5C3JA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 216
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c3jA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c3jA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c3jA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c3jA04
1IUUA 1FEBA 3NGCX 3S5WA 1KNPA 2YLZA 1NAAA 2APGA 2VOUA 3CTYA 4E0VA 3GYIA 5JCNA 4X9MA 3NTAA 1B4VA 5DBJA 4EQRA 3RP8A 3AEBA 1LQUA 3SQPA 4K7ZA 2H88A 2C75A 3QSEA 2X8GA 1E1MA 2W0HA 1F8SA 3AWIA 3P4RA 3ICRA 4JNQA 3B6DA 3CN8A 3M12A 5L46A 3UKFA 4EMJA 4A65A 2YM1A 3AYIA 3K7QX 4CCQA 3NTDA 2O9ZA 2OALA 2XVEA 3QSSA 2WESA 3AECA 2WOVA 3LZWA 3UTGA 2C73A 1GNDA 3VRDB 4EM4A 1PJ7A 4Z43A 1Z6LA 2WP9A 1NDAA 1PBCA 2YLXA 4H4TA 4I59A 1HYUA 2A8XA 4TM1A 4CRTA 1KFYA 1OJTA 2Q0KA 5M10A 1ONFA 3RNMA 2YLRA 2EQ9A 3ZYXA 4TLZA 4AP3A 2B76A 1KNRA 1PXBA 5BULA 3EANA 3NYCA 3AE1A 3K7MX 5GRTA 1N1PA 1BWCA 3UOYA 4Z2TA 4GRTA 1BF3A 2VRLA 3VR8A 2WU2A 3AEFA 1VRQB 5ER0A 1ZP0A 2YAUA 2BS4A 1H84A 4YKGA 1LVLA 5IQ1A 3GQHA 4CCRA 3V3OA 1L9DA 2YR4A 3KKJA 2ZBWA 4I58A 1PBDA 3CPIG 4B69A 3CIRA 5KVIA 4YSHA 5JCKA 1K0LA 1D4EA 1K0JA 2BA9A 2GB0A 2AR8A 4BK3A 2VRMA 4BJYA 1XDIA 3CNJA 1ZX9A 2OA1A 2BS2A 4YSXA 3CPJG 3L8KA 4ICYA 1H7WA 3NHOX 4C77A 1LQTA 3EAOA 4RSLA 4H4WA 4PABA 4C3YA 3P4PA 2UZZA 3QFAA 1JNZA 2JK6A 1EL7A 4REKA 3BHKA 2NPXA 4ZCCA 2XVHA 4DNAA 1N4WA 1OJ9A 1N4UA 3AE6A 1X31B 3PVCA 2XFPA 2ACZA 3UKLA 2ARDA 3AXBA 2BK4A 3CGCA 4H4YA 4IA5A 5EOWA 3UOXA 3NN6X 4Z25A 4OPDA 5BVAA 2QA2A 3AE4A 3DK4A 4X9NA 2JB2A 4H2RA 2EQ8A 3UTFA 4ZN0A 1S2QA 2X8CA 4NTEA 4TM0A 1GETA 1GRFA 4WX1A 4OPGA 2WP6A 4EMWA 1BKWA 1GT8A 1L9EA 4YKFA 3ITJA 3URHA 4USRA 3ADAB 4U2LA 2XLTA 1LV0A 4H4PA 1OJCA 4B63A 2E4GA 3K7TA 3AD9B 2CULA 4TM3A 2X3NA 4YWOA 4U8LA 3VRAA 3AB1A 2BK3A 1GRHA 4Z2RA 1GV4A 1Q9IA 2R45A 4H2QA 1GRGA 1CBOA 5U25A 1E1NA 4WCTA 2VQBA 2GEWA 3P4SA 3K30A 4CNJA 1PXCA 1GEUA 3JSKA 4H4UA 1Y56A 3ATQA 5C3JA 4LA1A 4C74A 2LFCA 3IWAA 4A5LA 3V76A 2C65A 4LU6A 4U2SA 3RP7A 1EBDA 2FJEA 1JRZA 1KSUA 2RGHA 2XCGA 5FS8A 5BRTA 2B9WA 4U8NA 2X99A 1TDOA 1DOCA 2C7GA 2J3NA 4ECHA 3ALLA 4H4ZA 2C66A 3CNTA 3IHMA 4JNAA 2XVIA 3ICSA 3BNMA 4C5OA 2V3AA 1IUVA 2XFUA 5JCLA 3CNPA 2WOWA 4TLXA 4K5RA 3UTEA 1NEKA 3NN0X 1EL9A 3UKKA 2IIDA 4J56A 1BGJA 1GXFA 3FBSA 4U8KA 5IQ4A 3SUCA 4Z26A 4IVMB 2XFQA 4Y4NA 2WHDA 1H86A 2GH5A 2C64A 4GDPA 2E5VA 3NIXA 3NK1X 2CFYA 3I3LA 4Y4MA 1ZMDA 1PS9A 2QA1A 3VQRA 3NK2X 1O5WA 1GREA 1GRBA 3BI2A 1PHHA 3Q9TA 2GMJA 3ALJA 4D03A 3PO7A 4B64A 4XWZA 1H81A 2YR6A 2I0ZA 1YQZA 1MO9A 2JB3A 2XFOA 4EQWA 5HXIA 3VR9A 1GTHA 4YTMA 2Q0LA 1B8SA 1GOSA 4FX9A 4FDCB 2Y6QA 1JRXA 3QJ4A 3QVPA 3DK9A 4J33A 2QCUA 4U8MA 1PN0A 4P9SA 1GRAA 2WPEA 1ZDLA 2H89A 5KWFA 1O94A 2XFNA 2YWLA 2Q7VA 1E1KA 1YKJA 4NTCA 3UKAA 4A79A 2B7SA 1ZMCA 4JN9A 2PHHA 2WPCA 2ZZ0A 1E39A 2BYBA 3DK8A 3AE9A 1TDEA 3P1WA 1VQWA 4RG4A 3FPZA 3KD9A 2YVFA 4USQA 5EB4A 1SEZA 1GRTA 2OLOA 3DGHA 4ZCDA 4FK1C 3NRNA 5IPYA 1UKVG 4Z2UA 3REDA 2BS3A 2JB1A 5EB5A 1FL2A 3DJDA 3M13A 2YLSA 4GUVA 2Y6RA 1ZKQA 1DOBA 1FEAA 5FS9A 3SFEA 2WOIA 3BI4A 2RGOA 3DA1A 4BURA 4GF7A 3FG2P 4CBQA 2AQJA 3UP5A 1NHPA 4H4VA 4K2XA 4U8JA 1F3PA 1YQ3A 3CNDA 4J34A 4NEVA 2BCGG 3DH9A 3H4KA 2YG6A 3ISHA 4YSZA 3GMBA 1DJQA 4CNKA 3ATRA 1QLBA 2YG3A 3B3RA 3AYLA 4H4SA 1GPEA 1BGNA 1NG4A 5HYMA 3DJEA 1REOA 3CGEA 3II4A 2R9ZA 4JQ9A 4CY6A 3CPHG 3H8IA 4JY2A 4B68A 1TDKA 2GRTA 4U8IA 3NNEA 4K8DA 2ZZBA 4J31A 2V61A 4XWRA 1CC6A 1PDHA 3BNUA 3GRTA 4AOSA 3GYXA 1GALA 4UDQA 4LIIA 4AP1A 2Z5YA 1DNCA 1TYPA 3V3NA 4JDRA 1RSGA 1CL0A 1XANA 5HHFA 3CNSA 2VZ2A 2GR1A 1H7XA 2XLSA 3GSIA 3I6DA 2YG5A 1YQ4A 1RYIA 2YG4A 1M6IA 4C3XA 3DGZA 1JOAA 1S3EA 2R0GA 1B37A 2WU5A 3LZXA 3KA7A 1XPQA 4K22A 1LJ1A 4H50A 4AT0A 2WQYA 1TDFA 1FOHA 1LPFA 1CJ3A 3F8RA 3GWFA 3NYFA 3AD7B 4NTDA 1KSSA 3NLCA 2YLTA 4NZHA 1P2EA 2WDQA 4GR1A 1BZLA 1H6VA 2XVJA 2X50A 5JCMA 4HB9A 4BV6A 1AOGA 3GRSA 1TYTA 4M52A 5FS7A 5JCIA 4HA6A 3BHFA 1Y0PA 3UKHA 4B67A 3AEEA 3QSMA 3F8PA 4OPCA 2FJBA 5CQFA 4KPRA 3ZDNA 2X8HA 3UCLA 1NENA 2C3CA 4JY3A 2WPFA 3L1RA 3UP4A 4B66A 4A6NA 5U1OA 3UOVA 1RP0A 2GR3A 5EBKA 3D8XA 3DJJA 4IVOB 1JU2A 5U63A 3NG7X 2VQ7A 3AE8A 2V60A 4KX6A 1TDNA 4H4RA 1K0IA 5J60A 1NHSA 1E7PA 1IUWA 1CJ4A 1QJDA 4H4XA 5GSNA 2GQFA 4YTPA 3HZLA 4H2NA 3OZ2A 4J36A 3RP6A 3AE2A 2V6OA 5HY5A 2EQ7A 3IHGA 2Z5XA 4Y4LA 1L9CA 4YTNA 3NYEA 2B9YA 1D7YA 2GAGB 4YSYA 1P2HA 2TPRA 1NHQA 2TMDA 4BK1A 1YY5A 3G5QA 4EM3A 1ZY8A 3E1TA 4APNA 4EQSA 2C3DA 2IVEA 2YLWA 4EMIA 4Z44A 4A99A 1F6MA 2WP5A 2HQMA 2GR0A 1JRYA 3VRBA 1PJ5A 4FK1A 1IUTA 2WEUA 3KLJA 2GAHB 5LV9A 5J7XA 3UTHA 1V59A 1VG0A 4EIPA 2DKIA 4XXGA 3SFDA 3P4QA 1IUSA 2YM2A 1JNRA 3LJPA 3DJGX 4B1BA 4U8OA 3C4AA 1H83A 3NK0X 2VVLA 4D04A 3UOZA 2XYOA 3ABVA 4B65A 2A87A 4J2WA 4EIQA 4OCGA 4YXDA 2V3BA 2GMHA 1PBBA 4BK2A 1FCDA 3IF9A 3O0HA 1GERA 5KOXA 1M64A 3CGDA 2RABA 1D4DA 4MJWA 4K5SA 1CC4A 2BC0A 2VVMA 3GD3A 2DKHA 3AE5A 3SM8A 2XDOA 4AOXA 3FIMB 2Q6UA 3AE7A 3H8LA 4ADWA 3KU9A 1D5TA 2WETA 1GSNA 1NPXA 2R0CA 1GESA 5TR3A 4Z24A 1EL8A 4DSGA 3G5RA 3AEGA 5KVHA 2IVDA 2YVJA 3QVRA 1DOEA 3PS9A 4NEWA 3KVEA 4GCMA 3CGBA 4BJZA 2VVLG 5KXJA 2B7RA 4A9WA 2C76A 5KOWA 2GVCA 3BI5A 3GYJA 2R46A 1ZOVA 1PBEA 1DXLA 2NVKX 3ICTA 5KRQA 1CJCA 5CKUA 1CF3A 1EL5A 3UKPA 2YVGA 4TM4A 3LXDA 2BC1A 4O5UA 3AE3A 3AD8B 3GD4A 4CY8A 3EPTA 2FJDA 4A6NB 1MXTA 2C72A 4DSHA 3AYJA 1LTXR 2R4JA 2FJAA 2BK5A 2C70A 3COXA 2GQWA 1Q1WA 1CHUA 3NKSA 5FS6A 2BXSA 3UKQA 2XLRA 1N4VA 2WDRA 1F8RA 1ZK7A 3NH3X 4H7UA 2F5ZA 1IJHA 2CVJA 3IC9A 4DGKA 1NG3A 3LADA 1D7LA 4OPTA 1OJDA 1CC2A 3DMEA 1DJNA 4UDPA 2PYXA 2WDVA 3SGLA 1QO8A 2E1MA 2V5ZA 2XLPA 1PXAA 4OVIA 4IA6A 4UP3A 3R9UA 1VG9A 1IUXA 2AAQA 4RG3A 3GDNA 3P9UA 5C2TA 1PJ6A 2JKCA 2A89A 3GWDA 4EQXA 1VDCA 5FMHA 1COYA 2ZZCA 1JEHA 1DODA 1ELIA 3EF6A 2OAMA 3D1CA 1Y56B 1S2YA 1NHRA 1E6EA 1H82A 1MOKA 4OPIA 3GDPA 4AT2A 1KDGA 3F8DA 4A7AA 1F8WA 2GV8A 2EQ6A 1B5QA 3C96A 2R4EA 3S61A 1KF6A 4YT0A 1S3BA 2GR2A 3NT6A 5M0ZA 1ZOYA 2YQUA 1D4CA 4X4JA 2BABA 2JAEA 2OLNA 3OC4A 4H4QA 3LB8A 2YR5A 4IV9A 1L0VA 1K4QA 3Q6JA 4U2TA 2C67A 1CJ2A 2B9XA 2XVFA 1OJAA 1TRBA 2WBAA 2R0PA 3G5SA 3KPFA 3RHAA 4GDEA 3ALMA 3GQKA 4OPLA 5BUKA 2BCPA 1GTEA 3AEDA 2BACA 3AEAA 3QFBA 1E1LA 4N9XA 1O95A 3FMWA 3GMCA 1PBFA 3M0OA 2RGJA 2FBWA 2YG7A 2GF3A 3LOVA 4OPUA 1XHCA 4H2PA 3WE0A 3C4NA 4J57A 1W4XA 2CDUA 2WS3A 3T37A 4O5QA 4UDRA 4PAAA 2BXRA 4U8PA 2JBVA 1Q1RA 2XLUA 1FECA 2QAEA
chains in the Genus database with same CATH superfamily
1MMNA 2VOUA 5CFBA 3AA6B 3C64A 5LMUT 3GYIA 4EZHA 5BR8T 2PYLA 4O4HE 1B4VA 5FY7A 3CQGB 3FZKB 1F8SA 3VKGA 3B6DA 4X66T 3RH3A 2XQ7A 3K7QX 3MZKB 2O9ZA 2XVEA 4A56A 2WESA 2WOVA 2V6YA 2C73A 4EM4A 4UELA 4TUYE 3AAAB 4CRTA 1KFYA 1OJTA 4PDWD 3RNMA 1RUI4 3ZYXA 4TLZA 5F8PA 5BULA 3EANA 3NYCA 3AE1A 2W4XA 5GRTA 5KMPA 3AA7B 1HR0T 4Z2TA 4X64T 1YKEB 3AEFA 1MIVA 3ZSTA 2V5CA 1H84A 4YKGA 1LVLA 2KWIB 2YR4A 4HTEA 3KKJA 1K0LA 2YN6A 1K0JA 3O4XE 2VRMA 3PJAJ 4DV1T 4BJYA 2V6YB 1HG2A 1PO14 2XAFB 4COFA 3NHOX 4C77A 4BJNA 2EHOA 1LQTA 2JK6A 4REKA 5LJMA 3BHKA 5BMVE 4ZCCA 2XVHA 4DNAA 3PVCA 3CGCA 4H4YA 2NWBA 4X9NA 2JB2A 3UTFA 2HH7A 2X66A 2N2NA 3PUXF 1GQEA 4ILUA 1ZV4X 4ERRA 3ITJA 2XAQB 3RRWA 4ISSA 3K3OA 1OJCA 4H4PA 4B63A 5JRCB 1DU2A 2VK9A 1J5ET 3VRAA 3WI3A 2BK3A 4Z2RA 3ZYMA 2WMNA 3K3NA 3TLWA 4V1Av 2VQBA 3K30A 4AIUA 4NPPA 4H4UA 2CWYA 1HFAA 2NOXA 3IWAA 3V76A 2AE9A 5EK3A 3TLTA 4E7ZA 4U2SA 3RP7A 3QB5A 1IBKT 1JRZA 2XCGA 5FXVA 5BRTA 4TWDA 1DOCA 4YJ2E 3PJAA 3RRCA 3ICSA 2NR4A 3CPZA 3ONXA 1IUVA 3ANWB 1VBA4 4K5RA 4QXCB 2X68A 3FZMB 3NN0X 3UKKA 2IUBA 4WBOA 5IQ4A 4U8KA 4Z26A 1BR0A 3JCFA 2E9XC 1KK7A 2UUAT 2WHDA 4GDPA 2C64A 1X79A 3NK1X 4Y4MA 1ZMDA 2LOSA 1O5WA 4JLEA 1XWMA 1PHHA 3VU7H 3HR0A 2VKDA 1EZ3A 2Z6EA 1HG5A 3PUAA 4AXPA 1YQZA 2XSAA 2I0MA 4EQWA 3VR9A 1GTHA 2Q0LA 2EHOD 1B8SA 3QNUA 3RIUA 2RMU4 3I9YA 4O4LE 4LMJA 5ETWA 3RKOA 4ZXLA 3DK9A 4UVCB 4AISA 4KP3C 1GRAA 2WPEA 4P9SA 2H89A 3AA1B 2KSRA 2Q7VA 4QWNB 1O3XA 3I0QA 4NTCA 4GAVA 2PJQA 4A79A 2B7SA 1MMDA 2PHHA 5KNLA 2BYBA 3DK8A 4P0BA 4G9KA 5CJ5A 3RQUA 4DR6T 1AR64 3A5XA 3FPZA 4LFBT 5AQPB 5HXCA 4USQA 5E0OA 1SEZA 2W00A 3DGHA 1ZKEA 4CXWA 4FK1C 5IPYA 3NKZA 4F8HA 3REDA 2BS3A 2J47A 1FL2A 5F3JA 3DJDA 2VASA 1ZKQA 1DOBA 2K24A 1FEAA 3RQWA 2WOIA 4I55E 2UXXB 2RGOA 3DA1A 2LLYA 3UP5A 4K2XA 5J2UE 1MQTD 4J34A 4ZZBA 3UU8A 1DJQA 5DQVA 4X20E 4H4SA 1GPEA 1NG4A 3ANWA 4PJNA 3PTRB 2BG9C 1AR84 4EAHA 3II4A 1WR6A 5H6RB 2R9ZA 4JQ9A 4CY6A 2Q9QA 3H8IA 4CN4A 2GRTA 4K8DA 2BBHA 5JDNA 2HPLA 2X0YA 2V61A 3BNUA 3GYXA 4JI6T 4UEMA 1GALA 4LIIA 2WMOA 3F57A 4QKNA 2DWGA 3EUHA 2LSJA 1CL0A 5HHFA 