5C3JA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 216
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c3jA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c3jA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c3jA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c3jA04
1GRGA 4GRTA 4EM4A 2GRTA 4I58A 3DH9A 1XHCA 2C3CA 2R0PA 1CJCA 1PBCA 1KNRA 3DA1A 4I59A 2GMHA 2YG4A 3NYFA 3OZ2A 4YKFA 3ALJA 3P4PA 4H4WA 5FS8A 3T37A 2YR5A 1NPXA 1VG9A 1YQ3A 3ATQA 3GQKA 4H4UA 1TDOA 3PO7A 4NTEA 5KWFA 2VVLG 1NHQA 2BS4A 4YTMA 4B1BA 1N4UA 2C70A 5DBJA 5IPYA 4J36A 4OPUA 1IUWA 4BJZA 3CNDA 1B8SA 2GAHB 2XFUA 3ATRA 3H8LA 1BGJA 3REDA 1F8WA 3GSIA 3Q9TA 3AB1A 3UTFA 1PXAA 2CULA 3DK9A 2B7SA 5GSNA 1PBFA 2X99A 4B68A 3M13A 1TDEA 1DOCA 5EOWA 3S61A 4ZCCA 4H2NA 4UDRA 3RNMA 4CCQA 1LVLA 2IIDA 3ICSA 4YSXA 1TDKA 3GMBA 2R0CA 4EQXA 4HB9A 4TM4A 4LU6A 1M6IA 1NENA 1ZDLA 2RGJA 3UOVA 4BURA 4RG4A 3BI4A 1VQWA 2Q7VA 4CCRA 4GCMA 1JNZA 3P4QA 3UKPA 4B69A 3AE7A 1FEAA 2GR3A 1Y0PA 4JNQA 4IVMB 1D4EA 4TLZA 3AE6A 3UOXA 4TM1A 1PXCA 3VQRA 3FG2P 1D7YA 2CVJA 3K30A 4Z25A 2XFQA 2BC0A 5J60A 3QSMA 2X3NA 3AWIA 1KSSA 1PJ5A 1ZOYA 2YM1A 4YTNA 2GR1A 1H7XA 4B65A 2CFYA 4K7ZA 2V3BA 3AE4A 1K0LA 1F3PA 1LTXR 2XLTA 1KSUA 4DSHA 3CNPA 4C3XA 4NTCA 2PHHA 1NEKA 1L9EA 3KPFA 1O5WA 4DNAA 4KPRA 2GF3A 3AEDA 3AEBA 3NK2X 3K7QX 5FMHA 2B9YA 1XDIA 2C3DA 3CGBA 1TRBA 1ZMDA 4NEVA 1X31B 2X8GA 4IA6A 3DMEA 1PN0A 2RABA 3AXBA 4MJWA 4PAAA 3G5QA 1JRXA 2JBVA 3M0OA 1H82A 4JDRA 3NKSA 3JSKA 5TR3A 2OALA 3UP4A 1CJ3A 1PBEA 1Q1WA 3AYJA 1ZMCA 4O5UA 2APGA 3UP5A 4A9WA 3AE2A 1GRTA 2Y6QA 3CNTA 1PXBA 4H2PA 3SFDA 2RGHA 3QFAA 2O9ZA 2QA2A 3SUCA 3F8DA 1K0IA 3VR9A 3VR8A 2X8HA 3C96A 3GDNA 5ER0A 3UTGA 3C4AA 4Z24A 4CRTA 3GYJA 4EMIA 3G5RA 2XFOA 5JCNA 4E0VA 1GPEA 3GD3A 1H6VA 4TM3A 2AR8A 1GETA 2H89A 2WP5A 3UCLA 1CBOA 4U2SA 1OJ9A 2ZZ0A 3LOVA 3ZYXA 4GUVA 2WS3A 1CF3A 2YVFA 1IUUA 4YSZA 1JU2A 1NAAA 2V61A 5FS9A 1IUSA 3NYCA 3P4RA 3P1WA 3URHA 4UDPA 1HYUA 2GEWA 2ACZA 1QO8A 4BK1A 5FS7A 5CQFA 4Z2TA 3GQHA 2B9WA 2QAEA 2YVGA 4H4RA 2WPFA 2WDQA 4USRA 1PJ7A 5FS6A 2OLOA 3ABVA 2Y6RA 3SQPA 4BJYA 1KDGA 3CIRA 1OJDA 4UDQA 2GMJA 3AEFA 1H81A 3FPZA 3AE8A 4NEWA 4JY3A 4RSLA 4CNKA 4CY6A 3NN6X 4H4SA 4YWOA 4J34A 3B3RA 3CGDA 3UTEA 3IC9A 1IJHA 3QJ4A 1LQUA 1D7LA 2ARDA 1LPFA 4B67A 2TMDA 2EQ8A 2VOUA 1VG0A 2EQ6A 2VVLA 3EANA 4AT0A 1L9DA 1Z6LA 2YLXA 1SEZA 3LZWA 4NZHA 2VQ7A 5C3JA 4C77A 3DGZA 3H8IA 2YWLA 2XFPA 4BV6A 2VQBA 4REKA 2OA1A 4GDPA 3RP7A 1FECA 4H2RA 4XWRA 3UTHA 2YLWA 1S3EA 3KA7A 2JKCA 3P4SA 2RGOA 4IVOB 2PYXA 2C73A 2YG7A 4EQWA 3R9UA 2FBWA 3PS9A 4BK3A 3KU9A 4EM3A 1EL5A 1ZKQA 3AE5A 2XDOA 1K4QA 1Y56A 2YR6A 1CC6A 3V76A 3NH3X 1MO9A 5KVHA 3AECA 4IA5A 2BACA 2YVJA 2WPCA 3UKLA 2GQWA 2BABA 2JB2A 2YLSA 3IWAA 4KX6A 1GESA 2I0ZA 2VZ2A 3DJDA 3GD4A 4N9XA 4AP3A 1JEHA 2BK5A 3NT6A 5IQ4A 1F8SA 2AAQA 4M52A 3KKJA 1GOSA 1RSGA 3CPJG 2YR4A 4FDCB 1ZP0A 1ELIA 5L46A 4ZN0A 4AT2A 2GB0A 3GMCA 2WDVA 3OC4A 2WP6A 4GDEA 3VRAA 3LZXA 1E1NA 5BVAA 2C67A 1O94A 1EL8A 1GXFA 1H84A 2XYOA 3GYIA 5KOWA 1O95A 5HYMA 1JRYA 2E4GA 2H88A 1DOBA 2IVEA 4U8PA 3VRBA 3ADAB 2C76A 2QCUA 4U8JA 3SFEA 2OAMA 2EQ9A 3BHKA 1JRZA 3KLJA 2AQJA 4U8KA 3NRNA 1GALA 2E1MA 2V6OA 4OPLA 1ZK7A 3BI2A 1F8RA 1Y56B 2A89A 4Y4NA 4Z44A 1GTHA 2NPXA 1FEBA 2B76A 1V59A 2GR2A 2FJAA 3ITJA 5J7XA 4U8LA 1LQTA 4H4XA 5U25A 4A79A 5M10A 1RYIA 2C65A 3LXDA 4LIIA 3S5WA 2XLUA 2W0HA 5M0ZA 3UOZA 2YQUA 3D8XA 4AOXA 1B37A 3AE1A 3AD9B 4YT0A 1D5TA 2VVMA 3UKKA 3ICTA 2WOVA 2WU2A 3GDPA 4U2TA 2WESA 1OJTA 1NHRA 4U8MA 4J31A 3UKQA 1E6EA 4H50A 1GSNA 1H86A 1GT8A 1S2QA 3PVCA 5EB5A 5EB4A 3Q6JA 1ONFA 3G5SA 4H4YA 1NG4A 1D4DA 5C2TA 4YXDA 2JK6A 4K2XA 1FL2A 3AEGA 4A7AA 2R4EA 3NYEA 1TYTA 1EL7A 3EF6A 1BWCA 3GRSA 4TLXA 4PABA 4EQSA 5JCLA 2WEUA 1DOEA 1XANA 1D4CA 1ZX9A 5JCMA 1BGNA 4J56A 2JB1A 4OPIA 4BK2A 2FJBA 5KVIA 4JY2A 2BCGG 3CPHG 2A8XA 2YG5A 3BNUA 1B5QA 3NGCX 2XVJA 4J33A 2V3AA 4P9SA 2XCGA 1EBDA 3COXA 3II4A 2X50A 3AEEA 2XLPA 1Q1RA 1TDFA 3UOYA 2HQMA 4K5RA 1M64A 2B9XA 2BXRA 2BCPA 3H4KA 3NIXA 2FJEA 2GVCA 5LV9A 3AE9A 1GRFA 3NTAA 3CNSA 1E39A 2BS3A 3E1TA 5HHFA 2TPRA 3CTYA 4XWZA 3GRTA 4ZCDA 1IUTA 3UKFA 4JQ9A 1MXTA 4FK1C 4X9NA 2DKIA 4EQRA 5CKUA 4YSYA 2J3NA 4X9MA 2R46A 4H4QA 3AD8B 2BS2A 2ZZCA 3K7MX 2XVEA 4AP1A 1H83A 4ICYA 1GRHA 2Q0LA 1GV4A 2C72A 3B6DA 3M12A 1LV0A 4WCTA 1YQ4A 4K8DA 1W4XA 4U8NA 1QLBA 1RP0A 3CN8A 2DKHA 4OPGA 4X4JA 5JCKA 2XVFA 2V5ZA 3UKAA 4FX9A 4D04A 1BF3A 2BK3A 4CBQA 5HY5A 4C3YA 4CY8A 4OVIA 5JCIA 1VDCA 5U1OA 4APNA 3D1CA 4C5OA 4LA1A 1XPQA 2JAEA 2OLNA 5U63A 4JN9A 1NHSA 3RHAA 1YKJA 1P2HA 2Z5XA 1H7WA 1P2EA 1UKVG 2V60A 2ZBWA 1CJ2A 1GREA 2X8CA 3DJJA 3IHMA 4Y4LA 1FCDA 1KFYA 2WBAA 2Q0KA 2WOWA 4D03A 2WDRA 1ZOVA 3BHFA 3IF9A 3V3OA 3ALLA 3K7TA 1S3BA 1BKWA 2YM2A 3NK1X 4AOSA 2YLZA 2GR0A 1AOGA 3AYLA 4USQA 3AD7B 1CHUA 1KF6A 3ISHA 3QFBA 3QVRA 2GQFA 2GV8A 2R9ZA 5EBKA 4EMJA 4EIQA 4K22A 3CPIG 3NN0X 3FMWA 1PBDA 1GNDA 3V3NA 4A6NA 1N4VA 2C64A 1TDNA 2YAUA 4OPTA 4U8OA 4H4TA 3QVPA 1F6MA 3O0HA 5BRTA 1KNPA 2NVKX 3AYIA 2CDUA 4J2WA 1ZY8A 2QA1A 2BC1A 3HZLA 1L0VA 3QSEA 3I3LA 2A87A 1NDAA 3WE0A 2WHDA 2GH5A 1DNCA 3NHOX 4B64A 4C74A 2C7GA 4DGKA 4J57A 2WOIA 1BZLA 1GERA 3F8PA 3SM8A 2XVHA 1YY5A 2BXSA 1GEUA 3NTDA 2VRMA 3RP8A 1PS9A 2BK4A 3EAOA 4TM0A 5HXIA 3DGHA 2F5ZA 1COYA 3KD9A 4GR1A 3CGEA 1NHPA 3C4NA 1DXLA 4XXGA 2WETA 1PJ6A 2YLRA 5KXJA 1L9CA 4JNAA 2WU5A 1FOHA 1YQZA 4Z26A 2E5VA 1PBBA 3L8KA 2VRLA 3ZDNA 2BA9A 4A65A 3CNJA 4YTPA 2R0GA 3RP6A 2Q6UA 2R4JA 1E1LA 1CL0A 1Q9IA 1OJAA 3DK4A 3LADA 1PDHA 3FBSA 2JB3A 1TYPA 4H2QA 4U8IA 1E7PA 2WP9A 3FIMB 3UKHA 3ALMA 4ADWA 4A6NB 1N1PA 2C75A 4RG3A 1E1KA 3P9UA 4WX1A 3LB8A 5KOXA 3L1RA 4Z2UA 4HA6A 3SGLA 1DJQA 3IHGA 1REOA 4A5LA 2XLRA 4UP3A 3AE3A 4O5QA 4OCGA 5GRTA 5KRQA 1NG3A 4EIPA 2XLSA 4IV9A 4OPCA 3GWDA 4GF7A 4OPDA 2BYBA 3VRDB 5BULA 3AEAA 4H4ZA 4H4PA 1JNRA 2FJDA 1K0JA 4Y4MA 1DJNA 2LFCA 1QJDA 4CNJA 2GAGB 1IUXA 1OJCA 2XVIA 3DJGX 2C66A 1B4VA 4B63A 2EQ7A 3ICRA 2YG6A 3I6DA 4H4VA 2B7RA 3EPTA 4NTDA 3NNEA 1IUVA 4Z43A 5IQ1A 1CC4A 3F8RA 3BI5A 3GWFA 1GRAA 2IVDA 3GYXA 5BUKA 1S2YA 2YLTA 1GTEA 2UZZA 2WPEA 3BNMA 2ZZBA 3NLCA 4Z2RA 1E1MA 2YG3A 1PHHA 4FK1A 2XFNA 2WQYA 4EMWA 4ECHA 4H7UA 3DJEA 2R45A 3QSSA 1N4WA 3DK8A 1EL9A 3KVEA 3CGCA 1JOAA 1DODA 2Z5YA 3NG7X 4U2LA 1CJ4A 4A99A 4B66A 4YSHA 1LJ1A 1GRBA 4DSGA 3LJPA 1CC2A 1MOKA 1VRQB 4K5SA 3NK0X 4YKGA
chains in the Genus database with same CATH superfamily
4GRTA 5EB5A 5AQPB 3DA1A 3ALJA 3P4PA 4H4WA 4NXMT 3ESLA 4H4UA 1MIWA 1TDOA 2VVLG 3HL6A 3RI5A 4B1BA 2C70A 4MBQA 4P1NA 4OPUA 4I0UA 3ATRA 3H8LA 4ILAA 3REDA 3GSIA 3E08A 1EAH4 5L3GB 1PXAA 2CULA 2LEHA 3QNUA 1HXS4 2X99A 4UF0A 2R6GF 2R074 4EZHA 4P0AA 2A72A 3RNMA 4UV9B 3KVBA 2IIDA 3ICSA 3RIFA 4A56A 3C51A 4AQGA 3UOVA 4BURA 4RG4A 5CGMA 1VQWA 1OOPD 2CEAA 2ZM2A 2ZMAA 5AQIB 3F31A 4B69A 1RUJ4 5LHHB 5LBQB 2X66A 2BBHA 4IVMB 4QH4A 1D4EA 4TLZA 3AE6A 4C91A 3SYIA 2PYJA 1PXCA 4AKLA 4QXBB 3K30A 2YDQA 3BQKA 2X3NA 2LSKA 4ZZBA 1EZ3A 3ONLC 2GR1A 1H7XA 2NP9A 4ZI7E 3WAJA 3AE4A 1K0LA 4PJLA 1KSUA 3I0OA 4DSHA 4C3XA 2I0MA 2N9DA 1NEKA 3KPFA 4CI2B 1O5WA 3H3AA 3ZT5A 1BR2A 2A2FX 3AEDA 4O2BE 3AEBA 5HEJA 3RLFF 3ZMTB 1XDIA 1ZMDA 4IA6A 3Q9DA 1B7TA 2RABA 2X5ID 2W63A 3G5QA 3CX7B 2IW5B 2V5CA 4O5UA 3UP5A 4H2PA 3LJCA 3ZMVB 5HXEA 2EHOD 1N32T 4U72A 4TWFA 2O9ZA 4II2A 5ER0A 3UTGA 3GDNA 4CRTA 1SA0E 2XFOA 3K3OA 2AR8A 2WP5A 1NCQD 2XY8B 4WBNE 1OJ9A 4IDQA 5FVKA 2EHOA 4GUVA 3MK7C 1IUUA 4YSZA 5L3BB 5AQGB 4ZEYA 4DR3T 2V61A 2XAJB 3EABA 5FXZA 4DVDA 2ACXA 4UDPA 4Q4Y4 3W15B 4TV8E 4AKGA 2WPFA 3SXIA 1O3XA 3NWIA 1WFDA 4XBFB 1UX4A 2XHEB 1OJDA 3D0TA 4UDQA 4DR6T 3AEFA 2VVSA 5JR9B 3FPZA 3AE8A 4NEWA 4CNKA 1POV0 4ZI2C 5LG4A 4H9RC 3CGDA 2X9YA 3T14A 1IJHA 2E2AA 5KMGP 5AQFB 2JPFA 5LMUT 3BK9A 4COFA 1US7B 2VOUA 1VOMA 2YLXA 3LZWA 4NZHA 5IWAT 1W09A 5C3JA 1LKXA 2XFPA 2UXDT 4LF9T 3N9OA 2JQQA 4GB34 4TWDA 4XWRA 1QUUA 3P50A 2VURA 4I50E 1VBC4 2RGOA 2FUPA 3HYWA 4EQWA 4U3CA 3SZ0A 4YLHA 5C8YE 1ZKQA 2XDOA 1Y56A 2X9HA 1EV14 2YR6A 5LA6E 1RVF4 4GK0E 1X9BA 2BACA 2WPCA 3ZSTA 3CVRA 2GQWA 3IWAA 3ZMZB 1F8SA 3AA7B 4M52A 3CWZB 3KKJA 2H7OA 4DR2T 2KMFA 4AT2A 1VRH4 3UU4A 2C67A 1H84A 3UULA 2V6YB 3GYIA 1O95A 5HYMA 2H88A 2ZLYA 3VRBA 3J8F4 3ADAB 2C76A 1HX8A 4LFBT 2OAMA 1WR6A 3K3NA 5AFUL 2E1MA 2V6OA 4Y4NA 1FEBA 5FNVE 5H6RB 3SRZA 2VQFT 5J7XA 3LK3B 3O4XE 2WWUA 5L4EA 3T1YT 1MMNA 2XLUA 2YQUA 2IC6A 3EVYA 4DV1T 3AAIA 3UUXB 3UKKA 4DV2T 2XQ8A 1U5PA 4U8MA 2DLRA 2NTXA 4CN4A 2WZIA 4FJOA 4H50A 4DV5T 1GT8A 1H8TD 3QB5K 1IBMT 1HNXT 5HWYA 4HTEA 2IUBA 5C2TA 3C4WA 