5C3JA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 216
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c3jA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c3jA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c3jA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c3jA04
4RSLA 2H88A 2YLWA 2QAEA 2VOUA 3P4SA 2CVJA 3CPHG 4GR1A 4RG3A 3DJJA 1B37A 2DKHA 1W4XA 2IIDA 1IUXA 2EQ8A 4H2NA 4A9WA 5BULA 1JOAA 2A8XA 2C75A 3F8RA 4YSXA 4OPLA 5FS8A 2GQFA 3SFEA 2J3NA 3UKHA 4OPIA 3CNSA 2WEUA 3K7TA 4OPCA 3AE2A 4JNQA 1O5WA 1MOKA 3DJDA 5KVIA 1VG0A 2Q7VA 1KDGA 3H4KA 3UP5A 2EQ9A 2GAHB 4D03A 4FX9A 2YM2A 1CJ2A 3UOZA 4H4TA 4YKGA 3ABVA 1S3BA 2OAMA 1F8WA 2FJEA 2GR2A 1DJNA 2C72A 1Y56A 1GERA 1DOCA 3OC4A 3UTFA 1Q9IA 2Q0KA 1DODA 1NPXA 1TDFA 2VVLA 3M12A 2XDOA 5GRTA 1YQ4A 1IUWA 4YSHA 4X9NA 1BGJA 2YLTA 2WQYA 4J56A 1GTEA 3GDPA 1RYIA 4UP3A 4CY8A 4U8OA 4B65A 1H83A 3DMEA 1DOBA 4YT0A 4GUVA 3G5RA 4Z26A 2FJDA 3QFBA 4Z25A 3NIXA 1ZK7A 1K0LA 3UTGA 3P4RA 1H86A 3KPFA 4IVMB 2YG4A 3FBSA 4UDQA 3ICSA 4B64A 4BK3A 1CC2A 3VRAA 1P2EA 3ZDNA 4H2QA 3BI5A 4AOXA 3VQRA 4NEWA 1QLBA 2XVJA 4OCGA 2F5ZA 1GRFA 2JB3A 3DA1A 4C77A 3AXBA 3RNMA 2BS4A 1K0JA 2VRMA 1K4QA 1PDHA 2E4GA 2WESA 5J7XA 5U25A 3H8IA 3UKQA 2JK6A 1KF6A 3NYFA 4DSHA 2RGJA 3AECA 3IWAA 4H4QA 2YM1A 3GD4A 4IVOB 4EMIA 3QVPA 1TDNA 2AQJA 2DKIA 3SGLA 4YXDA 1M64A 1PHHA 3SFDA 3EPTA 3II4A 3V3NA 4K5RA 1E1MA 2WDQA 3AE7A 4FK1C 2GB0A 2OALA 4X4JA 4ZCDA 1FEAA 4NTEA 2YLZA 2W0HA 4FK1A 2YAUA 4BK1A 3QSEA 3AE6A 1DOEA 4B63A 1E1KA 1KSSA 2PHHA 4I59A 4Z2TA 1TYPA 2BK5A 2QA2A 3R9UA 2BXSA 2C70A 1HYUA 4IV9A 3ZYXA 5L46A 3LADA 4KX6A 4H50A 1TDEA 2BACA 2HQMA 4IA6A 2A87A 3AWIA 1LV0A 3NK1X 4NTCA 3F8PA 4YSYA 3IC9A 3L8KA 1RP0A 3AEGA 2YR5A 3ALJA 5CQFA 3NRNA 3LB8A 3BNMA 5FS9A 4I58A 1PN0A 2BYBA 2R0CA 1FOHA 2WP5A 2XFNA 3C96A 4U2TA 5HYMA 2ZZ0A 1COYA 5KVHA 1PBFA 2TMDA 1RSGA 2GRTA 1CJ4A 2JAEA 3VR8A 2WBAA 1GSNA 4TM4A 4USQA 4B66A 4BJZA 1N4WA 5BUKA 5JCIA 1IUTA 2GMHA 2WU5A 3COXA 3LJPA 3EF6A 4ZN0A 5DBJA 3UOVA 5KOWA 3GWFA 3IHGA 4U2SA 5EB4A 1CL0A 4O5UA 4TLXA 1ELIA 3GRTA 1VQWA 1S3EA 4U8IA 1OJCA 4EIQA 3H8LA 3AYLA 4XWZA 1E6EA 1FCDA 2V5ZA 3BI4A 1REOA 2A89A 4J2WA 3B3RA 2ACZA 2GEWA 2EQ7A 2YVGA 4LA1A 2RABA 4AT2A 3ADAB 1XHCA 4C3XA 4H4XA 3ALMA 2YG6A 3ISHA 1H7WA 4CY6A 2R0GA 3T37A 3UKPA 1EBDA 3CNPA 4EQWA 3QJ4A 1GRBA 4NEVA 1H82A 2Q6UA 1GRGA 2WOVA 1QO8A 3E1TA 1TDKA 3UP4A 1FEBA 2YVJA 2V6OA 2IVDA 4CCQA 2JKCA 3EAOA 2OLNA 1YKJA 2R4EA 2WOIA 3QSSA 3I3LA 1K0IA 5GSNA 1CJCA 3BHFA 1JEHA 2B9WA 1Q1RA 1EL7A 2C3CA 2JB1A 4ICYA 2LFCA 4OPTA 5EB5A 5LV9A 1NAAA 5U1OA 1NENA 3NG7X 1L9CA 1L0VA 2XFOA 1JNRA 4H4WA 4JN9A 5C2TA 2WOWA 4J34A 3UCLA 5JCLA 4YSZA 3UTEA 3QFAA 3UKAA 1L9DA 3I6DA 2VQ7A 3AE9A 2WU2A 1IUSA 1BF3A 1MO9A 4YKFA 1V59A 1FL2A 1GOSA 2CULA 4J36A 4MJWA 1PJ6A 5FMHA 3NK2X 1GETA 1KSUA 1QJDA 2X8HA 3GMBA 5EOWA 4ZCCA 2X8GA 3NHOX 4C3YA 3P9UA 1GNDA 3BI2A 2ARDA 3GYJA 4WX1A 4H2RA 1M6IA 1Q1WA 3NTAA 3NYEA 4U8KA 4A7AA 1NHRA 3FIMB 4A65A 1FECA 3DGHA 4Y4LA 3RHAA 4H2PA 3P1WA 2I0ZA 4E0VA 2C64A 5CKUA 1UKVG 2B9YA 1LQUA 1XANA 3SM8A 2QCUA 1GRAA 4H4PA 1BKWA 3NKSA 2B76A 4BJYA 4EQRA 3RP8A 1GPEA 1H81A 2JBVA 1CJ3A 2TPRA 1N4VA 3ICTA 4U8LA 2WP6A 3KKJA 3PO7A 2GR3A 4YTPA 2APGA 1ZOYA 2BABA 2XFPA 3GDNA 2YG3A 3NYCA 1PXAA 3C4AA 3IF9A 4OVIA 4YTMA 3DJEA 1GREA 4XWRA 2O9ZA 5ER0A 4EQSA 2C67A 3GQHA 3SUCA 2XVEA 4X9MA 3VR9A 1JRYA 4WCTA 5BVAA 3FPZA 4J33A 4NTDA 3K7MX 1BZLA 2XLRA 3UKLA 5C3JA 3CGDA 4BURA 2CDUA 5M10A 1F8SA 3GMCA 3AEFA 4TM3A 1PJ5A 3S61A 1XPQA 1ZY8A 1YQ3A 1D5TA 1Z6LA 2GV8A 2R4JA 3FG2P 1BGNA 4H4SA 4U2LA 3URHA 3ITJA 1GV4A 1TYTA 5KXJA 2JB2A 4N9XA 4Z44A 2FJBA 2YLXA 3KU9A 4H4RA 4EQXA 1H84A 4K7ZA 1NEKA 3RP7A 2WDVA 2WPFA 2X99A 4EM3A 4B69A 1H7XA 1E1NA 4GRTA 3F8DA 4B68A 3FMWA 2BCGG 2E5VA 4CBQA 1IUVA 1S2YA 2GR1A 2V3BA 1ZP0A 1E1LA 1L9EA 1ZMCA 4OPDA 4TM0A 2EQ6A 4Z2RA 1D4CA 4IA5A 3DGZA 3AEEA 4AT0A 3RP6A 2Q0LA 3KVEA 5J60A 3AE4A 3AYJA 5HHFA 2WS3A 1ZOVA 2XFUA 4EM4A 3CIRA 2GAGB 2ZBWA 2VVLG 3JSKA 3K7QX 2CFYA 2YG5A 1GRHA 4A99A 3CPJG 4U8MA 2GF3A 1ZKQA 3CNJA 4C5OA 1OJ9A 2X50A 1NHPA 2BS3A 5FS7A 3B6DA 3V76A 3HZLA 1AOGA 3ALLA 1ZMDA 5IQ1A 1NG3A 1NHSA 3AE5A 4FDCB 2WPCA 4REKA 4CNJA 1VG9A 3AYIA 1GESA 2C3DA 4JDRA 2ZZBA 4KPRA 1ZDLA 4U8NA 4PAAA 4EMJA 4H4UA 2OLOA 3AEBA 5HXIA 3P4PA 3DJGX 4EMWA 1NHQA 3LZXA 4D04A 4GDPA 3G5SA 2XCGA 1F3PA 1JU2A 3D1CA 1PXBA 1DJQA 1O94A 2BK4A 2B9XA 2XLPA 3CTYA 5IPYA 1PBCA 2V3AA 2RGOA 3Q9TA 4HB9A 1CC6A 4YTNA 3NN6X 1LJ1A 3CGBA 3SQPA 3GWDA 2R0PA 5JCNA 2WDRA 3CPIG 4H4ZA 3PS9A 3AD7B 3CGCA 3PVCA 1PBBA 3AEDA 1Y56B 3DK8A 3GSIA 5TR3A 1GRTA 2ZZCA 4K5SA 3KD9A 4NZHA 2RGHA 3S5WA 3D8XA 1JRXA 2X8CA 2XVHA 3AEAA 3NLCA 3NH3X 4JY3A 3CN8A 2GQWA 3LXDA 3LZWA 4J57A 4OPUA 2VVMA 4K2XA 1DNCA 2VZ2A 2GH5A 4Y4MA 1DXLA 1EL8A 1O95A 2C76A 4APNA 2R45A 3Q6JA 3QVRA 4H4YA 3UTHA 2XYOA 1B8SA 3C4NA 3VRDB 4CNKA 5HY5A 2BCPA 1JNZA 3GD3A 4U8JA 1GALA 1XDIA 2C7GA 2FJAA 3O0HA 5EBKA 2C66A 4JY2A 3EANA 3KA7A 4Z2UA 2XLSA 1SEZA 3UKKA 1KNRA 3KLJA 4P9SA 4ECHA 3P4QA 2H89A 2R9ZA 4K8DA 