2VZ2A 3I6DA 3GSIA 2VKJA 3SOLA 5ABFB 2H3RA 2WSSV 4WBNE 1U5PA 3AB3B 3C4WA 1LJ1A 1LPFA 3NYFA 3F8RA 4U3CA 3TLUA 2YLTA 1RUH4 1P2EA 2WDQA 4U72A 4OHFA 5J2TE 2X50A 1AOGA 3GRSA 4WZXA 1TYTA 2CXFA 4PW8A 3UU6A 4HA6A 3UKHA 3JC6D 4IE4A 3AEEA 3QSMA 2FJBA 4IE6A 1KNZA 3KINB 5LXTE 2X8HA 3UP4A 4ZI3C 4B66A 3EAMA 1Z7S4 4PAGA 2GR3A 3KPKA 5EBKA 5JH7E 4IVOB 3NG7X 2V60A 4KX6A 4DR1T 1E7PA 2XQAA 3ZC1A 4HE8A 5FL0A 2GQFA 5GSNA 3AE2A 5HY5A 2D0UA 3EVYA 4YSYA 2E5LT 4UV9B 4EOZB 1YW0A 3GN5B 4APNA 3KBTA 3JBG4 4ILCA 4A99A 2WP5A 4DUZT 4IDQA 4ZHQE 2WEUA 3KLJA 2AXDS 3LK2B 1V59A 3HA4A 3P4QA 2CRBA 2KNDA 2VVLA 3UOZA 3KDSE 4WNKA 1UGOA 4B65A 2A87A 4EIQA 1Z0PA 3C50A 2JRKA 4I43B 2Y6XA 1D4DA 2VVMA 4LF5T 2DKHA 4KUMB 4AOXA 4HFCA 4PNIA 5HCJA 2R0CA 3CMLA 1GESA 5TR3A 3OJAA 4DMWA 2Y8DA 3G5RA 2YVJA 2BG9B 2RA1A 3FXEB 4JEHB 4GKKT 2KLQA 3ESLA 3CGBA 2PTFA 2PW9A 4AKGA 5KXJA 4A9WA 2C76A 5KOWA 3A8YC 2R46A 5KRQA 1DXLA 1CJCA 2WM9A 1HRV4 2CBIA 2BC1A 3DJBA 4HWDA 1I94T 3GD4A 3T1YT 4IGUA 3V5UA 2W0GA 2VQFT 4IREA 1MXTA 2C72A 1PIV4 2R064 5KMSA 1RHI4 2R4JA 2C70A 1EV14 3CWZB 3PV0F 1VBD4 2W2UA 4X1IE 2L8KA 2WDRA 3RPUA 2CVJA 4GK5E 1UCUA 4DO0A 5KMGP 5ABHA 5AQOB 2PYXA 4AQFA 2V5ZA 2XLPA 3R6NA 2JQKA 3HKBE 1VG9A 2AAQA 5AQJB 5LCYA 2JKCA 2A89A 5JR9C 3GWDA 4EQXA 4O2AE 1COYA 5AQGB 2OAMA 5CA0E 1H82A 4L9IA 2JJ9A 1KDGA 1F8WA 3C96A 5JREA 2HN2A 2ZM6T 4Q4X4 5L3BB 3ZMVB 4ZI2D 3NT6A 5M0ZA 1ZOYA 3DTOA 1IBLT 4Z90A 4Q4V4 2YR5A 3Q6JA 3RYHE 2C67A 1D4M4 2WBAA 4GDEA 3ALMA 2BCPA 3FZFB 4GYRA 4H9RC 5AQLB 2A3DA 5L2LA 3BK9A 4UXNB 2CMRA 2RGJA 2E9XB 2YG7A 2JQ9A 2ZMAA 1XHCA 4H2PA 2CM0A 2XASB 2K5BB 3L39A 5IYZE 4C90A 2BXRA 4UF0A 3AAIA 2JBVA 5LG3A 2XLUA 3HL6A 4J33A 3RI5A 1FEBA 3NGCX 2A9UA 4MFRA 1KNPA 2APGA 2CA5A 4E0VA 4P09A 4X9MA 2CHNA 3NTAA 5DBJA 3PU3A 2KMFA 4EQRA 3AEBA 1LQUA 3PE0A 2DLRA 2H88A 1E1MA 2ES0A 3PU8A 4JI5T 4HWFA 3AWIA 3ICRA 4IL4A 3CN8A 5L46A 3C4ZA 4EMJA 3ZN0B 1BR4A 1OEDA 1HNZT 3AYIA 5LJNA 3QSSA 2QGSA 4U2YA 3LZWA 3UTGA 1GNDA 3LFMA 1PJ7A 4A5XA 4II3A 1MNEA 1FIOA 2WP9A 1PBCA 3ZLIA 4H4TA 2XHEB 2YLRA 4LFAT 1HX8A 2EQ9A 1XHZA 3T1HT 1PXBA 3SYIA 3K7MX 4LF6T 3SZCA 1BF3A 5EK4A 2WU2A 2LRKA 1VRQB 1XNRT 3FBZA 5IQ1A 4CCRA 3IHRA 5AQVB 2VL8A 3ZKRA 2LJLA 3T2ZA 1PO24 4FJOA 2C5JA 4I58A 3CPIG 1D1AA 3CIRA 5KVIA 3RC3A 2GB0A 2AR8A 4BK3A 1XDIA 2IMLA 2BS2A 3Q5XA 2RP4A 3CPJG 3L8KA 1H7WA 2VWAA 3SX6A 1W09A 3EAOA 2D5UA 4PABA 2WZHA 2UZZA 3QFAA 4C3YA 2IAKA 1JNZA 5JR9B 3WAKA 1N4WA 2X9XA 1OJ9A 3AVRA 1X31B 2ZM8A 5FVKA 2BZBA 4ZS2A 3AXBA 4G6HA 2BK4A 4Z25A 5EOWA 3NN6X 5JDQA 2QA2A 3DK4A 3ZJ1A 2E2AA 2EQ8A 2BVMA 1S2QA 2X8CA 2MOZA 4NTEA 4TM0A 4F6RC 4OPGA 2PG8A 1L9EA 4YKFA 3A7MA 3URHA 4USRA 3LDQB 4U2LA 1LV0A 4Q4Y4 4TM3A 2X3NA 4YWOA 3L09A 4NWZA 1Q9IA 4H2QA 5U25A 1CBOA 2YDRA 2RR14 2JMKA 1D0YA 4LF8T 2LRLA 4G2AA 1Y56A 1YXRA 3ATQA 4LF4T 1YKHB 3EABA 3EI0A 2C65A 3CVRA 1EBDA 2RGHA 4ECHA 4U74A 4HKAA 3ALLA 5HEJA 4H4ZA 4UIGA 5L3FB 4JNAA 5L3DB 3BNMA 2MBGA 2XFUA 2KWHA 1NEKA 3OYXA 3UQ4A 2YOEA 4J56A 1GXFA 5FKYA 3PUGA 4QH1A 3UTKA 2UU9T 5KMRA 2CE7A 3J7Yq 1OXZA 3UU4A 4Y4NA 2GH5A 4CN6A 5JDLA 2NTYA 1OEDE 2CFYA 3I3LA 3NK2X 2CLYC 1GREA 1XMQT 4EEBA 5LGNB 2CPTA 4YHJA 2GMJA 2VKHA 4D03A 3PO7A 4XWZA 2I0ZA 3GA8A 1MO9A 2JB3A 2XFOA 5HXIA 4YTMA 1GOSA 2HN1A 1JRXA 2EHOC 1W0BA 1OOPD 3QVPA 4U8MA 2QCUA 1PN0A 1BR1A 4GK0E 1ZDLA 2YDSA 4DR3T 5KWFA 2XFNA 3IBPA 5HWYA 3QOFA 3UKAA 5LA6E 5CB4E 4TX5A 4DR5T 1E39A 3TLSA 1TDEA 3KV6A 5EB4A 5LG4A 2JQHA 5AQUB 4DUYT 4ZCDA 2YU2A 1UX4A 3NRNA 1J1JA 4KBMB 5AQNB 1HXS4 2YLSA 2V8SV 4ISTA 2Y6RA 2VVNA 5LMNT 3BI4A 1FEWA 4GF7A 3FG2P 2AQJA 4H4VA 1XI1A 2ZLYA 3LBXA 4NEVA 2BCGG 3ISHA 2X0LB 4YSZA 4AKIA 4IE7A 3CQCB 3U78A 3B3RA 3AYLA 1BGNA 3N2KE 5HYMA 1M62A 3F31A 3H37A 3MJXA 3CGEA 1D1CA 3CPHG 1WYBA 4B68A 1TDKA 4WYVA 2ZZBA 3EDUA 4EZ4A 4J31A 4DBQA 3NWIA 4AOSA 3GRTA 4IDNA 5HWXA 2YDQA 2NW8A 4UF0B 1RSGA 3CNSA 2GR1A 4CI3B 4G74A 4PJMA 2J62A 1XMOT 2H7VC 5L4EA 3LZXA 3Q5DA 4K22A 4AT0A 2WQYA 1TDFA 3N2GE 3GWFA 3AD7B 2LOPA 1RMU4 1VBB4 3F2EA 3N9QA 5A1LA 5AQIB 4HB9A 4QX7B 4IE5A 2LKGA 4M52A 2QA7A 4B67A 2R074 4OPCA 3F8PA 4X65T 2XQ4A 4KPRA 3ZDNA 2RM24 2C3CA 3HYVA 2VURA 2NW7A 3JADA 3NBXX 5HEGA 3UOVA 2HHHT 1RP0A 5L3GB 4JUYA 3DJJA 1JU2A 5H6QB 3AE8A 3CX6B 1SA0E 2V7KA 1E2AA 5LB7B 2XQ3A 1AJ3A 3HZLA 3OZ2A 5LYJE 3UU3A 3RP6A 2V6OA 3SZ0A 2EQ7A 3I0OA 3TLVA 1N34T 2GAGB 5ABGA 4CN1A 1NHQA 4JI8T 3VHLA 4AQGA 4BK1A 2RPAA 1YY5A 3ONJA 4EQSA 2C3DA 3FB2A 2YLWA 2PBIA 4EMIA 2XQ5A 3J8F4 2HQMA 5AQFB 1IJ6A 4FK1A 3K1SA 5LBQB 3QK6A 4FI5A 3QUJA 2XY8B 3ZSSA 5LV9A 2DWKA 3UTHA 3QC9A 4XXGA 2YM2A 4H63H 1JNRA 5TAOA 3LJPA 4B1BA 4U8OA 2SPCA 3OPCA 3NK0X 2XYOA 2LE8A 3ABVA 4J2WA 4IIJE 4OCGA 2GMHA 4BK2A 3O0HA 4JI2T 3CGDA 4HGAA 4PFPA 2Q9QC 3AE5A 3HKEE 1HNWT 3FIMB 2V1DB 1D5TA 2WETA 4GB34 3ZT7A 4DR7T 4DSGA 3QVRA 1DOEA 4NEWA 2W67A 1UX5A 2OLTA 4BJZA 2WZIA 4EYUA 1VBC4 3ONLC 5CKUA 2UXCT 1T72A 1EL5A 3GWHA 3AE3A 3AD8B 2Q9QD 3Q9DA 4CY8A 3EPTA 4IDOA 4DV7T 4LMKA 4NNJA 4DSHA 2D0TA 3AYJA 2LSKA 2X9HA 4KHZF 5JRCA 2FJAA 3COXA 2XQYA 2GQWA 1Q1WA 1CHUA 3M65A 1LVKA 2BXSA 3NKSA 5FS6A 4C91A 3E0ZA 1ZK7A 4TV8E 5JQGE 1IJHA 4DGKA 4J2CA 4PK4A 4DV0T 1NG3A 4H9OC 3JAEA 4UVBB 2JMHA 2MPKA 1PXAA 4IA6A 4MLKA 4IL9A 2X67A 5C2TA 3RIFA 1VDCA 4E7SA 5FMHA 2ODUA 5ABEA 2ZZCA 2LHNA 3UT5E 1T7SA 1HS7A 3GDPA 2EHOB 1MIWA 3EHZA 2GV8A 2YKSA 1B5QA 5DJQC 3S61A 1KF6A 4YT0A 1S3BA 1IAPA 4EGWA 2YQUA 4X4JA 4H4QA 4IT4A 4CI1B 5FY0A 3LB8A 1K4QA 2P9BA 1CJ2A 5LP6E 2B9XA 2CBJA 3G5SA 2MAWA 2XQ8A 3AEDA 2X5ID 3UFEA 3S4UA 1ASJ4 2BACA 4N9XA 1O95A 3GMCA 3D0TA 5HCMA 1OWAA 3VKHA 3N9PA 1BR2A 2GF3A 3LOVA 2ODVA 4J57A 2WS3A 3T37A 1HRI4 4U7IA 4DR4T 2QAEA 2M6BA 3PDYA 5ADXL 4DV6T 3FBLA 1NAAA 5HAXA 2XQ9A 2PYJA 1VBE4 3RP8A 4TV9E 2WB5A 3BQKA 3CKDA 1BEV4 2X8GA 3C98B 2LSIA 4GYSA 3MA9A 2PLV4 3UKFA 1WLXA 5IHYA 4A65A 2YM1A 4CCQA 2OALA 2HWB4 2W63A 2UXNB 3VRDB 4Z43A 1RUG4 3HYWA 1Z6LA 4TM1A 2YLXA 4I59A 2A8XA 2Q0KA 3HYXA 1KEYA 1KNRA 2L3LA 2XAGB 4I4TE 2KXPB 1N1PA 3UOYA 1OEDB 3VR8A 1ZP0A 2BS4A 1RUC4 4HFDA 2M67A 4ZOLE 3V3OA 1L9DA 3ZN1B 2ZBWA 1PBDA 4B69A 3KV5A 5JCKA 3FHNA 2BA9A 2X9YA 3MXZA 3GN5A 2ACXA 2V26A 2K48A 3UUXB 4HWCA 4N78D 3P4PA 4ILBA 2IDOB 3LG7A 5HEUA 2A72A 1N4UA 3AE6A 4NXMT 2C4CA 2ACZA 3HKCE 2ARDA 2E9XA 3P8CD 4DV3T 4QH5A 4ZN0A 2UXDT 1GETA 1GRFA 5L3EB 1W9RA 2QRXA 5FYMA 3KVBA 3UUMA 2XLTA 3AD9B 3FXDB 4U8LA 2WCAA 3ZT5A 1GRHA 1GV4A 2R45A 3T31A 2GK9A 1US7B 2MYSA 1E1NA 2V7IA 4I50E 4CNJA 1PXCA 1NA1D 5ABFA 3B13A 4ASKA 1IBMT 1GEUA 3JSKA 2XJ7A 4C74A 1NWMX 4CI2B 2LFCA 4A5LA 4HN9A 3NRYA 4LU6A 1VCSA 2VKOA 4JYAT 4G6GA 4QXBB 2X99A 1TDOA 3N9LA 2C7GA 2C66A 3CNTA 3B57A 4LMLA 3IHMA 2Q9QB 2XVIA 4AI6A 4C5OA 3CNPA 4JBWF 2WOWA 1PVC4 5FNVE 1WCRA 3UTEA 4OYJA 1BGJA 4IVMB 2NW9A 2XFQA 5EZYE 4YLHA 1H86A 2UXBT 4DV5T 3BQIA 2F4VT 3CQXC 2CEAA 3NIXA 4G73A 1PS9A 2QA1A 3VQRA 3AXJB 1GRBA 3BI2A 2WAUA 3Q9TA 2L9QA 3P7IA 3ALJA 4AKLA 4AKRB 4NIQA 2BG9A 5DABA 2HPJA 1NAFA 2VQET 2BBJA 4FX9A 4FDCB 3UUBA 2IIUA 3HKDE 3PUVF 3QJ4A 1H8TD 3W15B 2W62A 5JTGA 1FJGT 4OYKA 4H63V 2YWLA 3IEEA 1E1KA 3T8OA 3ZMZB 4U31A 1MMGA 4HFBA 4JN9A 2V7MA 4HFHA 4II2A 4OK0A 3E08A 3AE9A 5KMQA 3KD9A 1ZEEA 2NTXA 4H9SE 4NUVA 4H9PC 4LF7T 1GRTA 2OLOA 3AAEB 3IF8B 1UKVG 5JDFA 5LGUB 2N9DA 5EB5A 2XSBA 2M6IA 4GUVA 1SE7A 5FS9A 4ZS3A 1VCTA 4BURA 4JI0T 2XZEA 4CBQA 2LM2A 3T2YA 4Z91A 5AQMB 3DH9A 3ZYKA 3GMBA 5LGTB 2LM9A 2OA5A 1REOA 3UUNA 1MNDA 4U8IA 4U7YA 4XWRA 1CC6A 1PDHA 4ANJA 4AP1A 3CK6A 2Z5YA 1DNCA 3V3NA 2RS34 1H7XA 2YG5A 5L47A 1M6IA 4C3XA 2R7FA 1JOAA 2CXDA 2XPKA 2R0GA 1B37A 2CCQA 3KVAA 3KA7A 1XPQA 4U2ZA 4NZHA 1SHZC 1FOHA 4NTDA 1CJ3A 4WX1A 1KSSA 5AQHB 2C5IT 2LT3A 4IDPA 1LVFA 2XVJA 5JCMA 1VRBA 4BV6A 2PZSA 3KV4A 3BHFA 3OTOT 5FP3A 2XAJB 2ZM0A 2I6HA 5CQFA 4JY3A 1RUD4 4WW0A 4PFOA 4A6NA 1E1HB 2XAHB 2BKOA 3CX7B 3OYZA 2VQ7A 1UURA 2VB6A 3ZC0A 1TDNA 4H4RA 4X1YE 1NHSA 1QJDA 1CJ4A 4ZZCA 4HWHA 4H2NA 1XDOA 4J36A 4P0AA 5HXRA 3ZMSB 3L3PA 1N33T 2Z5XA 4TZ4C 4ZI2C 4UV8B 4YTNA 4O8SA 3NYEA 1D7YA 1P2HA 3KFWX 4EM3A 3Q5WA 2K3WA 3C51A 3E1TA 3KV9A 2IVEA 3E22E 4Z44A 1F6MA 2GR0A 1JRYA 1D0XA 5CA1E 3K8PC 5AQRB 1U4QA 4X62T 5J7XA 1UUSA 1VG0A 2E8IA 1IUSA 1X9BA 3DJGX 1H83A 3N9MA 4D04A 5AQTB 3PUQA 5FXXA 1MIYA 1EAH4 5JR9A 2IW5B 3JAFA 3V5SA 1GERA 5KOXA 1M64A 2RABA 4XAXB 4K5SA 1XNQT 3GD3A 1ZHCA 4GKJT 2Q6UA 2BKPA 3H8LA 4ADWA 3KU9A 3EDVA 1GSNA 1YD8G 1NPXA 4Z24A 1HF8A 2IVDA 5FMNA 4GCMA 1IJ5A 2VVLG 2CXLA 1ZOVA 2NVKX 4UR9A 3AXJA 5FL1A 4GOUA 5HXHA 3PUSA 4O5UA 2FJDA 4A6NB 5M4YA 1WRDA 1RUF4 1LTXR 3RX6A 4DVDA 4Q25A 1R8IA 3UKQA 4OX9T 3CMMA 2W61A 4EXTA 5CGMA 3IC9A 