA Q;  4ZK9 B;  3FKI B;  1A0I A;  3GP7 A;  3PV0 A;  5BN3 A;  2K14 A;  1X6O A;  1PHJ A;  1I4R A;  4Q0F A;  2UXC L;  4WJ4 A;  1LT6 D;  1IYJ B;  4UY8 C;  5EGT A;  3GTM H;  1STN A;  5ELC A;  4BBR G;  4CGY B;  5DM6 3;  3ZYY X;  1WTR A;  4MHE A;  1PTO D;  1N33 L;  3M3Y B;  2EE1 A;  3FVQ A;  2NTS A;  2R61 A;  4CDC C;  3BYY B;  2EYJ A;  2RKS A;  2R7Z G;  4LF9 L;  4IPH A;  1MJE A;  1L0X B;  1S5E D;  2NWG A;  4NKL A;  1QCB D;  4IUP A;  2R3Z A;  2QIL A;  3IAY A;  3FKI G;  3OWE B;  2F52 A;  4YWM A;  2H4O A;  2PZU A;  3S1N B;  3S24 A;  4CDF C;  3M4O B;  5FOB B;  5AJ3 L;  3M85 A;  3TS0 A;  3KLS X;  1N36 L;  1EY0 A;  1HQM C;  4A3G B;  1I4Q A;  1I5F A;  5AFW A;  2LXK A;  4G4K A;  4JI8 L;  4NXN L;  1GJX A;  1XTD A;  2NYZ D;  2A1A A;  2WP8 J;  1A3U A;  4BBR H;  3BS1 A;  5EJW A;  1E1O A;  2F0I A;  3BZD B;  3HP3 A;  1G8Z D;  2HD3 A;  4JI0 Q;  2WKD A;  5JPN C;  3NQT A;  2JXM B;  4B3R Q;  2F0Q A;  2K01 A;  1V1P A;  3MHB A;  2HDL A;  3O13 A;  4LFA L;  2MNA A;  1QOH A;  3PCO B;  1SRO A;  4X65 L;  2O2L D;  4HMI A;  4DR4 Q;  1DOL A;  1NTG A;  3FP9 A;  1E0B A;  1A15 A;  1ILP A;  1IYV A;  4IFD J;  3R2I A;  1VQG A;  1W6J A;  1AW7 A;  5FK9 C;  5LL6 X;  2RVL A;  4JC0 A;  1U0L A;  4LF8 L;  4YY3 Q;  4XQJ A;  4K6D A;  3J7Z C;  4NPS A;  2XRS D;  1SNO A;  4JI7 L;  2JA6 G;  2EXZ A;  4A3D B;  3J80 E;  1TU2 B;  1JE4 A;  1BO0 A;  3NQI A;  4A3K H;  4DV2 Q;  3LWU A;  3SVM A;  1VQB A;  2K04 A;  3MZ5 A;  5IYC H;  4DXF A;  1YHQ A;  1WTW A;  2EY2 A;  1VQF A;  1DD2 A;  2D0P A;  3UI2 A;  4DV1 Q;  3FHW A;  1IBL Q;  1HCZ A;  3E0E A;  3W2D A;  2SNS A;  4IFD G;  4LMQ D;  3PF5 A;  1N33 Q;  4J8Q A;  1YNJ D;  1BKB A;  2X6L A;  3A74 A;  5LMN Q;  2ZXR A;  4OIK A;  1VQA A;  2CVR A;  4I65 A;  4WFN 3;  1K83 B;  3S1R B;  2MO1 A;  4O1N A;  1YJW A;  3S1N H;  2I5L X;  1FNV A;  1DZ1 A;  1DCZ A;  1JB3 A;  3J81 j;  3F2U A;  1SN8 A;  3TSS A;  2JA8 H;  4V0B A;  4EQP A;  5J22 A;  3WDN A;  1CHP D;  1X3Q A;  3UDI A;  3J80 c;  2AUK A;  1XPO A;  4IAL A;  4A3C G;  4B9X A;  3A56 A;  3RLF A;  2N49 A;  2F3W A;  4WRD A;  3RZD H;  4H44 C;  3S2H B;  1TS4 A;  3J81 c;  2NN6 H;  3ONA B;  2QW7 A;  4LFB Q;  1RTN A;  1W2B A;  1DOK A;  3S1M H;  3E5S A;  3Q8D A;  2CQA A;  1CTM A;  2F0P A;  1HNW L;  1EY4 A;  5G3L D;  4V19 0;  4JOI A;  1OXX K;  3ZJY C;  2HHH Q;  1K0S A;  2MFI A;  3GTL H;  4B3R L;  2L1B A;  4YIJ A;  3HOU G;  1BCP D;  4XT1 B;  5M3M B;  1XMQ L;  4KTA A;  4GKJ Q;  4XIG S;  1LYL A;  2K4K A;  4DAM A;  4FF4 A;  5HUR A;  1CKO A;  3I72 A;  1KAB A;  1GKH A;  1Y8N B;  4GOP B;  1OTC A;  4P72 A;  3SK5 A;  3G7L A;  2Z4I A;  1VQN A;  4JI5 L;  2B2T A;  4A3D H;  1OXU A;  1LTS D;  3PSI A;  3ULJ A;  1TWF B;  5JEA H;  1AE3 A;  4UP9 A;  4DR3 L;  4PG3 A;  2CFM A;  4B3T Q;  2ICE C;  1WJJ A;  4RG1 A;  1RIP A;  2JK8 A;  1KC8 C;  1CHQ D;  1BDO A;  2ZT9 C;  5M3M G;  4JI6 L;  3PO3 G;  1YHA A;  1TWF H;  5CBE E;  5FLX L;  5GAD C;  2ZJP A;  4JBK A;  3GTP B;  3IL8 A;  5L37 A;  2XRQ D;  1IL2 A;  4X66 Q;  1C8C A;  4GKK Q;  3HKZ B;  4A93 G;  4GLA C;  3H94 A;  2ZM6 Q;  1EEI D;  2EYO A;  3PUW A;  1KHI A;  4CKB A;  1Y14 B;  2EY5 A;  4N8F A;  5C4X G;  1U5K A;  4XXE A;  4RMF A;  4YCU A;  2B2V A;  4AYB B;  2CQO A;  4MZ9 A;  3G4S A;  1R4P B;  3NBH B;  1PZI D;  3M7N A;  4KKS A;  1KL9 A;  3GTJ H;  5T1G A;  1O78 A;  3MWY W;  1PYS B;  5A35 A;  3KF8 B;  2R93 B;  4DK0 A;  2WV6 D;  4GLX A;  3J7A F;  3SHL A;  2GVA A;  2UXD Q;  1STE A;  1HUM A;  1NMF A;  1N8R C;  1VMC A;  4F88 A;  1JJG A;  2B63 H;  4NMZ A;  2C5C A;  4DV3 L;  3EJI A;  1JMC A;  2Z6K C;  1Q12 A;  5IT9 c;  2Q2T A;  4GOP C;  5C5L A;  4ZLT F;  1Q86 C;  2NVT B;  3ICE A;  1J8I A;  3FEW X;  1QVC A;  3A54 