2YLSA 3REDA 5KOXA 2XVIA 1X31B 2WETA 4C74A 1GT8A 4USRA 5JCMA 4TM1A 1EL9A 2Y6RA 2BK3A 1CC4A 3NT6A 3GYIA 1BWCA 3UOYA 1N1PA 3GQKA 4GF7A 2WPEA 2OA1A 1D4DA 1KFYA 2C73A 1CF3A 1LPFA 3NGCX 3CNTA 4XXGA 4YWOA 2NPXA 4ADWA 4A6NB 1B5QA 1D4EA 2V60A 1S2QA 2YG7A 3LOVA 2BC0A 1B4VA 2QA1A 3AB1A 1LVLA 1EL5A 1YY5A 4TLZA 3AE8A 2R46A 1D7YA 3QSMA 4HA6A 1LTXR 4DGKA 4PABA 2GVCA 2IVEA 2YVFA 2X3NA 5JCKA 1OJDA 2WHDA 2B7RA 4GCMA 1VDCA 1PXCA 4JNAA 1E39A 3AD9B 4Z24A 4A6NA 4A79A 4Z43A 3GRSA 4RG4A 2E1MA 3WE0A 1IJHA 1N4UA 1TRBA 4M52A 1GEUA 3AE1A 1D7LA 1F8RA 3V3OA 5IQ4A 5KRQA 2VQBA 1P2HA 2YLRA 2Z5XA 4O5QA 1PBDA 1GTHA 3UKFA 3DK9A 2PYXA 2WP9A 1VRQB 3ATQA 3DK4A 4JQ9A 1E7PA 4H7UA 1CHUA 3NNEA 4AP1A 1PBEA 2XLUA 3G5QA 4AOSA 2B7SA 3VRBA 3M13A 4Y4NA 3CGEA 3GYXA 1GXFA 3K30A 1TDOA 4J31A 1KNPA 1ZX9A 2Y6QA 2GR0A 4DSGA 2UZZA 3OZ2A 4B1BA 2BA9A 1PJ7A 1NDAA 2YQUA 4K22A 4CRTA 4A5LA 2YR6A 3AE3A 1PS9A 4DNAA 1H6VA 4BV6A 2YR4A 3NK0X 3BNUA 3NN0X 2FBWA 2BS2A 4BK2A 3IHMA 2XVFA 1OJAA 2Z5YA 5U63A 4B67A 4UDRA 2BXRA 3UOXA 5KWFA 1LQTA 3ICRA 5FS6A 4EIPA 4LU6A 2YWLA 3ATRA 4OPGA 2VRLA 3AD8B 1CBOA 4AP3A 4LIIA 1YQZA 2GMJA 3NTDA 1NG4A 3M0OA 3CNDA 1OJTA 1IUUA 1MXTA 1ONFA 4U8PA 5BRTA 2AAQA 4GDEA 3BHKA 2XFQA 2V61A 2BC1A 2C65A 2XLTA 5M0ZA 1JRZA 4H4VA 2AR8A 2NVKX 4UDPA 4CCRA 1Y0PA 3L1RA 1F6MA 3DH9A
chains in the Genus database with same CATH superfamily
4RSLA 2YLWA 5HXCA 3CPHG 5GONE 2V1DB 3RYCE 4H2NA 4A9WA 2JQ9A 3F8RA 2C75A 2GQFA 3K7TA 5ABFB 3HKCE 2NOXA 2X9YA 3FZFB 2CCQA 4DR3T 5FP3A 3Q5XA 1KDGA 3G06A 4D03A 4FX9A 3HKBE 1M7KA 5FYMA 4YKGA 3AA1B 3JAFA 3OYZA 2GR2A 3N2KE 1Y56A 3PDYA 3A7MA 1Q9IA 2Q0KA 2K48A 3N2OA 1PO14 2KXPB 4IT4A 5LCYA 3ZKRA 2YOEA 3TLWA 4P1NA 4B65A 1QSDA 1EAH4 2FJDA 3I1AA 5DABA 5LB7B 3NIXA 1ZK7A 3SX6A 1MMNA 3ICSA 3VRAA 3ZDNA 4H2QA 4EZ4A 3PTRB 4IIJE 4C77A 4ZI2D 3N9LA 2VRMA 3T31A 5U25A 5HEOA 3UKQA 4G73A 4JEUB 1KF6A 3AA7B 4AQGA 3NYFA 4GK5E 2YM1A 4Z90A 4C90A 4YY3T 4QX7B 3CK6A 2ODUA 3QVPA 1BR1A 3C4ZA 2VURA 5AQLB 1M64A 3EPTA 2NTXA 4IL4A 1OEDA 4I50E 4AQFC 3ZSSA 4FK1C 1VCTA 2W0HA 2YAUA 2K3WA 4COFA 3P50A 3F2EA 3ZSTA 2BG9C 4O4JE 2VK9A 5LHHB 5LYJE 2JQQA 5FY1A 2BK5A 2BXSA 4ZEYA 4KX6A 2BACA 2R6GF 2X0YA 3AWIA 4NTCA 4X20E 3R6NA 3AEGA 3ONXA 1MNEA 3PUWF 3R84B 5FS9A 3UUBA 2WP5A 2XFNA 5HYMA 3HR0A 1J1JA 5LP6E 1COYA 2LSKA 5L3BB 5KVHA 3EHZA 4ILBA 4OYKA 5JCIA 3EABA 4H9QC 1PO24 1IUTA 2UXXB 3COXA 3LJPA 2A9UA 4ZN0A 4ZI2C 4ZZBA 1VBB4 3NBXX 3GWFA 3IHGA 3GRTA 5ADXL 4QXCB 4B3ST 1VQWA 2JMHA 3H8LA 5E0OA 4XWZA 3F31A 5C8YE 5FY7A 2DLRA 2ACZA 2GEWA 4EYUA 2EQ7A 2YVGA 1XHCA 3ISHA 2V8SV 4UIGA 4GIWA 3UKPA 4E7ZA 3CNPA 3CWZB 4EQWA 3PUXF 4NEVA 1QO8A 2J4GA 3E1TA 1EV14 1NAFA 1N36T 5JRCA 2OLNA 3JC6C 1HCIA 2PFVA 4B3RT 3I3LA 3QSSA 1JEHA 1XWMA 1M62A 2B9WA 5AQNB 2C3CA 1LVKA 5EB5A 2JMKA 2IC9A 3AXJA 1NAAA 1D1AA 2XM1A 3KV4A 3T2KA 3NG7X 1HNWT 3UCLA 4YSZA 3QFAA 2RS34 3JAEA 2C5KT 4CQIA 2WU2A 1BF3A 4DIDB 2KWIB 1V59A 1FL2A 2CULA 5LBMA 2NW9A 4EEDA 1PJ6A 1KSUA 5EOWA 4ZCCA 2X8GA 3O4XE 1IBMT 5AQOB 3UU6A 2ARDA 4WX1A 2VL0A 1M6IA 2L3LA 3NTAA 4U8KA 2J62A 4A65A 3DGHA 3RHAA 5DJQC 2C64A 2ZLYA 3SM8A 5AQUB 3ZPOA 2JBVA 1CUNA 1D0XA 1N4VA 4IHJE 4Z91A 4I0UA 4UF0A 2APGA 2BABA 3GDNA 4TNWA 1PXAA 3IF9A 3DJEA 3GQHA 3SUCA 4QXBB 2XVEA 4HWFA 4MHCA 4WCTA 3K7MX 5C3JA 3VHLA 3M65A 3AEFA 4WBNE 3RC3A 1YQ3A 1D5TA 4GB34 4FJOA 4U2LA 2V6YB 3ITJA 1GV4A 1RUJ4 5KXJA 3MXZA 4TV8E 2WDVA 4B69A 4LFBT 4GRTA 2BCGG 4CBQA 5IHYA 4RHV4 3QB5A 1S2YA 2GR1A 4JI7T 2KWHA 3DGZA 3AEEA 3RX6A 4DBRA 1RUI4 5KDMC 1OEDE 4PJJA 5HHFA 4BAYB 3WI3A 2VVLG 2CFYA 4A99A 2LRKA 1D1BA 2XQ8A 2X50A 3B6DA 3V76A 3ALLA 4FDCB 3AE5A 4PJMA 2WPCA 2X5ID 3O1JA 4Z43A 3O1IA 2ZZBA 2OLOA 5BMVE 5TAOA 2OA5A 3LZXA 2XCGA 4HFDA 5LXTE 2B9XA 4LF6T 4UV8B 4TNVA 3CKDA 3E22E 1OXZA 3Q9DA 4JLEA 1CC6A 3CX8B 3GWDA 2M6IA 2WDRA 2GK9A 1X9BA 3CGCA 3PVCA 5AQMB 1Y56B 2CXLA 1ZV4X 1XDPA 4NZHA 5JDMA 2RGHA 1AR64 3AEAA 1I94T 2ZM0A 3CN8A 3LXDA 4A56A 3LBXA 4K2XA 2VZ2A 2Q9QD 1O95A 4APNA 2R45A 4H4YA 4IDZA 4PW8A 2CLYC 1UGOA 4CI1B 4PDWD 1JNZA 1GALA 5HWXA 2C7GA 1R084 3KA7A 3TLUA 4L9IA 1KNRA 4PFPA 2CXDA 4K8DA 2YLSA 2XVIA 1ASJ4 2PY5A 3AA6B 2WETA 4X65T 4IE5A 1N33T 4AKRB 3PUSA 2BK3A 3UOYA 1BWCA 3GQKA 2ZM8A 2XJ7A 2OA1A 1D4DA 3NGCX 1NA1D 3LOVA 1AR84 1B4VA 3AB1A 1EL5A 1BEV4 3UUNA 2GVCA 2X3NA 4GKJT 2UXDT 1IJ5A 3GRSA 2E1MA 4M52A 3SWHA 2Q9QB 1HFAA 3OTOT 3NVOA 3X1DA 3DK9A 3HKEE 2Q9QC 2WWVA 2XLUA 5L47A 4JI4T 2QRXA 2RM24 3GYXA 1GXFA 1UURA 4J31A 2QA7A 2GR0A 4DSGA 4ZOLE 1YD8G 1PJ7A 2YQUA 2G0UA 4A5LA 2BBHA 5HEGA 1T72A 4DMVA 2YR4A 1WYCA 2I6HA 3SZFA 2RA1A 2XVFA 3WAJA 4B67A 3UOXA 3MK7C 1LQTA 3ICRA 5FS6A 3AAEB 3RHWA 2YWLA 4LU6A 2GMJA 1BR2A 3CNDA 1HNZT 1OJTA 1RMU4 4IL9A 3EAMA 5ABEA 3BHKA 5HXHA 2JPFA 4NUUA 2XQ3A 4X5TA 2VB6A 4UDPA 4HWDA 3L1RA 1YXRA 5FXWA 1JNRA 1F6MA 3DH9A 2BVMA 3RIAA 3IF8B 2QAEA 3P4SA 2CVJA 4RG3A 3DJJA 1B37A 2DKHA 2WCAA 1WLXA 5JRCB 1IUXA 3K3NA 1FJGT 1FIOA 2A8XA 5AQRB 4BJMA 4YSXA 4OPLA 2LSIA 3N9OA 3SFEA 5FS8A 3UKHA 4OPIA 3DP7A 4OPCA 2LLYA 1HF8A 1MOKA 2E8IA 3AXJB 2CA5A 4AIUA 