4QX8B 3I9WA 1OJDA 3IA3A 4UDPA 3SGLA 2CHOA 2DI4A 4PJJA 3X1DA 1LKXA 2BKNA 3R9UA 2LSYA 1XHXA 2YK0A 3P9UA 2J1DG 1PJ6A 5HEHA 1RUJ4 1JEHA 2J4GA 1ELIA 3EF6A 3RF1A 1S2YA 1NHRA 4P1NA 1E6EA 1MOKA 5LHHB 4A7AA 3F8DA 4TWHA 2EQ6A 5IUXA 4A98A 3AA0B 4QXHB 2GR2A 1COV4 1D4CA 4CQIA 1L0VA 3PURA 3ZMTB 5FXWA 2R0PA 3KPFA 3GQKA 4Z8XA 4B6XA 4OPLA 5BUKA 1M7KA 4ZI3D 3QFBA 4JI1T 1PBFA 3M0OA 4TNWA 3JC6C 3MACA 4IHJE 4OPUA 5AQQB 4TWFA 3C4NA 1W4XA 1SUMB 4B3MT 4UDRA 2XM2A 2JQQA 2LSGA 5JVDE 4ZEYA 4GAPA 1FECA 1IUUA 5FVLA 3S5WA 2PY5A 4YHHT 2YLZA 3CTYA 3JD74 5JCNA 2BG9E 3HI2A 3RGLA 3QB5K 4AQFC 2RS54 3ZCJA 3SQPA 1D1BA 4K7ZA 5J1GA 1R084 2C75A 3QSEA 4HFIA 2W0HA 1WFDA 3PUYF 4PK6A 4JNQA 3UFGA 3P4RA 3M12A 4AQYT 2X51A 3NTDA 1HX1B 4YY3T 3AECA 4JEUB 5JDMA 1NDAA 3I1AA 1HYUA 3RYIE 5KDMC 5M10A 1ONFA 4AP3A 2BDEA 2B76A 3LSVA 3WAJA 2BRAA 4I0UA 2XQ6A 1D0ZA 1BWCA 4GRTA 4X1KE 2VRLA 5ER0A 2YAUA 3GQHA 3N5LA 5AQSB 2LHRA 1V9DA 1AR74 4YSHA 1D4EA 4O4JE 1QUUA 3O1JA 3CNJA 1ZX9A 2OA1A 4YSXA 2Y48B 4ICYA 5DQWA 4O2BE 3GMIA 3RIUC 2D9DA 4RSLA 4H4WA 1EL7A 4HFVA 2NPXA 4KI0F 2XFPA 3NZQA 4DIDB 3J9X1 4K0UA 1XZYA 3UKLA 4IA5A 3UOXA 4OPDA 5BVAA 3AE4A 4B3TT 4H2RA 1N36T 1NCQD 4B3ST 4DNDA 1OEDC 4B3RT 1RUE4 2WP6A 2JPFA 4M1PA 4EMWA 1BKWA 1GT8A 1UK5A 3ZYLA 2PFVA 2D2SA 3ADAB 4TNVA 1WYCA 3ZMUB 2E4GA 3K7TA 2CULA 2V5DA 2WBLA 2ZM2A 3B5MA 3AB1A 1GRGA 2WY2A 3H3AA 4YJ3E 4WCTA 2GEWA 3P4SA 3R84B 2V6XA 1I6ZA 5HXSA 5HXEA 4EEDA 2E9XD 5C3JA 4LF9T 4LA1A 5L3CB 3MKDA 4MHCA 3RHWA 3RYCE 2FJEA 1KSUA 5FS8A 3SS1A 2B9WA 4U8NA 2J3NA 3N9NA 3SWHA 4ADZA 4O4IE 2V3AA 2WWVA 5J0ZA 5JCLA 2KINB 1AL24 4TLXA 1EL9A 3L8RA 2IIDA 3SUCA 3FBSA 2KZ7B 2W66A 3DP7A 4XBFB 2E5VA 1XDPA 3T14A 5C8YE 5L4HA 4RHV4 4KMCA 4MALA 2MTQA 2EX3A 2JIWA 1VOMA 1J5WA 3P4WA 2DHRA 4B64A 1H81A 2XM1A 2YR6A 3K3QC 2NP9A 5HEOA 3NRXA 1RVF4 5JDGA 3H3MA 2IC9A 2Y6QA 3FZLB 3O1HA 5GONE 3RKGA 2I59A 2K9AA 1Y64B 2BRYA 3OVUA 2C0SA 1O94A 4UVAB 2KT9A 1YKJA 3N9OA 4YFSA 2V7LA 4G63A 4EYYR 1ZMCA 5FXZA 2LEHA 2WPCA 2ZZ0A 1FMWA 3P1WA 3SZFA 4DR2T 1VQWA 4RG4A 2YVFA 3AVSA 5AFUL 4X5TA 1W0AA 4Z2UA 2B1EA 4U33A 2UUCT 4PK5A 1CUNA 3N2OA 2JB1A 3SXIA 3M13A 2OV9A 3RC8A 3SFEA 1Y01A 1H7CA 4CZZB 1NHPA 4U8JA 1F3PA 1YQ3A 3CNDA 3FZHB 4HFEA 2YG6A 3H4KA 4QHOA 4CNKA 3ATRA 1QLBA 2YG3A 4H9QC 2VVSA 5KX5E 2DNXA 1QSDA 3DJEA 3UULA 1FMVA 2R6GF 4JY2A 4BA9A 2DCFA 1HCIA 3NNEA 3MK7C 4UDQA 3FI7A 1TYPA 2RS14 4JDRA 1XANA 2XLSA 5JDHA 3PUZF 1YQ4A 1RYIA 2YG4A 3U3IA 3DGZA 1S3EA 2UUBT 4TN7B 1POV0 2WU5A 1K5MD 4H50A 1T98A 2QYWA 2YINA 5IWAT 3NLCA 4GR1A 4NUUA 1BZLA 2FUPA 1H6VA 1S35A 2VL0A 5FS7A 3Q5EA 5JCIA 3O9XA 1Y0PA 4EIWA 2G0UA 4H9NC 3T0KA 3UCLA 1NENA 4MBQA 2WPFA 1LRZA 3L1RA 5LHGB 5U1OA 1T8BA 3D8XA 5U63A 3OKQA 5J60A 1K0IA 4H4XA 1IUWA 2IC6A 1WR0A 1HTJF 4YTPA 4L0RA 1B7TA 3IHGA 4Y4LA 1L9CA 4EV6A 2HWC4 2B9YA 2TPRA 2TMDA 2DL1A 3G5QA 1G8XA 1ZY8A 2N1GA 2XTLA 1HNXT 1Z8UA 5AQKB 2C5KT 2V7JA 3VRBA 3Q2MA 4LFCT 1PJ5A 1IUTA 1S94A 2GAHB 4EB6E 2DKIA 4EIPA 3SFDA 3RYFE 3C4AA 3T2KA 3CX8B 3UQ7A 2CWOA 2R044 3TKLB 4YXDA 2V3BA 3O1IA 1PBBA 2WWUA 4DV2T 1FCDA 2H7OA 3IF9A 4MJWA 1CC4A 2BC0A 3SM8A 2XDOA 4ILAA 5EK2A 5LBMA 3AE7A 2YU1A 4HEAA 2BVLA 5HYAA 1EL8A 3AEGA 5KVHA 3PS9A 4QH4A 3KVEA 2B7RA 4NXNT 3LBXB 3BQLA 2GVCA 3BI5A 3GYJA 1R094 1PBEA 3M3ZB 3ICTA 3ZEFB 1CF3A 3G06A 4KHPT 3UKPA 4BJMA 2YVGA 4TM4A 3LXDA 4BAYB 4OFZA 1VRH4 5LNKA 4DV4T 3KBUA 3ZJ2A 2YEVC 3RIAA 2BK5A 3SZWA 3ZPOA 2XLRA 1N4VA 1F8RA 4H7UA 1MMAA 3NH3X 3SY4A 2F5ZA 4HWIB 3ETVA 3NVOA 4JI4T 3LADA 1D7LA 4OPTA 4AKHA 3NZPA 1CC2A 3DMEA 1DJNA 2WDVA 4Q4W4 1QO8A 2E1MA 4OVIA 4UP3A 4RG3A 1IUXA 3GDNA 4JI3T 4ZI7E 2LKHA 1G73A 3C4XA 1DODA 1AR94 3PUWF 4IE0A 4CXYA 3D1CA 1Y56B 4OPIA 4DMVA 3OBVE 4AT2A 4K0KT 4JI7T 2R4EA 5F5WA 2XUEA 4DBRA 3RLFF 1IZNB 5FY1A 2BABA 5LHIB 2JAEA 3SRZA 2OLNA 3OC4A 2X0HA 4IV9A 4U2TA 2QVAA 2XVFA 1OJAA 1TRBA 4JV5T 3RHAA 2A2FX 4L5GA 3ETUA 3P50A 2CLYB 4IDZA 2X9WA 3LJCA 4GIWA 1GTEA 3AEAA 3LK42 3ZT6A 1E1LA 3FMWA 1N32T 2FBWA 5LOVE 3LK3B 3UU5A 4PJLA 3ZCIA 3WE0A 4CXXA 2CDUA 4O5QA 4PAAA 4A97A 4U8PA 2IHR1 1Q1RA 4XZCA
chains in the Genus database with same CATH topology
1IUUA 1FEBA 3NGCX 3S5WA 1KNPA 2YLZA 1NAAA 2APGA 2VOUA 3CTYA 4E0VA 3GYIA 5JCNA 4X9MA 3NTAA 1B4VA 5DBJA 4EQRA 3RP8A 3AEBA 1LQUA 3SQPA 4K7ZA 2H88A 2C75A 3QSEA 2X8GA 1E1MA 2W0HA 1F8SA 3AWIA 3P4RA 3ICRA 4JNQA 3B6DA 3CN8A 3M12A 5L46A 3UKFA 4EMJA 4A65A 2YM1A 3AYIA 3K7QX 4CCQA 3NTDA 2O9ZA 2OALA 2XVEA 3QSSA 2WESA 3AECA 2WOVA 3LZWA 3UTGA 2C73A 1GNDA 3VRDB 4EM4A 1PJ7A 4II3A 4Z43A 3HYWA 1Z6LA 2WP9A 1NDAA 1PBCA 2YLXA 4H4TA 4I59A 1HYUA 2A8XA 4TM1A 4CRTA 1KFYA 1OJTA 2Q0KA 3HYXA 1ONFA 5M10A 3RNMA 4GAPA 2YLRA 2EQ9A 3ZYXA 4TLZA 4AP3A 2B76A 1KNRA 1PXBA 5BULA 3EANA 3NYCA 3AE1A 3SYIA 2BRAA 3K7MX 5GRTA 1N1PA 1BWCA 3UOYA 4Z2TA 4GRTA 3SZCA 1BF3A 5KMPA 2VRLA 3VR8A 2WU2A 3AEFA 1VRQB 5ER0A 1ZP0A 2YAUA 2BS4A 1H84A 4YKGA 1LVLA 5IQ1A 3GQHA 4CCRA 3V3OA 1L9DA 2YR4A 3KKJA 3T2ZA 2ZBWA 4I58A 1PBDA 3CPIG 4B69A 3CIRA 5KVIA 4YSHA 5JCKA 1K0LA 1D4EA 1K0JA 2BA9A 2GB0A 2AR8A 4BK3A 2VRMA 4BJYA 1XDIA 3CNJA 1ZX9A 2OA1A 2BS2A 4YSXA 3CPJG 3L8KA 4ICYA 1H7WA 3NHOX 4C77A 3SX6A 1LQTA 3EAOA 4RSLA 4H4WA 4PABA 4C3YA 3P4PA 2UZZA 3QFAA 1JNZA 2JK6A 1EL7A 4REKA 3BHKA 2NPXA 4ZCCA 2XVHA 4DNAA 1N4WA 1OJ9A 1N4UA 3AE6A 1X31B 2C4CA 3PVCA 2XFPA 2ACZA 3UKLA 2ARDA 3AXBA 4G6HA 2BK4A 3CGCA 4H4YA 4IA5A 5EOWA 3UOXA 3NN6X 4Z25A 4OPDA 5BVAA 2QA2A 3AE4A 3DK4A 4X9NA 2JB2A 4H2RA 2EQ8A 3UTFA 4ZN0A 1S2QA 2X8CA 4NTEA 4TM0A 1GETA 1GRFA 4WX1A 4OPGA 2WP6A 4EMWA 1BKWA 1GT8A 1L9EA 4YKFA 3ITJA 3URHA 4USRA 3ADAB 4U2LA 2XLTA 1LV0A 4H4PA 1OJCA 4B63A 2E4GA 3K7TA 3AD9B 2CULA 4TM3A 2X3NA 4YWOA 4U8LA 3VRAA 3AB1A 2BK3A 1GRHA 4NWZA 1GV4A 1Q9IA 2R45A 3T31A 4Z2RA 4H2QA 1GRGA 1CBOA 5U25A 1E1NA 4WCTA 2VQBA 2GEWA 3P4SA 3K30A 4CNJA 1PXCA 1GEUA 3JSKA 4H4UA 1Y56A 3ATQA 5C3JA 4LA1A 4C74A 2LFCA 3IWAA 4A5LA 3V76A 2C65A 4LU6A 4U2SA 3RP7A 1EBDA 2FJEA 1JRZA 1KSUA 2RGHA 2XCGA 4G6GA 5FS8A 2B9WA 4U8NA 2X99A 1TDOA 1DOCA 2C7GA 2J3NA 4ECHA 3ALLA 4H4ZA 2C66A 3CNTA 3IHMA 4JNAA 2XVIA 3ICSA 3BNMA 4C5OA 2V3AA 1IUVA 2XFUA 5JCLA 3CNPA 2WOWA 4TLXA 4K5RA 3UTEA 1NEKA 3NN0X 1EL9A 3UKKA 2IIDA 4J56A 1BGJA 1GXFA 3FBSA 4U8KA 5IQ4A 3SUCA 4Z26A 4IVMB 5KMRA 2XFQA 4Y4NA 2WHDA 1H86A 2GH5A 2C64A 4GDPA 2E5VA 3T14A 3NIXA 3NK1X 2CFYA 3I3LA 4G73A 1ZMDA 4Y4MA 1PS9A 2QA1A 3VQRA 3NK2X 1O5WA 1GREA 1GRBA 3BI2A 1PHHA 3Q9TA 2GMJA 3ALJA 4D03A 3PO7A 4B64A 4XWZA 1H81A 2YR6A 2I0ZA 1YQZA 1MO9A 2JB3A 2XFOA 4EQWA 5HXIA 3VR9A 1GTHA 4YTMA 2Q0LA 1B8SA 1GOSA 4FX9A 4FDCB 2Y6QA 1JRXA 3QJ4A 3QVPA 2BRYA 3DK9A 4J33A 2QCUA 4U8MA 1PN0A 4P9SA 1GRAA 2WPEA 1ZDLA 2H89A 5KWFA 1O94A 2XFNA 2YWLA 2Q7VA 1E1KA 1YKJA 4NTCA 3UKAA 4GAVA 4A79A 2B7SA 1ZMCA 4JN9A 2PHHA 5KNLA 2WPCA 2ZZ0A 1E39A 2BYBA 3DK8A 4II2A 4G9KA 3AE9A 1TDEA 3P1WA 3SZFA 1VQWA 4RG4A 3FPZA 5KMQA 3KD9A 2YVFA 4USQA 5EB4A 1SEZA 1GRTA 2OLOA 3DGHA 4ZCDA 4FK1C 3NRNA 5IPYA 1UKVG 4Z2UA 3REDA 2BS3A 2JB1A 5EB5A 1FL2A 3DJDA 3SXIA 3M13A 2YLSA 4GUVA 2Y6RA 1ZKQA 1DOBA 1FEAA 5FS9A 3SFEA 2WOIA 3BI4A 2RGOA 3DA1A 4BURA 4GF7A 3FG2P 4CBQA 2AQJA 3UP5A 1NHPA 4H4VA 4K2XA 4U8JA 1F3PA 1YQ3A 3T2YA 3CNDA 4J34A 4NEVA 2BCGG 3DH9A 3H4KA 2YG6A 3ISHA 4YSZA 3GMBA 1DJQA 4CNKA 3ATRA 1QLBA 2YG3A 3B3RA 3AYLA 4H4SA 1GPEA 1BGNA 1NG4A 5HYMA 3DJEA 1REOA 3CGEA 3II4A 2R9ZA 4JQ9A 4CY6A 3CPHG 3H8IA 4JY2A 4B68A 1TDKA 2GRTA 4U8IA 3NNEA 4K8DA 2ZZBA 4J31A 2V61A 4XWRA 1CC6A 1PDHA 3BNUA 3GRTA 3GYXA 4AOSA 1GALA 4UDQA 4LIIA 4AP1A 2Z5YA 1DNCA 1TYPA 3V3NA 4JDRA 1RSGA 1CL0A 1XANA 5HHFA 3CNSA 2VZ2A 2GR1A 1H7XA 2XLSA 3GSIA 3I6DA 2YG5A 1YQ4A 1RYIA 2YG4A 1M6IA 4C3XA 3DGZA 1JOAA 1S3EA 4G74A 2R0GA 1B37A 2WU5A 3LZXA 3KA7A 1XPQA 4K22A 1LJ1A 4H50A 4AT0A 2WQYA 1TDFA 1FOHA 1LPFA 1CJ3A 3F8RA 3GWFA 3NYFA 3AD7B 4NTDA 1KSSA 3NLCA 2YLTA 4NZHA 1P2EA 2WDQA 4GR1A 1BZLA 1H6VA 2XVJA 2X50A 5JCMA 4HB9A 4BV6A 1AOGA 3GRSA 1TYTA 4M52A 5FS7A 5JCIA 4HA6A 3BHFA 1Y0PA 3UKHA 4B67A 3AEEA 3QSMA 3F8PA 4OPCA 2FJBA 5CQFA 4KPRA 3ZDNA 2X8HA 3T0KA 1NENA 2C3CA 3HYVA 2WPFA 3L1RA 4JY3A 3UCLA 3UP4A 4B66A 4A6NA 5U1OA 3UOVA 1RP0A 2GR3A 3KPKA 5EBKA 3D8XA 3DJJA 4IVOB 1JU2A 5U63A 3NG7X 2VQ7A 3AE8A 2V60A 4KX6A 1TDNA 4H4RA 1K0IA 5J60A 1NHSA 1E7PA 1IUWA 1CJ4A 1QJDA 4H4XA 5GSNA 2GQFA 4YTPA 3HZLA 4H2NA 3OZ2A 4J36A 3RP6A 3AE2A 2V6OA 5HY5A 3SZ0A 2EQ7A 3IHGA 2Z5XA 4Y4LA 1L9CA 4YTNA 3NYEA 2B9YA 1D7YA 2GAGB 4YSYA 1P2HA 2TPRA 1NHQA 2TMDA 4BK1A 1YY5A 3G5QA 4EM3A 1ZY8A 3E1TA 4APNA 4EQSA 2C3DA 2IVEA 2YLWA 4EMIA 4Z44A 4A99A 1F6MA 2WP5A 2HQMA 2GR0A 1JRYA 3VRBA 1PJ5A 4FK1A 1IUTA 2WEUA 