A;  3S1R H;  1GVP A;  2A69 C;  3VR2 A;  3BVZ A;  2R93 G;  2RA4 A;  1CM9 A;  4DV4 L;  1WCM G;  3C3L A;  1YIT A;  4HN7 A;  1PFN A;  3HGB A;  4PV1 C;  2K5V A;  1IL8 A;  2M9V A;  4FDB A;  3CRL C;  2A6H D;  2WII B;  4JI0 L;  1B44 D;  1FGU A;  1XMO L;  3SR1 A;  2OWO A;  1PVO A;  1ET9 A;  1PH2 A;  2SDF A;  1XNR Q;  4QUF A;  3U4V A;  2ALY B;  2KQ3 A;  1YNJ C;  3S17 B;  3TME A;  4Y7N B;  2JA5 H;  1FNU A;  3VA5 A;  4C3I B;  1O7L A;  3NEM A;  3GTJ B;  5D3I B;  4JI4 L;  1GXD C;  1JR0 D;  4BXX G;  3EQL C;  3VR5 A;  3T51 B;  3R93 A;  1NUC A;  3Q22 A;  4GN5 A;  2EDG A;  3T1Y L;  2JA6 B;  4PMC A;  3TEH B;  3Q0A A;  1ONL A;  4FF2 A;  2PO4 A;  3L9A X;  1Y1V G;  1QUQ A;  2CWP A;  4IOA A;  2D62 A;  5EKI A;  4POF A;  3ULL A;  4KKT A;  1LO5 D;  4KN7 C;  4ZKC B;  1LTA D;  3BDO A;  1X65 A;  4C3H B;  5AJ3 Q;  2HCI A;  5KEE A;  3D31 A;  3F8T A;  3BU2 A;  3R3O A;  2J4X A;  3FDT A;  5EBD A;  2Z0S A;  3HKZ E;  3CCS A;  4JK1 C;  4TVA B;  1U4M A;  5CYU A;  3A55 A;  4R4Q A;  4BBS G;  4LF4 Q;  1GM5 A;  4C1N K;  2EYF A;  1GUO A;  4EQ5 A;  4RWS C;  4JI3 Q;  4NXN Q;  5H1S E;  4DUZ L;  1V43 A;  4L8J A;  4AYB E;  1KD1 C;  4RCO A;  2KHS A;  4A3M H;  1UUP A;  5JEA J;  4DK6 C;  1NY4 A;  2HQE A;  3NTK A;  4CJ0 B;  1KDC A;  3WOF A;  5HY6 A;  3CHB D;  2XNA C;  2WAQ E;  1EIG A;  3DM1 A;  4RKB A;  3LNN A;  5GAH C;  4C3H G;  1SE4 A;  3I2Z A;  1DOM A;  2AUJ D;  4IJH A;  1GUN A;  3G6E A;  4GOP A;  2I0Q A;  1LTT D;  3I55 A;  2PZT A;  2IX3 A;  2Z6B A;  3K57 A;  3CU7 A;  2B2W A;  1BNZ A;  4EQO A;  4DV7 Q;  1SYE A;  1UNS A;  3CXC A;  1LTL A;  4DAY A;  2Y0S G;  4A3I B;  3S2D H;  2JA7 G;  1ML0 D;  4EGV A;  3CF5 A;  1PH3 A;  1SYF A;  1O80 A;  5C4J H;  3H0G G;  5GAG C;  3VYT A;  5C0X H;  4K8J A;  4UHV A;  2L12 A;  1HRJ A;  4KHZ A;  1II3 A;  3HKS A;  1SYB A;  4RHR A;  3G6J B;  1HNZ Q;  4A3B H;  2JA8 B;  1HZA A;  1TWH H;  2C9O A;  1AFP A;  4IOC A;  1HJP A;  2L9H A;  2BE5 C;  4H02 A;  2RBM A;  1B53 A;  1I4X A;  5M5X H;  1AZP A;  4A3I G;  2UUA L;  2VB3 X;  1Q82 C;  1V1O A;  2J0T D;  2UUB Q;  2Q2U A;  3B6Y A;  3T1Y Q;  3K7U C;  1BBX C;  1QZH A;  1K83 H;  1EWC A;  2I07 B;  1G51 A;  2MPM A;  3DEO A;  1K28 A;  1KAW A;  4QF4 A;  4FF1 A;  1WTQ A;  1B1Z A;  2A6E D;  4DNR B;  1SAP A;  3CRK C;  2EOT A;  5FO7 B;  1Y1W B;  3HOU H;  3NPP A;  5IGE A;  3M4P A;  2EYH A;  3HKZ G;  1HH2 P;  5C3W A;  4OO1 G;  3U50 C;  1WOC A;  5K36 H;  4HIM A;  5EPJ A;  3BVG A;  2Q8R E;  2JA6 H;  2L0C A;  1QVF A;  3R2T A;  3C46 A;  1IHZ A;  2R7D A;  3R8B A;  3T16 A;  5K5P A;  5F2D A;  2VXW A;  3ERQ A;  3NTI A;  4IQZ A;  1ICF B;  2F0F A;  1TVX A;  4BBS H;  2JA5 G;  1J5E Q;  1IKL A;  5IP7 G;  3I4M B;  2DY8 A;  1W6K A;  4X3U A;  4DGZ A;  1DJR D;  3K80 C;  4BY1 H;  5J1Z A;  2EJM A;  1Q81 C;  3S17 H;  4HSV A;  1HPC A;  4PZ6 A;  2OCE A;  4M1U B;  5M5W B;  2MGS A;  2WIN B;  3DM3 A;  3I3C A;  2ZXP A;  4LF7 L;  4U67 3;  2N3S A;  4X3T A;  4KI0 A;  2N55 A;  4ID6 A;  3GTK H;  1EFW A;  1J6Q A;  1RKN A;  4XTC S;  1SNM A;  3C1E A;  3VR3 A;  3I73 A;  1ROD A;  1G6P A;  4OGQ C;  4ZUJ A;  4OO1 H;  4DNT B;  1A8V A;  1UE7 A;  4BBR B;  3I4M G;  3H09 A;  1X3E A;  2VS1 A;  5IOD A;  4KJN A;  5C0X J;  1RCV D;  2D9U A;  4NXM Q;  3J81 E;  1KNE A;  1HQR D;  2B2U A;  3KJO A;  1BCP C;  4UP8 A;  2PQA A;  3QO2 A;  4ULL A;  1HR0 W;  2YTY A;  3HOZ G;  1B50 A;  2EJF C;  1YI2 A;  4L5R C;  3H3V I;  5CV9 A;  1ENA A;  1QUQ B;  4DK3 C;  1QWY A;  4A3M G;  1JJ2 A;  1FL0 A;  3TBI B;  4FF3 A;  1EIH A;  1E2V A;  1XNQ Q;  1ZKO A;  3KF6 A;  4M8A A;  3MA2 B;  2BE5 D;  2RHQ B;  4N9T A;  3EIV A;  1S5B D;  2Z8L A;  1B4O A;  2OT2 A;  1CFM A;  1D8L A;  2DJG C;  3MVV A;  1M90 C;  4DV1 L;  