4JI0T 1VG0A 2L9QA 2Q7VA 2VVNA 3H4KA 3UP5A 3TLTA 2CWOA 4P0BA 4HWIB 4QX8B 5HEJA 4M1PA 4X1YE 3C50A 1DJNA 2C72A 1IJ6A 1DOCA 3OC4A 2UUBT 1DODA 1TDFA 2VVLA 3SYIA 1S35A 5FXVA 2XDOA 5IUXA 2XAGB 4X9NA 1BGJA 4MALA 2P9BA 2WQYA 4J56A 1GTEA 2PLV4 1RYIA 4UP3A 4IE4A 1H83A 2KZ7B 5JDQA 4GUVA 3OKQA 4PK4A 5L4HA 1UK5A 2KSRA 3UTGA 3P4RA 2XAHB 4B6XA 1H86A 1SA0E 4IVMB 4UF0B 3BI5A 4AOXA 1Z0PA 2BKNA 3LFMA 3DA1A 3PUGA 1Y01A 3AXBA 3RNMA 1PDHA 3EVYA 2YDRA 1RUE4 2JK6A 2K5BB 1IBKT 3Q5DA 5AQHB 4G6HA 4HEAA 3OBVE 4LMLA 3IA3A 3JBG4 2X66A 1RUH4 2AQJA 3GA8A 1R094 4H9RC 5AQGB 4YXDA 1HR0T 3II4A 3SFDA 3PV0F 2HPLA 2B1EA 1KNZA 1MIWA 1IZNB 1FEAA 2YLZA 2MOZA 2JQHA 2LM9A 4KBMB 4EV6A 1KK7A 3FI7A 2PZSA 2WZIA 2Y8DA 1KSSA 2E9XA 2XQ7A 4E7SA 2PHHA 4U2YA 1MNDA 1HYUA 2J47A 2R074 2YDSA 4H50A 1TDEA 4IA6A 3SRZA 2A87A 3T0KA 3Q5WA 3F8PA 2OV9A 2XAFB 4V1Av 1G73A 1RP0A 4X66T 3ALJA 5CQFA 3TLSA 3ZMZB 3SZ0A 1U4QA 3LB8A 3BNMA 4PFOA 4I58A 2BYBA 2AE9A 4A98A 1FOHA 3C96A 2RS54 2ZZ0A 2CRBA 2MYSA 1CJ4A 3VR8A 4TM4A 4BJZA 4LFAT 4HWCA 3UOVA 5KOWA 5FL0A 5EB4A 4X64T 1CL0A 4JI1T 4OYJA 4NXNT 4EIQA 4HFEA 3HYWA 2YEVC 1UUSA 4LF8T 5LGTB 4G6GA 4J2WA 4OX9T 4QH1A 2RABA 2YG6A 2CE7A 4HE8A 4CY6A 2XY8B 5KMSA 2BZBA 1H82A 1WFDA 2Q6UA 2WOVA 3UP4A 1E2AA 2V6OA 4U7YA 4DR5T 4CCQA 4JEHB 1WR0A 2MAWA 1CJCA 4YLHA 3BHFA 2N2NA 3ZCIA 1EL7A 2LFCA 3T1HT 3W15B 1VCSA 4XBFB 4H4WA 1VBC4 2UUCT 4J34A 5JCLA 3UKAA 3AA0B 2VQ7A 3HKDE 2ODVA 1IUSA 3FXDB 3ZN0B 4J36A 3NK2X 1GETA 1QJDA 2X8HA 4IDQA 3NHOX 2JQKA 5DQVA 2VKDA 3VKGA 2IDOB 2IUBA 1T7SA 5ABHA 1NHRA 4Y4LA 1T8BA 3P1WA 2I0ZA 2JIWA 2LM2A 3UUXB 3PE0A 5J2UE 5JDHA 2B9YA 1XANA 3RYIE 4EQRA 1GPEA 1H81A 4WBOA 2WP6A 4I55E 1ZOYA 2YG3A 3NYCA 4WW0A 3RRWA 4OVIA 4XWRA 4EQSA 2BKPA 3E08A 3BQKA 3ANWB 2VQFT 4TV9E 4IGUA 3FPZA 4NTDA 1IAPA 1BZLA 3ESLA 2XLRA 5M10A 2CDUA 3N9MA 4TM3A 3S61A 3F57A 5AQFB 3ONLC 1Z6LA 3VKHA 1BGNA 3FG2P 2CMRA 2WMNA 4TZ4C 1TYTA 2JB2A 2MBGA 1ZHCA 3ZT6A 2V5CA 2WY2A 3LSVA 4K7ZA 2XASB 5CA1E 3RP7A 2X99A 3U78A 3EDVA 1E1NA 2XQ9A 3F8DA 1HRV4 1IUVA 2RPAA 3RKOA 1OWAA 1UX5A 1E1LA 1HG5A 3OYXA 4EEBA 3RP6A 2YN6A 2Q0LA 3AE4A 5CA0E 1KEYA 2WS3A 1ZOVA 4B3TT 2W61A 3KV9A 5CGMA 4EYYR 2ZBWA 5JTGA 3K7QX 5JDLA 3P7IA 2LOPA 2Y48B 3CNJA 3LK3B 2PYLA 3RIUC 1AOGA 5FY0A 1ZMDA 4DR7T 1HG2A 1NG3A 3FBZA 4REKA 4CNJA 3ZLIA 3QB5K 4EMJA 1GESA 4KPRA 4U8NA 4H4UA 1D0ZA 2C5IT 4PJLA 3DJGX 5IYZE 1NHQA 4O2BE 2N1GA 4P0AA 2E5LT 4D04A 4GKKT 3V5UA 3ZJ1A 2NWBA 2LKGA 3D1CA 1JU2A 4H9PC 4LF4T 1DJQA 1O94A 3PURA 3BQLA 1HX1B 5FMNA 2V3AA 1HX8A 4H9OC 4HFVA 1AL24 4JYAT 3CGBA 3SQPA 2R0PA 3HI2A 4QH5A 4NXMT 1PBBA 1COV4 5TR3A 3DK8A 4HFBA 4JI3T 2NR4A 2K24A 2GH5A 2C76A 1EL8A 2E9XD 3UTHA 3QVRA 2HWB4 2XYOA 4CNKA 4LF9T 3Q5EA 3O0HA 5LMNT 3EANA 2CWYA 3UKKA 3KLJA 2UUAT 1RUG4 3CPZA 3P4QA 4O4HE 3MA9A 1T98A 3REDA 5KOXA 2D5UA 1U5PA 4HTEA 5L3FB 1GT8A 4USRA 1EL9A 1DU2A 1PIV4 1POV0 1UCUA 2XQYA 3GYIA 4GF7A 4YWOA 1CF3A 1LPFA 4ADWA 4XXGA 2NPXA 2ZM2A 1D4EA 2LHRA 2IHR1 2SPCA 1S2QA 3PUZF 1XNQT 2QA1A 1XMQT 1LVLA 4TLZA 1YKHB 3AE8A 3UT5E 4CI2B 2XQ6A 1D7YA 3K1SA 3MKDA 4HA6A 3LK42 4N78D 3DTOA 1WRDA 3UUMA 5J2TE 1VDCA 1PXCA 4UVCB 4AKLA 4I43B 1E39A 4Z24A 4A6NA 5LHGB 4RG4A 4KUMB 3UU5A 2K9AA 1N4UA 1TRBA 1D7LA 2E9XB 1J5WA 1P2HA 4U74A 2XUEA 1VRQB 4AP1A 1PBEA 2E9XC 3K8PC 2MTQA 3M13A 4Q4W4 2IMLA 5JR9A 2BA9A 4K0UA 4JI5T 2I0MA 1US7B 3E0ZA 3CMMA 5HXEA 4BV6A 4OK0A 4ISSA 2RMU4 2WSSV 5U63A 2W0GA 5IWAT 2BXRA 3ZYLA 1NG4A 1IUUA 3ZN1B 3IBPA 2UXCT 5LGUB 5JDFA 2W63A 2RR14 5AQJB 5M0ZA 2PTFA 1RUF4 2UU9T 1JRZA 2AR8A 3FZHB 4H63H 2V6XA 4J2CA 3ZMSB 5FKYA 4JI6T 3FXEB 1FEWA 4MFRA 2H88A 4UR9A 4GR1A 3RC8A 4JI2T 1W4XA 1SUMB 5BULA 1JOAA 1HRI4 1H8TD 2J3NA 4CXWA 3D0TA 3PJAJ 3ZMTB 3CNSA 3AE2A 4JNQA 1BR0A 2BVLA 2XM2A 2BRYA 2LHNA 5HAXA 3M3ZB 2EQ9A 2YM2A 3UOZA 4H4TA 2OAMA 5KX5E 1F8WA 4NPPA 5L3EB 5ABFA 4II3A 4ZHQE 1WR6A 4WNKA 4CN4A 4AKIA 1YKEB 1GERA 3SY4A 3UTFA 4ERRA 2C0SA 3KBUA 3NRXA 4X1IE 1E1HB 1NPXA 5HEHA 2YLTA 3T2YA 4CY8A 4U8OA 5JDNA 5CB4E 4ZI3D 3QFBA 4Z25A 1B7TA 5BR8T 3AB3B 5JQGE 4LMJA 4BK3A 4G74A 3FBSA 4UDQA 1P2EA 1MMAA 3I9YA 4NEWA 4DUYT 1QLBA 2XVJA 1ZKEA 2F5ZA 1GRFA 2JB3A 5F3JA 2E4GA 4AISA 5J7XA 2WB5A 2R7FA 4DSHA 3AECA 1OEDB 3IWAA 5HCMA 4H4QA 4EMIA 2XZEA 1TDNA 3SGLA 1PHHA 2RP4A 4HKAA 1OEDC 3H3MA 1E1MA 2WDQA 2KMFA 4AQFA 4ZCDA 4FK1A 2DI4A 5AQSB 4TX5A 1QUUA 3DJBA 4B63A 4CXYA 2BG9A 4Z2TA 5LA6E 1TYPA 2QA2A 3R9UA 2C70A 4F6RC 4IV9A 5L46A 4HWHA 3NK1X 1LV0A 1WYBA 3ETVA 3IC9A 4ZZCA 4CN1A 5JREA 4HFCA 3PJAA 4ZS3A 4Q25A 5L3GB 1AR94 4IE6A 1Z7S4 2ES0A 1PBFA 2D9DA 3LDQB 2GRTA 1GSNA 4B66A 4USQA 2CBJA 4IDNA 3B57A 2GMHA 1G8XA 2VWAA 3J8F4 1YW0A 4LF7T 2X9XA 4EXTA 4IDPA 4TLXA 1H7CA 4U8IA 3B5MA 1OJCA 4UEMA 2HWC4 2KNDA 1FCDA 1R8IA 2V5ZA 3UU4A 2A89A 2QVAA 3RI5A 2OLTA 4C3XA 2KINB 5FNVE 4HN9A 1H7WA 2R0GA 1J5ET 1EBDA 5KMQA 3QJ4A 1GRBA 4DO0A 2C4CA 3CX7B 1GRGA 1TDKA 5L3DB 4AKHA 2AXDS 2IVDA 2JKCA 2YINA 3C4WA 1YKJA 2VKJA 1K0IA 1S94A 3SOLA 5GSNA 2EHOA 4ILCA 3WAKA 4ICYA 4YHJA 5FXZA 1L9CA 1L0VA 3TKLB 4JN9A 2WOWA 5ETWA 1L9DA 3I6DA 3AE9A 3UFGA 