4K2XA 3AEGA 5FXXA 1R094 3EF6A 4TLXA 1D1CA 2KWIB 2E8IA 4PABA 5JCLA 1DOEA 4TNVA 3LG7A 3ETVA 4HWFA 2CHNA 2G0UA 4CXYA 4GKKT 4QH1A 2BCGG 3CPHG 2XAFB 2YG5A 3BNUA 2UXNB 4TWHA 2V3AA 4P9SA 2Q9QB 5IHYA 4I55E 1EBDA 3II4A 3AEEA 3UOYA 1G73A 2NW7A 2B9XA 2BKPA 2FJEA 2GVCA 2KINB 4ZI3C 1E39A 3PUGA 4ERRA 4JI2T 4K0KT 2KXPB 2CWYA 2D2SA 3UKFA 4JQ9A 2BRYA 2R46A 4H4QA 5JDNA 4H9NC 4AP1A 1H83A 2Q0LA 3DP7A 1MNDA 4WCTA 1LV0A 2RS54 3UU8A 2X9XA 4B3RT 2XQ6A 4OPGA 5JCKA 4HFEA 4X1IE 4D04A 1BF3A 2XQYA 2BK3A 1OEDB 3N9MA 2C4CA 5U1OA 4C5OA 5ABEA 5HXRA 5U63A 2LSJA 1H7WA 1UKVG 4B3MT 2BG9A 1CJ2A 3IHMA 2WBAA 1KFYA 4IL9A 3BHFA 3ZC1A 3K7TA 2V7KA 4AXPA 2GR0A 1AOGA 3AYLA 1J5ET 3ISHA 4EXTA 2GV8A 3OYXA 3CPIG 5ABFA 3FMWA 1GNDA 3KINB 4NUVA 3EDUA 4Q25A 2CDUA 1L0VA 3QSEA 3A8YC 3WE0A 4C74A 4DGKA 3NHOX 4J57A 4IE4A 2AE9A 2BXSA 1GEUA 4B6XA 3NTDA 3RP8A 2BK4A 2DNXA 3DGHA 2F5ZA 3KD9A 3E22E 5DABA 4CXXA 4HFIA 4DO0A 4Z26A 2VRLA 3ZDNA 3CNJA 4O4HE 5AQSB 3AVRA 3SS1A 2K48A 1OJAA 4G6GA 2W67A 1PDHA 4O4LE 4ADZA 4ADWA 4UVBB 4GAVA 2UUBT 3T0KA 1T98A 1VRBA 3L1RA 4DMWA 1REOA 5ADXL 1AJ3A 3AE3A 4O5QA 5KRQA 1NWMX 1NG3A 5DJQC 2XLSA 2K5BB 1KNZA 4UR9A 2BVLA 3AEAA 5L3FB 4H4ZA 2FJDA 1K0JA 4Y4MA 1DJNA 1QJDA 5JR9C 3SZFA 4CNJA 2XVIA 3DJGX 2C66A 1B4VA 4O8SA 2B7RA 4H4VA 4NNJA 4NTDA 3NNEA 1IUVA 3GYXA 2LKGA 2PLV4 1S2YA 3BNMA 2WPEA 2ZZBA 1E1MA 4EMWA 3RIAA 2D9DA 2IMLA 5HXCA 3DJEA 3DK8A 1EL9A 2RPAA 5IUXA 1FJGT 2K24A 3NG7X 5JDLA 1CJ4A 4U2LA 3N2OA 3RIUC 5AQRB 3RHWA 2ES0A 4X62T 1SHZC 4K5SA 4GYRA 5JH7E 3KV5A 1GRGA 1H7CA 3DH9A 2XSAA 4YKFA 5KDMC 4HFHA 3OBVE 3JADA 2YR5A 2WWVA 4DR5T 3ATQA 4PFOA 4E7SA 3VKHA 3PO7A 1LRZA 4UVCB 5LJMA 1E2AA 4UIGA 5IPYA 4J36A 1HTJF 3LK2B 1B8SA 5LB7B 2GAHB 2XFUA 3Q5DA 2Y8DA 3BQIA 3UTFA 3TLVA 2B7SA 1HF8A 3RQUA 1DOCA 5EOWA 3RYCE 3N9NA 1M62A 2R064 2CMRA 1YW0A 2QYWA 2LM2A 4LU6A 1NENA 2CXDA 1ZDLA 2RGJA 4LFAT 2IDOB 3UFEA 5AQUB 5JTGA 3ONXA 1W0BA 4YFSA 1PIV4 3FZLB 4DMVA 4TM1A 2M67A 4G2AA 4PK6A 3VQRA 5JDHA 2VKOA 2DCFA 3ZLIA 3CMLA 1D7YA 4QWNB 4Z25A 4X65T 2PY5A 3ZKRA 5J60A 2VKJA 2PTFA 2V8SV 4DV7T 4B65A 4K7ZA 2Z6EA 4ZOLE 3HA4A 2LRLA 3LFMA 5FL1A 3CNPA 3R84B 4ZZCA 2VVNA 1VBD4 4KPRA 2W2UA 4UF0B 2GF3A 1D0ZA 3VU7H 3K7QX 2C3DA 3CGBA 2Q9QC 1J1JA 1PN0A 4FI5A 4MJWA 2JBVA 5KNLA 1H82A 3NKSA 3JSKA 2CRBA 2OALA 1CJ3A 1Q1WA 2UU9T 3O9XA 1GRTA 4IE0A 2Y6QA 1PXBA 2RGHA 2WZHA 3QB5A 2UXBT 3F8DA 3VR8A 2N2NA 2X8HA 1MQTD 3GYJA 4QX8B 3G5RA 2V7JA 3B57A 3C64A 4E0VA 4XAXB 2R7FA 3GD3A 1H6VA 5LGUB 4PK4A 1CBOA 2X51A 2ZZ0A 1WCRA 3LOVA 4H63H 3B13A 2NWBA 3O1IA 4A5XA 1IUSA 2GEWA 5KX5E 5FS7A 1OEDC 5AQQB 4Z2TA 2YVGA 1IBKT 4IDNA 3EDVA 2OLOA 1ZV4X 3ABVA 2Y6RA 4BJYA 4QKNA 3N9LA 1D0YA 4L0RA 3CIRA 1AR84 4RSLA 2V1DB 4BJNA 4CY6A 5TAOA 3KBTA 3GN5B 3UTEA 3IC9A 1D7LA 4B67A 2EQ8A 2VVLA 3EANA 3LBXA 2X9WA 3PU8A 2B1EA 4C77A 3CX6B 3RRWA 5BMVE 4BV6A 4ASKA 3FXEB 2OA1A 2EHOB 3CMMA 1FMVA 3AA6B 3RP7A 2NW8A 5IYZE 3ZSSA 2JKCA 2C73A 4HN9A 4O4JE 3R9UA 2FBWA 3TLTA 5JREA 3AE5A 3CK6A 5AQKB 3NH3X 5AQJB 4GYSA 2XUEA 1WYBA 3UKLA 4X64T 3DJDA 1GESA 2A3DA 4KMCA 3R6NA 5IQ4A 3NT6A 1BR0A 3CPJG 5HEGA 5LP6E 2YR4A 2KSRA 3RC3A 3A7MA 1RUH4 3VRAA 3LZXA 5DQWA 1EL8A 1GXFA 2XYOA 2KNDA 3RYFE 5KOWA 4HWDA 1JRYA 3ZT6A 2DWGA 2AQJA 3NRNA 3PUZF 1GALA 1Y56B 3RYHE 2VKDA 1IBLT 3ITJA 2FJAA 5HAXA 3SOLA 4JUYA 4U2ZA 4H4XA 4A79A 2LKHA 2C65A 1YKHB 2H7VC 3PUXF 5M0ZA 2OA5A 3D8XA 5F5WA 4AOXA 4AISA 4YT0A 3T2KA 2WOVA 4U2TA 2Y48B 3MZKB 4J31A 3UKQA 3SWHA 2RMU4 4AQFC 4Z90A 3Q6JA 4H4YA 4U31A 1NG4A 3EHZA 4JI3T 2CBJA 2JK6A 5HWXA 4YJ3E 1TYTA 2WB5A 2RA1A 4EQSA 3T2YA 5JCMA 1ZX9A 1D4CA 1BGNA 2JB1A 4OPIA 4KBMB 1MNEA 2FJBA 5LGNB 3NVOA 1VCTA 4U33A 4I43B 2XCGA 4NIQA 2VASA 4OX9T 3LDQB 3QOFA 3JC6D 1M64A 3NIXA 4II3A 2ZM8A 3AE9A 1GRFA 3MXZA 1FMWA 1W9RA 3OTOT 4IE7A 1HNWT 1IUTA 1KEYA 2M6BA 3C98B 1W0AA 2PFVA 1RUF4 2XM2A 4YSYA 2YU1A 1RUD4 3RF1A 1GRHA 3B6DA 4OYKA 4K8DA 1QLBA 4AKIA 1AR74 1E1HB 3PU3A 4HEAA 2XASB 4ZS3A 4X4JA 2F4VT 2XVFA 2V5ZA 3F57A 2C5JA 2NOXA 5EZYE 2JAEA 4H63V 1P2HA 2Z5XA 1P2EA 3NBXX 2ZBWA 3ZYKA 4MFRA 1YKEB 3FBZA 4H9SE 1WLXA 2HH7A 2BRAA 3JBG4 2LSGA 4JEUB 4KHPT 2P9BA 5HEOA 3RH3A 1ZOVA 2PW9A 3ALLA 4NXNT 4Q4V4 1BKWA 3NK1X 2D0UA 3SY4A 4I4TE 3L39A 4JI5T 2UXCT 2C64A 2CE7A 2YAUA 2NVKX 2N1GA 1ZY8A 1UX5A 1V9DA 2BC1A 2A9UA 3I3LA 1HNZT 1NDAA 2X0LB 2WHDA 4IHJE 1DNCA 2GH5A 2C7GA 2X67A 2V5DA 2XVHA 3ZYLA 5HXIA 4TM0A 1COYA 4WYVA 3CGEA 3C4NA 1UK5A 2BG9B 3QC9A 1XZYA 2YLRA 3JAFA 1YQZA 2WAUA 3GWHA 2E5VA 3L8KA 1IZNB 4YTPA 2R0GA 1XDPA 4BJMA 4P0BA 3LADA 2J47A 4H2QA 3FBSA 2DL1A 4GKJT 3QUJA 2AXDS 1E7PA 2WP9A 3ALMA 3ONJA 5ABFB 3FHNA 4RG3A 3CPZA 4Z2UA 5KMQA 1DJQA 3ZYMA 4UP3A 2CBIA 3O1HA 2L9QA 1HX1B 2MOZA 4EIPA 1HRV4 4AKHA 3GWDA 3T31A 2MBGA 5BULA 5JR9A 2PYLA 3WAKA 4H4PA 2BKNA 2QA7A 2YU2A 4PJMA 5FKYA 3MKDA 3PJAJ 4HGAA 2BZBA 5LHGB 2PG8A 2YG6A 2UXXB 2C0SA 3ANWA 4Z43A 5JQGE 3BI5A 4CN1A 2IVDA 3T1HT 4HFVA 3Q2MA 1GTEA 2UZZA 2E9XD 4O2AE 3QK6A 2YG3A 1PHHA 4FK1A 2EHOC 3IEEA 4WZXA 3QSSA 1N4WA 4LF4T 2Z5YA 2E9XA 4OK0A 4B66A 4DSGA 1GRBA 1CC2A 2HPLA 4YKGA 4EM4A 4UVAB 2GRTA 3V3OA 2C3CA 2R0PA 1PBCA 2QGSA 2GMHA 4B3ST 5JDFA 5FXVA 3GA8A 5AQMB 3HR0A 3GQKA 3IBPA 3M65A 4X5TA 2LM9A 4ZXLA 1UURA 2BS4A 2KLQA 1NHQA 1MMGA 4TV9E 4DR1T 5FYMA 2H3RA 4BJZA 1RUG4 3CNDA 5AQLB 5AQNB 2JQ9A 3Q9TA 3LK42 1ZEEA 3DK9A 5H6QB 2LJLA 1TDEA 3M13A 2WY2A 1VBA4 3BQLA 4H2NA 1NAFA 4YSXA 3GMBA 2R0CA 5LXTE 4HB9A 2CM0A 1M6IA 4HFDA 4ISSA 2XSBA 3BI4A 3K3QC 4CCRA 4GCMA 1JNZA 4UEMA 5ABHA 3AE7A 4PK5A 4F8HA 4WBOA 2GR3A 1Y0PA 4H9QC 4JNQA 5CA0E 4JI6T 1WYCA 2XFQA 2BC0A 4ZHQE 3QSMA 2X68A 3AWIA 4YTNA 3CQCB 2YDRA 4XZCA 4YHHT 2CFYA 1F3PA 1WR0A 1LTXR 2XLTA 4G9KA 3FBLA 1L9EA 4DNAA 5JVDE 3NK2X 4AKRB 5FMHA 4EIWA 4A98A 2WMNA 2RP4A 1JRXA 2RM24 3M0OA 3N5LA 4JDRA 5KMRA 1PBEA 3AYJA 4A9WA 2SPCA 4JI0T 3CNTA 2W61A 5LG3A 3SFDA 2WSSV 4LMKA 3SUCA 1OXZA 3RX6A 2XAQB 5LNKA 3M3ZB 3C4AA 4EMIA 3OYZA 5JCNA 5GONE 1GPEA 4G73A 4TM3A 5L47A 1YD8G 2BG9E 3UCLA 5LCYA 3HYXA 1N33T 3C4ZA 1VBE4 2DWKA 4L5GA 1CF3A 2LRKA 1JU2A 2IIUA 1U4QA 3NYCA 3P4RA 2R044 5FY7A 3HKDE 1OEDA 4BA9A 1HYUA 1FEWA 2ACZA 4BK1A 3GQHA 2QAEA 4JEHB 1PJ7A 3L3PA 3KPKA 3J9X1 5A1LA 1KDGA 3PUYF 2GMJA 3ZJ1A 2ZM0A 2V7LA 4YWOA 2J1DG 3QJ4A 3TLSA 1LPFA 3AA0B 3SX6A 4PFPA 1Z8UA 4AT0A 2VQ7A 3H8IA 1Z0PA 2VQBA 1XHZA 2BVMA 4BAYB 1FECA 4N78D 5ETWA 4LF5T 3KA7A 3P4SA 4IVOB 1HFAA 3ZPOA 4YHJA 3PS9A 3PJAA 2L3LA 4DV4T 2YKSA 1K4QA 2Y6XA 3P8CD 1CC6A 5LOVE 4IT4A 5KVHA 4F6RC 4EGWA 2J62A 2XJ7A 5J2TE 1GQEA 4X1KE 1PO14 2YVJA 2BG9C 2YLSA 2XQ5A 2BABA 2MAWA 4N9XA 1D4M4 4AP3A 4PNIA 3H37A 4DV3T 2LLYA 2IAKA 1ZP0A 4LF8T 3LBXB 2GB0A 5JRCA 3OC4A 4GDEA 2JJ9A 1E1NA 1HRI4 1MMAA 2LE8A 4OYJA 2JMHA 3EAMA 4TN7B 2YEVC 4AI6A 1DOBA 2IVEA 4MHCA 4UXNB 4U8PA 2KT9A 2QCUA 4CZZB 3SFEA 2EQ9A 1JRZA 3KLJA 4DUZT 4RHV4 2IHR1 3RPUA 1BEV4 5FY0A 2VWAA 3HI2A 1ZK7A 1F8RA 2A89A 1S94A 4IGUA 3VHLA 4Z44A 3JD74 1V59A 4U8LA 1LQTA 5U25A 2EX3A 5M10A 3LXDA 1HS7A 2YOEA 2W0HA 5FMNA 1RUE4 1B37A 4HWIB 3AE1A 1D5TA 1S35A 3ICTA 2CA5A 2WU2A 2YK0A 2WESA 1NHRA 3ZT7A 3PVCA 2MPKA 1H86A 1S2QA 5EB4A 1ONFA 3PUSA 4DIDB 3DJBA 4A7AA 2R4EA 3PDYA 5CB4E 1EL7A 2CWOA 1XANA 2HN2A 4BK2A 5CJ5A 4ZI2D 4G63A 3EUHA 2XVJA 1XNQT 4OFZA 3COXA 2YN6A 3CX8B 3N2GE 1Q1RA 5AQTB 3OPCA 4K5RA 5FL0A 2BCPA 2BXRA 3H4KA 3I1AA 5LV9A 3NTAA 4J2CA 4IL4A 3CNSA 3FZKB 2TPRA 4G74A 4ZCDA 5HXHA 1R084 1Y01A 1MXTA 3KV6A 4X9NA 1LVFA 5CKUA 3PUAA 2J3NA 5HCMA 2DHRA 2BS2A 4IDZA 3K7MX 3SZCA 3TLUA 4ICYA 4EV6A 1GV4A 2C72A 3M12A 4TZ4C 1ZHCA 1YQ4A 3RRCA 4U8NA 4GAPA 5J2UE 2XQAA 3CN8A 2DKHA 2HHHT 4Z91A 4C90A 1X79A 3UKAA 4O4IE 4FX9A 2BBJA 4CBQA 4AIUA 4C3YA 2X0HA 3AXJA 4CY8A 3Q5XA 4OVIA 1RUC4 4APNA 3D1CA 2WBLA 2XQ3A 5BR8T 3RHAA 1G8XA 2BDEA 1GREA 4HWHA 1FCDA 2V7MA 1VBB4 2WDRA 4U7IA 3IF9A 2HWC4 4P09A 3T8OA 2VQET 4AOSA 2YLZA 3AD7B 2GQFA 3Q5EA 4EMJA 4K22A 3NN0X 4A6NA 3V3NA 1I94T 1N4VA 2HWB4 5FY1A 1TDNA 4OPTA 4U8OA 4H4TA 4DV6T 1F6MA 3O0HA 1KNPA 3AYIA 3V5UA 2LSYA 1AR94 4J2WA 1N36T 3EI0A 3HZLA 5F3JA 4B64A 2LHRA 3MJXA 4CI3B 1AL24 3IHRA 2VRMA 1PS9A 1BR4A 5LMNT 3C50A 3S4UA 1NHPA 4JNAA 5KXJA 1L9CA 3N2KE 2NTYA 1FOHA 3ZN0B 1PBBA 2XQ7A 3NRYA 5LBMA 4QHOA 1PO24 3UT5E 4U7YA 3RP6A 1KK7A 3E0ZA 2LHNA 2R4JA 4Z8XA 3NZQA 4KHZF 3F2EA 3IA3A 3DK4A 4YY3T 2ODUA 2JB3A 2HN1A 2MYSA 4U8IA 4HE8A 3FIMB 3UKHA 1E1KA 2VL8A 4WX1A 5KOXA 4HA6A 3SGLA 3IHGA 2XLRA 4Q4X4 4OCGA 3PE0A 2W62A 4IV9A 3FZHB 4ZI3D 4OPCA 3KBUA 4NPPA 1D0XA 3KFWX 4EEBA 1NA1D 2ODVA 1JNRA 5J0ZA 3GN5A 2W4XA 2GAGB 1IUXA 3AVSA 1HG5A 1XI1A 3KDSE 4PAGA 3EPTA 1CC4A 3F8RA 2W00A 2LT3A 3Q5WA 5BUKA 1XWMA 