3KLJA 2GAHB 5LV9A 5J7XA 3UTHA 1V59A 1VG0A 4EIPA 2DKIA 4XXGA 3SFDA 3P4QA 1IUSA 2YM2A 1JNRA 3LJPA 3DJGX 4B1BA 4U8OA 3C4AA 3T2KA 1H83A 3NK0X 2VVLA 4D04A 3UOZA 2XYOA 3ABVA 4B65A 2A87A 4J2WA 4EIQA 4OCGA 4YXDA 2V3BA 2GMHA 1PBBA 4BK2A 1FCDA 3IF9A 3O0HA 1GERA 5KOXA 1M64A 3CGDA 2RABA 1D4DA 4MJWA 4K5SA 1CC4A 2BC0A 2VVMA 3GD3A 2DKHA 3AE5A 3SM8A 2XDOA 4AOXA 3FIMB 2Q6UA 3AE7A 3H8LA 4ADWA 3KU9A 1D5TA 2WETA 1GSNA 1NPXA 2R0CA 1GESA 5TR3A 4Z24A 1EL8A 4DSGA 3G5RA 3AEGA 5KVHA 2IVDA 2YVJA 3QVRA 1DOEA 3PS9A 4NEWA 3KVEA 4GCMA 3CGBA 4BJZA 2VVLG 5KXJA 2B7RA 4A9WA 2C76A 5KOWA 2GVCA 3BI5A 3GYJA 2R46A 1ZOVA 1PBEA 1DXLA 2NVKX 3ICTA 5KRQA 1CJCA 5CKUA 1CF3A 1EL5A 3UKPA 2YVGA 4TM4A 3LXDA 2BC1A 4O5UA 3AE3A 3AD8B 3GD4A 4CY8A 3EPTA 2FJDA 4A6NB 1MXTA 2C72A 4NNJA 4DSHA 3AYJA 5KMSA 1LTXR 2R4JA 2FJAA 2C70A 2BK5A 3COXA 2GQWA 1Q1WA 1CHUA 3SZWA 3NKSA 5FS6A 2BXSA 3UKQA 2XLRA 1N4VA 2WDRA 1F8RA 1ZK7A 3NH3X 3CMMA 4H7UA 3SY4A 2F5ZA 1IJHA 2CVJA 3IC9A 4DGKA 1NG3A 3LADA 1D7LA 4OPTA 1OJDA 1CC2A 3DMEA 1DJNA 4UDPA 2PYXA 2WDVA 3SGLA 1QO8A 2E1MA 2V5ZA 2XLPA 1PXAA 4OVIA 4IA6A 4UP3A 3R9UA 1VG9A 1IUXA 2AAQA 4RG3A 3GDNA 3P9UA 5C2TA 1PJ6A 2JKCA 2A89A 3GWDA 4EQXA 1VDCA 5FMHA 1COYA 2ZZCA 1JEHA 1DODA 1ELIA 3EF6A 2OAMA 3D1CA 1Y56B 1S2YA 1NHRA 1E6EA 1H82A 1MOKA 4OPIA 3GDPA 4AT2A 1KDGA 3F8DA 4A7AA 1F8WA 2GV8A 2EQ6A 1B5QA 3C96A 2R4EA 3S61A 1KF6A 4YT0A 1S3BA 2GR2A 3NT6A 5M0ZA 1ZOYA 2YQUA 1D4CA 4X4JA 2BABA 2JAEA 2OLNA 3OC4A 4H4QA 3LB8A 2YR5A 4IV9A 1L0VA 1K4QA 3Q6JA 4U2TA 2C67A 1CJ2A 2B9XA 2XVFA 1OJAA 1TRBA 2WBAA 2R0PA 3G5SA 3KPFA 3RHAA 4GDEA 3ALMA 3GQKA 4OPLA 5BUKA 2BCPA 1GTEA 3AEDA 2BACA 3AEAA 3QFBA 1E1LA 4N9XA 1O95A 3FMWA 3GMCA 1PBFA 3M0OA 2RGJA 2FBWA 2YG7A 2GF3A 3LOVA 4OPUA 1XHCA 4H2PA 3WE0A 3C4NA 4J57A 1W4XA 5BRTA 2CDUA 2WS3A 3T37A 4O5QA 4UDRA 4PAAA 2BXRA 4U8PA 2JBVA 1Q1RA 2XLUA 1FECA 2QAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUU A;  1FEB A;  3NGC X;  3S5W A;  1KNP A;  2YLZ A;  1NAA A;  2APG A;  2VOU A;  3CTY A;  4E0V A;  3GYI A;  5JCN A;  4X9M A;  3NTA A;  1B4V A;  5DBJ A;  4EQR A;  3RP8 A;  3AEB A;  1LQU A;  3SQP A;  4K7Z A;  2H88 A;  2C75 A;  3QSE A;  2X8G A;  1E1M A;  2W0H A;  1F8S A;  3AWI A;  3P4R A;  3ICR A;  4JNQ A;  3B6D A;  3CN8 A;  3M12 A;  5L46 A;  3UKF A;  4EMJ A;  4A65 A;  2YM1 A;  3AYI A;  3K7Q X;  4CCQ A;  3NTD A;  2O9Z A;  2OAL A;  2XVE A;  3QSS A;  2WES A;  3AEC A;  2WOV A;  3LZW A;  3UTG A;  2C73 A;  1GND A;  3VRD B;  4EM4 A;  1PJ7 A;  4Z43 A;  1Z6L A;  2WP9 A;  1NDA A;  1PBC A;  2YLX A;  4H4T A;  4I59 A;  1HYU A;  2A8X A;  4TM1 A;  4CRT A;  1KFY A;  1OJT A;  2Q0K A;  5M10 A;  1ONF A;  3RNM A;  2YLR A;  2EQ9 A;  3ZYX A;  4TLZ A;  4AP3 A;  2B76 A;  1KNR A;  1PXB A;  5BUL A;  3EAN A;  3NYC A;  3AE1 A;  3K7M X;  5GRT A;  1N1P A;  1BWC A;  3UOY A;  4Z2T A;  4GRT A;  1BF3 A;  2VRL A;  3VR8 A;  2WU2 A;  3AEF A;  1VRQ B;  5ER0 A;  1ZP0 A;  2YAU A;  2BS4 A;  1H84 A;  4YKG A;  1LVL A;  5IQ1 A;  3GQH A;  4CCR A;  3V3O A;  1L9D A;  2YR4 A;  3KKJ A;  2ZBW A;  4I58 A;  1PBD A;  3CPI G;  4B69 A;  3CIR A;  5KVI A;  4YSH A;  5JCK A;  1K0L A;  1D4E A;  1K0J A;  2BA9 A;  2GB0 A;  2AR8 A;  4BK3 A;  2VRM A;  4BJY A;  1XDI A;  3CNJ A;  1ZX9 A;  2OA1 A;  2BS2 A;  4YSX A;  3CPJ G;  3L8K A;  4ICY A;  1H7W A;  3NHO X;  4C77 A;  1LQT A;  3EAO A;  4RSL A;  4H4W A;  4PAB A;  4C3Y A;  3P4P A;  2UZZ A;  3QFA A;  1JNZ A;  2JK6 A;  1EL7 A;  4REK A;  3BHK A;  2NPX A;  4ZCC A;  2XVH A;  4DNA A;  1N4W A;  1OJ9 A;  1N4U A;  3AE6 A;  1X31 B;  3PVC A;  2XFP A;  2ACZ A;  3UKL A;  2ARD A;  3AXB A;  2BK4 A;  3CGC A;  4H4Y A;  4IA5 A;  5EOW A;  3UOX A;  3NN6 X;  4Z25 A;  4OPD A;  5BVA A;  2QA2 A;  3AE4 A;  3DK4 A;  4X9N A;  2JB2 A;  4H2R A;  2EQ8 A;  3UTF A;  4ZN0 A;  1S2Q A;  2X8C A;  4NTE A;  4TM0 A;  1GET A;  1GRF A;  4WX1 A;  4OPG A;  2WP6 A;  4EMW A;  1BKW A;  1GT8 A;  1L9E A;  4YKF A;  3ITJ A;  3URH A;  4USR A;  3ADA B;  4U2L A;  2XLT A;  1LV0 A;  4H4P A;  1OJC A;  4B63 A;  2E4G A;  3K7T A;  3AD9 B;  2CUL A;  4TM3 A;  2X3N A;  4YWO A;  4U8L A;  3VRA A;  3AB1 A;  2BK3 A;  1GRH A;  4Z2R A;  1GV4 A;  1Q9I A;  2R45 A;  4H2Q A;  1GRG A;  1CBO A;  5U25 A;  1E1N A;  4WCT A;  2VQB A;  2GEW A;  3P4S A;  3K30 A;  4CNJ A;  1PXC A;  1GEU A;  3JSK A;  4H4U A;  1Y56 A;  3ATQ A;  5C3J A;  4LA1 A;  4C74 A;  2LFC A;  3IWA A;  4A5L A;  3V76 A;  2C65 A;  4LU6 A;  4U2S A;  3RP7 A;  1EBD A;  2FJE A;  1JRZ A;  1KSU A;  2RGH A;  2XCG A;  5FS8 A;  5BRT A;  2B9W A;  4U8N A;  2X99 A;  1TDO A;  1DOC A;  2C7G A;  2J3N A;  4ECH A;  3ALL A;  4H4Z A;  2C66 A;  3CNT A;  3IHM A;  4JNA A;  2XVI A;  3ICS A;  3BNM A;  4C5O A;  2V3A A;  1IUV A;  2XFU A;  5JCL A;  3CNP A;  2WOW A;  4TLX A;  4K5R A;  3UTE A;  1NEK A;  3NN0 X;  1EL9 A;  3UKK A;  2IID A;  4J56 A;  1BGJ A;  1GXF A;  3FBS A;  4U8K A;  5IQ4 A;  3SUC A;  4Z26 A;  4IVM B;  2XFQ A;  4Y4N A;  2WHD A;  1H86 A;  2GH5 A;  2C64 A;  4GDP A;  2E5V A;  3NIX A;  3NK1 X;  2CFY A;  3I3L A;  4Y4M A;  1ZMD A;  1PS9 A;  2QA1 A;  3VQR A;  3NK2 X;  1O5W A;  1GRE A;  1GRB A;  3BI2 A;  1PHH A;  3Q9T A;  2GMJ A;  3ALJ A;  4D03 A;  3PO7 A;  4B64 A;  4XWZ A;  1H81 A;  2YR6 A;  2I0Z A;  1YQZ A;  1MO9 A;  2JB3 A;  2XFO A;  4EQW A;  5HXI A;  3VR9 A;  1GTH A;  4YTM A;  2Q0L A;  1B8S A;  1GOS A;  4FX9 A;  4FDC B;  2Y6Q A;  1JRX A;  3QJ4 A;  3QVP A;  3DK9 A;  4J33 A;  2QCU A;  4U8M A;  1PN0 A;  4P9S A;  1GRA A;  2WPE A;  1ZDL A;  2H89 A;  5KWF A;  1O94 A;  2XFN A;  2YWL A;  2Q7V A;  1E1K A;  1YKJ A;  4NTC A;  3UKA A;  4A79 A;  2B7S A;  1ZMC A;  4JN9 A;  2PHH A;  2WPC A;  2ZZ0 A;  1E39 A;  2BYB A;  3DK8 A;  3AE9 A;  1TDE A;  3P1W A;  1VQW A;  4RG4 A;  3FPZ A;  3KD9 A;  2YVF A;  4USQ A;  5EB4 A;  1SEZ A;  1GRT A;  2OLO A;  3DGH A;  4ZCD A;  4FK1 C;  3NRN A;  5IPY A;  1UKV G;  4Z2U A;  3RED A;  2BS3 A;  2JB1 A;  5EB5 A;  1FL2 A;  3DJD A;  3M13 A;  2YLS A;  4GUV A;  2Y6R A;  1ZKQ A;  1DOB A;  1FEA A;  5FS9 A;  3SFE A;  2WOI A;  3BI4 A;  2RGO A;  3DA1 A;  4BUR A;  4GF7 A;  3FG2 P;  4CBQ A;  2AQJ A;  3UP5 A;  1NHP A;  4H4V A;  4K2X A;  4U8J A;  1F3P A;  1YQ3 A;  3CND A;  4J34 A;  4NEV A;  2BCG G;  3DH9 A;  3H4K A;  2YG6 A;  3ISH A;  4YSZ A;  3GMB A;  1DJQ A;  4CNK A;  3ATR A;  1QLB A;  2YG3 A;  3B3R A;  3AYL A;  4H4S A;  1GPE A;  1BGN A;  1NG4 A;  5HYM A;  3DJE A;  1REO A;  3CGE A;  3II4 A;  2R9Z A;  4JQ9 A;  4CY6 A;  3CPH G;  3H8I A;  4JY2 A;  4B68 A;  1TDK A;  2GRT A;  4U8I A;  3NNE A;  4K8D A;  2ZZB A;  4J31 A;  2V61 A;  4XWR A;  1CC6 A;  1PDH A;  3BNU A;  3GRT A;  4AOS A;  3GYX A;  1GAL A;  4UDQ A;  4LII A;  4AP1 A;  2Z5Y A;  1DNC A;  1TYP A;  3V3N A;  4JDR A;  1RSG A;  1CL0 A;  1XAN A;  5HHF A;  3CNS A;  2VZ2 A;  2GR1 A;  1H7X A;  2XLS A;  3GSI A;  3I6D A;  2YG5 A;  1YQ4 A;  1RYI A;  2YG4 A;  1M6I A;  4C3X A;  3DGZ A;  1JOA A;  1S3E A;  2R0G A;  1B37 A;  2WU5 A;  3LZX A;  3KA7 A;  1XPQ A;  4K22 A;  1LJ1 A;  4H50 A;  4AT0 A;  2WQY A;  1TDF A;  1FOH A;  1LPF A;  1CJ3 A;  3F8R A;  3GWF A;  3NYF A;  3AD7 B;  4NTD A;  1KSS A;  3NLC A;  2YLT A;  4NZH A;  1P2E A;  2WDQ A;  4GR1 A;  1BZL A;  1H6V A;  2XVJ A;  2X50 A;  5JCM A;  4HB9 A;  4BV6 A;  1AOG A;  3GRS A;  1TYT A;  4M52 A;  5FS7 A;  5JCI A;  4HA6 A;  3BHF A;  1Y0P A;  3UKH A;  4B67 A;  3AEE A;  3QSM A;  3F8P A;  4OPC A;  2FJB A;  5CQF A;  4KPR A;  3ZDN A;  2X8H A;  3UCL A;  1NEN A;  2C3C A;  4JY3 A;  2WPF A;  3L1R A;  3UP4 A;  4B66 A;  4A6N A;  5U1O A;  3UOV A;  1RP0 A;  2GR3 A;  5EBK A;  3D8X A;  3DJJ A;  4IVO B;  1JU2 A;  5U63 A;  3NG7 X;  2VQ7 A;  3AE8 A;  2V60 A;  4KX6 A;  1TDN A;  4H4R A;  1K0I A;  5J60 A;  1NHS A;  1E7P A;  1IUW A;  1CJ4 A;  1QJD A;  4H4X A;  5GSN A;  2GQF A;  4YTP A;  3HZL A;  4H2N A;  3OZ2 A;  4J36 A;  3RP6 A;  3AE2 A;  2V6O A;  5HY5 A;  2EQ7 A;  3IHG A;  2Z5X A;  4Y4L A;  1L9C A;  4YTN A;  3NYE A;  2B9Y A;  1D7Y A;  2GAG B;  4YSY A;  1P2H A;  2TPR A;  1NHQ A;  2TMD A;  4BK1 A;  1YY5 A;  3G5Q A;  4EM3 A;  1ZY8 A;  3E1T A;  4APN A;  4EQS A;  2C3D A;  2IVE A;  2YLW A;  4EMI A;  4Z44 A;  4A99 A;  1F6M A;  2WP5 A;  2HQM A;  2GR0 A;  1JRY A;  3VRB A;  1PJ5 A;  4FK1 A;  1IUT A;  2WEU A;  3KLJ A;  2GAH B;  5LV9 A;  5J7X A;  3UTH A;  1V59 A;  1VG0 A;  4EIP A;  2DKI A;  4XXG A;  3SFD A;  3P4Q A;  1IUS A;  2YM2 A;  1JNR A;  3LJP A;  3DJG X;  4B1B A;  4U8O A;  3C4A A;  1H83 A;  3NK0 X;  2VVL A;  4D04 A;  3UOZ A;  2XYO A;  3ABV A;  4B65 A;  2A87 A;  