5ABGA 1AR74 1MO9A 4YKFA 4H9SE 4MJWA 3L39A 5FMHA 4L5GA 4C3YA 3GMBA 2WM9A 5KMRA 1MMGA 4UXNB 4H2RA 1Q1WA 3NYEA 4A7AA 3CQXC 3ZC0A 4TWFA 3ZYMA 3FIMB 1FECA 2H7VC 2X68A 2IC6A 3KVAA 5HEUA 5CKUA 1UKVG 4O2AE 1LQUA 4NWZA 3ZYKA 2QCUA 2HH7A 3CVRA 4DR6T 1GRAA 4H4PA 1W09A 4LMKA 3RP8A 3L09A 4G2AA 2QYWA 4U8LA 3KKJA 1MIYA 3PO7A 3RKGA 4EOZB 1HS7A 4DV7T 2V7LA 4IREA 4YJ3E 4DV3T 3C4AA 1RUC4 2W62A 4DBQA 2D0UA 1JRYA 1XZYA 3FZKB 1SE7A 1HTJF 3T1YT 1W9RA 3UKLA 3CGDA 4YJ2E 3O1HA 2X9HA 4DNDA 1PJ5A 4ISTA 1XPQA 1ZY8A 4DUZT 5M4YA 2FUPA 2GV8A 3QUJA 2W2UA 1Y64B 2LOSA 3URHA 2J1DG 1D4M4 4Z44A 2FJBA 3HA4A 2YLXA 2BBJA 1XHZA 3EUHA 3JCFA 4EQXA 1NEKA 4EM3A 3UFEA 2HHHT 5HCJA 1H7XA 5CFBA 1W0AA 4C91A 4B68A 1NCQD 3FMWA 2E5VA 2V3BA 1ZP0A 4Z2RA 2YU1A 2EQ6A 5JR9B 4IA5A 4NNJA 4ZXLA 3Q2MA 3KVEA 5J60A 4CI3B 3RYHE 3RH3A 2GAGB 3MACA 3JSKA 1XHXA 1RUD4 2R044 3CQGB 2BG9E 4U8MA 1ZKQA 4EZHA 4ILAA 1OJ9A 4PJNA 5L4EA 5FS7A 3RIFA 4DV6T 5IQ1A 2MPKA 1NHSA 3PUAA 5JVDE 4GAPA 4U33A 4ZS2A 3C98B 1VG9A 4JDRA 3SZCA 4ECHA 3BQIA 3I9WA 4DV1T 1ZDLA 4PAAA 2VASA 4ASKA 4OFZA 5HXIA 3MZKB 3JD74 4EMWA 3FZMB 3O9XA 3UU3A 3G5SA 3H3AA 4MBQA 3ETUA 1PXBA 4L0RA 2BK4A 2XHEB 2DNXA 2XLPA 2NW8A 1PBCA 4O8SA 2RGOA 2XQAA 4HB9A 4YTNA 2LT3A 3NN6X 1LJ1A 2UXNB 4X62T 3RF1A 3PS9A 3N2GE 3LBXB 3AD7B 3AVRA 1N32T 3AEDA 3GSIA 1UX4A 1GRTA 2ZZCA 5A1LA 3P4WA 3D8XA 3S5WA 1JRXA 4UELA 2X8CA 5HXRA 4JV5T 3NH3X 4JY3A 2M6BA 4KI0F 3LZWA 4OPUA 4Y4MA 4Q4X4 1DXLA 3KFWX 3K3QC 5LNKA 1B8SA 2Y6XA 5AQQB 5HY5A 2A2FX 2BCPA 4DV2T 4U8JA 1XDIA 5EBKA 4JY2A 3QNUA 5JH7E 1SEZA 4HGAA 3OPCA 1FMWA 2R9ZA 5LHIB 1XMOT 4BJNA 1HNXT 5JCMA 4NIQA 2PYJA 4TM1A 1CC4A 3NT6A 2WPEA 1KFYA 1EZ3A 2BKOA 1B5QA 2YG7A 2PW9A 2BC0A 5H6QB 2M67A 3B13A 1LTXR 4DGKA 5JDGA 2IVEA 2YVFA 2VKOA 3UULA 3RLFF 2WHDA 5JCKA 4GCMA 4JNAA 3AD9B 4A79A 5FXXA 4O4IE 3WE0A 4A97A 1F8RA 2BG9B 2CEAA 3V3OA 4DV4T 5KRQA 2VQBA 3H37A 2YLRA 2Z5XA 2CBIA 2PBIA 2X0LB 1PBDA 3UTKA 1GTHA 1VOMA 2PYXA 2WP9A 4JQ9A 3UQ7A 1E7PA 4H7UA 1OOPD 3NNEA 4TWHA 3G5QA 4AOSA 2Q9QA 3VRBA 2DWGA 1HXS4 3JC6D 3CGEA 2EHOD 2DL1A 4DV0T 1TDOA 1KNPA 1ZX9A 2Z6EA 2Y6QA 2UZZA 3IHRA 4B1BA 4K22A 3A5XA 5LG4A 4DNAA 1H6VA 3NK0X 3NN0X 2FBWA 3ZCJA 4BK2A 3IHMA 4AXPA 4EIPA 5KWFA 3KV5A 3ATRA 2VRLA 1CBOA 4AP3A 3RGLA 1YQZA 1RVF4 1O3XA 1ONFA 4U8PA 2CM0A 4YFSA 2V7JA 3T8OA 1MIVA 2NP9A 2V61A 2BC1A 5LG3A 3KVBA 4GYSA 4H4VA 4CCRA 2NVKX 4IE0A 5AQKB 2H3RA 4LFCT 3RRCA 3FB2A 5EZYE 5LGNB 2VOUA 2CHOA 3PU3A 2X51A 3NWIA 3HYXA 3I0QA 2IIDA 3GWHA 4DMWA 4XAXB 2WBLA 4WYVA 2EQ8A 2EHOB 5EK3A 2WEUA 2EX3A 4UVBB 1O5WA 3DJDA 5KVIA 2XAQB 4ADZA 5AQVB 2EHOC 3CX6B 5EK2A 2GAHB 2LSJA 3QOFA 4KHPT 1CJ2A 3ABVA 1S3BA 2FJEA 2LSGA 4AKGA 3KV6A 1IBLT 4HFHA 3M12A 5LJNA 4TWDA 5GRTA 1YQ4A 3N9NA 1IUWA 4YSHA 2V7KA 3GDPA 4TUYE 4EGWA 1XDOA 3DMEA 1DOBA 4CN6A 4YT0A 3G5RA 4Z26A 4PK5A 2XQ5A 1K0LA 3RQUA 1MMDA 5HYAA 4AI6A 3KPFA 3PUVF 4B64A 2YG4A 2N9DA 1CC2A 5F8PA 3SXIA 3VQRA 1VRH4 4WZXA 5AQTB 4OCGA 3T14A 2BS4A 1K0JA 3L8RA 3RQWA 1K4QA 2WESA 3H8IA 4PK6A 2RS14 2JRKA 2RGJA 2XSBA 3AVSA 5AQIB 3GD4A 4LF5T 2YK0A 2DCFA 2ZMAA 4IVOB 2YKSA 2DKIA 4QXHB 3V3NA 4K5RA 3GN5A 2W4XA 2X67A 3AE7A 2GB0A 2OALA 4X4JA 1VBD4 4NTEA 1VRBA 5LBQB 3MJXA 2I59A 4BK1A 3QSEA 2VKHA 4AQYT 3AE6A 1DOEA 2D0TA 1K5MD 1E1KA 3AAIA 4GOUA 4I59A 3GMIA 2HN1A 3ZYXA 3LADA 2HQMA 3FHNA 4YSYA 2CPTA 3L8KA 2YR5A 2LE8A 3PU8A 1GQEA 3LG7A 2V7IA 3ZMUB 3NRNA 1I6ZA 2L8KA 3HL6A 1PN0A 2R0CA 4U2TA 4KP3C 4IDOA 2YU2A 2TMDA 1RSGA 3CQCB 2JAEA 2WBAA 5BUKA 4U2ZA 4DR2T 1N4WA 4HFIA 2WU5A 3EF6A 5DBJA 3N5LA 5F5WA 4YHHT 4DR4T 5J0ZA 3UU8A 3ZJ2A 3ZEFB 4U2SA 3EI0A 2WAUA 4O5UA 1ELIA 3ZT7A 3HYVA 1S3EA 2DWKA 3AYLA 1E6EA 4Q4V4 3BI4A 1REOA 3FBLA 2V7MA 3B3RA 4PNIA 4LA1A 4AT2A 3ADAB 1WCRA 4H4XA 3ALMA 4JI8T 2ZM6T 5LJMA 3T37A 2CHNA 1PVC4 1FEBA 2BDEA 2YVJA 4CZZB 3C51A 2A72A 2W67A 5EK4A 5L2LA 3U3IA 3EAOA 2R4EA 1N34T 2WOIA 4U31A 4JUYA 1Q1RA 2JB1A 3IEEA 4OPTA 5LV9A 3ZC1A 3SZWA 5U1OA 1NENA 3P8CD 2XFOA 3S4UA 5C2TA 3UTEA 4A5XA 4K0KT 4JBWF 3ZT5A 3CMLA 3NZQA 4U3CA 1GOSA 2CLYB 2V26A 3P9UA 2W66A 1GNDA 3BI2A 3GYJA 5KMGP 2C5JA 1X79A 2XSAA 4H2PA 2D2SA 4E0VA 1NWMX 1VBA4 1BKWA 3NKSA 2B76A 4BJYA 3KDSE 2IIUA 1CJ3A 2TPRA 3ICTA 3KINB 2NW7A 2GR3A 4YTPA 4QH4A 2KLQA 2WMOA 4IE7A 2E2AA 5H6RB 2PG8A 2XFPA 3FZLB 4CXXA 2A3DA 4YTMA 2QGSA 1GREA 4UVAB 2O9ZA 5ER0A 2C67A 2XAJB 3N9PA 4X9MA 5CJ5A 3VR9A 3AAAB 3KBTA 5BVAA 4J33A 2LEHA 1SHZC 2HPJA 4F8HA 4BURA 2F4VT 1F8SA 2WZHA 3GMCA 1W0BA 5FVLA 5J1GA 2DHRA 3ANWA 3J9X1 2R4JA 4H4SA 3ONJA 5DQWA 4N9XA 3KU9A 2H7OA 4DR1T 4H4RA 4II2A 1H84A 4KMCA 2WPFA 3LK2B 4OPDA 1L9EA 1ZMCA 4TM0A 1D4CA 4ZI3C 3NKZA 4AT0A 4EIWA 5FL1A 3AYJA 3UQ4A 2XFUA 4EM4A 2UXBT 3C4XA 3CIRA 4ZI7E 2R064 5AFUL 2YG5A 3I0OA 1GRHA 4G63A 3CPJG 2GF3A 3PUQA 4C5OA 4P09A 2YDQA 1NHPA 2BS3A 1V9DA 3QK6A 4G9KA 4FI5A 3HZLA 4I4TE 3RIUA 2WWUA 3T2ZA 3AYIA 2C3DA 4ANJA 1VBE4 2VL8A 3AEBA 2LKHA 3P4PA 3NZPA 4GDPA 5LOVE 1LVFA 4DV5T 1F3PA 1LRZA 4U7IA 4X1KE 3CTYA 5IPYA 3Q9TA 2W00A 2LRLA 4KHZF 2X0HA 5JCNA 3CPIG 2LJLA 4H4ZA 1XNRT 1FMVA 4O4LE 4B3MT 2ACXA 4K5SA 