3P4WA 4KUMB 4DBRA 4JLEA 4LF7T 4H7UA 5JDGA 2BKOA 2VK9A 4EEDA 4GOUA 3KVEA 3JAEA 1JOAA 3PTRB 2K3WA 2C5IT 4JI4T 1HCIA 3I9WA 4CQIA 1LJ1A 3LJPA 3HKEE 3NK0X 2XZEA 1RMU4 4ILCA 2V26A 4GIWA 2YDSA 4I58A 1XHCA 3G06A 1CJCA 1KNRA 4I59A 2YG4A 3NYFA 3OZ2A 5L3EB 5FS8A 4QX7B 3T37A 4X66T 1NPXA 4DV0T 3C4XA 1VG9A 1YQ3A 4HFBA 3ANWB 4PW8A 4NTEA 5KWFA 5LGTB 5M4YA 4YTMA 1N4UA 4ILBA 5DBJA 3NRXA 1IUWA 4JI8T 3SZWA 4IE5A 1BGJA 4M1PA 1F8WA 3AB1A 4X20E 2XQ4A 3UU6A 4NUUA 3TLWA 2WM9A 3RYIE 3N9QA 1PBFA 5GSNA 1Z7S4 3UU3A 4B68A 5EK3A 1MIVA 5HYAA 3S61A 3K8PC 2E9XB 4ZCCA 1IAPA 4UDRA 4CCQA 1LVLA 1TDKA 4EQXA 4QXHB 4TM4A 2Q7VA 3P4QA 3UKPA 2K9AA 1FEAA 3JCFA 3ZCJA 3K1SA 3UOXA 3FG2P 3KV4A 3AA1B 2CVJA 3KV9A 1D1BA 4Q4W4 2L8KA 5HXSA 1KSSA 1PJ5A 1ZOYA 2YM1A 3A5XA 2V3BA 2M6IA 2OV9A 2VKHA 4NTCA 2PHHA 2CLYB 4WW0A 2ZM6T 2I6HA 2XQ9A 1RUI4 1XNRT 3LSVA 2PZSA 4LMJA 5AQOB 4DUYT 2B9YA 4NEVA 4ZS2A 1TRBA 1X31B 2X8GA 2X0YA 3DMEA 3AXBA 4PAAA 4DR4T 1XMOT 3NZPA 5TR3A 5L3CB 3UP4A 4G6HA 2DI4A 5HEHA 1ZMCA 2APGA 2RS34 3ZN1B 3L09A 3AE2A 5AQVB 5LHIB 3UU5A 1T8BA 5L3DB 5ABGA 3QFAA 2UUAT 2CHOA 2QA2A 1K0IA 4TUYE 3VR9A 5L4HA 3C96A 4NWZA 4Z24A 1BR1A 3UUNA 3TKLB 5KMPA 4IDPA 2XAGB 3RKGA 1VCSA 1GETA 2H89A 3MACA 4U2SA 3PV0F 3ZYXA 2WS3A 2CXFA 2YVFA 1NAAA 4DR7T 3MA9A 5FS9A 3HYVA 4LFCT 1FIOA 3B5MA 4EZ4A 3P1WA 3URHA 4PJJA 1QO8A 3RIUA 5CQFA 4IREA 3ETUA 2B9WA 4ILUA 2VB6A 4H4RA 2WDQA 4JBWF 4USRA 5FS6A 5CA1E 3SQPA 1RHI4 3AB3B 2LSIA 1H81A 3U78A 4JY3A 3NN6X 4H4SA 3FZFB 3RQWA 4J34A 3B3RA 3FZMB 5EK2A 1LQUA 1XHXA 2ARDA 2TMDA 4EYUA 1VG0A 2EQ6A 3ZCIA 3JC6C 1L9DA 1Z6LA 1SEZA 1ASJ4 2CCQA 2WCAA 1K5MD 1DU2A 3DGZA 2YWLA 2V6YA 4REKA 1M7KA 3ZMSB 3P7IA 4GDPA 5LJNA 4WNKA 4H2RA 3UTHA 2YLWA 1S3EA 1MMDA 2PYXA 4JV5T 2YG7A 4B3TT 4BK3A 3KU9A 2KWHA 1HR0T 4IIJE 4EM3A 1EL5A 3V76A 3X1DA 3AAAB 4QH5A 1MO9A 3PUVF 3AECA 2PJQA 3RGLA 4IA5A 2JB2A 4KX6A 3J7Yq 2I0ZA 1MIYA 2VZ2A 3GD4A 4YJ2E 1JEHA 2BK5A 2AAQA 2RR14 3UQ7A 2HPJA 1SUMB 1GOSA 1RSGA 4FDCB 1ELIA 4ZN0A 3GMCA 2WDVA 5E0OA 2WP6A 5L2LA 3I9YA 4CN6A 3GMIA 5BVAA 1O94A 4K0UA 2Q9QD 3FB2A 2E4GA 1D1AA 5J1GA 4E7ZA 4U8JA 4OHFA 3BHKA 3ZJ2A 4U8KA 3FXDB 4MLKA 4OPLA 3BI2A 3CQXC 1GTHA 2NPXA 2Q9QA 2B76A 5HEUA 2GR2A 5CFBA 1I6ZA 5AQHB 1RYIA 4LIIA 3S5WA 4LMLA 1UCUA 3UOZA 2I59A 2RS14 3PUWF 3OJAA 3AD9B 3HKBE 2VVMA 3O1JA 3GDPA 5KMSA 4PJNA 4ANJA 2D0TA 1OJTA 5JRCB 4IE6A 4V1Av 1E6EA 2WMOA 1GSNA 3G5SA 1D4DA 4YXDA 1FL2A 3NYEA 1BWCA 3GRSA 1QSDA 2WEUA 3PURA 4AQYT 4J56A 2V7IA 1OWAA 5KVIA 4JY2A 2JQKA 2A8XA 1B5QA 3UFGA 3NGCX 4J33A 4MALA 2X50A 2XLPA 1CUNA 3V5SA 1TDFA 3RKOA 3ZC0A 2HQMA 2NR4A 2LOPA 3NKZA 5EK4A 5LYJE 4JI7T 2NW9A 2BS3A 4JYAT 3E1TA 1UUSA 3WI3A 5HHFA 3CTYA 4XWZA 3GRTA 3UUMA 3U3IA 4FK1C 2DKIA 4EQRA 3CKDA 4X9MA 3AD8B 2QRXA 1ZKEA 2ZZCA 2XVEA 2UUCT 4L9IA 1W4XA 1RP0A 2E9XC 1AR64 2JMKA 2V6XA 5HY5A 3AAEB 5JCIA 4UELA 1VDCA 4LA1A 1XPQA 2OLNA 4JN9A 1NHSA 1YKJA 2D5UA 2V60A 2QVAA 2XM1A 2X8CA 3DJJA 4Y4LA 4DNDA 4TX5A 2Q0KA 2JRKA 2WOWA 3OKQA 4D03A 1XDOA 2PBIA 3H3MA 4DBQA 1S3BA 2YM2A 5HCJA 2VL0A 3ZEFB 1J5WA 4USQA 1CHUA 1KF6A 3QVRA 3QFBA 1N34T 2R9ZA 1LVKA 5DQVA 5EBKA 4EIQA 2CLYC 2XTLA 3FI7A 4EB6E 2CPTA 1PBDA 4ECHA 3KVAA 2MTQA 3QVPA 5BRTA 2W0GA 3IF8B 2XAHB 1T72A 4H9PC 2QA1A 3PUQA 4KP3C 2A87A 4HFCA 1SE7A 1UGOA 5FXWA 2WOIA 2LOSA 1BZLA 1GERA 3AXJB 3F8PA 3SM8A 4EAHA 1YY5A 3EAOA 5JDMA 4GR1A 4ISTA 1OEDE 1DXLA 4XXGA 2WETA 1Y64B 4GK5E 1PJ6A 2WU5A 2C5KT 4A65A 2BA9A 3L8RA 2Q6UA 1E1LA 1CL0A 3UUBA 1Q9IA 4UV8B 1IJ5A 1TYPA 4U74A 4AQFA 2E5LT 5L46A 4A6NB 1N1PA 2C75A 3P9UA 3LB8A 3UTKA 4CI1B 2KZ7B 4HWCA 2OLTA 4A5LA 5FP3A 5F8PA 5GRTA 2YINA 2IC9A 1COV4 4KI0F 4HKAA 1YXRA 4GF7A 4OPDA 2BYBA 3VRDB 2LFCA 3HKCE 5FVLA 3CQGB 1WRDA 1OJCA 4B63A 3ZMUB 3RC8A 2EQ7A 3ICRA 3I6DA 3VKGA 1IJ6A 5IQ1A 2GK9A 1XMQT 4CXWA 3GWFA 1GRAA 3UQ4A 4H9OC 2YLTA 2JIWA 4JI1T 3NLCA 4Z2RA 1R8IA 4IDOA 2XPKA 2XFNA 2WQYA 2W66A 1T7SA 2J4GA 3T2ZA 3I0QA 2JQHA 4A97A 4EYYR 2R45A 4LF6T 4EOZB 3CGCA 1PVC4 4PDWD 1DODA 1HG2A 5JDQA 3N9PA 4QXCB 3DTOA 3OVUA 4TNWA 4A99A 4YSHA 4X1YE 1MOKA 2CXLA 1VRQB 4U2YA
chains in the Genus database with same CATH topology
1GRGA 4GRTA 4EM4A 2GRTA 4I58A 3DH9A 1XHCA 2C3CA 2R0PA 1CJCA 1PBCA 1KNRA 3DA1A 4I59A 2GMHA 2YG4A 3NYFA 3OZ2A 4YKFA 3ALJA 3P4PA 4H4WA 5FS8A 3T37A 2YR5A 1NPXA 1VG9A 1YQ3A 3ATQA 3GQKA 4H4UA 1TDOA 3PO7A 4NTEA 5KWFA 2VVLG 1NHQA 2BS4A 4YTMA 4B1BA 1N4UA 2C70A 5DBJA 5IPYA 4J36A 4OPUA 1IUWA 4BJZA 3CNDA 1B8SA 2GAHB 2XFUA 3ATRA 3H8LA 3SZWA 1BGJA 3REDA 1F8WA 3GSIA 3Q9TA 3AB1A 3UTFA 1PXAA 2CULA 3DK9A 2B7SA 5GSNA 1PBFA 2X99A 4B68A 3M13A 1TDEA 1DOCA 5EOWA 3S61A 4ZCCA 4H2NA 4UDRA 3RNMA 4CCQA 1LVLA 2IIDA 3ICSA 4YSXA 1TDKA 3GMBA 2R0CA 4EQXA 4HB9A 4TM4A 4LU6A 1M6IA 1NENA 1ZDLA 2RGJA 3UOVA 4BURA 4RG4A 3BI4A 1VQWA 2Q7VA 4CCRA 4GCMA 1JNZA 3P4QA 3UKPA 4B69A 3AE7A 1FEAA 2GR3A 1Y0PA 4JNQA 4IVMB 1D4EA 4TLZA 3AE6A 3UOXA 3SYIA 4TM1A 1PXCA 3VQRA 3FG2P 1D7YA 2CVJA 3K30A 4Z25A 2XFQA 2BC0A 5J60A 3QSMA 2X3NA 3AWIA 1KSSA 1PJ5A 1ZOYA 2YM1A 4YTNA 2GR1A 1H7XA 4B65A 2CFYA 4K7ZA 2V3BA 3AE4A 1K0LA 1F3PA 1LTXR 2XLTA 1KSUA 4G9KA 4DSHA 3CNPA 4C3XA 4NTCA 2PHHA 1NEKA 1L9EA 3KPFA 1O5WA 4DNAA 4KPRA 2GF3A 3AEDA 3AEBA 3NK2X 3K7QX 5FMHA 2B9YA 1XDIA 2C3DA 3CGBA 1TRBA 1ZMDA 4NEVA 1X31B 2X8GA 4IA6A 3DMEA 1PN0A 2RABA 3AXBA 4MJWA 4PAAA 3G5QA 1JRXA 2JBVA 3M0OA 5KNLA 1H82A 4JDRA 3NKSA 3JSKA 5TR3A 5KMRA 2OALA 3UP4A 1CJ3A 1PBEA 1Q1WA 3AYJA 1ZMCA 4G6HA 2APGA 4O5UA 3UP5A 4A9WA 3AE2A 1GRTA 2Y6QA 3CNTA 1PXBA 4H2PA 3SFDA 2RGHA 3QFAA 2O9ZA 4II2A 2QA2A 3SUCA 3F8DA 1K0IA 3VR9A 3VR8A 2X8HA 3C96A 3GDNA 4NWZA 5ER0A 3C4AA 4Z24A 3UTGA 4CRTA 3GYJA 4EMIA 3G5RA 2XFOA 5JCNA 5KMPA 4E0VA 1GPEA 4G73A 3GD3A 1H6VA 4TM3A 2AR8A 1GETA 2H89A 2WP5A 3UCLA 3HYXA 1CBOA 4U2SA 1OJ9A 2ZZ0A 3LOVA 3ZYXA 4GUVA 2WS3A 1CF3A 2YVFA 1IUUA 4YSZA 1JU2A 1NAAA 2V61A 5FS9A 1IUSA 3NYCA 3HYVA 3P4RA 3P1WA 3URHA 4UDPA 1HYUA 2GEWA 2ACZA 1QO8A 4BK1A 5FS7A 5CQFA 4Z2TA 3GQHA 2B9WA 2QAEA 2YVGA 4H4RA 3SXIA 2WPFA 2WDQA 4USRA 1PJ7A 5FS6A 2OLOA 3ABVA 2Y6RA 3SQPA 4BJYA 3KPKA 1KDGA 3CIRA 1OJDA 4UDQA 2GMJA 3AEFA 1H81A 3FPZA 3AE8A 4NEWA 4JY3A 4RSLA 4CNKA 4CY6A 3NN6X 4H4SA 4YWOA 4J34A 3B3RA 3CGDA 3UTEA 3IC9A 3T14A 1IJHA 3QJ4A 1LQUA 1D7LA 2ARDA 1LPFA 4B67A 2TMDA 2EQ8A 2VOUA 1VG0A 3SX6A 2EQ6A 2VVLA 3EANA 4AT0A 1L9DA 1Z6LA 2YLXA 1SEZA 3LZWA 4NZHA 2VQ7A 5C3JA 4C77A 3DGZA 3H8IA 2YWLA 2XFPA 4BV6A 2VQBA 4REKA 2OA1A 3CMMA 4GDPA 3RP7A 1FECA 4H2RA 4XWRA 3UTHA 2YLWA 1S3EA 3KA7A 2JKCA 3P4SA 2RGOA 3HYWA 4IVOB 2PYXA 2C73A 2YG7A 4EQWA 3R9UA 2FBWA 3PS9A 3SZ0A 3KU9A 4BK3A 4EM3A 1EL5A 1ZKQA 3AE5A 2XDOA 1K4QA 1Y56A 2YR6A 1CC6A 3V76A 3NH3X 1MO9A 5KVHA 3AECA 4IA5A 2BACA 2YVJA 2WPCA 3UKLA 2GQWA 2BABA 2JB2A 2YLSA 3IWAA 4KX6A 1GESA 2I0ZA 2VZ2A 3DJDA 3GD4A 4N9XA 4AP3A 1JEHA 2BK5A 3NT6A 5IQ4A 1F8SA 2AAQA 4M52A 3KKJA 1GOSA 1RSGA 3CPJG 2YR4A 4FDCB 1ZP0A 1ELIA 5L46A 4ZN0A 4AT2A 2GB0A 3GMCA 2WDVA 3OC4A 2WP6A 4GDEA 3VRAA 3LZXA 1E1NA 5BVAA 2C67A 1O94A 1EL8A 1GXFA 1H84A 2XYOA 3GYIA 5KOWA 1O95A 5HYMA 1JRYA 2E4GA 2H88A 1DOBA 2IVEA 4U8PA 3VRBA 3ADAB 2C76A 2QCUA 4U8JA 3SFEA 2OAMA 2EQ9A 3BHKA 1JRZA 3KLJA 2AQJA 4U8KA 3NRNA 1GALA 2E1MA 2V6OA 4OPLA 1ZK7A 3BI2A 1F8RA 1Y56B 2A89A 4Y4NA 4Z44A 1GTHA 2NPXA 1FEBA 2B76A 1V59A 2GR2A 2FJAA 3ITJA 5J7XA 4U8LA 1LQTA 4H4XA 5U25A 4A79A 5M10A 1RYIA 2C65A 3LXDA 4LIIA 3S5WA 2XLUA 2W0HA 5M0ZA 3UOZA 2YQUA 3D8XA 4AOXA 1B37A 3AE1A 3AD9B 4YT0A 1D5TA 2VVMA 3T2KA 3UKKA 3ICTA 2WOVA 2WU2A 3GDPA 4U2TA 5KMSA 2WESA 1OJTA 1NHRA 4U8MA 4J31A 3UKQA 1E6EA 4H50A 1GSNA 1H86A 1GT8A 1S2QA 3PVCA 5EB5A 5EB4A 3Q6JA 1ONFA 3G5SA 4H4YA 1NG4A 1D4DA 5C2TA 4YXDA 2JK6A 4K2XA 1FL2A 3AEGA 4A7AA 2R4EA 3NYEA 1TYTA 1EL7A 3EF6A 1BWCA 3GRSA 4TLXA 4PABA 3T2YA 4EQSA 5JCLA 2WEUA 1DOEA 1XANA 1D4CA 1ZX9A 5JCMA 1BGNA 4J56A 2JB1A 4OPIA 4BK2A 2FJBA 5KVIA 4JY2A 2BCGG 3CPHG 2A8XA 2YG5A 3BNUA 1B5QA 3NGCX 2XVJA 4J33A 2V3AA 4P9SA 2XCGA 1EBDA 3COXA 3II4A 2X50A 3AEEA 2XLPA 1Q1RA 1TDFA 3UOYA 2HQMA 4K5RA 1M64A 2B9XA 2BXRA 2BCPA 3H4KA 3NIXA 4II3A 2FJEA 2GVCA 5LV9A 3AE9A 1GRFA 3NTAA 3CNSA 1E39A 2BS3A 3E1TA 5HHFA 2TPRA 4G74A 3CTYA 4XWZA 3GRTA 4ZCDA 1IUTA 3UKFA 4JQ9A 1MXTA 2BRYA 4FK1C 4X9NA 2DKIA 4EQRA 5CKUA 4YSYA 2J3NA 4X9MA 2R46A 4H4QA 3AD8B 2BS2A 2ZZCA 3K7MX 2XVEA 4AP1A 3SZCA 1H83A 4ICYA 1GRHA 2Q0LA 1GV4A 2C72A 3B6DA 3M12A 1LV0A 4WCTA 1YQ4A 4K8DA 1W4XA 4U8NA 1QLBA 4GAPA 1RP0A 3CN8A 2DKHA 4OPGA 4X4JA 5JCKA 2XVFA 2V5ZA 3UKAA 4FX9A 4D04A 1BF3A 2BK3A 4CBQA 5HY5A 4C3YA 4CY8A 4OVIA 5JCIA 1VDCA 2C4CA 5U1OA 4APNA 3D1CA 4C5OA 4LA1A 1XPQA 2JAEA 2OLNA 