4J2W A;  4EIQ A;  4OCG A;  4YXD A;  2V3B A;  2GMH A;  1PBB A;  4BK2 A;  1FCD A;  3IF9 A;  3O0H A;  1GER A;  5KOX A;  1M64 A;  3CGD A;  2RAB A;  1D4D A;  4MJW A;  4K5S A;  1CC4 A;  2BC0 A;  2VVM A;  3GD3 A;  2DKH A;  3AE5 A;  3SM8 A;  2XDO A;  4AOX A;  3FIM B;  2Q6U A;  3AE7 A;  3H8L A;  4ADW A;  3KU9 A;  1D5T A;  2WET A;  1GSN A;  1NPX A;  2R0C A;  1GES A;  5TR3 A;  4Z24 A;  1EL8 A;  4DSG A;  3G5R A;  3AEG A;  5KVH A;  2IVD A;  2YVJ A;  3QVR A;  1DOE A;  3PS9 A;  4NEW A;  3KVE A;  4GCM A;  3CGB A;  4BJZ A;  2VVL G;  5KXJ A;  2B7R A;  4A9W A;  2C76 A;  5KOW A;  2GVC A;  3BI5 A;  3GYJ A;  2R46 A;  1ZOV A;  1PBE A;  1DXL A;  2NVK X;  3ICT A;  5KRQ A;  1CJC A;  5CKU A;  1CF3 A;  1EL5 A;  3UKP A;  2YVG A;  4TM4 A;  3LXD A;  2BC1 A;  4O5U A;  3AE3 A;  3AD8 B;  3GD4 A;  4CY8 A;  3EPT A;  2FJD A;  4A6N B;  1MXT A;  2C72 A;  4DSH A;  3AYJ A;  1LTX R;  2R4J A;  2FJA A;  2BK5 A;  2C70 A;  3COX A;  2GQW A;  1Q1W A;  1CHU A;  3NKS A;  5FS6 A;  2BXS A;  3UKQ A;  2XLR A;  1N4V A;  2WDR A;  1F8R A;  1ZK7 A;  3NH3 X;  4H7U A;  2F5Z A;  1IJH A;  2CVJ A;  3IC9 A;  4DGK A;  1NG3 A;  3LAD A;  1D7L A;  4OPT A;  1OJD A;  1CC2 A;  3DME A;  1DJN A;  4UDP A;  2PYX A;  2WDV A;  3SGL A;  1QO8 A;  2E1M A;  2V5Z A;  2XLP A;  1PXA A;  4OVI A;  4IA6 A;  4UP3 A;  3R9U A;  1VG9 A;  1IUX A;  2AAQ A;  4RG3 A;  3GDN A;  3P9U A;  5C2T A;  1PJ6 A;  2JKC A;  2A89 A;  3GWD A;  4EQX A;  1VDC A;  5FMH A;  1COY A;  2ZZC A;  1JEH A;  1DOD A;  1ELI A;  3EF6 A;  2OAM A;  3D1C A;  1Y56 B;  1S2Y A;  1NHR A;  1E6E A;  1H82 A;  1MOK A;  4OPI A;  3GDP A;  4AT2 A;  1KDG A;  3F8D A;  4A7A A;  1F8W A;  2GV8 A;  2EQ6 A;  1B5Q A;  3C96 A;  2R4E A;  3S61 A;  1KF6 A;  4YT0 A;  1S3B A;  2GR2 A;  3NT6 A;  5M0Z A;  1ZOY A;  2YQU A;  1D4C A;  4X4J A;  2BAB A;  2JAE A;  2OLN A;  3OC4 A;  4H4Q A;  3LB8 A;  2YR5 A;  4IV9 A;  1L0V A;  1K4Q A;  3Q6J A;  4U2T A;  2C67 A;  1CJ2 A;  2B9X A;  2XVF A;  1OJA A;  1TRB A;  2WBA A;  2R0P A;  3G5S A;  3KPF A;  3RHA A;  4GDE A;  3ALM A;  3GQK A;  4OPL A;  5BUK A;  2BCP A;  1GTE A;  3AED A;  2BAC A;  3AEA A;  3QFB A;  1E1L A;  4N9X A;  1O95 A;  3FMW A;  3GMC A;  1PBF A;  3M0O A;  2RGJ A;  2FBW A;  2YG7 A;  2GF3 A;  3LOV A;  4OPU A;  1XHC A;  4H2P A;  3WE0 A;  3C4N A;  4J57 A;  1W4X A;  2CDU A;  2WS3 A;  3T37 A;  4O5Q A;  4UDR A;  4PAA A;  2BXR A;  4U8P A;  2JBV A;  1Q1R A;  2XLU A;  1FEC A;  2QAE A; 
#chains in the Genus database with same CATH topology
 1MMN A;  2VOU A;  5CFB A;  3AA6 B;  3C64 A;  5LMU T;  3GYI A;  4EZH A;  5BR8 T;  2PYL A;  4O4H E;  1B4V A;  5FY7 A;  3CQG B;  3FZK B;  1F8S A;  3VKG A;  3B6D A;  4X66 T;  3RH3 A;  2XQ7 A;  3K7Q X;  3MZK B;  2O9Z A;  2XVE A;  4A56 A;  2WES A;  2WOV A;  2V6Y A;  2C73 A;  4EM4 A;  4UEL A;  4TUY E;  3AAA B;  4CRT A;  1KFY A;  1OJT A;  4PDW D;  3RNM A;  1RUI 4;  3ZYX A;  4TLZ A;  5F8P A;  5BUL A;  3EAN A;  3NYC A;  3AE1 A;  2W4X A;  5GRT A;  5KMP A;  3AA7 B;  1HR0 T;  4Z2T A;  4X64 T;  1YKE B;  3AEF A;  1MIV A;  3ZST A;  2V5C A;  1H84 A;  4YKG A;  1LVL A;  2KWI B;  2YR4 A;  4HTE A;  3KKJ A;  1K0L A;  2YN6 A;  1K0J A;  3O4X E;  2VRM A;  3PJA J;  4DV1 T;  4BJY A;  2V6Y B;  1HG2 A;  1PO1 4;  2XAF B;  4COF A;  3NHO X;  4C77 A;  4BJN A;  2EHO A;  1LQT A;  2JK6 A;  4REK A;  5LJM A;  3BHK A;  5BMV E;  4ZCC A;  2XVH A;  4DNA A;  3PVC A;  3CGC A;  4H4Y A;  2NWB A;  4X9N A;  2JB2 A;  3UTF A;  2HH7 A;  2X66 A;  2N2N A;  3PUX F;  1GQE A;  4ILU A;  1ZV4 X;  4ERR A;  3ITJ A;  2XAQ B;  3RRW A;  4ISS A;  3K3O A;  1OJC A;  4H4P A;  4B63 A;  5JRC B;  1DU2 A;  2VK9 A;  1J5E T;  3VRA A;  3WI3 A;  2BK3 A;  4Z2R A;  3ZYM A;  2WMN A;  3K3N A;  3TLW A;  4V1A v;  2VQB A;  3K30 A;  4AIU A;  4NPP A;  4H4U A;  2CWY A;  1HFA A;  2NOX A;  3IWA A;  3V76 A;  2AE9 A;  5EK3 A;  3TLT A;  4E7Z A;  4U2S A;  3RP7 A;  3QB5 A;  1IBK T;  1JRZ A;  2XCG A;  5FXV A;  5BRT A;  4TWD A;  1DOC A;  4YJ2 E;  3PJA A;  3RRC A;  3ICS A;  2NR4 A;  3CPZ A;  3ONX A;  1IUV A;  3ANW B;  1VBA 4;  4K5R A;  4QXC B;  2X68 A;  3FZM B;  3NN0 X;  3UKK A;  2IUB A;  4WBO A;  5IQ4 A;  4U8K A;  4Z26 A;  1BR0 A;  3JCF A;  2E9X C;  1KK7 A;  2UUA T;  2WHD A;  4GDP A;  2C64 A;  1X79 A;  3NK1 X;  4Y4M A;  1ZMD A;  2LOS A;  1O5W A;  4JLE A;  1XWM A;  1PHH A;  3VU7 H;  3HR0 A;  2VKD A;  1EZ3 A;  2Z6E A;  1HG5 A;  3PUA A;  4AXP A;  1YQZ A;  2XSA A;  2I0M A;  4EQW A;  3VR9 A;  1GTH A;  2Q0L A;  2EHO D;  1B8S A;  3QNU A;  3RIU A;  2RMU 4;  3I9Y A;  4O4L E;  4LMJ A;  5ETW A;  3RKO A;  4ZXL A;  3DK9 A;  4UVC B;  4AIS A;  4KP3 C;  1GRA A;  2WPE A;  4P9S A;  2H89 A;  3AA1 B;  2KSR A;  2Q7V A;  4QWN B;  1O3X A;  3I0Q A;  4NTC A;  4GAV A;  2PJQ A;  4A79 A;  2B7S A;  1MMD A;  2PHH A;  5KNL A;  2BYB A;  3DK8 A;  4P0B A;  4G9K A;  5CJ5 A;  3RQU A;  4DR6 T;  1AR6 4;  3A5X A;  3FPZ A;  4LFB T;  5AQP B;  5HXC A;  4USQ A;  5E0O A;  1SEZ A;  2W00 A;  3DGH A;  1ZKE A;  4CXW A;  4FK1 C;  5IPY A;  3NKZ A;  4F8H A;  3RED A;  2BS3 A;  2J47 A;  1FL2 A;  5F3J A;  3DJD A;  2VAS A;  1ZKQ A;  1DOB A;  2K24 A;  1FEA A;  3RQW A;  2WOI A;  4I55 E;  2UXX B;  2RGO A;  3DA1 A;  2LLY A;  3UP5 A;  4K2X A;  5J2U E;  1MQT D;  4J34 A;  4ZZB A;  3UU8 A;  1DJQ A;  5DQV A;  4X20 E;  4H4S A;  1GPE A;  1NG4 A;  3ANW A;  4PJN A;  3PTR B;  2BG9 C;  1AR8 4;  4EAH A;  3II4 A;  1WR6 A;  5H6R B;  2R9Z A;  4JQ9 A;  4CY6 A;  2Q9Q A;  3H8I A;  4CN4 A;  2GRT A;  4K8D A;  2BBH A;  5JDN A;  2HPL A;  2X0Y A;  2V61 A;  3BNU A;  3GYX A;  4JI6 T;  4UEM A;  1GAL A;  4LII A;  2WMO A;  3F57 A;  4QKN A;  2DWG A;  3EUH A;  2LSJ A;  1CL0 A;  5HHF A;  2VZ2 A;  3I6D A;  3GSI A;  2VKJ A;  3SOL A;  5ABF B;  2H3R A;  2WSS V;  4WBN E;  1U5P A;  3AB3 B;  3C4W A;  1LJ1 A;  1LPF A;  3NYF A;  3F8R A;  4U3C A;  3TLU A;  2YLT A;  1RUH 4;  1P2E A;  2WDQ A;  4U72 A;  4OHF A;  5J2T E;  2X50 A;  1AOG A;  3GRS A;  4WZX A;  1TYT A;  2CXF A;  4PW8 A;  3UU6 A;  4HA6 A;  3UKH A;  3JC6 D;  4IE4 A;  3AEE A;  3QSM A;  2FJB A;  4IE6 A;  1KNZ A;  3KIN B;  5LXT E;  2X8H A;  3UP4 A;  4ZI3 C;  4B66 A;  3EAM A;  1Z7S 4;  4PAG A;  2GR3 A;  3KPK A;  5EBK A;  5JH7 E;  4IVO B;  3NG7 X;  2V60 A;  4KX6 A;  4DR1 T;  1E7P A;  2XQA A;  3ZC1 A;  4HE8 A;  5FL0 A;  2GQF A;  5GSN A;  3AE2 A;  5HY5 A;  2D0U A;  3EVY A;  4YSY A;  2E5L T;  4UV9 B;  4EOZ B;  1YW0 A;  3GN5 B;  4APN A;  3KBT A;  3JBG 4;  4ILC A;  4A99 A;  2WP5 A;  4DUZ T;  4IDQ A;  4ZHQ E;  2WEU A;  3KLJ A;  2AXD S;  3LK2 B;  1V59 A;  3HA4 A;  3P4Q A;  2CRB A;  2KND A;  2VVL A;  3UOZ A;  3KDS E;  4WNK A;  1UGO A;  4B65 A;  2A87 A;  4EIQ A;  1Z0P A;  3C50 A;  2JRK A;  4I43 B;  2Y6X A;  1D4D A;  2VVM A;  4LF5 T;  2DKH A;  4KUM B;  4AOX A;  4HFC A;  4PNI A;  5HCJ A;  2R0C A;  3CML A;  1GES A;  5TR3 A;  3OJA A;  4DMW A;  2Y8D A;  3G5R A;  2YVJ A;  2BG9 B;  2RA1 A;  3FXE B;  4JEH B;  4GKK T;  2KLQ A;  3ESL A;  3CGB A;  2PTF A;  2PW9 A;  4AKG A;  5KXJ A;  4A9W A;  2C76 A;  5KOW A;  3A8Y C;  2R46 A;  5KRQ A;  1DXL A;  1CJC A;  2WM9 A;  1HRV 4;  2CBI A;  2BC1 A;  3DJB A;  4HWD A;  1I94 T;  3GD4 A;  3T1Y T;  4IGU A;  3V5U A;  2W0G A;  2VQF T;  4IRE A;  1MXT A;  2C72 A;  1PIV 4;  2R06 4;  5KMS A;  1RHI 4;  2R4J A;  2C70 A;  1EV1 4;  3CWZ B;  3PV0 F;  1VBD 4;  2W2U A;  4X1I E;  2L8K A;  2WDR A;  3RPU A;  2CVJ A;  4GK5 E;  1UCU A;  4DO0 A;  5KMG P;  5ABH A;  5AQO B;  2PYX A;  4AQF A;  2V5Z A;  2XLP A;  3R6N A;  2JQK A;  3HKB E;  1VG9 A;  2AAQ A;  5AQJ B;  5LCY A;  2JKC A;  2A89 A;  5JR9 C;  3GWD A;  4EQX A;  4O2A E;  1COY A;  5AQG B;  2OAM A;  5CA0 E;  1H82 A;  4L9I A;  2JJ9 A;  1KDG A;  1F8W A;  3C96 A;  5JRE A;  2HN2 A;  2ZM6 T;  4Q4X 4;  5L3B B;  3ZMV B;  4ZI2 D;  3NT6 A;  5M0Z A;  1ZOY A;  3DTO A;  1IBL T;  4Z90 A;  4Q4V 4;  2YR5 A;  3Q6J A;  3RYH E;  2C67 A;  1D4M 4;  2WBA A;  4GDE A;  3ALM A;  2BCP A;  3FZF B;  4GYR A;  4H9R C;  5AQL B;  2A3D A;  5L2L A;  3BK9 A;  4UXN B;  2CMR A;  2RGJ A;  2E9X B;  2YG7 A;  2JQ9 A;  2ZMA A;  1XHC A;  4H2P A;  2CM0 A;  2XAS B;  2K5B B;  3L39 A;  5IYZ E;  4C90 A;  2BXR A;  4UF0 A;  3AAI A;  2JBV A;  5LG3 A;  2XLU A;  3HL6 A;  4J33 A;  3RI5 A;  1FEB A;  3NGC X;  2A9U A;  4MFR A;  1KNP A;  2APG A;  2CA5 A;  4E0V A;  4P09 A;  4X9M A;  2CHN A;  3NTA A;  5DBJ A;  3PU3 A;  2KMF A;  4EQR A;  3AEB A;  1LQU A;  3PE0 A;  2DLR A;  2H88 A;  1E1M A;  2ES0 A;  3PU8 A;  4JI5 T;  4HWF A;  3AWI A;  3ICR A;  4IL4 A;  3CN8 A;  