5KYL A;  1Q8K A;  1I94 Q;  2E5L L;  4DR7 Q;  2F0S A;  1FGB D;  1DYQ A;  4X3K A;  2E2J H;  4JYA L;  2A8V A;  2KHI A;  1HHV A;  2FXQ A;  3P75 A;  3MXP A;  5IYC G;  1B2T A;  4FXD A;  3DWP A;  1H9J A;  4QIW B;  3AFQ A;  4IZ8 A;  2EZV A;  3H91 A;  4OIJ A;  2OXP A;  2NVT H;  1S5F D;  1Y1V B;  4RH6 A;  3S9W A;  3HOZ H;  1VQ6 A;  3I4N B;  4B3M Q;  2MJ8 A;  2IX1 A;  2L4N A;  2PMZ B;  2E2I B;  1SBB B;  4ZRZ A;  4K8I A;  1NBW A;  4XQQ A;  4P2C B;  2DN8 A;  1VCI A;  4KY6 A;  4A3B B;  3RUZ A;  4NP5 A;  1LLR D;  4C2M B;  1TWG B;  4HIK A;  4LF9 Q;  4DR1 Q;  4EQN A;  3OWF A;  1VQ9 A;  2QDB A;  3K7A H;  2G5D A;  2PNR C;  3QG1 A;  1I50 B;  1O7Z A;  4MTN A;  3IFD A;  4UP7 A;  4APV A;  2KHJ A;  5KYI A;  3OMC A;  1LAB A;  2LFN A;  4FXG C;  3TP8 A;  4HID A;  5M3F B;  2MP1 A;  1SRU A;  3VDY A;  2KEN A;  1SR3 A;  2ES2 A;  3MXG A;  3OIP A;  3DLL A;  4WOR A;  1N36 Q;  3AQQ A;  4JOI C;  4KD3 A;  4GKJ L;  1S3O A;  3LGJ A;  1XMQ Q;  2QGQ A;  1KTK A;  3SEB A;  4R8N A;  1WI5 A;  4A3B G;  1V1Q A;  4JI2 Q;  3DUZ A;  3KF8 A;  3RR5 A;  3PIP 3;  2F0M A;  4DV0 Q;  1STB A;  4C1N I;  2GN5 A;  2KCC A;  4HJ9 A;  5ELE A;  2K03 A;  4A3J B;  2RF4 A;  4C3J H;  4EX5 A;  2O5I C;  3SE0 A;  1CKM A;  3RZO B;  5E4X A;  2LSS A;  2KCT A;  3K5M A;  2JA7 B;  3J81 L;  2B63 G;  1H95 A;  5BR8 Q;  4LW1 A;  1LT5 D;  3DWA A;  3S2H H;  2IX0 A;  5C44 B;  2WAQ G;  1VQL A;  2PQE A;  4G7H C;  2K1B A;  1D5X C;  3D6W A;  2KUM A;  3NBI A;  3MXU A;  5DLQ E;  4H7B A;  1B7Y B;  4HMJ A;  1N34 L;  1F9S A;  2F0V A;  1I3Q H;  1EY7 A;  1B3Q A;  1LTI D;  4LF4 L;  1F2M A;  2BA0 A;  4LNQ A;  3I4N H;  3PO2 G;  4DUZ Q;  5M3M H;  3PUX A;  3SK4 A;  2I5H A;  1KXL A;  2X69 A;  2A6H C;  3S1Q H;  3T13 A;  2HIV A;  4KMU C;  4R4I A;  3IKJ A;  2IJ0 A;  2G9H D;  5TSS A;  1UAP A;  4YWK A;  1MJC A;  1VMP A;  2ENB A;  3GTQ B;  5C44 G;  5LMU L;  5FLM H;  1WD0 A;  3HZX A;  1STH A;  4KN4 C;  4P73 A;  4A3E H;  4B3M L;  4A93 H;  3FMC A;  4JI8 Q;  2F0T A;  2SEB D;  1EYC A;  2DJF C;  2QA4 A;  4DV5 Q;  2A69 D;  3RZD B;  1FD7 D;  1L1O C;  5FLX c;  4DUY Q;  4GZY C;  4DR5 L;  4C3I H;  3ERO A;  4DAY B;  5FKA C;  3K0Y A;  4Y7N H;  1L0Y B;  1Q3L A;  2A68 D;  3OSO A;  3FPU B;  3UE1 A;  1VDZ A;  1EYD A;  2VB2 X;  4X65 Q;  4QUC A;  1YNN C;  3C2P A;  1LTB D;  3NWT A;  1HNX L;  3BZC A;  1F9R A;  3NSW A;  1LM0 A;  4NB3 A;  3TP6 A;  1STG A;  4A76 A;  2PW5 A;  1IKM A;  1PH8 A;  2CKZ B;  4DV4 Q;  3JAM L;  3EBE A;  5CV6 A;  3AMU A;  1SFO B;  5G3L F;  4JI7 Q;  3L3O C;  2AMC B;  5IIF A;  1VQ4 A;  1SXT A;  2DY7 A;  3GQB A;  4E6I A;  3H3V C;  2B8G A;  1NNX A;  3GTO H;  1HNW Q;  3KDF A;  1ESR A;  2IY5 B;  4AYB G;  1YBY A;  5IT9 L;  3HS0 C;  3S14 B;  2SOB A;  1UE1 A;  2PNH A;  3PIP A;  1IBL L;  4BY1 B;  1Q1E A;  3SGI A;  2QF7 A;  1TY2 A;  1E22 A;  3K58 A;  5IP9 G;  4B3S Q;  1G6Z A;  5EAY A;  2NZ1 D;  3AB9 A;  4RGT A;  1YJ9 A;  2NZO A;  4AQY L;  3VR6 A;  2EIF A;  5A2Q E;  2RDH A;  4NXM L;  2F0N A;  1X3F A;  1LT3 D;  1V1P B;  3I90 A;  3PQI A;  2E2H H;  3HOY G;  1G2S A;  4F87 A;  3H15 A;  3F2D A;  2Z1C A;  5KND A;  4C3J B;  5LHY 1;  3TRZ A;  2RSO A;  2A5H A;  3K8A A;  3T56 B;  2GVB A;  1VF5 C;  1RF2 D;  2YTV A;  4PZ7 A;  5KGU A;  1CUK A;  1XNQ L;  2M00 A;  1KRS A;  3MC0 B;  1Q7Y C;  3VR4 A;  2HCC A;  4UPA A;  2UXB Q;  4XT3 B;  4R1J A;  1O7Y A;  2L11 A;  2AWO A;  4JBJ A;  2R7Z B;  3BDL A;  3ND8 A;  1X9N A;  2A74 C;  5M3F H;  3MXN B;  1A3T A;  2K5D A;  4DA2 A;  1NR2 A;  4TRD A;  4Z9C B;  4X3S A;  2LY7 A;  3QOJ A;  3HOV G;  3T53 B;  2K52 A;  4FVM A;  3S1Q B;  3E6Z X;  2K5W A;  4IJL A;  1PV4 A;  4IPC A;  3VYS A;  4ZKB B;  4JBM A;  2K28 A;  3HG9 A;  2JEB I;  3D3R A;  4J1M