5U63A 4JN9A 1NHSA 3RHAA 1YKJA 1P2HA 2Z5XA 1H7WA 1P2EA 1UKVG 2V60A 2ZBWA 1CJ2A 1GREA 2X8CA 3DJJA 3IHMA 4Y4LA 1FCDA 1KFYA 2BRAA 2WBAA 2Q0KA 2WOWA 4D03A 2WDRA 1ZOVA 3BHFA 3IF9A 3V3OA 3ALLA 3K7TA 1S3BA 1BKWA 2YM2A 3NK1X 4AOSA 2YLZA 2GR0A 1AOGA 3AYLA 4USQA 3AD7B 1CHUA 1KF6A 3ISHA 3QFBA 3QVRA 3SY4A 2GQFA 2GV8A 2R9ZA 5EBKA 4EMJA 4EIQA 4K22A 3CPIG 3NN0X 3FMWA 1PBDA 1GNDA 3V3NA 4A6NA 1N4VA 2C64A 1TDNA 2YAUA 4OPTA 4U8OA 4H4TA 3QVPA 1F6MA 3O0HA 5BRTA 1KNPA 2NVKX 3AYIA 2CDUA 4J2WA 1ZY8A 2QA1A 2BC1A 3HZLA 1L0VA 3QSEA 3I3LA 2A87A 1NDAA 3WE0A 2WHDA 2GH5A 1DNCA 3NHOX 4B64A 4C74A 2C7GA 4DGKA 4J57A 2WOIA 1BZLA 1GERA 3F8PA 3SM8A 2XVHA 1YY5A 2BXSA 1GEUA 3NTDA 2VRMA 3RP8A 1PS9A 2BK4A 3EAOA 4TM0A 5HXIA 3DGHA 2F5ZA 1COYA 3KD9A 4GR1A 3CGEA 1NHPA 3C4NA 1DXLA 4XXGA 2WETA 1PJ6A 2YLRA 5KXJA 1L9CA 4JNAA 2WU5A 1FOHA 1YQZA 4Z26A 2E5VA 1PBBA 3L8KA 2VRLA 3ZDNA 2BA9A 4A65A 3CNJA 4YTPA 2R0GA 3RP6A 2Q6UA 2R4JA 1E1LA 1CL0A 1Q9IA 1OJAA 3DK4A 3LADA 4G6GA 1PDHA 3FBSA 2JB3A 1TYPA 4H2QA 4U8IA 1E7PA 2WP9A 3FIMB 3UKHA 3ALMA 4ADWA 4A6NB 1N1PA 2C75A 4RG3A 1E1KA 3P9UA 4GAVA 3LB8A 4WX1A 3T0KA 5KOXA 3L1RA 4Z2UA 4HA6A 5KMQA 1DJQA 3IHGA 1REOA 3SGLA 4A5LA 2XLRA 4UP3A 3AE3A 4O5QA 4OCGA 5GRTA 5KRQA 1NG3A 4EIPA 2XLSA 4IV9A 4OPCA 3GWDA 4GF7A 4OPDA 2BYBA 3T31A 3VRDB 5BULA 3AEAA 4H4ZA 4H4PA 1JNRA 2FJDA 1K0JA 4Y4MA 1DJNA 2LFCA 1QJDA 3SZFA 4CNJA 2GAGB 1IUXA 1OJCA 2XVIA 3DJGX 2C66A 1B4VA 4B63A 2EQ7A 3ICRA 2YG6A 3I6DA 4H4VA 2B7RA 4NNJA 3EPTA 4NTDA 3NNEA 1IUVA 4Z43A 5IQ1A 1CC4A 3F8RA 3BI5A 3GWFA 1GRAA 3GYXA 2IVDA 5BUKA 1S2YA 2YLTA 1GTEA 2UZZA 2WPEA 3BNMA 2ZZBA 3NLCA 4Z2RA 1E1MA 2YG3A 1PHHA 4FK1A 2XFNA 2WQYA 4EMWA 4ECHA 3T2ZA 4H7UA 3DJEA 2R45A 3QSSA 1N4WA 3DK8A 1EL9A 3KVEA 3CGCA 1JOAA 1DODA 2Z5YA 3NG7X 4U2LA 1CJ4A 4A99A 4B66A 4YSHA 1LJ1A 1GRBA 4DSGA 3LJPA 1CC2A 1MOKA 1VRQB 4K5SA 3NK0X 4YKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRG A;  4GRT A;  4EM4 A;  2GRT A;  4I58 A;  3DH9 A;  1XHC A;  2C3C A;  2R0P A;  1CJC A;  1PBC A;  1KNR A;  3DA1 A;  4I59 A;  2GMH A;  2YG4 A;  3NYF A;  3OZ2 A;  4YKF A;  3ALJ A;  3P4P A;  4H4W A;  5FS8 A;  3T37 A;  2YR5 A;  1NPX A;  1VG9 A;  1YQ3 A;  3ATQ A;  3GQK A;  4H4U A;  1TDO A;  3PO7 A;  4NTE A;  5KWF A;  2VVL G;  1NHQ A;  2BS4 A;  4YTM A;  4B1B A;  1N4U A;  2C70 A;  5DBJ A;  5IPY A;  4J36 A;  4OPU A;  1IUW A;  4BJZ A;  3CND A;  1B8S A;  2GAH B;  2XFU A;  3ATR A;  3H8L A;  1BGJ A;  3RED A;  1F8W A;  3GSI A;  3Q9T A;  3AB1 A;  3UTF A;  1PXA A;  2CUL A;  3DK9 A;  2B7S A;  5GSN A;  1PBF A;  2X99 A;  4B68 A;  3M13 A;  1TDE A;  1DOC A;  5EOW A;  3S61 A;  4ZCC A;  4H2N A;  4UDR A;  3RNM A;  4CCQ A;  1LVL A;  2IID A;  3ICS A;  4YSX A;  1TDK A;  3GMB A;  2R0C A;  4EQX A;  4HB9 A;  4TM4 A;  4LU6 A;  1M6I A;  1NEN A;  1ZDL A;  2RGJ A;  3UOV A;  4BUR A;  4RG4 A;  3BI4 A;  1VQW A;  2Q7V A;  4CCR A;  4GCM A;  1JNZ A;  3P4Q A;  3UKP A;  4B69 A;  3AE7 A;  1FEA A;  2GR3 A;  1Y0P A;  4JNQ A;  4IVM B;  1D4E A;  4TLZ A;  3AE6 A;  3UOX A;  4TM1 A;  1PXC A;  3VQR A;  3FG2 P;  1D7Y A;  2CVJ A;  3K30 A;  4Z25 A;  2XFQ A;  2BC0 A;  5J60 A;  3QSM A;  2X3N A;  3AWI A;  1KSS A;  1PJ5 A;  1ZOY A;  2YM1 A;  4YTN A;  2GR1 A;  1H7X A;  4B65 A;  2CFY A;  4K7Z A;  2V3B A;  3AE4 A;  1K0L A;  1F3P A;  1LTX R;  2XLT A;  1KSU A;  4DSH A;  3CNP A;  4C3X A;  4NTC A;  2PHH A;  1NEK A;  1L9E A;  3KPF A;  1O5W A;  4DNA A;  4KPR A;  2GF3 A;  3AED A;  3AEB A;  3NK2 X;  3K7Q X;  5FMH A;  2B9Y A;  1XDI A;  2C3D A;  3CGB A;  1TRB A;  1ZMD A;  4NEV A;  1X31 B;  2X8G A;  4IA6 A;  3DME A;  1PN0 A;  2RAB A;  3AXB A;  4MJW A;  4PAA A;  3G5Q A;  1JRX A;  2JBV A;  3M0O A;  1H82 A;  4JDR A;  3NKS A;  3JSK A;  5TR3 A;  2OAL A;  3UP4 A;  1CJ3 A;  1PBE A;  1Q1W A;  3AYJ A;  1ZMC A;  4O5U A;  2APG A;  3UP5 A;  4A9W A;  3AE2 A;  1GRT A;  2Y6Q A;  3CNT A;  1PXB A;  4H2P A;  3SFD A;  2RGH A;  3QFA A;  2O9Z A;  2QA2 A;  3SUC A;  3F8D A;  1K0I A;  3VR9 A;  3VR8 A;  2X8H A;  3C96 A;  3GDN A;  5ER0 A;  3UTG A;  3C4A A;  4Z24 A;  4CRT A;  3GYJ A;  4EMI A;  3G5R A;  2XFO A;  5JCN A;  4E0V A;  1GPE A;  3GD3 A;  1H6V A;  4TM3 A;  2AR8 A;  1GET A;  2H89 A;  2WP5 A;  3UCL A;  1CBO A;  4U2S A;  1OJ9 A;  2ZZ0 A;  3LOV A;  3ZYX A;  4GUV A;  2WS3 A;  1CF3 A;  2YVF A;  1IUU A;  4YSZ A;  1JU2 A;  1NAA A;  2V61 A;  5FS9 A;  1IUS A;  3NYC A;  3P4R A;  3P1W A;  3URH A;  4UDP A;  1HYU A;  2GEW A;  2ACZ A;  1QO8 A;  4BK1 A;  5FS7 A;  5CQF A;  4Z2T A;  3GQH A;  2B9W A;  2QAE A;  2YVG A;  4H4R A;  2WPF A;  2WDQ A;  4USR A;  1PJ7 A;  5FS6 A;  2OLO A;  3ABV A;  2Y6R A;  3SQP A;  4BJY A;  1KDG A;  3CIR A;  1OJD A;  4UDQ A;  2GMJ A;  3AEF A;  1H81 A;  3FPZ A;  3AE8 A;  4NEW A;  4JY3 A;  4RSL A;  4CNK A;  4CY6 A;  3NN6 X;  4H4S A;  4YWO A;  4J34 A;  3B3R A;  3CGD A;  3UTE A;  3IC9 A;  1IJH A;  3QJ4 A;  1LQU A;  1D7L A;  2ARD A;  1LPF A;  4B67 A;  2TMD A;  2EQ8 A;  2VOU A;  1VG0 A;  2EQ6 A;  2VVL A;  3EAN A;  4AT0 A;  1L9D A;  1Z6L A;  2YLX A;  1SEZ A;  3LZW A;  4NZH A;  2VQ7 A;  5C3J A;  4C77 A;  3DGZ A;  3H8I A;  2YWL A;  2XFP A;  4BV6 A;  2VQB A;  4REK A;  2OA1 A;  4GDP A;  3RP7 A;  1FEC A;  4H2R A;  4XWR A;  3UTH A;  2YLW A;  1S3E A;  3KA7 A;  2JKC A;  3P4S A;  2RGO A;  4IVO B;  2PYX A;  2C73 A;  2YG7 A;  4EQW A;  3R9U A;  2FBW A;  3PS9 A;  4BK3 A;  3KU9 A;  4EM3 A;  1EL5 A;  1ZKQ A;  3AE5 A;  2XDO A;  1K4Q A;  1Y56 A;  2YR6 A;  1CC6 A;  3V76 A;  3NH3 X;  1MO9 A;  5KVH A;  3AEC A;  4IA5 A;  2BAC A;  2YVJ A;  2WPC A;  3UKL A;  2GQW A;  2BAB A;  2JB2 A;  2YLS A;  3IWA A;  4KX6 A;  1GES A;  2I0Z A;  2VZ2 A;  3DJD A;  3GD4 A;  4N9X A;  4AP3 A;  1JEH A;  2BK5 A;  3NT6 A;  5IQ4 A;  1F8S A;  2AAQ A;  4M52 A;  3KKJ A;  1GOS A;  1RSG A;  3CPJ G;  2YR4 A;  4FDC B;  1ZP0 A;  1ELI A;  5L46 A;  4ZN0 A;  4AT2 A;  2GB0 A;  3GMC A;  2WDV A;  3OC4 A;  2WP6 A;  4GDE A;  3VRA A;  3LZX A;  1E1N A;  5BVA A;  2C67 A;  1O94 A;  1EL8 A;  1GXF A;  1H84 A;  2XYO A;  3GYI A;  5KOW A;  1O95 A;  5HYM A;  1JRY A;  2E4G A;  2H88 A;  1DOB A;  2IVE A;  4U8P A;  3VRB A;  3ADA B;  2C76 A;  2QCU A;  4U8J A;  3SFE A;  2OAM A;  2EQ9 A;  3BHK A;  1JRZ A;  3KLJ A;  2AQJ A;  4U8K A;  3NRN A;  1GAL A;  2E1M A;  2V6O A;  4OPL A;  1ZK7 A;  3BI2 A;  1F8R A;  1Y56 B;  2A89 A;  4Y4N A;  4Z44 A;  1GTH A;  2NPX A;  1FEB A;  2B76 A;  1V59 A;  2GR2 A;  2FJA A;  3ITJ A;  5J7X A;  4U8L A;  1LQT A;  4H4X A;  5U25 A;  4A79 A;  5M10 A;  1RYI A;  2C65 A;  3LXD A;  4LII A;  3S5W A;  2XLU A;  2W0H A;  5M0Z A;  3UOZ A;  2YQU A;  3D8X A;  4AOX A;  1B37 A;  3AE1 A;  3AD9 B;  4YT0 A;  1D5T A;  2VVM A;  3UKK A;  3ICT A;  2WOV A;  2WU2 A;  3GDP A;  4U2T A;  2WES A;  1OJT A;  1NHR A;  4U8M A;  4J31 A;  3UKQ A;  1E6E A;  4H50 A;  1GSN A;  1H86 A;  1GT8 A;  1S2Q A;  3PVC A;  5EB5 A;  5EB4 A;  3Q6J A;  1ONF A;  3G5S A;  4H4Y A;  1NG4 A;  1D4D A;  5C2T A;  4YXD A;  2JK6 A;  4K2X A;  1FL2 A;  3AEG A;  4A7A A;  2R4E A;  3NYE A;  1TYT A;  1EL7 A;  3EF6 A;  1BWC A;  3GRS A;  4TLX A;  4PAB A;  4EQS A;  5JCL A;  2WEU A;  1DOE A;  1XAN A;  1D4C A;  1ZX9 A;  5JCM A;  1BGN A;  4J56 A;  2JB1 A;  4OPI A;  4BK2 A;  2FJB A;  5KVI A;  4JY2 A;  2BCG G;  3CPH G;  2A8X A;  2YG5 A;  3BNU A;  1B5Q A;  3NGC X;  2XVJ A;  4J33 A;  2V3A A;  4P9S A;  2XCG A;  1EBD A;  3COX A;  3II4 A;  2X50 A;  3AEE A;  2XLP A;  1Q1R A;  1TDF A;  3UOY A;  2HQM A;  4K5R A;  1M64 A;  2B9X A;  2BXR A;  2BCP A;  3H4K A;  3NIX A;  2FJE A;  2GVC A;  5LV9 A;  3AE9 A;  1GRF A;  3NTA A;  3CNS A;  1E39 A;  2BS3 A;  3E1T A;  5HHF A;  2TPR A;  3CTY A;  4XWZ A;  3GRT A;  4ZCD A;  1IUT A;  3UKF A;  4JQ9 A;  1MXT A;  4FK1 C;  4X9N A;  2DKI A;  4EQR A;  5CKU A;  4YSY A;  2J3N A;  4X9M A;  2R46 A;  4H4Q A;  3AD8 B;  2BS2 A;  2ZZC A;  3K7M X;  2XVE A;  4AP1 A;  1H83 A;  4ICY A;  1GRH A;  2Q0L A;  1GV4 A;  2C72 A;  3B6D A;  3M12 A;  1LV0 A;  4WCT A;  1YQ4 A;  4K8D A;  1W4X A;  4U8N A;  1QLB A;  1RP0 A;  3CN8 A;  2DKH A;  4OPG A;  4X4J A;  5JCK A;  2XVF A;  2V5Z A;  3UKA A;  4FX9 A;  4D04 A;  1BF3 A;  2BK3 A;  4CBQ A;  5HY5 A;  4C3Y A;  4CY8 A;  4OVI A;  5JCI A;  1VDC A;  5U1O A;  4APN A;  3D1C A;  4C5O A;  4LA1 A;  1XPQ A;  2JAE A;  2OLN A;  5U63 A;  4JN9 A;  1NHS A;  3RHA A;  1YKJ A;  1P2H A;  2Z5X A;  1H7W A;  1P2E A;  1UKV G;  2V60 A;  2ZBW A;  1CJ2 A;  1GRE A;  2X8C A;  3DJJ A;  3IHM A;  4Y4L A;  1FCD A;  1KFY A;  2WBA A;  2Q0K A;  2WOW A;  4D03 A;  2WDR A;  1ZOV A;  