5L46 A;  3C4Z A;  4EMJ A;  3ZN0 B;  1BR4 A;  1OED A;  1HNZ T;  3AYI A;  5LJN A;  3QSS A;  2QGS A;  4U2Y A;  3LZW A;  3UTG A;  1GND A;  3LFM A;  1PJ7 A;  4A5X A;  4II3 A;  1MNE A;  1FIO A;  2WP9 A;  1PBC A;  3ZLI A;  4H4T A;  2XHE B;  2YLR A;  4LFA T;  1HX8 A;  2EQ9 A;  1XHZ A;  3T1H T;  1PXB A;  3SYI A;  3K7M X;  4LF6 T;  3SZC A;  1BF3 A;  5EK4 A;  2WU2 A;  2LRK A;  1VRQ B;  1XNR T;  3FBZ A;  5IQ1 A;  4CCR A;  3IHR A;  5AQV B;  2VL8 A;  3ZKR A;  2LJL A;  3T2Z A;  1PO2 4;  4FJO A;  2C5J A;  4I58 A;  3CPI G;  1D1A A;  3CIR A;  5KVI A;  3RC3 A;  2GB0 A;  2AR8 A;  4BK3 A;  1XDI A;  2IML A;  2BS2 A;  3Q5X A;  2RP4 A;  3CPJ G;  3L8K A;  1H7W A;  2VWA A;  3SX6 A;  1W09 A;  3EAO A;  2D5U A;  4PAB A;  2WZH A;  2UZZ A;  3QFA A;  4C3Y A;  2IAK A;  1JNZ A;  5JR9 B;  3WAK A;  1N4W A;  2X9X A;  1OJ9 A;  3AVR A;  1X31 B;  2ZM8 A;  5FVK A;  2BZB A;  4ZS2 A;  3AXB A;  4G6H A;  2BK4 A;  4Z25 A;  5EOW A;  3NN6 X;  5JDQ A;  2QA2 A;  3DK4 A;  3ZJ1 A;  2E2A A;  2EQ8 A;  2BVM A;  1S2Q A;  2X8C A;  2MOZ A;  4NTE A;  4TM0 A;  4F6R C;  4OPG A;  2PG8 A;  1L9E A;  4YKF A;  3A7M A;  3URH A;  4USR A;  3LDQ B;  4U2L A;  1LV0 A;  4Q4Y 4;  4TM3 A;  2X3N A;  4YWO A;  3L09 A;  4NWZ A;  1Q9I A;  4H2Q A;  5U25 A;  1CBO A;  2YDR A;  2RR1 4;  2JMK A;  1D0Y A;  4LF8 T;  2LRL A;  4G2A A;  1Y56 A;  1YXR A;  3ATQ A;  4LF4 T;  1YKH B;  3EAB A;  3EI0 A;  2C65 A;  3CVR A;  1EBD A;  2RGH A;  4ECH A;  4U74 A;  4HKA A;  3ALL A;  5HEJ A;  4H4Z A;  4UIG A;  5L3F B;  4JNA A;  5L3D B;  3BNM A;  2MBG A;  2XFU A;  2KWH A;  1NEK A;  3OYX A;  3UQ4 A;  2YOE A;  4J56 A;  1GXF A;  5FKY A;  3PUG A;  4QH1 A;  3UTK A;  2UU9 T;  5KMR A;  2CE7 A;  3J7Y q;  1OXZ A;  3UU4 A;  4Y4N A;  2GH5 A;  4CN6 A;  5JDL A;  2NTY A;  1OED E;  2CFY A;  3I3L A;  3NK2 X;  2CLY C;  1GRE A;  1XMQ T;  4EEB A;  5LGN B;  2CPT A;  4YHJ A;  2GMJ A;  2VKH A;  4D03 A;  3PO7 A;  4XWZ A;  2I0Z A;  3GA8 A;  1MO9 A;  2JB3 A;  2XFO A;  5HXI A;  4YTM A;  1GOS A;  2HN1 A;  1JRX A;  2EHO C;  1W0B A;  1OOP D;  3QVP A;  4U8M A;  2QCU A;  1PN0 A;  1BR1 A;  4GK0 E;  1ZDL A;  2YDS A;  4DR3 T;  5KWF A;  2XFN A;  3IBP A;  5HWY A;  3QOF A;  3UKA A;  5LA6 E;  5CB4 E;  4TX5 A;  4DR5 T;  1E39 A;  3TLS A;  1TDE A;  3KV6 A;  5EB4 A;  5LG4 A;  2JQH A;  5AQU B;  4DUY T;  4ZCD A;  2YU2 A;  1UX4 A;  3NRN A;  1J1J A;  4KBM B;  5AQN B;  1HXS 4;  2YLS A;  2V8S V;  4IST A;  2Y6R A;  2VVN A;  5LMN T;  3BI4 A;  1FEW A;  4GF7 A;  3FG2 P;  2AQJ A;  4H4V A;  1XI1 A;  2ZLY A;  3LBX A;  4NEV A;  2BCG G;  3ISH A;  2X0L B;  4YSZ A;  4AKI A;  4IE7 A;  3CQC B;  3U78 A;  3B3R A;  3AYL A;  1BGN A;  3N2K E;  5HYM A;  1M62 A;  3F31 A;  3H37 A;  3MJX A;  3CGE A;  1D1C A;  3CPH G;  1WYB A;  4B68 A;  1TDK A;  4WYV A;  2ZZB A;  3EDU A;  4EZ4 A;  4J31 A;  4DBQ A;  3NWI A;  4AOS A;  3GRT A;  4IDN A;  5HWX A;  2YDQ A;  2NW8 A;  4UF0 B;  1RSG A;  3CNS A;  2GR1 A;  4CI3 B;  4G74 A;  4PJM A;  2J62 A;  1XMO T;  2H7V C;  5L4E A;  3LZX A;  3Q5D A;  4K22 A;  4AT0 A;  2WQY A;  1TDF A;  3N2G E;  3GWF A;  3AD7 B;  2LOP A;  1RMU 4;  1VBB 4;  3F2E A;  3N9Q A;  5A1L A;  5AQI B;  4HB9 A;  4QX7 B;  4IE5 A;  2LKG A;  4M52 A;  2QA7 A;  4B67 A;  2R07 4;  4OPC A;  3F8P A;  4X65 T;  2XQ4 A;  4KPR A;  3ZDN A;  2RM2 4;  2C3C A;  3HYV A;  2VUR A;  2NW7 A;  3JAD A;  3NBX X;  5HEG A;  3UOV A;  2HHH T;  1RP0 A;  5L3G B;  4JUY A;  3DJJ A;  1JU2 A;  5H6Q B;  3AE8 A;  3CX6 B;  1SA0 E;  2V7K A;  1E2A A;  5LB7 B;  2XQ3 A;  1AJ3 A;  3HZL A;  3OZ2 A;  5LYJ E;  3UU3 A;  3RP6 A;  2V6O A;  3SZ0 A;  2EQ7 A;  3I0O A;  3TLV A;  1N34 T;  2GAG B;  5ABG A;  4CN1 A;  1NHQ A;  4JI8 T;  3VHL A;  4AQG A;  4BK1 A;  2RPA A;  1YY5 A;  3ONJ A;  4EQS A;  2C3D A;  3FB2 A;  2YLW A;  2PBI A;  4EMI A;  2XQ5 A;  3J8F 4;  2HQM A;  5AQF B;  1IJ6 A;  4FK1 A;  3K1S A;  5LBQ B;  3QK6 A;  4FI5 A;  3QUJ A;  2XY8 B;  3ZSS A;  5LV9 A;  2DWK A;  3UTH A;  3QC9 A;  4XXG A;  2YM2 A;  4H63 H;  1JNR A;  5TAO A;  3LJP A;  4B1B A;  4U8O A;  2SPC A;  3OPC A;  3NK0 X;  2XYO A;  2LE8 A;  3ABV A;  4J2W A;  4IIJ E;  4OCG A;  2GMH A;  4BK2 A;  3O0H A;  4JI2 T;  3CGD A;  4HGA A;  4PFP A;  2Q9Q C;  3AE5 A;  3HKE E;  1HNW T;  3FIM B;  2V1D B;  1D5T A;  2WET A;  4GB3 4;  3ZT7 A;  4DR7 T;  4DSG A;  3QVR A;  1DOE A;  4NEW A;  2W67 A;  1UX5 A;  2OLT A;  4BJZ A;  2WZI A;  4EYU A;  1VBC 4;  3ONL C;  5CKU A;  2UXC T;  1T72 A;  1EL5 A;  3GWH A;  3AE3 A;  3AD8 B;  2Q9Q D;  3Q9D A;  4CY8 A;  3EPT A;  4IDO A;  4DV7 T;  4LMK A;  4NNJ A;  4DSH A;  2D0T A;  3AYJ A;  2LSK A;  2X9H A;  4KHZ F;  5JRC A;  2FJA A;  3COX A;  2XQY A;  2GQW A;  1Q1W A;  1CHU A;  3M65 A;  1LVK A;  2BXS A;  3NKS A;  5FS6 A;  4C91 A;  3E0Z A;  1ZK7 A;  4TV8 E;  5JQG E;  1IJH A;  4DGK A;  4J2C A;  4PK4 A;  4DV0 T;  1NG3 A;  4H9O C;  3JAE A;  4UVB B;  2JMH A;  2MPK A;  1PXA A;  4IA6 A;  4MLK A;  4IL9 A;  2X67 A;  5C2T A;  3RIF A;  1VDC A;  4E7S A;  5FMH A;  2ODU A;  5ABE A;  2ZZC A;  2LHN A;  3UT5 E;  1T7S A;  1HS7 A;  3GDP A;  2EHO B;  1MIW A;  3EHZ A;  2GV8 A;  2YKS A;  1B5Q A;  5DJQ C;  3S61 A;  1KF6 A;  4YT0 A;  1S3B A;  1IAP A;  4EGW A;  2YQU A;  4X4J A;  4H4Q A;  4IT4 A;  4CI1 B;  5FY0 A;  3LB8 A;  1K4Q A;  2P9B A;  1CJ2 A;  5LP6 E;  2B9X A;  2CBJ A;  3G5S A;  2MAW A;  2XQ8 A;  3AED A;  2X5I D;  3UFE A;  3S4U A;  1ASJ 4;  2BAC A;  4N9X A;  1O95 A;  3GMC A;  3D0T A;  5HCM A;  1OWA A;  3VKH A;  3N9P A;  1BR2 A;  2GF3 A;  3LOV A;  2ODV A;  4J57 A;  2WS3 A;  3T37 A;  1HRI 4;  4U7I A;  4DR4 T;  2QAE A;  2M6B A;  3PDY A;  5ADX L;  4DV6 T;  3FBL A;  1NAA A;  5HAX A;  2XQ9 A;  2PYJ A;  1VBE 4;  3RP8 A;  4TV9 E;  2WB5 A;  3BQK A;  3CKD A;  1BEV 4;  2X8G A;  3C98 B;  2LSI A;  4GYS A;  3MA9 A;  2PLV 4;  3UKF A;  1WLX A;  5IHY A;  4A65 A;  2YM1 A;  4CCQ A;  2OAL A;  2HWB 4;  2W63 A;  2UXN B;  3VRD B;  4Z43 A;  1RUG 4;  3HYW A;  1Z6L A;  4TM1 A;  2YLX A;  4I59 A;  2A8X A;  2Q0K A;  3HYX A;  1KEY A;  1KNR A;  2L3L A;  2XAG B;  4I4T E;  2KXP B;  1N1P A;  3UOY A;  1OED B;  3VR8 A;  1ZP0 A;  2BS4 A;  1RUC 4;  4HFD A;  2M67 A;  4ZOL E;  3V3O A;  1L9D A;  3ZN1 B;  2ZBW A;  1PBD A;  4B69 A;  3KV5 A;  5JCK A;  3FHN A;  2BA9 A;  2X9Y A;  3MXZ A;  3GN5 A;  2ACX A;  2V26 A;  2K48 A;  3UUX B;  4HWC A;  4N78 D;  3P4P A;  4ILB A;  2IDO B;  3LG7 A;  5HEU A;  2A72 A;  1N4U A;  3AE6 A;  4NXM T;  2C4C A;  2ACZ A;  3HKC E;  2ARD A;  2E9X A;  3P8C D;  4DV3 T;  4QH5 A;  4ZN0 A;  2UXD T;  1GET A;  1GRF A;  5L3E B;  1W9R A;  2QRX A;  5FYM A;  3KVB A;  3UUM A;  2XLT A;  3AD9 B;  3FXD B;  4U8L A;  2WCA A;  3ZT5 A;  1GRH A;  1GV4 A;  2R45 A;  3T31 A;  2GK9 A;  1US7 B;  2MYS A;  1E1N A;  2V7I A;  4I50 E;  4CNJ A;  1PXC A;  1NA1 D;  5ABF A;  3B13 A;  4ASK A;  1IBM T;  1GEU A;  3JSK A;  2XJ7 A;  4C74 A;  1NWM X;  4CI2 B;  2LFC A;  4A5L A;  4HN9 A;  3NRY A;  4LU6 A;  1VCS A;  2VKO A;  4JYA T;  4G6G A;  4QXB B;  2X99 A;  1TDO A;  3N9L A;  2C7G A;  2C66 A;  3CNT A;  3B57 A;  4LML A;  3IHM A;  2Q9Q B;  2XVI A;  4AI6 A;  4C5O A;  3CNP A;  4JBW F;  2WOW A;  1PVC 4;  5FNV E;  1WCR A;  3UTE A;  4OYJ A;  1BGJ A;  4IVM B;  2NW9 A;  2XFQ A;  5EZY E;  4YLH A;  1H86 A;  2UXB T;  4DV5 T;  3BQI A;  2F4V T;  3CQX C;  2CEA A;  3NIX A;  4G73 A;  1PS9 A;  2QA1 A;  3VQR A;  3AXJ B;  1GRB A;  3BI2 A;  2WAU A;  3Q9T A;  2L9Q A;  3P7I A;  3ALJ A;  4AKL A;  4AKR B;  4NIQ A;  2BG9 A;  5DAB A;  2HPJ A;  1NAF A;  2VQE T;  2BBJ A;  4FX9 A;  4FDC B;  3UUB A;  2IIU A;  3HKD E;  3PUV F;  3QJ4 A;  1H8T D;  3W15 B;  2W62 A;  5JTG A;  1FJG T;  4OYK A;  4H63 V;  2YWL A;  3IEE A;  1E1K A;  3T8O A;  3ZMZ B;  4U31 A;  1MMG A;  4HFB A;  4JN9 A;  2V7M A;  4HFH A;  4II2 A;  4OK0 A;  3E08 A;  3AE9 A;  5KMQ A;  3KD9 A;  1ZEE A;  2NTX A;  4H9S E;  4NUV A;  4H9P C;  4LF7 T;  1GRT A;  2OLO A;  3AAE B;  3IF8 B;  1UKV G;  5JDF A;  5LGU B;  2N9D A;  5EB5 A;  2XSB A;  2M6I A;  4GUV A;  1SE7 A;  5FS9 A;  4ZS3 A;  1VCT A;  4BUR A;  4JI0 T;  2XZE A;  4CBQ A;  2LM2 A;  3T2Y A;  4Z91 A;  5AQM B;  3DH9 A;  3ZYK A;  3GMB A;  5LGT B;  2LM9 A;  2OA5 A;  1REO A;  3UUN A;  1MND A;  4U8I A;  4U7Y A;  4XWR A;  1CC6 A;  1PDH A;  4ANJ A;  4AP1 A;  3CK6 A;  2Z5Y A;  1DNC A;  3V3N A;  2RS3 4;  1H7X A;  2YG5 A;  5L47 A;  1M6I A;  4C3X A;  2R7F A;  1JOA A;  2CXD A;  2XPK A;  2R0G A;  1B37 A;  2CCQ A;  3KVA A;  3KA7 A;  1XPQ A;  4U2Z A;  4NZH A;  1SHZ C;  1FOH A;  4NTD A;  1CJ3 A;  4WX1 A;  1KSS A;  