3KD9A 3L3PA 2NTYA 3QC9A 5KNLA 2XVHA 3NLCA 5L3CB 4TN7B 2GQWA 4J57A 4EB6E 2VVMA 1DNCA 4Q4Y4 2PJQA 2JJ9A 3Q6JA 3VRDB 3C4NA 3OJAA 2BRAA 3GD3A 2XQ4A 1MQTD 4H9NC 4QKNA 1XI1A 2FJAA 2C66A 3SS1A 4UV9B 4Z2UA 2XLSA 3RYFE 4H63V 4OHFA 4P9SA 2H89A 3V5SA 5KMPA 1X31B 4GAVA 4C74A 2Y6RA 3TLVA 1N1PA 2C73A 1AJ3A 3CNTA 4PAGA 4A6NB 4XZCA 2V60A 3KPKA 1Z8UA 5HWYA 1YY5A 1RHI4 2R46A 2V5DA 3QSMA 3LJCA 3GN5B 4PABA 2VQET 3EDUA 1OJDA 2B7RA 4ILUA 4NUVA 1IJHA 1BR4A 3K3OA 1GEUA 3AE1A 2CXFA 1ZEEA 5IQ4A 4GYRA 1D1CA 4O5QA 3C64A 2V6YA 3VU7H 3UKFA 3A8YC 3ATQA 3DK4A 3OVUA 1CHUA 2X9WA 2B7SA 4DVDA 5AQPB 4Y4NA 2LSYA 3K30A 2XPKA 5JR9C 4QHOA 3ZMVB 3OZ2A 4CRTA 2IAKA 1NDAA 3N9QA 2YR6A 3AE3A 5LMUT 1PS9A 3BNUA 4QWNB 2BS2A 1D0YA 1OJAA 2Z5YA 5HXSA 4UDRA 2KT9A 4EAHA 4Z8XA 2XTLA 4OPGA 3AD8B 3RPUA 3BK9A 3J7Yq 4U72A 4LIIA 2IW5B 1LKXA 3NTDA 3M0OA 4BA9A 1MXTA 3PUYF 5BRTA 2VVSA 2AAQA 4GDEA 2XFQA 4MLKA 2C65A 2XLTA 3NRYA 3JADA 1Y0PA 4GK0E 5FVKA 2HN2A
chains in the Genus database with same CATH topology
4RSLA 2H88A 2YLWA 2QAEA 2VOUA 3P4SA 2CVJA 3CPHG 4GR1A 4RG3A 3DJJA 1B37A 3HYXA 2DKHA 1W4XA 2IIDA 1IUXA 2EQ8A 4H2NA 4A9WA 5BULA 1JOAA 2A8XA 2C75A 3F8RA 4YSXA 4OPLA 5FS8A 2GQFA 3SFEA 2J3NA 3UKHA 4OPIA 3CNSA 2WEUA 3K7TA 4OPCA 3AE2A 4JNQA 1O5WA 1MOKA 3DJDA 2BRYA 5KVIA 1VG0A 2Q7VA 1KDGA 3H4KA 3UP5A 2EQ9A 2GAHB 4D03A 4FX9A 2YM2A 1CJ2A 3UOZA 4H4TA 4YKGA 3ABVA 1S3BA 2OAMA 1F8WA 2FJEA 2GR2A 4II3A 1DJNA 3SY4A 2C72A 1Y56A 1GERA 1DOCA 3OC4A 3UTFA 1Q9IA 2Q0KA 1DODA 1NPXA 1TDFA 2VVLA 3M12A 3SYIA 2XDOA 5GRTA 1YQ4A 1IUWA 4YSHA 4X9NA 1BGJA 2YLTA 3T2YA 2WQYA 4J56A 1GTEA 3GDPA 1RYIA 4UP3A 4CY8A 4U8OA 4B65A 1H83A 3DMEA 1DOBA 4YT0A 4GUVA 3G5RA 4Z26A 2FJDA 3QFBA 4Z25A 3NIXA 1ZK7A 1K0LA 3SX6A 3UTGA 3P4RA 1H86A 3KPFA 4IVMB 2YG4A 3FBSA 4G74A 3ICSA 4UDQA 4B64A 4BK3A 1CC2A 3VRAA 1P2EA 3ZDNA 4H2QA 3BI5A 4AOXA 3SXIA 3VQRA 4NEWA 1QLBA 2XVJA 4OCGA 2F5ZA 1GRFA 2JB3A 3DA1A 3T14A 4C77A 3AXBA 3RNMA 2BS4A 1K0JA 2VRMA 1K4QA 3T31A 1PDHA 2E4GA 2WESA 5J7XA 5U25A 3H8IA 3UKQA 4G73A 2JK6A 1KF6A 3NYFA 4DSHA 2RGJA 3AECA 3IWAA 4G6HA 4H4QA 2YM1A 3GD4A 4IVOB 4EMIA 3QVPA 1TDNA 2AQJA 2DKIA 3SGLA 4YXDA 1M64A 1PHHA 3SFDA 3EPTA 3II4A 3V3NA 4K5RA 1E1MA 2WDQA 3AE7A 4FK1C 2GB0A 2OALA 4X4JA 4ZCDA 1FEAA 4NTEA 2YLZA 2W0HA 4FK1A 2YAUA 4BK1A 3QSEA 3AE6A 1DOEA 4B63A 1E1KA 1KSSA 2PHHA 4I59A 4Z2TA 1TYPA 2BK5A 2QA2A 3R9UA 2BXSA 2C70A 1HYUA 4IV9A 3ZYXA 5L46A 3LADA 4KX6A 4H50A 1TDEA 2BACA 2HQMA 4IA6A 2A87A 3AWIA 1LV0A 3NK1X 4NTCA 3F8PA 3T0KA 4YSYA 3IC9A 3L8KA 1RP0A 3AEGA 2YR5A 3ALJA 5CQFA 3SZ0A 3NRNA 3LB8A 3BNMA 5FS9A 4I58A 1PN0A 2BYBA 2R0CA 1FOHA 2WP5A 2XFNA 3C96A 4U2TA 5HYMA 2ZZ0A 1COYA 5KVHA 1PBFA 2TMDA 1RSGA 2GRTA 1CJ4A 2JAEA 3VR8A 2WBAA 1GSNA 4TM4A 4USQA 4B66A 4BJZA 1N4WA 5BUKA 5JCIA 1IUTA 2GMHA 2WU5A 3COXA 3LJPA 3EF6A 4ZN0A 5DBJA 3UOVA 5KOWA 3GWFA 3IHGA 4U2SA 5EB4A 1CL0A 4O5UA 4TLXA 1ELIA 3GRTA 1VQWA 3HYVA 1S3EA 4U8IA 1OJCA 4EIQA 3H8LA 3AYLA 3HYWA 1E6EA 4XWZA 1FCDA 2V5ZA 3BI4A 1REOA 2A89A 4G6GA 4J2WA 3B3RA 2ACZA 2GEWA 2EQ7A 2YVGA 4LA1A 2RABA 4AT2A 3ADAB 1XHCA 4C3XA 4H4XA 3ALMA 2YG6A 3ISHA 1H7WA 4CY6A 2R0GA 3T37A 3UKPA 1EBDA 3CNPA 4EQWA 5KMQA 3QJ4A 5KMSA 1GRBA 2C4CA 1H82A 2Q6UA 4NEVA 1GRGA 2WOVA 1QO8A 3E1TA 1TDKA 3UP4A 1FEBA 2YVJA 2V6OA 2IVDA 4CCQA 2JKCA 3EAOA 2OLNA 1YKJA 2R4EA 2WOIA 3QSSA 3I3LA 1K0IA 5GSNA 1CJCA 3BHFA 1JEHA 2B9WA 1Q1RA 1EL7A 2C3CA 2JB1A 4ICYA 2LFCA 4OPTA 5EB5A 5LV9A 3SZWA 1NAAA 5U1OA 3T2KA 1NENA 3NG7X 1L9CA 1L0VA 2XFOA 1JNRA 4H4WA 4JN9A 5C2TA 2WOWA 4J34A 3UCLA 5JCLA 4YSZA 3UTEA 3QFAA 3UKAA 1L9DA 3I6DA 2VQ7A 3AE9A 2WU2A 1IUSA 1BF3A 1MO9A 4YKFA 1V59A 1FL2A 1GOSA 2CULA 4J36A 4MJWA 1PJ6A 5FMHA 3NK2X 1GETA 1KSUA 1QJDA 2X8HA 3GMBA 5EOWA 4ZCCA 2X8GA 3NHOX 4C3YA 3P9UA 1GNDA 3BI2A 5KMRA 2ARDA 3GYJA 4WX1A 4H2RA 1M6IA 1Q1WA 3NTAA 3NYEA 4U8KA 4A7AA 1NHRA 3FIMB 4A65A 1FECA 3DGHA 4Y4LA 3RHAA 4H2PA 3P1WA 2I0ZA 4E0VA 2C64A 5CKUA 1UKVG 2B9YA 1LQUA 4NWZA 1XANA 3SM8A 2QCUA 1GRAA 4H4PA 1BKWA 3NKSA 2B76A 4BJYA 4EQRA 3RP8A 1GPEA 1H81A 2JBVA 1CJ3A 2TPRA 1N4VA 3ICTA 4U8LA 2WP6A 3KKJA 3PO7A 2GR3A 4YTPA 2APGA 1ZOYA 2BABA 2XFPA 3GDNA 2YG3A 3NYCA 1PXAA 3C4AA 3IF9A 4OVIA 4YTMA 3DJEA 1GREA 4XWRA 2O9ZA 5ER0A 4EQSA 2C67A 3GQHA 3SUCA 2XVEA 4X9MA 3VR9A 1JRYA 4WCTA 5BVAA 3FPZA 4J33A 4NTDA 3K7MX 1BZLA 2XLRA 3UKLA 5C3JA 3CGDA 4BURA 2CDUA 5M10A 1F8SA 3GMCA 3AEFA 4TM3A 1PJ5A 3S61A 1XPQA 1ZY8A 1YQ3A 1D5TA 1Z6LA 2GV8A 2R4JA 3FG2P 1BGNA 4H4SA 4U2LA 3URHA 3ITJA 1GV4A 1TYTA 5KXJA 2JB2A 4N9XA 4Z44A 2FJBA 2YLXA 3KU9A 4H4RA 4EQXA 4II2A 1H84A 4K7ZA 1NEKA 3RP7A 2WDVA 2WPFA 2X99A 4EM3A 4B69A 1H7XA 1E1NA 4GRTA 3F8DA 4B68A 3FMWA 2BCGG 2E5VA 4CBQA 1IUVA 1S2YA 2GR1A 2V3BA 1ZP0A 1E1LA 1L9EA 1ZMCA 4OPDA 4TM0A 2EQ6A 4Z2RA 1D4CA 4IA5A 3DGZA 3AEEA 4NNJA 4AT0A 3RP6A 2Q0LA 3KVEA 5J60A 3AE4A 3AYJA 5HHFA 2WS3A 1ZOVA 2XFUA 4EM4A 3CIRA 2GAGB 2ZBWA 2VVLG 3JSKA 3K7QX 2CFYA 2YG5A 1GRHA 4A99A 3CPJG 4U8MA 2GF3A 1ZKQA 3CNJA 4C5OA 1OJ9A 2X50A 1NHPA 2BS3A 5FS7A 3B6DA 4G9KA 3V76A 3HZLA 1AOGA 3ALLA 1ZMDA 