3BHF A;  3IF9 A;  3V3O A;  3ALL A;  3K7T A;  1S3B A;  1BKW A;  2YM2 A;  3NK1 X;  4AOS A;  2YLZ A;  2GR0 A;  1AOG A;  3AYL A;  4USQ A;  3AD7 B;  1CHU A;  1KF6 A;  3ISH A;  3QFB A;  3QVR A;  2GQF A;  2GV8 A;  2R9Z A;  5EBK A;  4EMJ A;  4EIQ A;  4K22 A;  3CPI G;  3NN0 X;  3FMW A;  1PBD A;  1GND A;  3V3N A;  4A6N A;  1N4V A;  2C64 A;  1TDN A;  2YAU A;  4OPT A;  4U8O A;  4H4T A;  3QVP A;  1F6M A;  3O0H A;  5BRT A;  1KNP A;  2NVK X;  3AYI A;  2CDU A;  4J2W A;  1ZY8 A;  2QA1 A;  2BC1 A;  3HZL A;  1L0V A;  3QSE A;  3I3L A;  2A87 A;  1NDA A;  3WE0 A;  2WHD A;  2GH5 A;  1DNC A;  3NHO X;  4B64 A;  4C74 A;  2C7G A;  4DGK A;  4J57 A;  2WOI A;  1BZL A;  1GER A;  3F8P A;  3SM8 A;  2XVH A;  1YY5 A;  2BXS A;  1GEU A;  3NTD A;  2VRM A;  3RP8 A;  1PS9 A;  2BK4 A;  3EAO A;  4TM0 A;  5HXI A;  3DGH A;  2F5Z A;  1COY A;  3KD9 A;  4GR1 A;  3CGE A;  1NHP A;  3C4N A;  1DXL A;  4XXG A;  2WET A;  1PJ6 A;  2YLR A;  5KXJ A;  1L9C A;  4JNA A;  2WU5 A;  1FOH A;  1YQZ A;  4Z26 A;  2E5V A;  1PBB A;  3L8K A;  2VRL A;  3ZDN A;  2BA9 A;  4A65 A;  3CNJ A;  4YTP A;  2R0G A;  3RP6 A;  2Q6U A;  2R4J A;  1E1L A;  1CL0 A;  1Q9I A;  1OJA A;  3DK4 A;  3LAD A;  1PDH A;  3FBS A;  2JB3 A;  1TYP A;  4H2Q A;  4U8I A;  1E7P A;  2WP9 A;  3FIM B;  3UKH A;  3ALM A;  4ADW A;  4A6N B;  1N1P A;  2C75 A;  4RG3 A;  1E1K A;  3P9U A;  4WX1 A;  3LB8 A;  5KOX A;  3L1R A;  4Z2U A;  4HA6 A;  3SGL A;  1DJQ A;  3IHG A;  1REO A;  4A5L A;  2XLR A;  4UP3 A;  3AE3 A;  4O5Q A;  4OCG A;  5GRT A;  5KRQ A;  1NG3 A;  4EIP A;  2XLS A;  4IV9 A;  4OPC A;  3GWD A;  4GF7 A;  4OPD A;  2BYB A;  3VRD B;  5BUL A;  3AEA A;  4H4Z A;  4H4P A;  1JNR A;  2FJD A;  1K0J A;  4Y4M A;  1DJN A;  2LFC A;  1QJD A;  4CNJ A;  2GAG B;  1IUX A;  1OJC A;  2XVI A;  3DJG X;  2C66 A;  1B4V A;  4B63 A;  2EQ7 A;  3ICR A;  2YG6 A;  3I6D A;  4H4V A;  2B7R A;  3EPT A;  4NTD A;  3NNE A;  1IUV A;  4Z43 A;  5IQ1 A;  1CC4 A;  3F8R A;  3BI5 A;  3GWF A;  1GRA A;  2IVD A;  3GYX A;  5BUK A;  1S2Y A;  2YLT A;  1GTE A;  2UZZ A;  2WPE A;  3BNM A;  2ZZB A;  3NLC A;  4Z2R A;  1E1M A;  2YG3 A;  1PHH A;  4FK1 A;  2XFN A;  2WQY A;  4EMW A;  4ECH A;  4H7U A;  3DJE A;  2R45 A;  3QSS A;  1N4W A;  3DK8 A;  1EL9 A;  3KVE A;  3CGC A;  1JOA A;  1DOD A;  2Z5Y A;  3NG7 X;  4U2L A;  1CJ4 A;  4A99 A;  4B66 A;  4YSH A;  1LJ1 A;  1GRB A;  4DSG A;  3LJP A;  1CC2 A;  1MOK A;  1VRQ B;  4K5S A;  3NK0 X;  4YKG A; 
#chains in the Genus database with same CATH topology
 4GRT A;  5EB5 A;  5AQP B;  3DA1 A;  3ALJ A;  3P4P A;  4H4W A;  4NXM T;  3ESL A;  4H4U A;  1MIW A;  1TDO A;  2VVL G;  3HL6 A;  3RI5 A;  4B1B A;  2C70 A;  4MBQ A;  4P1N A;  4OPU A;  4I0U A;  3ATR A;  3H8L A;  4ILA A;  3RED A;  3GSI A;  3E08 A;  1EAH 4;  5L3G B;  1PXA A;  2CUL A;  2LEH A;  3QNU A;  1HXS 4;  2X99 A;  4UF0 A;  2R6G F;  2R07 4;  4EZH A;  4P0A A;  2A72 A;  3RNM A;  4UV9 B;  3KVB A;  2IID A;  3ICS A;  3RIF A;  4A56 A;  3C51 A;  4AQG A;  3UOV A;  4BUR A;  4RG4 A;  5CGM A;  1VQW A;  1OOP D;  2CEA A;  2ZM2 A;  2ZMA A;  5AQI B;  3F31 A;  4B69 A;  1RUJ 4;  5LHH B;  5LBQ B;  2X66 A;  2BBH A;  4IVM B;  4QH4 A;  1D4E A;  4TLZ A;  3AE6 A;  4C91 A;  3SYI A;  2PYJ A;  1PXC A;  4AKL A;  4QXB B;  3K30 A;  2YDQ A;  3BQK A;  2X3N A;  2LSK A;  4ZZB A;  1EZ3 A;  3ONL C;  2GR1 A;  1H7X A;  2NP9 A;  4ZI7 E;  3WAJ A;  3AE4 A;  1K0L A;  4PJL A;  1KSU A;  3I0O A;  4DSH A;  4C3X A;  2I0M A;  2N9D A;  1NEK A;  3KPF A;  4CI2 B;  1O5W A;  3H3A A;  3ZT5 A;  1BR2 A;  2A2F X;  3AED A;  4O2B E;  3AEB A;  5HEJ A;  3RLF F;  3ZMT B;  1XDI A;  1ZMD A;  4IA6 A;  3Q9D A;  1B7T A;  2RAB A;  2X5I D;  2W63 A;  3G5Q A;  3CX7 B;  2IW5 B;  2V5C A;  4O5U A;  3UP5 A;  4H2P A;  3LJC A;  3ZMV B;  5HXE A;  2EHO D;  1N32 T;  4U72 A;  4TWF A;  2O9Z A;  4II2 A;  5ER0 A;  3UTG A;  3GDN A;  4CRT A;  1SA0 E;  2XFO A;  3K3O A;  2AR8 A;  2WP5 A;  1NCQ D;  2XY8 B;  4WBN E;  1OJ9 A;  4IDQ A;  5FVK A;  2EHO A;  4GUV A;  3MK7 C;  1IUU A;  4YSZ A;  5L3B B;  5AQG B;  4ZEY A;  4DR3 T;  2V61 A;  2XAJ B;  3EAB A;  5FXZ A;  4DVD A;  2ACX A;  4UDP A;  4Q4Y 4;  3W15 B;  4TV8 E;  4AKG A;  2WPF A;  3SXI A;  1O3X A;  3NWI A;  1WFD A;  4XBF B;  1UX4 A;  2XHE B;  1OJD A;  3D0T A;  4UDQ A;  4DR6 T;  3AEF A;  2VVS A;  5JR9 B;  3FPZ A;  3AE8 A;  4NEW A;  4CNK A;  1POV 0;  4ZI2 C;  5LG4 A;  4H9R C;  3CGD A;  2X9Y A;  3T14 A;  1IJH A;  2E2A A;  5KMG P;  5AQF B;  2JPF A;  5LMU T;  3BK9 A;  4COF A;  1US7 B;  2VOU A;  1VOM A;  2YLX A;  3LZW A;  4NZH A;  5IWA T;  1W09 A;  5C3J A;  1LKX A;  2XFP A;  2UXD T;  4LF9 T;  3N9O A;  2JQQ A;  4GB3 4;  4TWD A;  4XWR A;  1QUU A;  3P50 A;  2VUR A;  4I50 E;  1VBC 4;  2RGO A;  2FUP A;  3HYW A;  4EQW A;  4U3C A;  3SZ0 A;  4YLH A;  5C8Y E;  1ZKQ A;  2XDO A;  1Y56 A;  2X9H A;  1EV1 4;  2YR6 A;  5LA6 E;  1RVF 4;  4GK0 E;  1X9B A;  2BAC A;  2WPC A;  3ZST A;  3CVR A;  2GQW A;  3IWA A;  3ZMZ B;  1F8S A;  3AA7 B;  4M52 A;  3CWZ B;  3KKJ A;  2H7O A;  4DR2 T;  2KMF A;  4AT2 A;  1VRH 4;  3UU4 A;  2C67 A;  1H84 A;  3UUL A;  2V6Y B;  3GYI A;  1O95 A;  5HYM A;  2H88 A;  2ZLY A;  3VRB A;  3J8F 4;  3ADA B;  2C76 A;  1HX8 A;  4LFB T;  2OAM A;  1WR6 A;  3K3N A;  5AFU L;  2E1M A;  2V6O A;  4Y4N A;  1FEB A;  5FNV E;  5H6R B;  3SRZ A;  2VQF T;  5J7X A;  3LK3 B;  3O4X E;  2WWU A;  5L4E A;  3T1Y T;  1MMN A;  2XLU A;  2YQU A;  2IC6 A;  3EVY A;  4DV1 T;  3AAI A;  3UUX B;  3UKK A;  4DV2 T;  2XQ8 A;  1U5P A;  4U8M A;  2DLR A;  2NTX A;  4CN4 A;  2WZI A;  4FJO A;  4H50 A;  4DV5 T;  1GT8 A;  1H8T D;  3QB5 K;  1IBM T;  1HNX T;  5HWY A;  4HTE A;  2IUB A;  5C2T A;  3C4W A;  4K2X A;  3AEG A;  5FXX A;  1R09 4;  3EF6 A;  4TLX A;  1D1C A;  2KWI B;  2E8I A;  4PAB A;  5JCL A;  1DOE A;  4TNV A;  3LG7 A;  3ETV A;  4HWF A;  2CHN A;  2G0U A;  4CXY A;  4GKK T;  4QH1 A;  2BCG G;  3CPH G;  2XAF B;  2YG5 A;  3BNU A;  2UXN B;  4TWH A;  2V3A A;  4P9S A;  2Q9Q B;  5IHY A;  4I55 E;  1EBD A;  3II4 A;  3AEE A;  3UOY A;  1G73 A;  2NW7 A;  2B9X A;  2BKP A;  2FJE A;  2GVC A;  2KIN B;  4ZI3 C;  1E39 A;  3PUG A;  4ERR A;  4JI2 T;  4K0K T;  2KXP B;  2CWY A;  2D2S A;  3UKF A;  4JQ9 A;  2BRY A;  2R46 A;  4H4Q A;  5JDN A;  4H9N C;  4AP1 A;  1H83 A;  2Q0L A;  3DP7 A;  1MND A;  4WCT A;  1LV0 A;  2RS5 4;  3UU8 A;  2X9X A;  4B3R T;  2XQ6 A;  4OPG A;  5JCK A;  4HFE A;  4X1I E;  4D04 A;  1BF3 A;  2XQY A;  2BK3 A;  1OED B;  3N9M A;  2C4C A;  5U1O A;  4C5O A;  5ABE A;  5HXR A;  5U63 A;  2LSJ A;  1H7W A;  1UKV G;  4B3M T;  2BG9 A;  1CJ2 A;  3IHM A;  2WBA A;  1KFY A;  4IL9 A;  3BHF A;  3ZC1 A;  3K7T A;  2V7K A;  4AXP A;  2GR0 A;  1AOG A;  3AYL A;  1J5E T;  3ISH A;  4EXT A;  2GV8 A;  3OYX A;  3CPI G;  5ABF A;  3FMW A;  1GND A;  3KIN B;  4NUV A;  3EDU A;  4Q25 A;  2CDU A;  1L0V A;  3QSE A;  3A8Y C;  3WE0 A;  4C74 A;  4DGK A;  3NHO X;  4J57 A;  4IE4 A;  2AE9 A;  2BXS A;  1GEU A;  4B6X A;  3NTD A;  3RP8 A;  2BK4 A;  2DNX A;  3DGH A;  2F5Z A;  3KD9 A;  3E22 E;  5DAB A;  4CXX A;  4HFI A;  4DO0 A;  4Z26 A;  2VRL A;  3ZDN A;  3CNJ A;  4O4H E;  5AQS B;  3AVR A;  3SS1 A;  2K48 A;  1OJA A;  4G6G A;  2W67 A;  1PDH A;  4O4L E;  4ADZ A;  4ADW A;  4UVB B;  4GAV A;  2UUB T;  3T0K A;  1T98 A;  1VRB A;  3L1R A;  4DMW A;  1REO A;  5ADX L;  1AJ3 A;  3AE3 A;  4O5Q A;  5KRQ A;  1NWM X;  1NG3 A;  5DJQ C;  2XLS A;  2K5B B;  1KNZ A;  4UR9 A;  2BVL A;  3AEA A;  5L3F B;  4H4Z A;  2FJD A;  1K0J A;  4Y4M A;  1DJN A;  1QJD A;  5JR9 C;  3SZF A;  4CNJ A;  2XVI A;  3DJG X;  2C66 A;  1B4V A;  4O8S A;  2B7R A;  4H4V A;  4NNJ A;  4NTD A;  3NNE A;  1IUV A;  3GYX A;  2LKG A;  2PLV 4;  1S2Y A;  3BNM A;  2WPE A;  2ZZB A;  1E1M A;  4EMW A;  3RIA A;  2D9D A;  2IML A;  5HXC A;  3DJE A;  3DK8 A;  1EL9 A;  2RPA A;  5IUX A;  1FJG T;  2K24 A;  3NG7 X;  5JDL A;  1CJ4 A;  4U2L A;  3N2O A;  3RIU C;  5AQR B;  3RHW A;  2ES0 A;  4X62 T;  1SHZ C;  4K5S A;  4GYR A;  5JH7 E;  3KV5 A;  1GRG A;  1H7C A;  3DH9 A;  2XSA A;  4YKF A;  5KDM C;  4HFH A;  3OBV E;  3JAD A;  2YR5 A;  2WWV A;  4DR5 T;  3ATQ A;  4PFO A;  4E7S A;  3VKH A;  3PO7 A;  1LRZ A;  4UVC B;  5LJM A;  1E2A A;  4UIG A;  5IPY A;  4J36 A;  1HTJ F;  3LK2 B;  1B8S A;  5LB7 B;  2GAH B;  2XFU A;  3Q5D A;  2Y8D A;  3BQI A;  3UTF A;  3TLV A;  2B7S A;  1HF8 A;  3RQU A;  1DOC A;  5EOW A;  3RYC E;  3N9N A;  1M62 A;  2R06 4;  2CMR A;  1YW0 A;  2QYW A;  2LM2 A;  4LU6 A;  1NEN A;  2CXD A;  1ZDL A;  2RGJ A;  4LFA T;  2IDO B;  