5AQH B;  2C5I T;  2LT3 A;  4IDP A;  1LVF A;  2XVJ A;  5JCM A;  1VRB A;  4BV6 A;  2PZS A;  3KV4 A;  3BHF A;  3OTO T;  5FP3 A;  2XAJ B;  2ZM0 A;  2I6H A;  5CQF A;  4JY3 A;  1RUD 4;  4WW0 A;  4PFO A;  4A6N A;  1E1H B;  2XAH B;  2BKO A;  3CX7 B;  3OYZ A;  2VQ7 A;  1UUR A;  2VB6 A;  3ZC0 A;  1TDN A;  4H4R A;  4X1Y E;  1NHS A;  1QJD A;  1CJ4 A;  4ZZC A;  4HWH A;  4H2N A;  1XDO A;  4J36 A;  4P0A A;  5HXR A;  3ZMS B;  3L3P A;  1N33 T;  2Z5X A;  4TZ4 C;  4ZI2 C;  4UV8 B;  4YTN A;  4O8S A;  3NYE A;  1D7Y A;  1P2H A;  3KFW X;  4EM3 A;  3Q5W A;  2K3W A;  3C51 A;  3E1T A;  3KV9 A;  2IVE A;  3E22 E;  4Z44 A;  1F6M A;  2GR0 A;  1JRY A;  1D0X A;  5CA1 E;  3K8P C;  5AQR B;  1U4Q A;  4X62 T;  5J7X A;  1UUS A;  1VG0 A;  2E8I A;  1IUS A;  1X9B A;  3DJG X;  1H83 A;  3N9M A;  4D04 A;  5AQT B;  3PUQ A;  5FXX A;  1MIY A;  1EAH 4;  5JR9 A;  2IW5 B;  3JAF A;  3V5S A;  1GER A;  5KOX A;  1M64 A;  2RAB A;  4XAX B;  4K5S A;  1XNQ T;  3GD3 A;  1ZHC A;  4GKJ T;  2Q6U A;  2BKP A;  3H8L A;  4ADW A;  3KU9 A;  3EDV A;  1GSN A;  1YD8 G;  1NPX A;  4Z24 A;  1HF8 A;  2IVD A;  5FMN A;  4GCM A;  1IJ5 A;  2VVL G;  2CXL A;  1ZOV A;  2NVK X;  4UR9 A;  3AXJ A;  5FL1 A;  4GOU A;  5HXH A;  3PUS A;  4O5U A;  2FJD A;  4A6N B;  5M4Y A;  1WRD A;  1RUF 4;  1LTX R;  3RX6 A;  4DVD A;  4Q25 A;  1R8I A;  3UKQ A;  4OX9 T;  3CMM A;  2W61 A;  4EXT A;  5CGM A;  3IC9 A;  4QX8 B;  3I9W A;  1OJD A;  3IA3 A;  4UDP A;  3SGL A;  2CHO A;  2DI4 A;  4PJJ A;  3X1D A;  1LKX A;  2BKN A;  3R9U A;  2LSY A;  1XHX A;  2YK0 A;  3P9U A;  2J1D G;  1PJ6 A;  5HEH A;  1RUJ 4;  1JEH A;  2J4G A;  1ELI A;  3EF6 A;  3RF1 A;  1S2Y A;  1NHR A;  4P1N A;  1E6E A;  1MOK A;  5LHH B;  4A7A A;  3F8D A;  4TWH A;  2EQ6 A;  5IUX A;  4A98 A;  3AA0 B;  4QXH B;  2GR2 A;  1COV 4;  1D4C A;  4CQI A;  1L0V A;  3PUR A;  3ZMT B;  5FXW A;  2R0P A;  3KPF A;  3GQK A;  4Z8X A;  4B6X A;  4OPL A;  5BUK A;  1M7K A;  4ZI3 D;  3QFB A;  4JI1 T;  1PBF A;  3M0O A;  4TNW A;  3JC6 C;  3MAC A;  4IHJ E;  4OPU A;  5AQQ B;  4TWF A;  3C4N A;  1W4X A;  1SUM B;  4B3M T;  4UDR A;  2XM2 A;  2JQQ A;  2LSG A;  5JVD E;  4ZEY A;  4GAP A;  1FEC A;  1IUU A;  5FVL A;  3S5W A;  2PY5 A;  4YHH T;  2YLZ A;  3CTY A;  3JD7 4;  5JCN A;  2BG9 E;  3HI2 A;  3RGL A;  3QB5 K;  4AQF C;  2RS5 4;  3ZCJ A;  3SQP A;  1D1B A;  4K7Z A;  5J1G A;  1R08 4;  2C75 A;  3QSE A;  4HFI A;  2W0H A;  1WFD A;  3PUY F;  4PK6 A;  4JNQ A;  3UFG A;  3P4R A;  3M12 A;  4AQY T;  2X51 A;  3NTD A;  1HX1 B;  4YY3 T;  3AEC A;  4JEU B;  5JDM A;  1NDA A;  3I1A A;  1HYU A;  3RYI E;  5KDM C;  5M10 A;  1ONF A;  4AP3 A;  2BDE A;  2B76 A;  3LSV A;  3WAJ A;  2BRA A;  4I0U A;  2XQ6 A;  1D0Z A;  1BWC A;  4GRT A;  4X1K E;  2VRL A;  5ER0 A;  2YAU A;  3GQH A;  3N5L A;  5AQS B;  2LHR A;  1V9D A;  1AR7 4;  4YSH A;  1D4E A;  4O4J E;  1QUU A;  3O1J A;  3CNJ A;  1ZX9 A;  2OA1 A;  4YSX A;  2Y48 B;  4ICY A;  5DQW A;  4O2B E;  3GMI A;  3RIU C;  2D9D A;  4RSL A;  4H4W A;  1EL7 A;  4HFV A;  2NPX A;  4KI0 F;  2XFP A;  3NZQ A;  4DID B;  3J9X 1;  4K0U A;  1XZY A;  3UKL A;  4IA5 A;  3UOX A;  4OPD A;  5BVA A;  3AE4 A;  4B3T T;  4H2R A;  1N36 T;  1NCQ D;  4B3S T;  4DND A;  1OED C;  4B3R T;  1RUE 4;  2WP6 A;  2JPF A;  4M1P A;  4EMW A;  1BKW A;  1GT8 A;  1UK5 A;  3ZYL A;  2PFV A;  2D2S A;  3ADA B;  4TNV A;  1WYC A;  3ZMU B;  2E4G A;  3K7T A;  2CUL A;  2V5D A;  2WBL A;  2ZM2 A;  3B5M A;  3AB1 A;  1GRG A;  2WY2 A;  3H3A A;  4YJ3 E;  4WCT A;  2GEW A;  3P4S A;  3R84 B;  2V6X A;  1I6Z A;  5HXS A;  5HXE A;  4EED A;  2E9X D;  5C3J A;  4LF9 T;  4LA1 A;  5L3C B;  3MKD A;  4MHC A;  3RHW A;  3RYC E;  2FJE A;  1KSU A;  5FS8 A;  3SS1 A;  2B9W A;  4U8N A;  2J3N A;  3N9N A;  3SWH A;  4ADZ A;  4O4I E;  2V3A A;  2WWV A;  5J0Z A;  5JCL A;  2KIN B;  1AL2 4;  4TLX A;  1EL9 A;  3L8R A;  2IID A;  3SUC A;  3FBS A;  2KZ7 B;  2W66 A;  3DP7 A;  4XBF B;  2E5V A;  1XDP A;  3T14 A;  5C8Y E;  5L4H A;  4RHV 4;  4KMC A;  4MAL A;  2MTQ A;  2EX3 A;  2JIW A;  1VOM A;  1J5W A;  3P4W A;  2DHR A;  4B64 A;  1H81 A;  2XM1 A;  2YR6 A;  3K3Q C;  2NP9 A;  5HEO A;  3NRX A;  1RVF 4;  5JDG A;  3H3M A;  2IC9 A;  2Y6Q A;  3FZL B;  3O1H A;  5GON E;  3RKG A;  2I59 A;  2K9A A;  1Y64 B;  2BRY A;  3OVU A;  2C0S A;  1O94 A;  4UVA B;  2KT9 A;  1YKJ A;  3N9O A;  4YFS A;  2V7L A;  4G63 A;  4EYY R;  1ZMC A;  5FXZ A;  2LEH A;  2WPC A;  2ZZ0 A;  1FMW A;  3P1W A;  3SZF A;  4DR2 T;  1VQW A;  4RG4 A;  2YVF A;  3AVS A;  5AFU L;  4X5T A;  1W0A A;  4Z2U A;  2B1E A;  4U33 A;  2UUC T;  4PK5 A;  1CUN A;  3N2O A;  2JB1 A;  3SXI A;  3M13 A;  2OV9 A;  3RC8 A;  3SFE A;  1Y01 A;  1H7C A;  4CZZ B;  1NHP A;  4U8J A;  1F3P A;  1YQ3 A;  3CND A;  3FZH B;  4HFE A;  2YG6 A;  3H4K A;  4QHO A;  4CNK A;  3ATR A;  1QLB A;  2YG3 A;  4H9Q C;  2VVS A;  5KX5 E;  2DNX A;  1QSD A;  3DJE A;  3UUL A;  1FMV A;  2R6G F;  4JY2 A;  4BA9 A;  2DCF A;  1HCI A;  3NNE A;  3MK7 C;  4UDQ A;  3FI7 A;  1TYP A;  2RS1 4;  4JDR A;  1XAN A;  2XLS A;  5JDH A;  3PUZ F;  1YQ4 A;  1RYI A;  2YG4 A;  3U3I A;  3DGZ A;  1S3E A;  2UUB T;  4TN7 B;  1POV 0;  2WU5 A;  1K5M D;  4H50 A;  1T98 A;  2QYW A;  2YIN A;  5IWA T;  3NLC A;  4GR1 A;  4NUU A;  1BZL A;  2FUP A;  1H6V A;  1S35 A;  2VL0 A;  5FS7 A;  3Q5E A;  5JCI A;  3O9X A;  1Y0P A;  4EIW A;  2G0U A;  4H9N C;  3T0K A;  3UCL A;  1NEN A;  4MBQ A;  2WPF A;  1LRZ A;  3L1R A;  5LHG B;  5U1O A;  1T8B A;  3D8X A;  5U63 A;  3OKQ A;  5J60 A;  1K0I A;  4H4X A;  1IUW A;  2IC6 A;  1WR0 A;  1HTJ F;  4YTP A;  4L0R A;  1B7T A;  3IHG A;  4Y4L A;  1L9C A;  4EV6 A;  2HWC 4;  2B9Y A;  2TPR A;  2TMD A;  2DL1 A;  3G5Q A;  1G8X A;  1ZY8 A;  2N1G A;  2XTL A;  1HNX T;  1Z8U A;  5AQK B;  2C5K T;  2V7J A;  3VRB A;  3Q2M A;  4LFC T;  1PJ5 A;  1IUT A;  1S94 A;  2GAH B;  4EB6 E;  2DKI A;  4EIP A;  3SFD A;  3RYF E;  3C4A A;  3T2K A;  3CX8 B;  3UQ7 A;  2CWO A;  2R04 4;  3TKL B;  4YXD A;  2V3B A;  3O1I A;  1PBB A;  2WWU A;  4DV2 T;  1FCD A;  2H7O A;  3IF9 A;  4MJW A;  1CC4 A;  2BC0 A;  3SM8 A;  2XDO A;  4ILA A;  5EK2 A;  5LBM A;  3AE7 A;  2YU1 A;  4HEA A;  2BVL A;  5HYA A;  1EL8 A;  3AEG A;  5KVH A;  3PS9 A;  4QH4 A;  3KVE A;  2B7R A;  4NXN T;  3LBX B;  3BQL A;  2GVC A;  3BI5 A;  3GYJ A;  1R09 4;  1PBE A;  3M3Z B;  3ICT A;  3ZEF B;  1CF3 A;  3G06 A;  4KHP T;  3UKP A;  4BJM A;  2YVG A;  4TM4 A;  3LXD A;  4BAY B;  4OFZ A;  1VRH 4;  5LNK A;  4DV4 T;  3KBU A;  3ZJ2 A;  2YEV C;  3RIA A;  2BK5 A;  3SZW A;  3ZPO A;  2XLR A;  1N4V A;  1F8R A;  4H7U A;  1MMA A;  3NH3 X;  3SY4 A;  2F5Z A;  4HWI B;  3ETV A;  3NVO A;  4JI4 T;  3LAD A;  1D7L A;  4OPT A;  4AKH A;  3NZP A;  1CC2 A;  3DME A;  1DJN A;  2WDV A;  4Q4W 4;  1QO8 A;  2E1M A;  4OVI A;  4UP3 A;  4RG3 A;  1IUX A;  3GDN A;  4JI3 T;  4ZI7 E;  2LKH A;  1G73 A;  3C4X A;  1DOD A;  1AR9 4;  3PUW F;  4IE0 A;  4CXY A;  3D1C A;  1Y56 B;  4OPI A;  4DMV A;  3OBV E;  4AT2 A;  4K0K T;  4JI7 T;  2R4E A;  5F5W A;  2XUE A;  4DBR A;  3RLF F;  1IZN B;  5FY1 A;  2BAB A;  5LHI B;  2JAE A;  3SRZ A;  2OLN A;  3OC4 A;  2X0H A;  4IV9 A;  4U2T A;  2QVA A;  2XVF A;  1OJA A;  1TRB A;  4JV5 T;  3RHA A;  2A2F X;  4L5G A;  3ETU A;  3P50 A;  2CLY B;  4IDZ A;  2X9W A;  3LJC A;  4GIW A;  1GTE A;  3AEA A;  3LK4 2;  3ZT6 A;  1E1L A;  3FMW A;  1N32 T;  2FBW A;  5LOV E;  3LK3 B;  3UU5 A;  4PJL A;  3ZCI A;  3WE0 A;  4CXX A;  2CDU A;  4O5Q A;  4PAA A;  4A97 A;  4U8P A;  2IHR 1;  1Q1R A;  4XZC A; 
#chains in the Genus database with same CATH homology