A;  2FMM A;  2MUY A;  1ZYR D;  2DUD A;  2XWB B;  1HTL D;  4C3I G;  1CZG A;  1HTP A;  2UUC L;  1EY5 A;  4HAE A;  5FJ8 G;  2FMC A;  1F2Y A;  4RKL A;  3U4Z A;  2IW3 A;  2EJG C;  5JJZ A;  2NB0 A;  4OEL B;  3M3Y H;  3J80 i;  4BA1 I;  5D14 A;  3STB D;  1K9M C;  4ME5 A;  3BYT B;  4DPG A;  1ASZ A;  3PO2 H;  1O7I A;  5C4J B;  3HOV B;  4XYO A;  1KLG D;  5K36 G;  1WTH A;  1WTX A;  4JV5 Q;  3C1F A;  5M3F G;  1MBY A;  5DNF A;  2F0L A;  1XPU A;  3I7F A;  1B70 B;  3GD7 A;  2R7Z H;  3IRB A;  4KJO A;  1YHB A;  3AYH B;  2F0O A;  3I56 A;  4X62 L;  3OOC A;  2XIW A;  4FXK C;  3HEJ A;  4K6L A;  3OW2 A;  4ODG A;  1TY0 A;  1XPR A;  1EY6 A;  1D1K A;  1EUJ A;  4X6A H;  4RGO S;  2PQA B;  3TQY A;  4A3D G;  3DWQ A;  4PNY A;  1I4H A;  3HRZ C;  1E24 A;  5DEH A;  1JT8 A;  3S16 H;  4A75 A;  5C4H A;  4I7Z C;  5IGC A;  4GN3 B;  1A62 A;  1PFS A;  2I46 A;  5EPK A;  3BZK A;  5M9O A;  3MTS A;  4BY7 B;  2F3V A;  5CV7 A;  2ID0 A;  1HR0 L;  3MFG A;  2FHT A;  1EQQ A;  1FR3 A;  1JWM D;  3BDC A;  1EQV A;  3NTH A;  1TXY A;  4YHH L;  5I2X A;  3URY A;  1PA6 A;  1GUW A;  1T5E A;  3H0G H;  2V4D A;  4IN3 A;  3T1H Q;  1V9P A;  2XTI A;  4A3K B;  3I70 A;  1X56 A;  4K0K Q;  4B08 A;  4S3S A;  2EYL A;  2IHF A;  4IUN A;  1WTO A;  4BY7 G;  3I4O A;  4ABN A;  3ND9 A;  1H9S A;  4A3F H;  1J5E L;  3ULP A;  5BN4 A;  1JB7 A;  3J7A V;  3D6C A;  4K2L A;  1H9M A;  1LUZ A;  2JA8 G;  2BH2 A;  5C3E B;  4H13 C;  4OL7 A;  4FP5 D;  1FVI A;  1QVG A;  3BJU A;  1XXG A;  4HJA A;  4LF7 Q;  4ALP A;  3E3X A;  1IBM L;  2OEO A;  4DR2 L;  5KNC A;  3Q6S A;  4N9P A;  1YVC A;  2VUM G;  1SE3 A;  1STY A;  2Z4H A;  5KRU A;  1EIY B;  1PRT B;  5CV5 A;  1QG7 A;  1FYC A;  2R92 G;  4LF5 Q;  1PDQ A;  1EYA A;  5FJ8 H;  2B2V C;  2K50 A;  4QCL A;  4DU9 A;  1PTO C;  3NHH A;  1Y1W G;  1VQ7 A;  2BCO A;  3NUC A;  1PRT F;  4K5W A;  5D3D A;  1SMX A;  3AU7 A;  1PH6 A;  1EU3 A;  2F0W A;  4DK1 A;  5LMN W;  3CD6 A;  4LUO A;  3V96 A;  2KVM A;  3PUY A;  4NW2 A;  3PF4 A;  3M4O H;  2CW0 D;  4PMB A;  5E1F A;  3M7G A;  1Z9F A;  3KBX A;  3MFY A;  2ZTC A;  4XQN A;  3K0X A;  4AIM A;  3EVQ A;  1TWH B;  2K6A A;  3KLW A;  4KD4 A;  5JEA G;  1ASY A;  3EN2 A;  5LMU Q;  2RHS B;  2R93 H;  4BY1 G;  3MEH A;  1E3P A;  1S4Z A;  1IZ6 A;  2NZH A;  4GKK L;  3GV6 A;  1YEZ A;  5C3X A;  3MXN A;  4IPD A;  1F9P A;  4JYA Q;  1HR0 Q;  1RHP A;  3JAM E;  1PLF A;  3GTG H;  3HOY B;  1KDA A;  1K0R A;  2KEE A;  2DNE A;  1K8A C;  4ILW A;  4C3J G;  1D7Q A;  3RZO H;  2BDN A;  4DN4 M;  4LK1 C;  4A3J H;  3HFZ B;  4K5X A;  2BA1 A;  4RFB A;  2NVY B;  3BVM A;  3P20 A;  1IBK L;  1KAA A;  4NDX A;  3Q23 A;  3CCJ A;  5GQO A;  3P1H A;  5M5Y H;  3QJY A;  3KBG A;  4YCV A;  1RDP D;  4C56 C;  1UEB A;  3PUV A;  4DR1 L;  1IW7 C;  1KQS A;  1ZXT A;  1YNX A;  1B9M A;  1CSQ A;  5ELO A;  1E2Z A;  1EU4 A;  1P16 A;  4JBW A;  3CKI B;  4A3M B;  3S16 B;  1D6E C;  4HTH A;  4A4I A;  1D2B A;  3OTO L;  4A3F G;  2K5N A;  4ZAI A;  1HNZ L;  1ENF A;  3CCL A;  4IUU A;  2PPB C;  3U9O A;  4DV0 L;  2D0O A;  4HSP A;  3TRE A;  1D1I A;  4B3S L;  2QKI C;  2VZA A;  2K05 A;  4YCW A;  5EPL A;  2RDG A;  4HCE A;  1TWC H;  2C35 B;  4LF8 Q;  2KCN A;  1NJI C;  1PMR A;  3HOX B;  2ZTD A;  3CQZ B;  1F77 A;  2KEC A;  1I4P A;  4F7X A;  4HJ7 A;  3M9B A;  1PH1 A;  3TS2 A;  2Q2H A;  1Z47 A;  2EVB A;  4JPB W;  3I4N G;  4QL5 A;  4R9W A;  1JOQ A;  4DV2 L;  2TMP A;  2E2D C;  2F3I A;  2JSO A;  1STA A;  2UU9 Q;  4K14 A;  4G7Z C;  1JCK B;  2YU9 H;  3D0F A;  3S15 B;  1VQK A;  1X3P A;  1Q8I A;  3X3M A;  1SNC A;  4HJ8 A;  5FLM G;  4FNF A;  1YIJ A;  4CKC A;  3HOX G;  1A63 A;  3CCR A;  4WJW A;  2ICI A;  1MD2 D;  3IFT A;  1GUS A;  2AWN A;  1K8G A;  1TWA