3UFE A;  5AQU B;  5JTG A;  3ONX A;  1W0B A;  4YFS A;  1PIV 4;  3FZL B;  4DMV A;  4TM1 A;  2M67 A;  4G2A A;  4PK6 A;  3VQR A;  5JDH A;  2VKO A;  2DCF A;  3ZLI A;  3CML A;  1D7Y A;  4QWN B;  4Z25 A;  4X65 T;  2PY5 A;  3ZKR A;  5J60 A;  2VKJ A;  2PTF A;  2V8S V;  4DV7 T;  4B65 A;  4K7Z A;  2Z6E A;  4ZOL E;  3HA4 A;  2LRL A;  3LFM A;  5FL1 A;  3CNP A;  3R84 B;  4ZZC A;  2VVN A;  1VBD 4;  4KPR A;  2W2U A;  4UF0 B;  2GF3 A;  1D0Z A;  3VU7 H;  3K7Q X;  2C3D A;  3CGB A;  2Q9Q C;  1J1J A;  1PN0 A;  4FI5 A;  4MJW A;  2JBV A;  5KNL A;  1H82 A;  3NKS A;  3JSK A;  2CRB A;  2OAL A;  1CJ3 A;  1Q1W A;  2UU9 T;  3O9X A;  1GRT A;  4IE0 A;  2Y6Q A;  1PXB A;  2RGH A;  2WZH A;  3QB5 A;  2UXB T;  3F8D A;  3VR8 A;  2N2N A;  2X8H A;  1MQT D;  3GYJ A;  4QX8 B;  3G5R A;  2V7J A;  3B57 A;  3C64 A;  4E0V A;  4XAX B;  2R7F A;  3GD3 A;  1H6V A;  5LGU B;  4PK4 A;  1CBO A;  2X51 A;  2ZZ0 A;  1WCR A;  3LOV A;  4H63 H;  3B13 A;  2NWB A;  3O1I A;  4A5X A;  1IUS A;  2GEW A;  5KX5 E;  5FS7 A;  1OED C;  5AQQ B;  4Z2T A;  2YVG A;  1IBK T;  4IDN A;  3EDV A;  2OLO A;  1ZV4 X;  3ABV A;  2Y6R A;  4BJY A;  4QKN A;  3N9L A;  1D0Y A;  4L0R A;  3CIR A;  1AR8 4;  4RSL A;  2V1D B;  4BJN A;  4CY6 A;  5TAO A;  3KBT A;  3GN5 B;  3UTE A;  3IC9 A;  1D7L A;  4B67 A;  2EQ8 A;  2VVL A;  3EAN A;  3LBX A;  2X9W A;  3PU8 A;  2B1E A;  4C77 A;  3CX6 B;  3RRW A;  5BMV E;  4BV6 A;  4ASK A;  3FXE B;  2OA1 A;  2EHO B;  3CMM A;  1FMV A;  3AA6 B;  3RP7 A;  2NW8 A;  5IYZ E;  3ZSS A;  2JKC A;  2C73 A;  4HN9 A;  4O4J E;  3R9U A;  2FBW A;  3TLT A;  5JRE A;  3AE5 A;  3CK6 A;  5AQK B;  3NH3 X;  5AQJ B;  4GYS A;  2XUE A;  1WYB A;  3UKL A;  4X64 T;  3DJD A;  1GES A;  2A3D A;  4KMC A;  3R6N A;  5IQ4 A;  3NT6 A;  1BR0 A;  3CPJ G;  5HEG A;  5LP6 E;  2YR4 A;  2KSR A;  3RC3 A;  3A7M A;  1RUH 4;  3VRA A;  3LZX A;  5DQW A;  1EL8 A;  1GXF A;  2XYO A;  2KND A;  3RYF E;  5KOW A;  4HWD A;  1JRY A;  3ZT6 A;  2DWG A;  2AQJ A;  3NRN A;  3PUZ F;  1GAL A;  1Y56 B;  3RYH E;  2VKD A;  1IBL T;  3ITJ A;  2FJA A;  5HAX A;  3SOL A;  4JUY A;  4U2Z A;  4H4X A;  4A79 A;  2LKH A;  2C65 A;  1YKH B;  2H7V C;  3PUX F;  5M0Z A;  2OA5 A;  3D8X A;  5F5W A;  4AOX A;  4AIS A;  4YT0 A;  3T2K A;  2WOV A;  4U2T A;  2Y48 B;  3MZK B;  4J31 A;  3UKQ A;  3SWH A;  2RMU 4;  4AQF C;  4Z90 A;  3Q6J A;  4H4Y A;  4U31 A;  1NG4 A;  3EHZ A;  4JI3 T;  2CBJ A;  2JK6 A;  5HWX A;  4YJ3 E;  1TYT A;  2WB5 A;  2RA1 A;  4EQS A;  3T2Y A;  5JCM A;  1ZX9 A;  1D4C A;  1BGN A;  2JB1 A;  4OPI A;  4KBM B;  1MNE A;  2FJB A;  5LGN B;  3NVO A;  1VCT A;  4U33 A;  4I43 B;  2XCG A;  4NIQ A;  2VAS A;  4OX9 T;  3LDQ B;  3QOF A;  3JC6 D;  1M64 A;  3NIX A;  4II3 A;  2ZM8 A;  3AE9 A;  1GRF A;  3MXZ A;  1FMW A;  1W9R A;  3OTO T;  4IE7 A;  1HNW T;  1IUT A;  1KEY A;  2M6B A;  3C98 B;  1W0A A;  2PFV A;  1RUF 4;  2XM2 A;  4YSY A;  2YU1 A;  1RUD 4;  3RF1 A;  1GRH A;  3B6D A;  4OYK A;  4K8D A;  1QLB A;  4AKI A;  1AR7 4;  1E1H B;  3PU3 A;  4HEA A;  2XAS B;  4ZS3 A;  4X4J A;  2F4V T;  2XVF A;  2V5Z A;  3F57 A;  2C5J A;  2NOX A;  5EZY E;  2JAE A;  4H63 V;  1P2H A;  2Z5X A;  1P2E A;  3NBX X;  2ZBW A;  3ZYK A;  4MFR A;  1YKE B;  3FBZ A;  4H9S E;  1WLX A;  2HH7 A;  2BRA A;  3JBG 4;  2LSG A;  4JEU B;  4KHP T;  2P9B A;  5HEO A;  3RH3 A;  1ZOV A;  2PW9 A;  3ALL A;  4NXN T;  4Q4V 4;  1BKW A;  3NK1 X;  2D0U A;  3SY4 A;  4I4T E;  3L39 A;  4JI5 T;  2UXC T;  2C64 A;  2CE7 A;  2YAU A;  2NVK X;  2N1G A;  1ZY8 A;  1UX5 A;  1V9D A;  2BC1 A;  2A9U A;  3I3L A;  1HNZ T;  1NDA A;  2X0L B;  2WHD A;  4IHJ E;  1DNC A;  2GH5 A;  2C7G A;  2X67 A;  2V5D A;  2XVH A;  3ZYL A;  5HXI A;  4TM0 A;  1COY A;  4WYV A;  3CGE A;  3C4N A;  1UK5 A;  2BG9 B;  3QC9 A;  1XZY A;  2YLR A;  3JAF A;  1YQZ A;  2WAU A;  3GWH A;  2E5V A;  3L8K A;  1IZN B;  4YTP A;  2R0G A;  1XDP A;  4BJM A;  4P0B A;  3LAD A;  2J47 A;  4H2Q A;  3FBS A;  2DL1 A;  4GKJ T;  3QUJ A;  2AXD S;  1E7P A;  2WP9 A;  3ALM A;  3ONJ A;  5ABF B;  3FHN A;  4RG3 A;  3CPZ A;  4Z2U A;  5KMQ A;  1DJQ A;  3ZYM A;  4UP3 A;  2CBI A;  3O1H A;  2L9Q A;  1HX1 B;  2MOZ A;  4EIP A;  1HRV 4;  4AKH A;  3GWD A;  3T31 A;  2MBG A;  5BUL A;  5JR9 A;  2PYL A;  3WAK A;  4H4P A;  2BKN A;  2QA7 A;  2YU2 A;  4PJM A;  5FKY A;  3MKD A;  3PJA J;  4HGA A;  2BZB A;  5LHG B;  2PG8 A;  2YG6 A;  2UXX B;  2C0S A;  3ANW A;  4Z43 A;  5JQG E;  3BI5 A;  4CN1 A;  2IVD A;  3T1H T;  4HFV A;  3Q2M A;  1GTE A;  2UZZ A;  2E9X D;  4O2A E;  3QK6 A;  2YG3 A;  1PHH A;  4FK1 A;  2EHO C;  3IEE A;  4WZX A;  3QSS A;  1N4W A;  4LF4 T;  2Z5Y A;  2E9X A;  4OK0 A;  4B66 A;  4DSG A;  1GRB A;  1CC2 A;  2HPL A;  4YKG A;  4EM4 A;  4UVA B;  2GRT A;  3V3O A;  2C3C A;  2R0P A;  1PBC A;  2QGS A;  2GMH A;  4B3S T;  5JDF A;  5FXV A;  3GA8 A;  5AQM B;  3HR0 A;  3GQK A;  3IBP A;  3M65 A;  4X5T A;  2LM9 A;  4ZXL A;  1UUR A;  2BS4 A;  2KLQ A;  1NHQ A;  1MMG A;  4TV9 E;  4DR1 T;  5FYM A;  2H3R A;  4BJZ A;  1RUG 4;  3CND A;  5AQL B;  5AQN B;  2JQ9 A;  3Q9T A;  3LK4 2;  1ZEE A;  3DK9 A;  5H6Q B;  2LJL A;  1TDE A;  3M13 A;  2WY2 A;  1VBA 4;  3BQL A;  4H2N A;  1NAF A;  4YSX A;  3GMB A;  2R0C A;  5LXT E;  4HB9 A;  2CM0 A;  1M6I A;  4HFD A;  4ISS A;  2XSB A;  3BI4 A;  3K3Q C;  4CCR A;  4GCM A;  1JNZ A;  4UEM A;  5ABH A;  3AE7 A;  4PK5 A;  4F8H A;  4WBO A;  2GR3 A;  1Y0P A;  4H9Q C;  4JNQ A;  5CA0 E;  4JI6 T;  1WYC A;  2XFQ A;  2BC0 A;  4ZHQ E;  3QSM A;  2X68 A;  3AWI A;  4YTN A;  3CQC B;  2YDR A;  4XZC A;  4YHH T;  2CFY A;  1F3P A;  1WR0 A;  1LTX R;  2XLT A;  4G9K A;  3FBL A;  1L9E A;  4DNA A;  5JVD E;  3NK2 X;  4AKR B;  5FMH A;  4EIW A;  4A98 A;  2WMN A;  2RP4 A;  1JRX A;  2RM2 4;  3M0O A;  3N5L A;  4JDR A;  5KMR A;  1PBE A;  3AYJ A;  4A9W A;  2SPC A;  4JI0 T;  3CNT A;  2W61 A;  5LG3 A;  3SFD A;  2WSS V;  4LMK A;  3SUC A;  1OXZ A;  3RX6 A;  2XAQ B;  5LNK A;  3M3Z B;  3C4A A;  4EMI A;  3OYZ A;  5JCN A;  5GON E;  1GPE A;  4G73 A;  4TM3 A;  5L47 A;  1YD8 G;  2BG9 E;  3UCL A;  5LCY A;  3HYX A;  1N33 T;  3C4Z A;  1VBE 4;  2DWK A;  4L5G A;  1CF3 A;  2LRK A;  1JU2 A;  2IIU A;  1U4Q A;  3NYC A;  3P4R A;  2R04 4;  5FY7 A;  3HKD E;  1OED A;  4BA9 A;  1HYU A;  1FEW A;  2ACZ A;  4BK1 A;  3GQH A;  2QAE A;  4JEH B;  1PJ7 A;  3L3P A;  3KPK A;  3J9X 1;  5A1L A;  1KDG A;  3PUY F;  2GMJ A;  3ZJ1 A;  2ZM0 A;  2V7L A;  4YWO A;  2J1D G;  3QJ4 A;  3TLS A;  1LPF A;  3AA0 B;  3SX6 A;  4PFP A;  1Z8U A;  4AT0 A;  2VQ7 A;  3H8I A;  1Z0P A;  2VQB A;  1XHZ A;  2BVM A;  4BAY B;  1FEC A;  4N78 D;  5ETW A;  4LF5 T;  3KA7 A;  3P4S A;  4IVO B;  1HFA A;  3ZPO A;  4YHJ A;  3PS9 A;  3PJA A;  2L3L A;  4DV4 T;  2YKS A;  1K4Q A;  2Y6X A;  3P8C D;  1CC6 A;  5LOV E;  4IT4 A;  5KVH A;  4F6R C;  4EGW A;  2J62 A;  2XJ7 A;  5J2T E;  1GQE A;  4X1K E;  1PO1 4;  2YVJ A;  2BG9 C;  2YLS A;  2XQ5 A;  2BAB A;  2MAW A;  4N9X A;  1D4M 4;  4AP3 A;  4PNI A;  3H37 A;  4DV3 T;  2LLY A;  2IAK A;  1ZP0 A;  4LF8 T;  3LBX B;  2GB0 A;  5JRC A;  3OC4 A;  4GDE A;  2JJ9 A;  1E1N A;  1HRI 4;  1MMA A;  2LE8 A;  4OYJ A;  2JMH A;  3EAM A;  4TN7 B;  2YEV C;  4AI6 A;  1DOB A;  2IVE A;  4MHC A;  4UXN B;  4U8P A;  2KT9 A;  2QCU A;  4CZZ B;  3SFE A;  2EQ9 A;  1JRZ A;  3KLJ A;  4DUZ T;  4RHV 4;  2IHR 1;  3RPU A;  1BEV 4;  5FY0 A;  2VWA A;  3HI2 A;  1ZK7 A;  1F8R A;  2A89 A;  1S94 A;  4IGU A;  3VHL A;  4Z44 A;  3JD7 4;  1V59 A;  4U8L A;  1LQT A;  5U25 A;  2EX3 A;  5M10 A;  3LXD A;  1HS7 A;  2YOE A;  2W0H A;  5FMN A;  1RUE 4;  1B37 A;  4HWI B;  3AE1 A;  1D5T A;  1S35 A;  3ICT A;  2CA5 A;  2WU2 A;  2YK0 A;  2WES A;  1NHR A;  3ZT7 A;  3PVC A;  2MPK A;  1H86 A;  1S2Q A;  5EB4 A;  1ONF A;  3PUS A;  4DID B;  3DJB A;  4A7A A;  2R4E A;  3PDY A;  5CB4 E;  1EL7 A;  2CWO A;  1XAN A;  2HN2 A;  4BK2 A;  5CJ5 A;  4ZI2 D;  4G63 A;  3EUH A;  2XVJ A;  1XNQ T;  4OFZ A;  3COX A;  2YN6 A;  3CX8 B;  3N2G E;  1Q1R A;  5AQT B;  3OPC A;  4K5R A;  5FL0 A;  2BCP A;  2BXR A;  3H4K A;  3I1A A;  5LV9 A;  3NTA A;  4J2C A;  4IL4 A;  3CNS A;  3FZK B;  2TPR A;  4G74 A;  4ZCD A;  5HXH A;  1R08 4;  1Y01 A;  1MXT A;  3KV6 A;  4X9N A;  1LVF A;  5CKU A;  3PUA A;  2J3N A;  5HCM A;  2DHR A;  2BS2 A;  4IDZ A;  3K7M X;  3SZC A;  3TLU A;  4ICY A;  4EV6 A;  1GV4 A;  2C72 A;  3M12 A;  4TZ4 C;  1ZHC A;  1YQ4 A;  3RRC A;  4U8N A;  4GAP A;  5J2U E;  2XQA A;  3CN8 A;  2DKH A;  2HHH T;  4Z91 A;  4C90 A;  1X79 A;  3UKA A;  4O4I E;  4FX9 A;  2BBJ A;  4CBQ A;  4AIU A;  