5IQ1A 1NG3A 1NHSA 3AE5A 4FDCB 2WPCA 4GAPA 4REKA 4CNJA 3SZCA 3T2ZA 1VG9A 3AYIA 1GESA 2C3DA 4JDRA 2ZZBA 4KPRA 1ZDLA 4U8NA 4PAAA 4EMJA 4H4UA 2OLOA 3AEBA 5HXIA 3P4PA 3DJGX 4EMWA 1NHQA 3LZXA 4D04A 4GDPA 3G5SA 2XCGA 1F3PA 1JU2A 3D1CA 1PXBA 1DJQA 1O94A 2BK4A 2B9XA 2XLPA 3CTYA 5IPYA 1PBCA 2V3AA 2RGOA 3Q9TA 4HB9A 1CC6A 4YTNA 3NN6X 1LJ1A 3CGBA 3SQPA 3GWDA 2R0PA 5JCNA 2WDRA 3CPIG 4H4ZA 3PS9A 3AD7B 3CGCA 3PVCA 1PBBA 3AEDA 1Y56B 3DK8A 3GSIA 5TR3A 1GRTA 2ZZCA 4K5SA 3KD9A 4NZHA 2RGHA 3S5WA 3D8XA 1JRXA 5KNLA 2X8CA 2XVHA 3AEAA 3NLCA 3NH3X 4JY3A 3CN8A 2GQWA 3LXDA 3LZWA 4J57A 4OPUA 2VVMA 4K2XA 1DNCA 2VZ2A 2GH5A 4Y4MA 1DXLA 1EL8A 1O95A 2C76A 4APNA 2R45A 3Q6JA 3QVRA 4H4YA 3UTHA 2XYOA 1B8SA 3C4NA 3VRDB 4CNKA 5HY5A 2BCPA 1JNZA 2BRAA 3GD3A 4U8JA 1GALA 1XDIA 2C7GA 2FJAA 3O0HA 5EBKA 2C66A 4JY2A 3EANA 3KA7A 4Z2UA 2XLSA 1SEZA 3UKKA 1KNRA 3KLJA 4P9SA 4ECHA 3P4QA 2H89A 2R9ZA 4K8DA 2YLSA 3REDA 5KOXA 2XVIA 5KMPA 1X31B 4GAVA 2WETA 4C74A 1GT8A 4USRA 5JCMA 4TM1A 1EL9A 2Y6RA 2BK3A 1CC4A 3NT6A 3GYIA 1BWCA 3UOYA 1N1PA 3GQKA 4GF7A 2WPEA 2OA1A 1D4DA 1KFYA 2C73A 1CF3A 1LPFA 3NGCX 3CNTA 4XXGA 4YWOA 2NPXA 4ADWA 4A6NB 1B5QA 1D4EA 2V60A 1S2QA 2YG7A 3KPKA 3LOVA 2BC0A 1B4VA 2QA1A 3AB1A 1LVLA 1EL5A 1YY5A 4TLZA 3AE8A 2R46A 1D7YA 3QSMA 4HA6A 1LTXR 4DGKA 4PABA 2GVCA 2IVEA 2YVFA 2X3NA 5JCKA 1OJDA 2WHDA 2B7RA 4GCMA 1VDCA 1PXCA 4JNAA 1E39A 3AD9B 4Z24A 4A6NA 4A79A 4Z43A 3GRSA 4RG4A 2E1MA 3WE0A 1IJHA 1N4UA 1TRBA 4M52A 1GEUA 3AE1A 1D7LA 1F8RA 3V3OA 5IQ4A 5KRQA 2VQBA 1P2HA 2YLRA 2Z5XA 4O5QA 1PBDA 1GTHA 3UKFA 3DK9A 2PYXA 2WP9A 1VRQB 3ATQA 3DK4A 4JQ9A 1E7PA 4H7UA 1CHUA 3NNEA 4AP1A 1PBEA 2XLUA 3G5QA 4AOSA 2B7SA 3VRBA 3M13A 4Y4NA 3CGEA 3GYXA 1GXFA 3K30A 1TDOA 4J31A 1KNPA 1ZX9A 2Y6QA 2GR0A 4DSGA 2UZZA 3OZ2A 4B1BA 2BA9A 1PJ7A 1NDAA 2YQUA 4K22A 4CRTA 4A5LA 2YR6A 3AE3A 1PS9A 4DNAA 1H6VA 4BV6A 2YR4A 3CMMA 3NK0X 3BNUA 3NN0X 2FBWA 2BS2A 4BK2A 3IHMA 3SZFA 2XVFA 1OJAA 2Z5YA 5U63A 4B67A 4UDRA 2BXRA 3UOXA 5KWFA 1LQTA 3ICRA 5FS6A 4EIPA 4LU6A 2YWLA 3ATRA 4OPGA 2VRLA 3AD8B 1CBOA 4AP3A 4LIIA 1YQZA 2GMJA 3NTDA 1NG4A 3M0OA 3CNDA 1OJTA 1IUUA 1MXTA 1ONFA 4U8PA 5BRTA 2AAQA 4GDEA 3BHKA 2XFQA 2V61A 2BC1A 2C65A 2XLTA 5M0ZA 1JRZA 4H4VA 2AR8A 2NVKX 4UDPA 4CCRA 1Y0PA 3L1RA 1F6MA 3DH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RSL A;  2H88 A;  2YLW A;  2QAE A;  2VOU A;  3P4S A;  2CVJ A;  3CPH G;  4GR1 A;  4RG3 A;  3DJJ A;  1B37 A;  2DKH A;  1W4X A;  2IID A;  1IUX A;  2EQ8 A;  4H2N A;  4A9W A;  5BUL A;  1JOA A;  2A8X A;  2C75 A;  3F8R A;  4YSX A;  4OPL A;  5FS8 A;  2GQF A;  3SFE A;  2J3N A;  3UKH A;  4OPI A;  3CNS A;  2WEU A;  3K7T A;  4OPC A;  3AE2 A;  4JNQ A;  1O5W A;  1MOK A;  3DJD A;  5KVI A;  1VG0 A;  2Q7V A;  1KDG A;  3H4K A;  3UP5 A;  2EQ9 A;  2GAH B;  4D03 A;  4FX9 A;  2YM2 A;  1CJ2 A;  3UOZ A;  4H4T A;  4YKG A;  3ABV A;  1S3B A;  2OAM A;  1F8W A;  2FJE A;  2GR2 A;  1DJN A;  2C72 A;  1Y56 A;  1GER A;  1DOC A;  3OC4 A;  3UTF A;  1Q9I A;  2Q0K A;  1DOD A;  1NPX A;  1TDF A;  2VVL A;  3M12 A;  2XDO A;  5GRT A;  1YQ4 A;  1IUW A;  4YSH A;  4X9N A;  1BGJ A;  2YLT A;  2WQY A;  4J56 A;  1GTE A;  3GDP A;  1RYI A;  4UP3 A;  4CY8 A;  4U8O A;  4B65 A;  1H83 A;  3DME A;  1DOB A;  4YT0 A;  4GUV A;  3G5R A;  4Z26 A;  2FJD A;  3QFB A;  4Z25 A;  3NIX A;  1ZK7 A;  1K0L A;  3UTG A;  3P4R A;  1H86 A;  3KPF A;  4IVM B;  2YG4 A;  3FBS A;  4UDQ A;  3ICS A;  4B64 A;  4BK3 A;  1CC2 A;  3VRA A;  1P2E A;  3ZDN A;  4H2Q A;  3BI5 A;  4AOX A;  3VQR A;  4NEW A;  1QLB A;  2XVJ A;  4OCG A;  2F5Z A;  1GRF A;  2JB3 A;  3DA1 A;  4C77 A;  3AXB A;  3RNM A;  2BS4 A;  1K0J A;  2VRM A;  1K4Q A;  1PDH A;  2E4G A;  2WES A;  5J7X A;  5U25 A;  3H8I A;  3UKQ A;  2JK6 A;  1KF6 A;  3NYF A;  4DSH A;  2RGJ A;  3AEC A;  3IWA A;  4H4Q A;  2YM1 A;  3GD4 A;  4IVO B;  4EMI A;  3QVP A;  1TDN A;  2AQJ A;  2DKI A;  3SGL A;  4YXD A;  1M64 A;  1PHH A;  3SFD A;  3EPT A;  3II4 A;  3V3N A;  4K5R A;  1E1M A;  2WDQ A;  3AE7 A;  4FK1 C;  2GB0 A;  2OAL A;  4X4J A;  4ZCD A;  1FEA A;  4NTE A;  2YLZ A;  2W0H A;  4FK1 A;  2YAU A;  4BK1 A;  3QSE A;  3AE6 A;  1DOE A;  4B63 A;  1E1K A;  1KSS A;  2PHH A;  4I59 A;  4Z2T A;  1TYP A;  2BK5 A;  2QA2 A;  3R9U A;  2BXS A;  2C70 A;  1HYU A;  4IV9 A;  3ZYX A;  5L46 A;  3LAD A;  4KX6 A;  4H50 A;  1TDE A;  2BAC A;  2HQM A;  4IA6 A;  2A87 A;  3AWI A;  1LV0 A;  3NK1 X;  4NTC A;  3F8P A;  4YSY A;  3IC9 A;  3L8K A;  1RP0 A;  3AEG A;  2YR5 A;  3ALJ A;  5CQF A;  3NRN A;  3LB8 A;  3BNM A;  5FS9 A;  4I58 A;  1PN0 A;  2BYB A;  2R0C A;  1FOH A;  2WP5 A;  2XFN A;  3C96 A;  4U2T A;  5HYM A;  2ZZ0 A;  1COY A;  5KVH A;  1PBF A;  2TMD A;  1RSG A;  2GRT A;  1CJ4 A;  2JAE A;  3VR8 A;  2WBA A;  1GSN A;  4TM4 A;  4USQ A;  4B66 A;  4BJZ A;  1N4W A;  5BUK A;  5JCI A;  1IUT A;  2GMH A;  2WU5 A;  3COX A;  3LJP A;  3EF6 A;  4ZN0 A;  5DBJ A;  3UOV A;  5KOW A;  3GWF A;  3IHG A;  4U2S A;  5EB4 A;  1CL0 A;  4O5U A;  4TLX A;  1ELI A;  3GRT A;  1VQW A;  1S3E A;  4U8I