H;  4X64 L;  1JWU D;  1CK1 A;  4KHV A;  1FNW A;  4AH6 A;  2QCP X;  2EY1 A;  5COR A;  3K59 A;  3H3V H;  2RQX A;  4CJ2 C;  2K32 A;  4LWC A;  1K3R A;  3PIO A;  4GNX C;  1XWE A;  2J7Z A;  4DR5 Q;  1VF7 A;  3M4Y A;  5EKL A;  3A5Z B;  2KJX A;  1JWS D;  1UWV A;  1WVL A;  1EQR A;  1SYD A;  1AN8 A;  3GDE A;  4KHP L;  2ZXO A;  5DM7 3;  4OO1 I;  3K6O A;  3OIQ A;  1E2W A;  2B63 B;  3QIA A;  2YTX A;  2PYK A;  1JQY D;  2ZJR A;  3NBH A;  2WAQ B;  2HIX A;  3NEN A;  1PXU A;  2P5Z X;  2AKW B;  3ERS X;  2F0U A;  1EZ6 A;  1DM0 B;  2JA9 A;  2JE6 I;  3VA7 A;  1Y69 U;  2EYM A;  4DR6 Q;  4CJ1 B;  2HDM A;  5C3E G;  3CP0 A;  2DNC A;  1OXT A;  4OWW B;  4WJ3 M;  2Y0S B;  2VQE L;  1AZQ A;  2PI2 A;  3CC7 A;  2R7F A;  4YWL A;  1U4P A;  3QR8 A;  1ESF A;  1S40 A;  5IWA L;  1SMY C;  1VQC A;  4LFC Q;  3CAM A;  1DGS A;  1NSN S;  2UXC Q;  1G91 A;  3PO3 B;  4KK7 A;  3GTP H;  3TDQ A;  4A3E B;  2K5Q A;  5IGB A;  3UDG A;  3RD4 A;  2PMZ E;  2B2T C;  1J9O A;  4U68 A;  1C48 A;  5CBA E;  3GV3 A;  1EZ8 A;  4DKA C;  1JIC A;  5DAU A;  1TS2 A;  3X3N A;  3JAM c;  1YNN D;  1U9R A;  2B2W C;  4ZCK A;  4YHH Q;  3CPF A;  2N78 A;  2ZM6 L;  2Y0S E;  2HT1 A;  1VS0 A;  2D2C C;  2CW0 C;  2IHE A;  2FJ2 A;  2A68 C;  2WKC A;  3KUP A;  4J15 A;  1I3Q B;  2JQO A;  3A5U A;  1KRT A;  5JJK A;  4OXP A;  1VQM A;  2PI2 E;  4IO9 A;  1BBW A;  1CA5 A;  4P71 A;  1VQO A;  1CQF A;  5IY0 A;  2UXB L;  3RNU A;  1QJO A;  2YU9 B;  3S15 H;  3PGZ A;  3CW2 C;  5C0X G;  4LUV A;  1GOZ A;  1D5Z C;  4O42 A;  3AEV A;  4JCV E;  2MQH A;  4LUZ A;  3DHQ A;  3K81 C;  4RHS A;  1A6X A;  4KY5 A;  2HUG A;  4QQB X;  2F4V Q;  1SDF A;  4GNX B;  4KHP Q;  1W3S A;  1R9T H;  1SEB D;  1PTO F;  3KF6 B;  3EFX D;  1QE6 A;  1R4Q B;  4JI2 L;  2OQK A;  1EYG A;  2CH4 W;  4B9W A;  1PFM A;  5EKK A;  5JPM C;  3H6M A;  3KFU A;  2XSC A;  2ASB A;  2A73 B;  2WFW A;  4TSS A;  5ELN A;  2XWJ B;  1H9S B;  2UUC Q;  3CMA A;  4TQU S;  4QMG A;  1BR9 A;  1CKN A;  2NVX H;  1VQ5 A;  5C5M A;  5JJI A;  2B2U C;  2OTJ A;  1TII D;  1SMY D;  1AP0 A;  5IYD H;  5HGQ A;  2G9D A;  2RCF A;  4FO2 A;  5BR8 L;  3LWE A;  1K8O A;  2N88 A;  1GO3 E;  2CHB D;  4K2K A;  2JP1 A;  2NTT A;  1HZ9 A;  4GS3 A;  3HOW H;  4LFB L;  2VQE Q;  4IUR A;  2L5T A;  3U58 A;  4CDE C;  2JJQ A;  3PMF A;  1RD9 D;  1JJC B;  2JYO A;  2XVS A;  5FO9 B;  2MHV A;  4GLV B;  1XMO Q;  5GRO A;  2O4X A;  2JEA I;  4BS9 A;  4XYQ A;  4HCS A;  2F0K A;  4DAV A;  5I9O A;  4EVO A;  4BXX H;  1DXM A;  1SLJ A;  4XDX A;  5M5Y B;  1MI2 A;  1TT2 A;  2RDF A;  4C3H H;  2IWH A;  1BVS A;  1PRT D;  3HOZ B;  2FFK B;  4JI4 Q;  3TN2 A;  1R9T B;  1PTO H;  3NK9 A;  1RTO A;  3TZD A;  4RCN A;  1VQD A;  2M2L A;  1UE6 A;  5T1I A;  2E2H B;  1SE2 A;  3E9H A;  4OX9 Q;  1X54 A;  3RLO A;  5CR3 A;  1OXS C;  1X3G A;  1GUG A;  1Q46 A;  1GUT A;  3SXH A;  2ZJQ A;  3J7A 5;  2FIN B;  2B2Y A;  2CH4 A;  4BWG B;  2IT1 A;  2YYZ A;  3L2P A;  1L1O A;  4JI3 L;  1PH7 A;  2KED A;  5J3B A;  1SND A;  1Y1V H;  1C7Y A;  3V2T A;  3T1H L;  4QB4 A;  3K5O A;  4QJF A;  1M4V A;  5C6A A;  2AQ1 B;  3STB C;  1B3A A;  2PCF B;  3J7Y W;  2DGY A;  3M4Q A;  3TZU A;  1BUV T;  1OO9 B;  4JVZ A;  5CMD A;  3RN5 A;  1S5C D;  5LL6 S;  1ENC A;  4HIO A;  3QB3 A;  1N32 L;  4LF6 L;  3A7L A;  4R4T A;  3PO3 H;  4UDU C;  2B29 A;  3WOE A;  1FJG L;  1SNQ A;  1SJH D;  4TKO B;  2RCN A;  4R8I A;  4BA2 I;  3MAQ A;  2KA7 A;  4UAI A;  4GNX A;  3KLS A;  4N8X 1;  3KLR A;  1SYC A;  4B3T L;  2B3G A;  3A8I E;  3A0J A;  4CKE A;  2O5J C;  3L7Z C;  3G48 A;  4JI6 Q;  4KLK A;  3ER0 A;  1BXT A;  1EL0 A;  3K5N A;  4G7O C;  2VW9 A;  1WD1 A;  5IT9 E;  2LS0 1;  3W3A A;  1EY8 A;  1KDB A;  3CCV A;  4FYD A;  2JA7 H;  4YY3 L;  