4C3Y A;  2X0H A;  3AXJ A;  4CY8 A;  3Q5X A;  4OVI A;  1RUC 4;  4APN A;  3D1C A;  2WBL A;  2XQ3 A;  5BR8 T;  3RHA A;  1G8X A;  2BDE A;  1GRE A;  4HWH A;  1FCD A;  2V7M A;  1VBB 4;  2WDR A;  4U7I A;  3IF9 A;  2HWC 4;  4P09 A;  3T8O A;  2VQE T;  4AOS A;  2YLZ A;  3AD7 B;  2GQF A;  3Q5E A;  4EMJ A;  4K22 A;  3NN0 X;  4A6N A;  3V3N A;  1I94 T;  1N4V A;  2HWB 4;  5FY1 A;  1TDN A;  4OPT A;  4U8O A;  4H4T A;  4DV6 T;  1F6M A;  3O0H A;  1KNP A;  3AYI A;  3V5U A;  2LSY A;  1AR9 4;  4J2W A;  1N36 T;  3EI0 A;  3HZL A;  5F3J A;  4B64 A;  2LHR A;  3MJX A;  4CI3 B;  1AL2 4;  3IHR A;  2VRM A;  1PS9 A;  1BR4 A;  5LMN T;  3C50 A;  3S4U A;  1NHP A;  4JNA A;  5KXJ A;  1L9C A;  3N2K E;  2NTY A;  1FOH A;  3ZN0 B;  1PBB A;  2XQ7 A;  3NRY A;  5LBM A;  4QHO A;  1PO2 4;  3UT5 E;  4U7Y A;  3RP6 A;  1KK7 A;  3E0Z A;  2LHN A;  2R4J A;  4Z8X A;  3NZQ A;  4KHZ F;  3F2E A;  3IA3 A;  3DK4 A;  4YY3 T;  2ODU A;  2JB3 A;  2HN1 A;  2MYS A;  4U8I A;  4HE8 A;  3FIM B;  3UKH A;  1E1K A;  2VL8 A;  4WX1 A;  5KOX A;  4HA6 A;  3SGL A;  3IHG A;  2XLR A;  4Q4X 4;  4OCG A;  3PE0 A;  2W62 A;  4IV9 A;  3FZH B;  4ZI3 D;  4OPC A;  3KBU A;  4NPP A;  1D0X A;  3KFW X;  4EEB A;  1NA1 D;  2ODV A;  1JNR A;  5J0Z A;  3GN5 A;  2W4X A;  2GAG B;  1IUX A;  3AVS A;  1HG5 A;  1XI1 A;  3KDS E;  4PAG A;  3EPT A;  1CC4 A;  3F8R A;  2W00 A;  2LT3 A;  3Q5W A;  5BUK A;  1XWM A;  3P4W A;  4KUM B;  4DBR A;  4JLE A;  4LF7 T;  4H7U A;  5JDG A;  2BKO A;  2VK9 A;  4EED A;  4GOU A;  3KVE A;  3JAE A;  1JOA A;  3PTR B;  2K3W A;  2C5I T;  4JI4 T;  1HCI A;  3I9W A;  4CQI A;  1LJ1 A;  3LJP A;  3HKE E;  3NK0 X;  2XZE A;  1RMU 4;  4ILC A;  2V26 A;  4GIW A;  2YDS A;  4I58 A;  1XHC A;  3G06 A;  1CJC A;  1KNR A;  4I59 A;  2YG4 A;  3NYF A;  3OZ2 A;  5L3E B;  5FS8 A;  4QX7 B;  3T37 A;  4X66 T;  1NPX A;  4DV0 T;  3C4X A;  1VG9 A;  1YQ3 A;  4HFB A;  3ANW B;  4PW8 A;  4NTE A;  5KWF A;  5LGT B;  5M4Y A;  4YTM A;  1N4U A;  4ILB A;  5DBJ A;  3NRX A;  1IUW A;  4JI8 T;  3SZW A;  4IE5 A;  1BGJ A;  4M1P A;  1F8W A;  3AB1 A;  4X20 E;  2XQ4 A;  3UU6 A;  4NUU A;  3TLW A;  2WM9 A;  3RYI E;  3N9Q A;  1PBF A;  5GSN A;  1Z7S 4;  3UU3 A;  4B68 A;  5EK3 A;  1MIV A;  5HYA A;  3S61 A;  3K8P C;  2E9X B;  4ZCC A;  1IAP A;  4UDR A;  4CCQ A;  1LVL A;  1TDK A;  4EQX A;  4QXH B;  4TM4 A;  2Q7V A;  3P4Q A;  3UKP A;  2K9A A;  1FEA A;  3JCF A;  3ZCJ A;  3K1S A;  3UOX A;  3FG2 P;  3KV4 A;  3AA1 B;  2CVJ A;  3KV9 A;  1D1B A;  4Q4W 4;  2L8K A;  5HXS A;  1KSS A;  1PJ5 A;  1ZOY A;  2YM1 A;  3A5X A;  2V3B A;  2M6I A;  2OV9 A;  2VKH A;  4NTC A;  2PHH A;  2CLY B;  4WW0 A;  2ZM6 T;  2I6H A;  2XQ9 A;  1RUI 4;  1XNR T;  3LSV A;  2PZS A;  4LMJ A;  5AQO B;  4DUY T;  2B9Y A;  4NEV A;  4ZS2 A;  1TRB A;  1X31 B;  2X8G A;  2X0Y A;  3DME A;  3AXB A;  4PAA A;  4DR4 T;  1XMO T;  3NZP A;  5TR3 A;  5L3C B;  3UP4 A;  4G6H A;  2DI4 A;  5HEH A;  1ZMC A;  2APG A;  2RS3 4;  3ZN1 B;  3L09 A;  3AE2 A;  5AQV B;  5LHI B;  3UU5 A;  1T8B A;  5L3D B;  5ABG A;  3QFA A;  2UUA T;  2CHO A;  2QA2 A;  1K0I A;  4TUY E;  3VR9 A;  5L4H A;  3C96 A;  4NWZ A;  4Z24 A;  1BR1 A;  3UUN A;  3TKL B;  5KMP A;  4IDP A;  2XAG B;  3RKG A;  1VCS A;  1GET A;  2H89 A;  3MAC A;  4U2S A;  3PV0 F;  3ZYX A;  2WS3 A;  2CXF A;  2YVF A;  1NAA A;  4DR7 T;  3MA9 A;  5FS9 A;  3HYV A;  4LFC T;  1FIO A;  3B5M A;  4EZ4 A;  3P1W A;  3URH A;  4PJJ A;  1QO8 A;  3RIU A;  5CQF A;  4IRE A;  3ETU A;  2B9W A;  4ILU A;  2VB6 A;  4H4R A;  2WDQ A;  4JBW F;  4USR A;  5FS6 A;  5CA1 E;  3SQP A;  1RHI 4;  3AB3 B;  2LSI A;  1H81 A;  3U78 A;  4JY3 A;  3NN6 X;  4H4S A;  3FZF B;  3RQW A;  4J34 A;  3B3R A;  3FZM B;  5EK2 A;  1LQU A;  1XHX A;  2ARD A;  2TMD A;  4EYU A;  1VG0 A;  2EQ6 A;  3ZCI A;  3JC6 C;  1L9D A;  1Z6L A;  1SEZ A;  1ASJ 4;  2CCQ A;  2WCA A;  1K5M D;  1DU2 A;  3DGZ A;  2YWL A;  2V6Y A;  4REK A;  1M7K A;  3ZMS B;  3P7I A;  4GDP A;  5LJN A;  4WNK A;  4H2R A;  3UTH A;  2YLW A;  1S3E A;  1MMD A;  2PYX A;  4JV5 T;  2YG7 A;  4B3T T;  4BK3 A;  3KU9 A;  2KWH A;  1HR0 T;  4IIJ E;  4EM3 A;  1EL5 A;  3V76 A;  3X1D A;  3AAA B;  4QH5 A;  1MO9 A;  3PUV F;  3AEC A;  2PJQ A;  3RGL A;  4IA5 A;  2JB2 A;  4KX6 A;  3J7Y q;  2I0Z A;  1MIY A;  2VZ2 A;  3GD4 A;  4YJ2 E;  1JEH A;  2BK5 A;  2AAQ A;  2RR1 4;  3UQ7 A;  2HPJ A;  1SUM B;  1GOS A;  1RSG A;  4FDC B;  1ELI A;  4ZN0 A;  3GMC A;  2WDV A;  5E0O A;  2WP6 A;  5L2L A;  3I9Y A;  4CN6 A;  3GMI A;  5BVA A;  1O94 A;  4K0U A;  2Q9Q D;  3FB2 A;  2E4G A;  1D1A A;  5J1G A;  4E7Z A;  4U8J A;  4OHF A;  3BHK A;  3ZJ2 A;  4U8K A;  3FXD B;  4MLK A;  4OPL A;  3BI2 A;  3CQX C;  1GTH A;  2NPX A;  2Q9Q A;  2B76 A;  5HEU A;  2GR2 A;  5CFB A;  1I6Z A;  5AQH B;  1RYI A;  4LII A;  3S5W A;  4LML A;  1UCU A;  3UOZ A;  2I59 A;  2RS1 4;  3PUW F;  3OJA A;  3AD9 B;  3HKB E;  2VVM A;  3O1J A;  3GDP A;  5KMS A;  4PJN A;  4ANJ A;  2D0T A;  1OJT A;  5JRC B;  4IE6 A;  4V1A v;  1E6E A;  2WMO A;  1GSN A;  3G5S A;  1D4D A;  4YXD A;  1FL2 A;  3NYE A;  1BWC A;  3GRS A;  1QSD A;  2WEU A;  3PUR A;  4AQY T;  4J56 A;  2V7I A;  1OWA A;  5KVI A;  4JY2 A;  2JQK A;  2A8X A;  1B5Q A;  3UFG A;  3NGC X;  4J33 A;  4MAL A;  2X50 A;  2XLP A;  1CUN A;  3V5S A;  1TDF A;  3RKO A;  3ZC0 A;  2HQM A;  2NR4 A;  2LOP A;  3NKZ A;  5EK4 A;  5LYJ E;  4JI7 T;  2NW9 A;  2BS3 A;  4JYA T;  3E1T A;  1UUS A;  3WI3 A;  5HHF A;  3CTY A;  4XWZ A;  3GRT A;  3UUM A;  3U3I A;  4FK1 C;  2DKI A;  4EQR A;  3CKD A;  4X9M A;  3AD8 B;  2QRX A;  1ZKE A;  2ZZC A;  2XVE A;  2UUC T;  4L9I A;  1W4X A;  1RP0 A;  2E9X C;  1AR6 4;  2JMK A;  2V6X A;  5HY5 A;  3AAE B;  5JCI A;  4UEL A;  1VDC A;  4LA1 A;  1XPQ A;  2OLN A;  4JN9 A;  1NHS A;  1YKJ A;  2D5U A;  2V60 A;  2QVA A;  2XM1 A;  2X8C A;  3DJJ A;  4Y4L A;  4DND A;  4TX5 A;  2Q0K A;  2JRK A;  2WOW A;  3OKQ A;  4D03 A;  1XDO A;  2PBI A;  3H3M A;  4DBQ A;  1S3B A;  2YM2 A;  5HCJ A;  2VL0 A;  3ZEF B;  1J5W A;  4USQ A;  1CHU A;  1KF6 A;  3QVR A;  3QFB A;  1N34 T;  2R9Z A;  1LVK A;  5DQV A;  5EBK A;  4EIQ A;  2CLY C;  2XTL A;  3FI7 A;  4EB6 E;  2CPT A;  1PBD A;  4ECH A;  3KVA A;  2MTQ A;  3QVP A;  5BRT A;  2W0G A;  3IF8 B;  2XAH B;  1T72 A;  4H9P C;  2QA1 A;  3PUQ A;  4KP3 C;  2A87 A;  4HFC A;  1SE7 A;  1UGO A;  5FXW A;  2WOI A;  2LOS A;  1BZL A;  1GER A;  3AXJ B;  3F8P A;  3SM8 A;  4EAH A;  1YY5 A;  3EAO A;  5JDM A;  4GR1 A;  4IST A;  1OED E;  1DXL A;  4XXG A;  2WET A;  1Y64 B;  4GK5 E;  1PJ6 A;  2WU5 A;  2C5K T;  4A65 A;  2BA9 A;  3L8R A;  2Q6U A;  1E1L A;  1CL0 A;  3UUB A;  1Q9I A;  4UV8 B;  1IJ5 A;  1TYP A;  4U74 A;  4AQF A;  2E5L T;  5L46 A;  4A6N B;  1N1P A;  2C75 A;  3P9U A;  3LB8 A;  3UTK A;  4CI1 B;  2KZ7 B;  4HWC A;  2OLT A;  4A5L A;  5FP3 A;  5F8P A;  5GRT A;  2YIN A;  2IC9 A;  1COV 4;  4KI0 F;  4HKA A;  1YXR A;  4GF7 A;  4OPD A;  2BYB A;  3VRD B;  2LFC A;  3HKC E;  5FVL A;  3CQG B;  1WRD A;  1OJC A;  4B63 A;  3ZMU B;  3RC8 A;  2EQ7 A;  3ICR A;  3I6D A;  3VKG A;  1IJ6 A;  5IQ1 A;  2GK9 A;  1XMQ T;  4CXW A;  3GWF A;  1GRA A;  3UQ4 A;  4H9O C;  2YLT A;  2JIW A;  4JI1 T;  3NLC A;  4Z2R A;  1R8I A;  4IDO A;  2XPK A;  2XFN A;  2WQY A;  2W66 A;  1T7S A;  2J4G A;  3T2Z A;  3I0Q A;  2JQH A;  4A97 A;  4EYY R;  2R45 A;  4LF6 T;  4EOZ B;  3CGC A;  1PVC 4;  4PDW D;  1DOD A;  1HG2 A;  5JDQ A;  3N9P A;  4QXC B;  3DTO A;  3OVU A;  4TNW A;  4A99 A;  4YSH A;  4X1Y E;  1MOK A;  2CXL A;  1VRQ B;  4U2Y A; 
#chains in the Genus database with same CATH homology