A;  1OJC A;  4EIQ A;  3H8L A;  3AYL A;  4XWZ A;  1E6E A;  1FCD A;  2V5Z A;  3BI4 A;  1REO A;  2A89 A;  4J2W A;  3B3R A;  2ACZ A;  2GEW A;  2EQ7 A;  2YVG A;  4LA1 A;  2RAB A;  4AT2 A;  3ADA B;  1XHC A;  4C3X A;  4H4X A;  3ALM A;  2YG6 A;  3ISH A;  1H7W A;  4CY6 A;  2R0G A;  3T37 A;  3UKP A;  1EBD A;  3CNP A;  4EQW A;  3QJ4 A;  1GRB A;  4NEV A;  1H82 A;  2Q6U A;  1GRG A;  2WOV A;  1QO8 A;  3E1T A;  1TDK A;  3UP4 A;  1FEB A;  2YVJ A;  2V6O A;  2IVD A;  4CCQ A;  2JKC A;  3EAO A;  2OLN A;  1YKJ A;  2R4E A;  2WOI A;  3QSS A;  3I3L A;  1K0I A;  5GSN A;  1CJC A;  3BHF A;  1JEH A;  2B9W A;  1Q1R A;  1EL7 A;  2C3C A;  2JB1 A;  4ICY A;  2LFC A;  4OPT A;  5EB5 A;  5LV9 A;  1NAA A;  5U1O A;  1NEN A;  3NG7 X;  1L9C A;  1L0V A;  2XFO A;  1JNR A;  4H4W A;  4JN9 A;  5C2T A;  2WOW A;  4J34 A;  3UCL A;  5JCL A;  4YSZ A;  3UTE A;  3QFA A;  3UKA A;  1L9D A;  3I6D A;  2VQ7 A;  3AE9 A;  2WU2 A;  1IUS A;  1BF3 A;  1MO9 A;  4YKF A;  1V59 A;  1FL2 A;  1GOS A;  2CUL A;  4J36 A;  4MJW A;  1PJ6 A;  5FMH A;  3NK2 X;  1GET A;  1KSU A;  1QJD A;  2X8H A;  3GMB A;  5EOW A;  4ZCC A;  2X8G A;  3NHO X;  4C3Y A;  3P9U A;  1GND A;  3BI2 A;  2ARD A;  3GYJ A;  4WX1 A;  4H2R A;  1M6I A;  1Q1W A;  3NTA A;  3NYE A;  4U8K A;  4A7A A;  1NHR A;  3FIM B;  4A65 A;  1FEC A;  3DGH A;  4Y4L A;  3RHA A;  4H2P A;  3P1W A;  2I0Z A;  4E0V A;  2C64 A;  5CKU A;  1UKV G;  2B9Y A;  1LQU A;  1XAN A;  3SM8 A;  2QCU A;  1GRA A;  4H4P A;  1BKW A;  3NKS A;  2B76 A;  4BJY A;  4EQR A;  3RP8 A;  1GPE A;  1H81 A;  2JBV A;  1CJ3 A;  2TPR A;  1N4V A;  3ICT A;  4U8L A;  2WP6 A;  3KKJ A;  3PO7 A;  2GR3 A;  4YTP A;  2APG A;  1ZOY A;  2BAB A;  2XFP A;  3GDN A;  2YG3 A;  3NYC A;  1PXA A;  3C4A A;  3IF9 A;  4OVI A;  4YTM A;  3DJE A;  1GRE A;  4XWR A;  2O9Z A;  5ER0 A;  4EQS A;  2C67 A;  3GQH A;  3SUC A;  2XVE A;  4X9M A;  3VR9 A;  1JRY A;  4WCT A;  5BVA A;  3FPZ A;  4J33 A;  4NTD A;  3K7M X;  1BZL A;  2XLR A;  3UKL A;  5C3J A;  3CGD A;  4BUR A;  2CDU A;  5M10 A;  1F8S A;  3GMC A;  3AEF A;  4TM3 A;  1PJ5 A;  3S61 A;  1XPQ A;  1ZY8 A;  1YQ3 A;  1D5T A;  1Z6L A;  2GV8 A;  2R4J A;  3FG2 P;  1BGN A;  4H4S A;  4U2L A;  3URH A;  3ITJ A;  1GV4 A;  1TYT A;  5KXJ A;  2JB2 A;  4N9X A;  4Z44 A;  2FJB A;  2YLX A;  3KU9 A;  4H4R A;  4EQX A;  1H84 A;  4K7Z A;  1NEK A;  3RP7 A;  2WDV A;  2WPF A;  2X99 A;  4EM3 A;  4B69 A;  1H7X A;  1E1N A;  4GRT A;  3F8D A;  4B68 A;  3FMW A;  2BCG G;  2E5V A;  4CBQ A;  1IUV A;  1S2Y A;  2GR1 A;  2V3B A;  1ZP0 A;  1E1L A;  1L9E A;  1ZMC A;  4OPD A;  4TM0 A;  2EQ6 A;  4Z2R A;  1D4C A;  4IA5 A;  3DGZ A;  3AEE A;  4AT0 A;  3RP6 A;  2Q0L A;  3KVE A;  5J60 A;  3AE4 A;  3AYJ A;  5HHF A;  2WS3 A;  1ZOV A;  2XFU A;  4EM4 A;  3CIR A;  2GAG B;  2ZBW A;  2VVL G;  3JSK A;  3K7Q X;  2CFY A;  2YG5 A;  1GRH A;  4A99 A;  3CPJ G;  4U8M A;  2GF3 A;  1ZKQ A;  3CNJ A;  4C5O A;  1OJ9 A;  2X50 A;  1NHP A;  2BS3 A;  5FS7 A;  3B6D A;  3V76 A;  3HZL A;  1AOG A;  3ALL A;  1ZMD A;  5IQ1 A;  1NG3 A;  1NHS A;  3AE5 A;  4FDC B;  2WPC A;  4REK A;  4CNJ A;  1VG9 A;  3AYI A;  1GES A;  2C3D A;  4JDR A;  2ZZB A;  4KPR A;  1ZDL A;  4U8N A;  4PAA A;  4EMJ A;  4H4U A;  2OLO A;  3AEB A;  5HXI A;  3P4P A;  3DJG X;  4EMW A;  1NHQ A;  3LZX A;  4D04 A;  4GDP A;  3G5S A;  2XCG A;  1F3P A;  1JU2 A;  3D1C A;  1PXB A;  1DJQ A;  1O94 A;  2BK4 A;  2B9X A;  2XLP A;  3CTY A;  5IPY A;  1PBC A;  2V3A A;  2RGO A;  3Q9T A;  4HB9 A;  1CC6 A;  4YTN A;  3NN6 X;  1LJ1 A;  3CGB A;  3SQP A;  3GWD A;  2R0P A;  5JCN A;  2WDR A;  3CPI G;  4H4Z A;  3PS9 A;  3AD7 B;  3CGC A;  3PVC A;  1PBB A;  3AED A;  1Y56 B;  3DK8 A;  3GSI A;  5TR3 A;  1GRT A;  2ZZC A;  4K5S A;  3KD9 A;  4NZH A;  2RGH A;  3S5W A;  3D8X A;  1JRX A;  2X8C A;  2XVH A;  3AEA A;  3NLC A;  3NH3 X;  4JY3 A;  3CN8 A;  2GQW A;  3LXD A;  3LZW A;  4J57 A;  4OPU A;  2VVM A;  4K2X A;  1DNC A;  2VZ2 A;  2GH5 A;  4Y4M A;  1DXL A;  1EL8 A;  1O95 A;  2C76 A;  4APN A;  2R45 A;  3Q6J A;  3QVR A;  4H4Y A;  3UTH A;  2XYO A;  1B8S A;  3C4N A;  3VRD B;  4CNK A;  5HY5 A;  2BCP A;  1JNZ A;  3GD3 A;  4U8J A;  1GAL A;  1XDI A;  2C7G A;  2FJA A;  3O0H A;  5EBK A;  2C66 A;  4JY2 A;  3EAN A;  3KA7 A;  4Z2U A;  2XLS A;  1SEZ A;  3UKK A;  1KNR A;  3KLJ A;  4P9S A;  4ECH A;  3P4Q A;  2H89 A;  2R9Z A;  4K8D A;  2YLS A;  3RED A;  5KOX A;  2XVI A;  1X31 B;  2WET A;  4C74 A;  1GT8 A;  4USR A;  5JCM A;  4TM1 A;  1EL9 A;  2Y6R A;  2BK3 A;  1CC4 A;  3NT6 A;  3GYI A;  1BWC A;  3UOY A;  1N1P A;  3GQK A;  4GF7 A;  2WPE A;  2OA1 A;  1D4D A;  1KFY A;  2C73 A;  1CF3 A;  1LPF A;  3NGC X;  3CNT A;  4XXG A;  4YWO A;  2NPX A;  4ADW A;  4A6N B;  1B5Q A;  1D4E A;  2V60 A;  1S2Q A;  2YG7 A;  3LOV A;  2BC0 A;  1B4V A;  2QA1 A;  3AB1 A;  1LVL A;  1EL5 A;  1YY5 A;  4TLZ A;  3AE8 A;  2R46 A;  1D7Y A;  3QSM A;  4HA6 A;  1LTX R;  4DGK A;  4PAB A;  2GVC A;  2IVE A;  2YVF A;  2X3N A;  5JCK A;  1OJD A;  2WHD A;  2B7R A;  4GCM A;  1VDC A;  1PXC