3FKI H;  3I91 A;  3U9S A;  3MEF A;  1C4Q A;  2YV5 A;  5CV8 A;  1RJT A;  1SE8 A;  4L5T A;  1UE5 A;  2AHO B;  3KJP A;  5C0X I;  1I4G A;  2E74 C;  1PTO B;  4JV5 L;  3L0O A;  3RN2 A;  4A3L H;  1L0W A;  4X64 Q;  1SJE D;  1TQO A;  3J80 L;  4KKU A;  1IW7 D;  1PRT C;  2K33 A;  3HOU B;  3PUZ A;  3GTO B;  2F0J A;  1EEF D;  1N34 Q;  1PH5 A;  4OWT B;  1SNP A;  1XNR L;  4DAP A;  5I4D A;  2VL6 A;  4A3E G;  1SFO H;  5J39 A;  4A3G H;  5IP9 H;  3J81 i;  5ELF A;  2Z6K A;  2PZW A;  3EA6 A;  5E4W C;  5IYB G;  3K5L A;  3TP5 A;  2UXD L;  2PW7 A;  4JI1 L;  1UEA B;  5LMN L;  1T9H A;  2EQS A;  1I50 H;  2EPB A;  3T4A C;  1PH4 A;  1BF4 A;  3I8Z A;  5EQ0 A;  1CKN B;  2BH8 A;  5IYD G;  4DV3 Q;  5M5X B;  3CC4 A;  4Q5V A; 
#chains in the Genus database with same CATH homology
 3HOZ H;  4A3J H;  1VQ6 A;  3HFZ B;  2BA1 A;  1SN8 A;  4B3M Q;  2IX1 A;  2JA8 H;  4DV5 L;  1IBK L;  3UDI A;  3J80 c;  4OON A;  1NBW A;  1PYB A;  5GQO A;  3CCJ A;  5M5Y H;  1XPO A;  1VCI A;  2K5H A;  2L15 A;  4A3C G;  4YCV A;  1UEB A;  4PMW A;  1YZ6 A;  3PUV A;  3RLF A;  4DR1 L;  2N49 A;  3F2B A;  4HIK A;  4LF9 Q;  3RZD H;  4DR1 Q;  4DR6 L;  1EWI A;  2LXJ A;  3J81 c;  3K7A H;  5GAE C;  1WFQ A;  4HJ5 A;  1YNX A;  1K73 C;  1KQS A;  1CSQ A;  5ELO A;  4LFB Q;  1W2B A;  3GO5 A;  1P16 A;  3HOW G;  3S1M H;  3Q8D A;  4JBW A;  4MTN A;  4UP7 A;  4APV A;  2KHJ A;  1N9W A;  3CQZ H;  1HNW L;  4HID A;  3HOV H;  4JOI A;  1OXX K;  3ZJY C;  4A4I A;  5C4X H;  2HHH Q;  1SRU A;  2MFI A;  3GTL H;  4B3R L;  3VDY A;  2KEN A;  3H3V I;  1SR3 A;  4LFC L;  2ES2 A;  3HOU G;  3DLL A;  3OTO L;  1N36 Q;  5IP7 H;  4A3F G;  3AQQ A;  4JOI C;  3CME A;  1XMQ L;  1S3O A;  4GKJ L;  3LGJ A;  2K5N A;  4POG A;  1HNZ L;  1XMQ Q;  2NN6 G;  2QGQ A;  2NN6 I;  1LYL A;  4XIG S;  2K4K A;  4DAM A;  4DV6 Q;  4JG2 A;  3CCL A;  4A3B G;  1WI5 A;  1CKO A;  1V1Q A;  4JI2 Q;  3RR5 A;  4DV0 L;  2V1C C;  2D0O A;  3TRE A;  1GKH A;  4DV0 Q;  4B3S L;  2R6G A;  4GOP B;  2VZA A;  2WB1 E;  4YCW A;  4P72 A;  2GN5 A;  1OTC A;  4HJ9 A;  1VQN A;  4A3L G;  4JI5 L;  1TWC H;  4A3D H;  2RF4 A;  4JI5 Q;  2C35 B;  1OXU A;  3PSI A;  3ULJ A;  4C3J H;  4EX5 A;  5C44 H;  1NJI C;  1CKM A;  4LF8 Q;  2LSS A;  2ZTD A;  1AE3 A;  4UP9 A;  2KCT A;  4DR3 L;  4GKJ Q;  4PG3 A;  2CFM A;  4HJ7 A;  2B63 G;  4LFA Q;  4B3T Q;  2KCM A;  1YJN A;  3M9B A;  4MNO A;  1WJJ A;  1PH1 A;  3TS2 A;  2Q2H A;  4LW1 A;  4RG1 A;  5BR8 Q;  1RIP A;  3HOZ G;  1RL2 A;  1Z47 A;  2JK8 A;  1KC8 C;  3I4N G;  2ZTE A;  4QL5 A;  4R4O A;  3S2H H;  4DV2 L;  5M3M G;  3HOX H;  1VQP A;  4JI6 L;  1YHA A;  2F3I A;  2IX0 A;  1TWF H;  2WAQ G;  4LF5 L;  5IYB H;  1VQL A;  3PO3 G;  2UU9 Q;  2I5M X;  4A3C H;  3UE0 A;  5DLQ E;  5GAD C;  2ZJP A;  2UU9 L;  4QY7 A;  1B7Y B;  3D0F A;  2OQ0 A;  2YU9 H;  4JBK A;  1N34 L;  2A19 A;  1VQK A;  2VQF L;  2KBN A;  1I3Q H;  1VQI A;  4LF4 L;  4HJ8 A;  1IL2 A;  2BA0 A;  2CCZ A;  4QIW E;  5FLM G;  4X66 Q;  2E5L Q;  4LNQ A;  4GKK Q;  3I4N H;  4X66 L;  4A93 G;  2K75 A;  4GLA C;  2VUM H;  4DUZ Q;  3PO2 G;  1YIJ A;  1MIU A;  2ZM6 Q;  5M3M H;  3HOX G;  1A63 A;  3CCR A;  3PUX A;  4K0K L;  3PUW A;  1KHI A;  5M5W H;  2I5H A;  4PZ8 A;  1KXL A;  2AWN A;  1Y14 B;  3S1Q H;  5C4X G;  1NE3 A;  1U5K A;  1TWA H;  1K8G A;  4ME3 A;  4X64 L;  2HIV A;  4R4I A;  4RMF A;  4YCU A;  2CQO A;  3HOY H;  1Q1B A;  4MZ9 A;  1M1K C;  4AH6 A;  4YWK A;  3G4S A;  1MJC A;  1CSP A;  5C44 G;  5LMU L;  5FLM H;  3NBH B;  3H3V H;  3M7N A;  4P73 A;  1KL9 A;  4A3E H;  4LWC A;  4B3M L;  4A93 H;  1K3R A;  3GTJ H;  4JI8 Q;  3PIO A;  1PYS B;  4A3G G;  2QA4 A;  4GNX C;  4DV5 Q;  3UDF A;  3KF8 B;  1TWG H;  4DR5 Q;  1L1O C;  5FLX c;  4DUY Q;  