 1IUU A;  1FEB A;  3NGC X;  3S5W A;  1KNP A;  2YLZ A;  1NAA A;  2APG A;  2VOU A;  3CTY A;  4E0V A;  3GYI A;  5JCN A;  4X9M A;  3NTA A;  1B4V A;  5DBJ A;  4EQR A;  3RP8 A;  3AEB A;  1LQU A;  3SQP A;  4K7Z A;  2H88 A;  2C75 A;  3QSE A;  2X8G A;  1E1M A;  2W0H A;  1F8S A;  3AWI A;  3P4R A;  3ICR A;  4JNQ A;  3B6D A;  3CN8 A;  3M12 A;  5L46 A;  3UKF A;  4EMJ A;  4A65 A;  2YM1 A;  3AYI A;  3K7Q X;  4CCQ A;  3NTD A;  2O9Z A;  2OAL A;  2XVE A;  3QSS A;  2WES A;  3AEC A;  2WOV A;  3LZW A;  3UTG A;  2C73 A;  1GND A;  3VRD B;  4EM4 A;  1PJ7 A;  4II3 A;  4Z43 A;  3HYW A;  1Z6L A;  2WP9 A;  1NDA A;  1PBC A;  2YLX A;  4H4T A;  4I59 A;  1HYU A;  2A8X A;  4TM1 A;  4CRT A;  1KFY A;  1OJT A;  2Q0K A;  3HYX A;  1ONF A;  5M10 A;  3RNM A;  4GAP A;  2YLR A;  2EQ9 A;  3ZYX A;  4TLZ A;  4AP3 A;  2B76 A;  1KNR A;  1PXB A;  5BUL A;  3EAN A;  3NYC A;  3AE1 A;  3SYI A;  2BRA A;  3K7M X;  5GRT A;  1N1P A;  1BWC A;  3UOY A;  4Z2T A;  4GRT A;  3SZC A;  1BF3 A;  5KMP A;  2VRL A;  3VR8 A;  2WU2 A;  3AEF A;  1VRQ B;  5ER0 A;  1ZP0 A;  2YAU A;  2BS4 A;  1H84 A;  4YKG A;  1LVL A;  5IQ1 A;  3GQH A;  4CCR A;  3V3O A;  1L9D A;  2YR4 A;  3KKJ A;  3T2Z A;  2ZBW A;  4I58 A;  1PBD A;  3CPI G;  4B69 A;  3CIR A;  5KVI A;  4YSH A;  5JCK A;  1K0L A;  1D4E A;  1K0J A;  2BA9 A;  2GB0 A;  2AR8 A;  4BK3 A;  2VRM A;  4BJY A;  1XDI A;  3CNJ A;  1ZX9 A;  2OA1 A;  2BS2 A;  4YSX A;  3CPJ G;  3L8K A;  4ICY A;  1H7W A;  3NHO X;  4C77 A;  3SX6 A;  1LQT A;  3EAO A;  4RSL A;  4H4W A;  4PAB A;  4C3Y A;  3P4P A;  2UZZ A;  3QFA A;  1JNZ A;  2JK6 A;  1EL7 A;  4REK A;  3BHK A;  2NPX A;  4ZCC A;  2XVH A;  4DNA A;  1N4W A;  1OJ9 A;  1N4U A;  3AE6 A;  1X31 B;  2C4C A;  3PVC A;  2XFP A;  2ACZ A;  3UKL A;  2ARD A;  3AXB A;  4G6H A;  2BK4 A;  3CGC A;  4H4Y A;  4IA5 A;  5EOW A;  3UOX A;  3NN6 X;  4Z25 A;  4OPD A;  5BVA A;  2QA2 A;  3AE4 A;  3DK4 A;  4X9N A;  2JB2 A;  4H2R A;  2EQ8 A;  3UTF A;  4ZN0 A;  1S2Q A;  2X8C A;  4NTE A;  4TM0 A;  1GET A;  1GRF A;  4WX1 A;  4OPG A;  2WP6 A;  4EMW A;  1BKW A;  1GT8 A;  1L9E A;  4YKF A;  3ITJ A;  3URH A;  4USR A;  3ADA B;  4U2L A;  2XLT A;  1LV0 A;  4H4P A;  1OJC A;  4B63 A;  2E4G A;  3K7T A;  3AD9 B;  2CUL A;  4TM3 A;  2X3N A;  4YWO A;  4U8L A;  3VRA A;  3AB1 A;  2BK3 A;  1GRH A;  4NWZ A;  1GV4 A;  1Q9I A;  2R45 A;  3T31 A;  4Z2R A;  4H2Q A;  1GRG A;  1CBO A;  5U25 A;  1E1N A;  4WCT A;  2VQB A;  2GEW A;  3P4S A;  3K30 A;  4CNJ A;  1PXC A;  1GEU A;  3JSK A;  4H4U A;  1Y56 A;  3ATQ A;  5C3J A;  4LA1 A;  4C74 A;  2LFC A;  3IWA A;  4A5L A;  3V76 A;  2C65 A;  4LU6 A;  4U2S A;  3RP7 A;  1EBD A;  2FJE A;  1JRZ A;  1KSU A;  2RGH A;  2XCG A;  4G6G A;  5FS8 A;  2B9W A;  4U8N A;  2X99 A;  1TDO A;  1DOC A;  2C7G A;  2J3N A;  4ECH A;  3ALL A;  4H4Z A;  2C66 A;  3CNT A;  3IHM A;  4JNA A;  2XVI A;  3ICS A;  3BNM A;  4C5O A;  2V3A A;  1IUV A;  2XFU A;  5JCL A;  3CNP A;  2WOW A;  4TLX A;  4K5R A;  3UTE A;  1NEK A;  3NN0 X;  1EL9 A;  3UKK A;  2IID A;  4J56 A;  1BGJ A;  1GXF A;  3FBS A;  4U8K A;  5IQ4 A;  3SUC A;  4Z26 A;  4IVM B;  5KMR A;  2XFQ A;  4Y4N A;  2WHD A;  1H86 A;  2GH5 A;  2C64 A;  4GDP A;  2E5V A;  3T14 A;  3NIX A;  3NK1 X;  2CFY A;  3I3L A;  4G73 A;  1ZMD A;  4Y4M A;  1PS9 A;  2QA1 A;  3VQR A;  3NK2 X;  1O5W A;  1GRE A;  1GRB A;  3BI2 A;  1PHH A;  3Q9T A;  2GMJ A;  3ALJ A;  4D03 A;  3PO7 A;  4B64 A;  4XWZ A;  1H81 A;  2YR6 A;  2I0Z A;  1YQZ A;  1MO9 A;  2JB3 A;  2XFO A;  4EQW A;  5HXI A;  3VR9 A;  1GTH A;  4YTM A;  2Q0L A;  1B8S A;  1GOS A;  4FX9 A;  4FDC B;  2Y6Q A;  1JRX A;  3QJ4 A;  3QVP A;  2BRY A;  3DK9 A;  4J33 A;  2QCU A;  4U8M A;  1PN0 A;  4P9S A;  1GRA A;  2WPE A;  1ZDL A;  2H89 A;  5KWF A;  1O94 A;  2XFN A;  2YWL A;  2Q7V A;  1E1K A;  1YKJ A;  4NTC A;  3UKA A;  4GAV A;  4A79 A;  2B7S A;  1ZMC A;  4JN9 A;  2PHH A;  5KNL A;  2WPC A;  2ZZ0 A;  1E39 A;  2BYB A;  3DK8 A;  4II2 A;  4G9K A;  3AE9 A;  1TDE A;  3P1W A;  3SZF A;  1VQW A;  4RG4 A;  3FPZ A;  5KMQ A;  3KD9 A;  2YVF A;  4USQ A;  5EB4 A;  1SEZ A;  1GRT A;  2OLO A;  3DGH A;  4ZCD A;  4FK1 C;  3NRN A;  5IPY A;  1UKV G;  4Z2U A;  3RED A;  2BS3 A;  2JB1 A;  5EB5 A;  1FL2 A;  3DJD A;  3SXI A;  3M13 A;  2YLS A;  4GUV A;  2Y6R A;  1ZKQ A;  1DOB A;  1FEA A;  5FS9 A;  3SFE A;  2WOI A;  3BI4 A;  2RGO A;  3DA1 A;  4BUR A;  4GF7 A;  3FG2 P;  4CBQ A;  2AQJ A;  3UP5 A;  1NHP A;  4H4V A;  4K2X A;  4U8J A;  1F3P A;  1YQ3 A;  3T2Y A;  3CND A;  4J34 A;  4NEV A;  2BCG G;  3DH9 A;  3H4K A;  2YG6 A;  3ISH A;  4YSZ A;  3GMB A;  1DJQ A;  4CNK A;  3ATR A;  1QLB A;  2YG3 A;  3B3R A;  3AYL A;  4H4S A;  1GPE A;  1BGN A;  1NG4 A;  5HYM A;  3DJE A;  1REO A;  3CGE A;  3II4 A;  2R9Z A;  4JQ9 A;  4CY6 A;  3CPH G;  3H8I A;  4JY2 A;  4B68 A;  1TDK A;  2GRT A;  4U8I A;  3NNE A;  4K8D A;  2ZZB A;  4J31 A;  2V61 A;  4XWR A;  1CC6 A;  1PDH A;  3BNU A;  3GRT A;  3GYX A;  4AOS A;  1GAL A;  4UDQ A;  4LII A;  4AP1 A;  2Z5Y A;  1DNC A;  1TYP A;  3V3N A;  4JDR A;  1RSG A;  1CL0 A;  1XAN A;  5HHF A;  3CNS A;  2VZ2 A;  2GR1 A;  1H7X A;  2XLS A;  3GSI A;  3I6D A;  2YG5 A;  1YQ4 A;  1RYI A;  2YG4 A;  1M6I A;  4C3X A;  3DGZ A;  1JOA A;  1S3E A;  4G74 A;  2R0G A;  1B37 A;  2WU5 A;  3LZX A;  3KA7 A;  1XPQ A;  4K22 A;  1LJ1 A;  4H50 A;  4AT0 A;  2WQY A;  1TDF A;  1FOH A;  1LPF A;  1CJ3 A;  3F8R A;  3GWF A;  3NYF A;  3AD7 B;  4NTD A;  1KSS A;  3NLC A;  2YLT A;  4NZH A;  1P2E A;  2WDQ A;  4GR1 A;  1BZL A;  1H6V A;  2XVJ A;  2X50 A;  5JCM A;  4HB9 A;  4BV6 A;  1AOG A;  3GRS A;  1TYT A;  4M52 A;  5FS7 A;  5JCI A;  4HA6 A;  3BHF A;  1Y0P A;  3UKH A;  4B67 A;  3AEE A;  3QSM A;  3F8P A;  4OPC A;  2FJB A;  5CQF A;  4KPR A;  3ZDN A;  2X8H A;  3T0K A;  1NEN A;  2C3C A;  3HYV A;  2WPF A;  3L1R A;  4JY3 A;  3UCL A;  3UP4 A;  4B66 A;  4A6N A;  5U1O A;  3UOV A;  1RP0 A;  2GR3 A;  3KPK A;  5EBK A;  3D8X A;  3DJJ A;  4IVO B;  1JU2 A;  5U63 A;  3NG7 X;  2VQ7 A;  3AE8 A;  2V60 A;  4KX6 A;  1TDN A;  4H4R A;  1K0I A;  5J60 A;  1NHS A;  1E7P A;  1IUW A;  1CJ4 A;  1QJD A;  4H4X A;  5GSN A;  2GQF A;  4YTP A;  3HZL A;  4H2N A;  3OZ2 A;  4J36 A;  3RP6 A;  3AE2 A;  2V6O A;  5HY5 A;  3SZ0 A;  2EQ7 A;  3IHG A;  2Z5X A;  4Y4L A;  1L9C A;  4YTN A;  3NYE A;  2B9Y A;  1D7Y A;  2GAG B;  4YSY A;  1P2H A;  2TPR A;  1NHQ A;  2TMD A;  4BK1 A;  1YY5 A;  3G5Q A;  4EM3 A;  1ZY8 A;  3E1T A;  4APN A;  4EQS A;  2C3D A;  2IVE A;  2YLW A;  4EMI A;  4Z44 A;  4A99 A;  1F6M A;  2WP5 A;  2HQM A;  2GR0 A;  1JRY A;  3VRB A;  1PJ5 A;  4FK1 A;  1IUT A;  2WEU A;  3KLJ A;  2GAH B;  5LV9 A;  5J7X A;  3UTH A;  1V59 A;  1VG0 A;  4EIP A;  2DKI A;  4XXG A;  3SFD A;  3P4Q A;  1IUS A;  2YM2 A;  1JNR A;  3LJP A;  3DJG X;  4B1B A;  4U8O A;  3C4A A;  3T2K A;  1H83 A;  3NK0 X;  2VVL A;  4D04 A;  3UOZ A;  2XYO A;  3ABV A;  4B65 A;  2A87 A;  4J2W A;  4EIQ A;  4OCG A;  4YXD A;  2V3B A;  2GMH A;  1PBB A;  4BK2 A;  1FCD A;  3IF9 A;  3O0H A;  1GER A;  5KOX A;  1M64 A;  3CGD A;  2RAB A;  1D4D A;  4MJW A;  4K5S A;  1CC4 A;  2BC0 A;  2VVM A;  3GD3 A;  2DKH A;  3AE5 A;  3SM8 A;  2XDO A;  4AOX A;  3FIM B;  2Q6U A;  3AE7 A;  3H8L A;  4ADW A;  3KU9 A;  1D5T A;  2WET A;  1GSN A;  1NPX A;  2R0C A;  1GES A;  5TR3 A;  4Z24 A;  1EL8 A;  4DSG A;  3G5R A;  3AEG A;  5KVH A;  2IVD A;  2YVJ A;  3QVR A;  1DOE A;  3PS9 A;  4NEW A;  3KVE A;  4GCM A;  3CGB A;  4BJZ A;  2VVL G;  5KXJ A;  2B7R A;  4A9W A;  2C76 A;  5KOW A;  2GVC A;  3BI5 A;  3GYJ A;  2R46 A;  1ZOV A;  1PBE A;  1DXL A;  2NVK X;  3ICT A;  5KRQ A;  1CJC A;  5CKU A;  1CF3 A;  1EL5 A;  3UKP A;  2YVG A;  4TM4 A;  3LXD A;  2BC1 A;  4O5U A;  3AE3 A;  3AD8 B;  3GD4 A;  4CY8 A;  3EPT A;  2FJD A;  4A6N B;  1MXT A;  2C72 A;  4NNJ A;  4DSH A;  3AYJ A;  5KMS A;  1LTX R;  2R4J A;  2FJA A;  2C70 A;  2BK5 A;  3COX A;  2GQW A;  1Q1W A;  1CHU A;  3SZW A;  3NKS A;  5FS6 A;  2BXS A;  3UKQ A;  2XLR A;  1N4V A;  2WDR A;  1F8R A;  1ZK7 A;  3NH3 X;  3CMM A;  4H7U A;  3SY4 A;  2F5Z A;  1IJH A;  2CVJ A;  3IC9 A;  4DGK A;  1NG3 A;  3LAD A;  1D7L A;  4OPT A;  1OJD A;  1CC2 A;  3DME A;  1DJN A;  4UDP A;  2PYX A;  2WDV A;  3SGL A;  1QO8 A;  2E1M A;  2V5Z A;  2XLP A;  1PXA A;  4OVI A;  4IA6 A;  4UP3 A;  3R9U A;  1VG9 A;  1IUX A;  2AAQ A;  4RG3 A;  3GDN A;  3P9U A;  5C2T A;  1PJ6 A;  2JKC A;  2A89 A;  3GWD A;  4EQX A;  1VDC A;  5FMH A;  1COY A;  2ZZC A;  1JEH A;  1DOD A;  1ELI A;  3EF6 A;  2OAM A;  3D1C A;  1Y56 B;  1S2Y A;  1NHR A;  1E6E A;  1H82 A;  1MOK A;  4OPI A;  3GDP A;  4AT2 A;  1KDG A;  3F8D A;  4A7A A;  1F8W A;  2GV8 A;  2EQ6 A;  1B5Q A;  3C96 A;  2R4E A;  3S61 A;  1KF6 A;  4YT0 A;  1S3B A;  2GR2 A;  3NT6 A;  5M0Z A;  1ZOY A;  2YQU A;  1D4C A;  4X4J A;  2BAB A;  2JAE A;  2OLN A;  3OC4 A;  4H4Q A;  3LB8 A;  2YR5 A;  4IV9 A;  1L0V A;  1K4Q A;  3Q6J A;  4U2T A;  2C67 A;  1CJ2 A;  2B9X A;  2XVF A;  1OJA A;  1TRB A;  2WBA A;  2R0P A;  3G5S A;  3KPF A;  3RHA A;  4GDE A;  3ALM A;  3GQK A;  4OPL A;  5BUK A;  2BCP A;  1GTE A;  3AED A;  2BAC A;  3AEA A;  3QFB A;  1E1L A;  4N9X A;  1O95 A;  3FMW A;  3GMC A;  1PBF A;  3M0O A;  2RGJ A;  2FBW A;  2YG7 A;  2GF3 A;  3LOV A;  4OPU A;  1XHC A;  4H2P A;  3WE0 A;  3C4N A;  4J57 A;  1W4X A;  5BRT A;  2CDU A;  2WS3 A;  3T37 A;  4O5Q A;  4UDR A;  4PAA A;  2BXR A;  4U8P A;  2JBV A;  1Q1R A;  2XLU A;  1FEC A;  2QAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...