 1GRG A;  4GRT A;  4EM4 A;  2GRT A;  4I58 A;  3DH9 A;  1XHC A;  2C3C A;  2R0P A;  1CJC A;  1PBC A;  1KNR A;  3DA1 A;  4I59 A;  2GMH A;  2YG4 A;  3NYF A;  3OZ2 A;  4YKF A;  3ALJ A;  3P4P A;  4H4W A;  5FS8 A;  3T37 A;  2YR5 A;  1NPX A;  1VG9 A;  1YQ3 A;  3ATQ A;  3GQK A;  4H4U A;  1TDO A;  3PO7 A;  4NTE A;  5KWF A;  2VVL G;  1NHQ A;  2BS4 A;  4YTM A;  4B1B A;  1N4U A;  2C70 A;  5DBJ A;  5IPY A;  4J36 A;  4OPU A;  1IUW A;  4BJZ A;  3CND A;  1B8S A;  2GAH B;  2XFU A;  3ATR A;  3H8L A;  3SZW A;  1BGJ A;  3RED A;  1F8W A;  3GSI A;  3Q9T A;  3AB1 A;  3UTF A;  1PXA A;  2CUL A;  3DK9 A;  2B7S A;  5GSN A;  1PBF A;  2X99 A;  4B68 A;  3M13 A;  1TDE A;  1DOC A;  5EOW A;  3S61 A;  4ZCC A;  4H2N A;  4UDR A;  3RNM A;  4CCQ A;  1LVL A;  2IID A;  3ICS A;  4YSX A;  1TDK A;  3GMB A;  2R0C A;  4EQX A;  4HB9 A;  4TM4 A;  4LU6 A;  1M6I A;  1NEN A;  1ZDL A;  2RGJ A;  3UOV A;  4BUR A;  4RG4 A;  3BI4 A;  1VQW A;  2Q7V A;  4CCR A;  4GCM A;  1JNZ A;  3P4Q A;  3UKP A;  4B69 A;  3AE7 A;  1FEA A;  2GR3 A;  1Y0P A;  4JNQ A;  4IVM B;  1D4E A;  4TLZ A;  3AE6 A;  3UOX A;  3SYI A;  4TM1 A;  1PXC A;  3VQR A;  3FG2 P;  1D7Y A;  2CVJ A;  3K30 A;  4Z25 A;  2XFQ A;  2BC0 A;  5J60 A;  3QSM A;  2X3N A;  3AWI A;  1KSS A;  1PJ5 A;  1ZOY A;  2YM1 A;  4YTN A;  2GR1 A;  1H7X A;  4B65 A;  2CFY A;  4K7Z A;  2V3B A;  3AE4 A;  1K0L A;  1F3P A;  1LTX R;  2XLT A;  1KSU A;  4G9K A;  4DSH A;  3CNP A;  4C3X A;  4NTC A;  2PHH A;  1NEK A;  1L9E A;  3KPF A;  1O5W A;  4DNA A;  4KPR A;  2GF3 A;  3AED A;  3AEB A;  3NK2 X;  3K7Q X;  5FMH A;  2B9Y A;  1XDI A;  2C3D A;  3CGB A;  1TRB A;  1ZMD A;  4NEV A;  1X31 B;  2X8G A;  4IA6 A;  3DME A;  1PN0 A;  2RAB A;  3AXB A;  4MJW A;  4PAA A;  3G5Q A;  1JRX A;  2JBV A;  3M0O A;  5KNL A;  1H82 A;  4JDR A;  3NKS A;  3JSK A;  5TR3 A;  5KMR A;  2OAL A;  3UP4 A;  1CJ3 A;  1PBE A;  1Q1W A;  3AYJ A;  1ZMC A;  4G6H A;  2APG A;  4O5U A;  3UP5 A;  4A9W A;  3AE2 A;  1GRT A;  2Y6Q A;  3CNT A;  1PXB A;  4H2P A;  3SFD A;  2RGH A;  3QFA A;  2O9Z A;  4II2 A;  2QA2 A;  3SUC A;  3F8D A;  1K0I A;  3VR9 A;  3VR8 A;  2X8H A;  3C96 A;  3GDN A;  4NWZ A;  5ER0 A;  3C4A A;  4Z24 A;  3UTG A;  4CRT A;  3GYJ A;  4EMI A;  3G5R A;  2XFO A;  5JCN A;  5KMP A;  4E0V A;  1GPE A;  4G73 A;  3GD3 A;  1H6V A;  4TM3 A;  2AR8 A;  1GET A;  2H89 A;  2WP5 A;  3UCL A;  3HYX A;  1CBO A;  4U2S A;  1OJ9 A;  2ZZ0 A;  3LOV A;  3ZYX A;  4GUV A;  2WS3 A;  1CF3 A;  2YVF A;  1IUU A;  4YSZ A;  1JU2 A;  1NAA A;  2V61 A;  5FS9 A;  1IUS A;  3NYC A;  3HYV A;  3P4R A;  3P1W A;  3URH A;  4UDP A;  1HYU A;  2GEW A;  2ACZ A;  1QO8 A;  4BK1 A;  5FS7 A;  5CQF A;  4Z2T A;  3GQH A;  2B9W A;  2QAE A;  2YVG A;  4H4R A;  3SXI A;  2WPF A;  2WDQ A;  4USR A;  1PJ7 A;  5FS6 A;  2OLO A;  3ABV A;  2Y6R A;  3SQP A;  4BJY A;  3KPK A;  1KDG A;  3CIR A;  1OJD A;  4UDQ A;  2GMJ A;  3AEF A;  1H81 A;  3FPZ A;  3AE8 A;  4NEW A;  4JY3 A;  4RSL A;  4CNK A;  4CY6 A;  3NN6 X;  4H4S A;  4YWO A;  4J34 A;  3B3R A;  3CGD A;  3UTE A;  3IC9 A;  3T14 A;  1IJH A;  3QJ4 A;  1LQU A;  1D7L A;  2ARD A;  1LPF A;  4B67 A;  2TMD A;  2EQ8 A;  2VOU A;  1VG0 A;  3SX6 A;  2EQ6 A;  2VVL A;  3EAN A;  4AT0 A;  1L9D A;  1Z6L A;  2YLX A;  1SEZ A;  3LZW A;  4NZH A;  2VQ7 A;  5C3J A;  4C77 A;  3DGZ A;  3H8I A;  2YWL A;  2XFP A;  4BV6 A;  2VQB A;  4REK A;  2OA1 A;  3CMM A;  4GDP A;  3RP7 A;  1FEC A;  4H2R A;  4XWR A;  3UTH A;  2YLW A;  1S3E A;  3KA7 A;  2JKC A;  3P4S A;  2RGO A;  3HYW A;  4IVO B;  2PYX A;  2C73 A;  2YG7 A;  4EQW A;  3R9U A;  2FBW A;  3PS9 A;  3SZ0 A;  3KU9 A;  4BK3 A;  4EM3 A;  1EL5 A;  1ZKQ A;  3AE5 A;  2XDO A;  1K4Q A;  1Y56 A;  2YR6 A;  1CC6 A;  3V76 A;  3NH3 X;  1MO9 A;  5KVH A;  3AEC A;  4IA5 A;  2BAC A;  2YVJ A;  2WPC A;  3UKL A;  2GQW A;  2BAB A;  2JB2 A;  2YLS A;  3IWA A;  4KX6 A;  1GES A;  2I0Z A;  2VZ2 A;  3DJD A;  3GD4 A;  4N9X A;  4AP3 A;  1JEH A;  2BK5 A;  3NT6 A;  5IQ4 A;  1F8S A;  2AAQ A;  4M52 A;  3KKJ A;  1GOS A;  1RSG A;  3CPJ G;  2YR4 A;  4FDC B;  1ZP0 A;  1ELI A;  5L46 A;  4ZN0 A;  4AT2 A;  2GB0 A;  3GMC A;  2WDV A;  3OC4 A;  2WP6 A;  4GDE A;  3VRA A;  3LZX A;  1E1N A;  5BVA A;  2C67 A;  1O94 A;  1EL8 A;  1GXF A;  1H84 A;  2XYO A;  3GYI A;  5KOW A;  1O95 A;  5HYM A;  1JRY A;  2E4G A;  2H88 A;  1DOB A;  2IVE A;  4U8P A;  3VRB A;  3ADA B;  2C76 A;  2QCU A;  4U8J A;  3SFE A;  2OAM A;  2EQ9 A;  3BHK A;  1JRZ A;  3KLJ A;  2AQJ A;  4U8K A;  3NRN A;  1GAL A;  2E1M A;  2V6O A;  4OPL A;  1ZK7 A;  3BI2 A;  1F8R A;  1Y56 B;  2A89 A;  4Y4N A;  4Z44 A;  1GTH A;  2NPX A;  1FEB A;  2B76 A;  1V59 A;  2GR2 A;  2FJA A;  3ITJ A;  5J7X A;  4U8L A;  1LQT A;  4H4X A;  5U25 A;  4A79 A;  5M10 A;  1RYI A;  2C65 A;  3LXD A;  4LII A;  3S5W A;  2XLU A;  2W0H A;  5M0Z A;  3UOZ A;  2YQU A;  3D8X A;  4AOX A;  1B37 A;  3AE1 A;  3AD9 B;  4YT0 A;  1D5T A;  2VVM A;  3T2K A;  3UKK A;  3ICT A;  2WOV A;  2WU2 A;  3GDP A;  4U2T A;  5KMS A;  2WES A;  1OJT A;  1NHR A;  4U8M A;  4J31 A;  3UKQ A;  1E6E A;  4H50 A;  1GSN A;  1H86 A;  1GT8 A;  1S2Q A;  3PVC A;  5EB5 A;  5EB4 A;  3Q6J A;  1ONF A;  3G5S A;  4H4Y A;  1NG4 A;  1D4D A;  5C2T A;  4YXD A;  2JK6 A;  4K2X A;  1FL2 A;  3AEG A;  4A7A A;  2R4E A;  3NYE A;  1TYT A;  1EL7 A;  3EF6 A;  1BWC A;  3GRS A;  4TLX A;  4PAB A;  3T2Y A;  4EQS A;  5JCL A;  2WEU A;  1DOE A;  1XAN A;  1D4C A;  1ZX9 A;  5JCM A;  1BGN A;  4J56 A;  2JB1 A;  4OPI A;  4BK2 A;  2FJB A;  5KVI A;  4JY2 A;  2BCG G;  3CPH G;  2A8X A;  2YG5 A;  3BNU A;  1B5Q A;  3NGC X;  2XVJ A;  4J33 A;  2V3A A;  4P9S A;  2XCG A;  1EBD A;  3COX A;  3II4 A;  2X50 A;  3AEE A;  2XLP A;  1Q1R A;  1TDF A;  3UOY A;  2HQM A;  4K5R A;  1M64 A;  2B9X A;  2BXR A;  2BCP A;  3H4K A;  3NIX A;  4II3 A;  2FJE A;  2GVC A;  5LV9 A;  3AE9 A;  1GRF A;  3NTA A;  3CNS A;  1E39 A;  2BS3 A;  3E1T A;  5HHF A;  2TPR A;  4G74 A;  3CTY A;  4XWZ A;  3GRT A;  4ZCD A;  1IUT A;  3UKF A;  4JQ9 A;  1MXT A;  2BRY A;  4FK1 C;  4X9N A;  2DKI A;  4EQR A;  5CKU A;  4YSY A;  2J3N A;  4X9M A;  2R46 A;  4H4Q A;  3AD8 B;  2BS2 A;  2ZZC A;  3K7M X;  2XVE A;  4AP1 A;  3SZC A;  1H83 A;  4ICY A;  1GRH A;  2Q0L A;  1GV4 A;  2C72 A;  3B6D A;  3M12 A;  1LV0 A;  4WCT A;  1YQ4 A;  4K8D A;  1W4X A;  4U8N A;  1QLB A;  4GAP A;  1RP0 A;  3CN8 A;  2DKH A;  4OPG A;  4X4J A;  5JCK A;  2XVF A;  2V5Z A;  3UKA A;  4FX9 A;  4D04 A;  1BF3 A;  2BK3 A;  4CBQ A;  5HY5 A;  4C3Y A;  4CY8 A;  4OVI A;  5JCI A;  1VDC A;  2C4C A;  5U1O A;  4APN A;  3D1C A;  4C5O A;  4LA1 A;  1XPQ A;  2JAE A;  2OLN A;  5U63 A;  4JN9 A;  1NHS A;  3RHA A;  1YKJ A;  1P2H A;  2Z5X A;  1H7W A;  1P2E A;  1UKV G;  2V60 A;  2ZBW A;  1CJ2 A;  1GRE A;  2X8C A;  3DJJ A;  3IHM A;  4Y4L A;  1FCD A;  1KFY A;  2BRA A;  2WBA A;  2Q0K A;  2WOW A;  4D03 A;  2WDR A;  1ZOV A;  3BHF A;  3IF9 A;  3V3O A;  3ALL A;  3K7T A;  1S3B A;  1BKW A;  2YM2 A;  3NK1 X;  4AOS A;  2YLZ A;  2GR0 A;  1AOG A;  3AYL A;  4USQ A;  3AD7 B;  1CHU A;  1KF6 A;  3ISH A;  3QFB A;  3QVR A;  3SY4 A;  2GQF A;  2GV8 A;  2R9Z A;  5EBK A;  4EMJ A;  4EIQ A;  4K22 A;  3CPI G;  3NN0 X;  3FMW A;  1PBD A;  1GND A;  3V3N A;  4A6N A;  1N4V A;  2C64 A;  1TDN A;  2YAU A;  4OPT A;  4U8O A;  4H4T A;  3QVP A;  1F6M A;  3O0H A;  5BRT A;  1KNP A;  2NVK X;  3AYI A;  2CDU A;  4J2W A;  1ZY8 A;  2QA1 A;  2BC1 A;  3HZL A;  1L0V A;  3QSE A;  3I3L A;  2A87 A;  1NDA A;  3WE0 A;  2WHD A;  2GH5 A;  1DNC A;  3NHO X;  4B64 A;  4C74 A;  2C7G A;  4DGK A;  4J57 A;  2WOI A;  1BZL A;  1GER A;  3F8P A;  3SM8 A;  2XVH A;  1YY5 A;  2BXS A;  1GEU A;  3NTD A;  2VRM A;  3RP8 A;  1PS9 A;  2BK4 A;  3EAO A;  4TM0 A;  5HXI A;  3DGH A;  2F5Z A;  1COY A;  3KD9 A;  4GR1 A;  3CGE A;  1NHP A;  3C4N A;  1DXL A;  4XXG A;  2WET A;  1PJ6 A;  2YLR A;  5KXJ A;  1L9C A;  4JNA A;  2WU5 A;  1FOH A;  1YQZ A;  4Z26 A;  2E5V A;  1PBB A;  3L8K A;  2VRL A;  3ZDN A;  2BA9 A;  4A65 A;  3CNJ A;  4YTP A;  2R0G A;  3RP6 A;  2Q6U A;  2R4J A;  1E1L A;  1CL0 A;  1Q9I A;  1OJA A;  3DK4 A;  3LAD A;  4G6G A;  1PDH A;  3FBS A;  2JB3 A;  1TYP A;  4H2Q A;  4U8I A;  1E7P A;  2WP9 A;  3FIM B;  3UKH A;  3ALM A;  4ADW A;  4A6N B;  1N1P A;  2C75 A;  4RG3 A;  1E1K A;  3P9U A;  4GAV A;  3LB8 A;  4WX1 A;  3T0K A;  5KOX A;  3L1R A;  4Z2U A;  4HA6 A;  5KMQ A;  1DJQ A;  3IHG A;  1REO A;  3SGL A;  4A5L A;  2XLR A;  4UP3 A;  3AE3 A;  4O5Q A;  4OCG A;  5GRT A;  5KRQ A;  1NG3 A;  4EIP A;  2XLS A;  4IV9 A;  4OPC A;  3GWD A;  4GF7 A;  4OPD A;  2BYB A;  3T31 A;  3VRD B;  5BUL A;  3AEA A;  4H4Z A;  4H4P A;  1JNR A;  2FJD A;  1K0J A;  4Y4M A;  1DJN A;  2LFC A;  1QJD A;  3SZF A;  4CNJ A;  2GAG B;  1IUX A;  1OJC A;  2XVI A;  3DJG X;  2C66 A;  1B4V A;  4B63 A;  2EQ7 A;  3ICR A;  2YG6 A;  3I6D A;  4H4V A;  2B7R A;  4NNJ A;  3EPT A;  4NTD A;  3NNE A;  1IUV A;  4Z43 A;  5IQ1 A;  1CC4 A;  3F8R A;  3BI5 A;  3GWF A;  1GRA A;  3GYX A;  2IVD A;  5BUK A;  1S2Y A;  2YLT A;  1GTE A;  2UZZ A;  2WPE A;  3BNM A;  2ZZB A;  3NLC A;  4Z2R A;  1E1M A;  2YG3 A;  1PHH A;  4FK1 A;  2XFN A;  2WQY A;  4EMW A;  4ECH A;  3T2Z A;  4H7U A;  3DJE A;  2R45 A;  3QSS A;  1N4W A;  3DK8 A;  1EL9 A;  3KVE A;  3CGC A;  1JOA A;  1DOD A;  2Z5Y A;  3NG7 X;  4U2L A;  1CJ4 A;  4A99 A;  4B66 A;  4YSH A;  1LJ1 A;  1GRB A;  4DSG A;  3LJP A;  1CC2 A;  1MOK A;  1VRQ B;  4K5S A;  3NK0 X;  4YKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...