4DR5 L;  4C3I H;  4GLX A;  3A5Z B;  2GVA A;  4DAY B;  1C9O A;  2UXD Q;  1NMG A;  1NMF A;  1UWV A;  1N8R C;  4Y7N H;  4O0A A;  1EQR A;  1JJG A;  1E7Z A;  2ATW A;  2B63 H;  3GDE A;  3S14 H;  4DV3 L;  1L2F A;  1JMC A;  1JE5 A;  2NVY H;  2Z6K C;  3UE1 A;  4KHP L;  1Q12 A;  5IT9 c;  4OO1 I;  2Q2T A;  4GOP C;  4R4C A;  4X65 Q;  3KDF B;  3F1Z A;  1XJV A;  2YTX A;  4DR4 L;  1Q86 C;  2ZJR A;  3ICE A;  1HNX L;  4DNI A;  3BZC A;  1QVC A;  3S1R H;  1IBK Q;  2HIX A;  3NEN A;  1GVP A;  3G71 A;  1LM0 A;  4NB3 A;  1VQH A;  4BY7 H;  2AKW B;  4A76 A;  3ERS X;  1PH8 A;  1BBU A;  2CKZ B;  3OYY A;  1AH9 A;  2R93 G;  2JA9 A;  2JE6 I;  4DV4 Q;  4DV4 L;  3EBE A;  1WCM G;  1YIT A;  2VNU D;  4DR6 Q;  4JI7 Q;  2E8G A;  5C3E G;  2AMC B;  3CP0 A;  4LF6 Q;  1VQ4 A;  1OXT A;  2K5V A;  4A3J G;  3JC6 6;  2MO0 A;  4OWW B;  4WJ3 M;  1FJG Q;  2VQE L;  4FDB A;  2PI2 A;  3GTO H;  3CC7 A;  1HNW Q;  2R7F A;  4JI0 L;  4YWL A;  1FGU A;  1XMO L;  3KDF A;  2HHH L;  2OWO A;  1B8A A;  5IWA L;  4AYB G;  1YBY A;  1S40 A;  2UUB L;  1PVO A;  1VQC A;  4LFC Q;  2IY5 B;  1PH2 A;  5IWA Q;  1WYD A;  3CAM A;  3OTO Q;  1XNR Q;  1WCM H;  1DGS A;  2ALY B;  3U4V A;  1UE1 A;  1PH9 A;  2UXC Q;  5JJL A;  2PNH A;  5C3E H;  3PIP A;  1IBL L;  2JA5 H;  4OX9 L;  1VQJ A;  4X62 Q;  3GTP H;  4P74 A;  1Q1E A;  3SGI A;  2N8N A;  3NEM A;  1E22 A;  5IP9 G;  4B3S Q;  3RLN A;  5EAY A;  4JI4 L;  3UDG A;  1YJ9 A;  2NZO A;  4AQY L;  2PMZ E;  3F2C A;  2EIF A;  4DKA C;  4NXM L;  4BXX G;  1X3F A;  3JAM c;  2VQF Q;  1X55 A;  3HOY G;  2E2H H;  3GTQ H;  4GN5 A;  1VQE A;  4DR3 Q;  3T1Y L;  4YHH Q;  3H15 A;  3F2D A;  3CPF A;  3TEH B;  2N78 A;  3CCU A;  3TRZ A;  2ZM6 L;  2Y0S E;  2HT1 A;  1VS0 A;  5E7N A;  2IHE A;  3K8A A;  1Y1V G;  1QUQ A;  2CWP A;  2GVB A;  4IFD I;  2D62 A;  4IOA A;  4POF A;  1GD7 A;  3ULL A;  3CPW A;  2YTV A;  4PZ7 A;  4J15 A;  2JQO A;  1CUK A;  1X65 A;  1KRT A;  5AJ3 Q;  3A5U A;  1XNQ L;  2WB1 G;  4OXP A;  1VQM A;  1KRS A;  2PI2 E;  1Q7Y C;  4IO9 A;  3D31 A;  1BBW A;  3F8T A;  1EOV A;  3BU2 A;  3NEL A;  4UPA A;  3CCS A;  2Z0S A;  3HKZ E;  1I6H H;  2UXB Q;  4QGU A;  3CCE A;  4P71 A;  4TVA B;  1VQO A;  5IY0 A;  4R1J A;  2UXB L;  1IXR A;  4R4Q A;  3RNU A;  4BBS G;  4LF4 Q;  2AWO A;  3CCQ A;  3S15 H;  3PGZ A;  1GM5 A;  4JBJ A;  1N32 Q;  4EQ5 A;  1X9N A;  4GN4 B;  4JI3 Q;  4NXN Q;  3CW2 C;  5H1S E;  2CWA A;  3KOJ A;  4LUV A;  1V43 A;  5C0X G;  5M3F H;  3MXN B;  4DUY L;  4DUZ L;  3AEV A;  1EIF A;  3I4M H;  1KD1 C;  4JCV E;  4AYB E;  1HZC A;  2MQH A;  2XGT A;  4LUZ A;  3K81 C;  4IPG A;  5JEA J;  4DK6 C;  4A3M H;  3W1B A;  3JAM i;  2F4V L;  1NY4 A;  1QZG A;  1L1O B;  4QQB X;  4A3K G;  2F4V Q;  3HOV G;  4Y52 H;  5IE8 A;  2K52 A;  4GNX B;  4A3I H;  4KHP Q;  5HY6 A;  1OXV A;  1P8L A;  2WAQ E;  1S72 A;  1KIX A;  1W3S A;  1R9T H;  1E1T A;  4L5Q A;  4IJL A;  1PV4 A;  4IPC A;  1C0A A;  4JBM A;  3KF6 B;  5GAH C;  3UDX A;  2NVQ H;  1G29 1;  2JEB I;  4JI2 L;  2OQK A;  3I2Z A;  1EYG A;  2DUD A;  3AFP A;  4IJH A;  1HNX Q;  3W5O A;  3G6E A;  4GOP A;  2I0Q A;  3I55 A;  3KFU A;  2R92 H;  2ASB A;  2WFW A;  2UUC L;  2Q2I A;  3WWV A;  5ELN A;  2UUC Q;  5FJ8 G;  3CMA A;  4TQU S;  3U4Z A;  4DV7 L;  1Y1W H;  1CKN A;  2NVX H;  4DV7 Q;  1VQ5 A;  5JJI A;  3M3Y H;  3J80 i;  4BA1 I;  2OTJ A;  3STB D;  3CXC A;  1K9M C;  5IYD H;  1LTL A;  5HGQ A;  1IBM Q;  2Y0S G;  4DPG A;  1ASZ A;  5BR8 L;  1O7I A;  4DR2 Q;  2VY3 A;  3PO2 H;  2JA7 G;  3S2D H;  5JJK A;  3CCM A;  3CF5 A;  1GO3 E;  1PH3 A;  2OTL A;  4GS3 A;  1HZ9 A;  5C4J H;  3CC2 A;  3HOW H;  4LFB L;  3H0G G;  2VQE Q;  3U58 A;  5K36 G;  3E9I A;  5GAG C;  4JV5 Q;  2JJQ A;  5M3F G;  1JJC B;  1XPU A;  2HQL A;  1XMO Q;  4GLV B;  5GRO A;  2QEX A;  3I7F A;  1VQ8 A;  1B70 B;  2JEA I;  3GD7 A;  2R7Z H;  3IRB A;  2EXD A;  4KHZ A;  4O2D A;  3W1G A;  1YHB A;  2H5X A;  4P75 A;  3AYH B;  4BXX H;  4C2M H;  1MKH A;  3HKS A;  2E2I H;  3I56 A;  1SLJ A;  4X62 L;  1HNZ Q;  4A3B H;  1I94 L;  4DR7 L;  4DV6 L;  1HZA A;  1TWH H;  4C3H H;  4IOC A;  1AE2 A;  1BVS A;  1HJP A;  4L5S A;  1HZB A;  3KYH C;  3OW2 A;  4H02 A;  4JI4 Q;  1XPR A;  1EUJ A;  4AQY Q;  4X6A H;  1H95 A;  4JI1 Q;  5M5X H;  4A3I G;  2PQA B;  4OWX B;  3TQY A;  4A3D G;  2UUA L;  1VQD A;  1Q82 C;  2UUA Q;  1E24 A;  1A0I A;  2Q2U A;  2UUB Q;  1JT8 A;  3S16 H;  3B6Y A;  4A75 A;  3PV0 A;  3T1Y Q;  2K14 A;  1UE6 A;  1X6O A;  3K7U C;  1PHJ A;  1QZH A;  3E9H A;  4GN3 B;  1A62 A;  1K83 H;  2UXC L;  4WJ4 A;  1PFS A;  1IYJ B;  3BZK A;  4OX9 Q;  4UY8 C;  1G51 A;  1X54 A;  3GTM H;  3RLO A;  1KAW A;  4BBR G;  1OXS C;  1X3G A;  1N33 L;  2ID0 A;  1Q46 A;  2ZJQ A;  1HR0 L;  3HOU H;  3J7A 5;  1EQQ A;  2R7Z G;  3M4P A;  2IT1 A;  4LF9 L;  4IPH A;  1TXY A;  2YYZ A;  3HKZ G;  1MJE A;  1HH2 P;  4YHH L;  4OO1 G;  3L2P A;  1L1O A;  1WOC A;  3U50 C;  1PA6 A;  4JI3 L;  3H0G H;  1PH7 A;  5J3B A;  1Y1V H;  4HIM A;  1V9P A;  3FKI G;  2XTI A;  2F52 A;  4YWM A;  3T1H Q;  1C7Y A;  3T1H L;  1X56 A;  2JA6 H;  4K0K Q;  1QVF A;  3S24 A;  4QJF A;  2R7D A;  3STB C;  2IHF A;  5AJ3 L;  3M85 A;  2DGY A;  3M4Q A;  3TS0 A;  4BY7 G;  3I4O A;  1N36 L;  4BBS H;  2JA5 G;  1J5E Q;  3RN5 A;  5IP7 G;  4A3F H;  1J5E L;  3ULP A;  1JB7 A;  1I5F A;  1VQ9 A;  4HIO A;  1N32 L;  4LF6 L;  2LXK A;  3K80 C;  4JI8 L;  4BY1 H;  1LUZ A;  4NXN L;  2JA8 G;  4R4T A;  1XTD A;  1Q81 C;  2BH2 A;  3PO3 H;  2B29 A;  3S17 H;  2A1A A;  2WP8 J;  1FJG L;  4PZ6 A;  1FVI A;  4BBR H;  1E1O A;  1QVG A;  2OCE A;  2RCN A;  4JI0 Q;  3BJU A;  3DM3 A;  4BA2 I;  4LF7 L;  2N3S A;  4HJA A;  4LF7 Q;  4KI0 A;  4ALP A;  4GNX A;  4B3R Q;  3GTK H;  1EFW A;  1IBM L;  1J6Q A;  4XTC S;  4B3T L;  4DR2 L;  4LFA L;  2B3G A;  1YVC A;  3PCO B;  2MNA A;  2VUM G;  1SRO A;  4X65 L;  3A0J A;  1G6P A;  1EIY B;  4DR4 Q;  3L7Z C;  1A8V A;  1NTG A;  1UE7 A;  3FP9 A;  3G48 A;  4JI6 Q;  4KLK A;  3ER0 A;  4LF5 Q;  2R92 G;  3I4M G;  1X3E A;  4IFD J;  5FJ8 H;  2VS1 A;  1VQG A;  2K50 A;  5C0X J;  1Y1W G;  1VQ7 A;  4JC0 A;  4NXM Q;  1U0L A;  3KJO A;  2VW9 A;  4LF8 L;  1SMX A;  4UP8 A;  2PQA A;  4YY3 Q;  3CCV A;  5LMN W;  2YTY A;  1PH6 A;  1HR0 W;  3J7Z C;  2JA7 H;  4LUO A;  4YY3 L;  4NPS A;  3CD6 A;  3FKI H;  3PUY A;  1YI2 A;  4JI7 L;  3PF4 A;  3M4O H;  3MEF A;  2YV5 A;  4L5R C;  2JA6 G;  1SE8 A;  1QUQ B;  4L5T A;  1UE5 A;  2AHO B;  4DK3 C;  3KJP A;  5C0X I;  4A3M G;  1JJ2 A;  1FL0 A;  4JV5 L;  1Z9F A;  3L0O A;  3RN2 A;  4A3K H;  4DV2 Q;  4A3L H;  2ZTC A;  1L0W A;  4X64 Q;  1XNQ Q;  3K0X A;  4AIM A;  1VQB A;  3KF6 A;  2RHQ B;  3KLW A;  5JEA G;  5IYC H;  1ASY A;  3EIV A;  3PUZ A;  1YHQ A;  3EN2 A;  1N34 Q;  5LMU Q;  1VQF A;  2RHS B;  2D0P A;  1D8L A;  4OWT B;  1PH5 A;  1XNR L;  2R93 H;  4BY1 G;  4DV1 Q;  1M90 C;  1E3P A;  3FHW A;  4DV1 L;  1IBL Q;  1IZ6 A;  1Q8K A;  1I94 Q;  2VL6 A;  3E0E A;  4A3E G;  2NZH A;  2E5L L;  1SFO H;  4DR7 Q;  4GKK L;  4IFD G;  1YEZ A;  3PF5 A;  4A3G H;  5IP9 H;  3J81 i;  4IPD A;  2E2J H;  2Z6K A;  1N33 Q;  4JYA L;  5IYB G;  1BKB A;  3A74 A;  2A8V A;  5LMN Q;  4JYA Q;  2KHI A;  1HR0 Q;  2FXQ A;  4JI1 L;  2UXD L;  5LMN L;  1T9H A;  2EQS A;  1I50 H;  1PH4 A;  3GTG H;  5IYC G;  1VQA A;  1K0R A;  2MO1 A;  1CKN B;  2BH8 A;  3AFQ A;  5IYD G;  1K8A C;  4DV3 Q;  1YJW A;  3S1N H;  2I5L X;  1D7Q A;  3CC4 A;  3RZO H;  2NVT H;  3J81 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...