A;  4JNA A;  1E39 A;  3AD9 B;  4Z24 A;  4A6N A;  4A79 A;  4Z43 A;  3GRS A;  4RG4 A;  2E1M A;  3WE0 A;  1IJH A;  1N4U A;  1TRB A;  4M52 A;  1GEU A;  3AE1 A;  1D7L A;  1F8R A;  3V3O A;  5IQ4 A;  5KRQ A;  2VQB A;  1P2H A;  2YLR A;  2Z5X A;  4O5Q A;  1PBD A;  1GTH A;  3UKF A;  3DK9 A;  2PYX A;  2WP9 A;  1VRQ B;  3ATQ A;  3DK4 A;  4JQ9 A;  1E7P A;  4H7U A;  1CHU A;  3NNE A;  4AP1 A;  1PBE A;  2XLU A;  3G5Q A;  4AOS A;  2B7S A;  3VRB A;  3M13 A;  4Y4N A;  3CGE A;  3GYX A;  1GXF A;  3K30 A;  1TDO A;  4J31 A;  1KNP A;  1ZX9 A;  2Y6Q A;  2GR0 A;  4DSG A;  2UZZ A;  3OZ2 A;  4B1B A;  2BA9 A;  1PJ7 A;  1NDA A;  2YQU A;  4K22 A;  4CRT A;  4A5L A;  2YR6 A;  3AE3 A;  1PS9 A;  4DNA A;  1H6V A;  4BV6 A;  2YR4 A;  3NK0 X;  3BNU A;  3NN0 X;  2FBW A;  2BS2 A;  4BK2 A;  3IHM A;  2XVF A;  1OJA A;  2Z5Y A;  5U63 A;  4B67 A;  4UDR A;  2BXR A;  3UOX A;  5KWF A;  1LQT A;  3ICR A;  5FS6 A;  4EIP A;  4LU6 A;  2YWL A;  3ATR A;  4OPG A;  2VRL A;  3AD8 B;  1CBO A;  4AP3 A;  4LII A;  1YQZ A;  2GMJ A;  3NTD A;  1NG4 A;  3M0O A;  3CND A;  1OJT A;  1IUU A;  1MXT A;  1ONF A;  4U8P A;  5BRT A;  2AAQ A;  4GDE A;  3BHK A;  2XFQ A;  2V61 A;  2BC1 A;  2C65 A;  2XLT A;  5M0Z A;  1JRZ A;  4H4V A;  2AR8 A;  2NVK X;  4UDP A;  4CCR A;  1Y0P A;  3L1R A;  1F6M A;  3DH9 A; 
#chains in the Genus database with same CATH topology
 4RSL A;  2YLW A;  5HXC A;  3CPH G;  5GON E;  2V1D B;  3RYC E;  4H2N A;  4A9W A;  2JQ9 A;  3F8R A;  2C75 A;  2GQF A;  3K7T A;  5ABF B;  3HKC E;  2NOX A;  2X9Y A;  3FZF B;  2CCQ A;  4DR3 T;  5FP3 A;  3Q5X A;  1KDG A;  3G06 A;  4D03 A;  4FX9 A;  3HKB E;  1M7K A;  5FYM A;  4YKG A;  3AA1 B;  3JAF A;  3OYZ A;  2GR2 A;  3N2K E;  1Y56 A;  3PDY A;  3A7M A;  1Q9I A;  2Q0K A;  2K48 A;  3N2O A;  1PO1 4;  2KXP B;  4IT4 A;  5LCY A;  3ZKR A;  2YOE A;  3TLW A;  4P1N A;  4B65 A;  1QSD A;  1EAH 4;  2FJD A;  3I1A A;  5DAB A;  5LB7 B;  3NIX A;  1ZK7 A;  3SX6 A;  1MMN A;  3ICS A;  3VRA A;  3ZDN A;  4H2Q A;  4EZ4 A;  3PTR B;  4IIJ E;  4C77 A;  4ZI2 D;  3N9L A;  2VRM A;  3T31 A;  5U25 A;  5HEO A;  3UKQ A;  4G73 A;  4JEU B;  1KF6 A;  3AA7 B;  4AQG A;  3NYF A;  4GK5 E;  2YM1 A;  4Z90 A;  4C90 A;  4YY3 T;  4QX7 B;  3CK6 A;  2ODU A;  3QVP A;  1BR1 A;  3C4Z A;  2VUR A;  5AQL B;  1M64 A;  3EPT A;  2NTX A;  4IL4 A;  1OED A;  4I50 E;  4AQF C;  3ZSS A;  4FK1 C;  1VCT A;  2W0H A;  2YAU A;  2K3W A;  4COF A;  3P50 A;  3F2E A;  3ZST A;  2BG9 C;  4O4J E;  2VK9 A;  5LHH B;  5LYJ E;  2JQQ A;  5FY1 A;  2BK5 A;  2BXS A;  4ZEY A;  4KX6 A;  2BAC A;  2R6G F;  2X0Y A;  3AWI A;  4NTC A;  4X20 E;  3R6N A;  3AEG A;  3ONX A;  1MNE A;  3PUW F;  3R84 B;  5FS9 A;  3UUB A;  2WP5 A;  2XFN A;  5HYM A;  3HR0 A;  1J1J A;  5LP6 E;  1COY A;  2LSK A;  5L3B B;  5KVH A;  3EHZ A;  4ILB A;  4OYK A;  5JCI A;  3EAB A;  4H9Q C;  1PO2 4;  1IUT A;  2UXX B;  3COX A;  3LJP A;  2A9U A;  4ZN0 A;  4ZI2 C;  4ZZB A;  1VBB 4;  3NBX X;  3GWF A;  3IHG A;  3GRT A;  5ADX L;  4QXC B;  4B3S T;  1VQW A;  2JMH A;  3H8L A;  5E0O A;  4XWZ A;  3F31 A;  5C8Y E;  5FY7 A;  2DLR A;  2ACZ A;  2GEW A;  4EYU A;  2EQ7 A;  2YVG A;  1XHC A;  3ISH A;  2V8S V;  4UIG A;  4GIW A;  3UKP A;  4E7Z A;  3CNP A;  3CWZ B;  4EQW A;  3PUX F;  4NEV A;  1QO8 A;  2J4G A;  3E1T A;  1EV1 4;  1NAF A;  1N36 T;  5JRC A;  2OLN A;  3JC6 C;  1HCI A;  2PFV A;  4B3R T;  3I3L A;  3QSS A;  1JEH A;  1XWM A;  1M62 A;  2B9W A;  5AQN B;  2C3C A;  1LVK A;  5EB5 A;  2JMK A;  2IC9 A;  3AXJ A;  1NAA A;  1D1A A;  2XM1 A;  3KV4 A;  3T2K A;  3NG7 X;  1HNW T;  3UCL A;  4YSZ A;  3QFA A;  2RS3 4;  3JAE A;  2C5K T;  4CQI A;  2WU2 A;  1BF3 A;  4DID B;  2KWI B;  1V59 A;  1FL2 A;  2CUL A;  5LBM A;  2NW9 A;  4EED A;  1PJ6 A;  1KSU A;  5EOW A;  4ZCC A;  2X8G A;  3O4X E;  1IBM T;  5AQO B;  3UU6 A;  2ARD A;  4WX1 A;  2VL0 A;  1M6I A;  2L3L A;  3NTA A;  4U8K A;  2J62 A;  4A65 A;  3DGH A;  3RHA A;  5DJQ C;  2C64 A;  2ZLY A;  3SM8 A;  5AQU B;  3ZPO A;  2JBV A;  1CUN A;  1D0X A;  1N4V A;  4IHJ E;  4Z91 A;  4I0U A;  4UF0 A;  2APG A;  2BAB A;  3GDN A;  4TNW A;  1PXA A;  3IF9 A;  3DJE A;  3GQH A;  3SUC A;  4QXB B;  2XVE A;  4HWF A;  4MHC A;  4WCT A;  3K7M X;  5C3J A;  3VHL A;  3M65 A;  3AEF A;  4WBN E;  3RC3 A;  1YQ3 A;  1D5T A;  4GB3 4;  4FJO A;  4U2L A;  2V6Y B;  3ITJ A;  1GV4 A;  1RUJ 4;  5KXJ A;  3MXZ A;  4TV8 E;  2WDV A;  4B69 A;  4LFB T;  4GRT A;  2BCG G;  4CBQ A;  5IHY A;  4RHV 4;  3QB5 A;  1S2Y A;  2GR1 A;  4JI7 T;  2KWH A;  3DGZ A;  3AEE A;  3RX6 A;  4DBR A;  1RUI 4;  5KDM C;  1OED E;  4PJJ A;  5HHF A;  4BAY B;  3WI3 A;  2VVL G;  2CFY A;  4A99 A;  2LRK A;  1D1B A;  2XQ8 A;  2X50 A;  3B6D A;  3V76 A;  3ALL A;  4FDC B;  3AE5 A;  4PJM A;  2WPC A;  2X5I D;  3O1J A;  4Z43 A;  3O1I A;  2ZZB A;  2OLO A;  5BMV E;  5TAO A;  2OA5 A;  3LZX A;  2XCG A;  4HFD A;  5LXT E;  2B9X A;  4LF6 T;  4UV8 B;  4TNV A;  3CKD A;  3E22 E;  1OXZ A;  3Q9D A;  4JLE A;  1CC6 A;  3CX8 B;  3GWD A;  2M6I A;  2WDR A;  2GK9 A;  1X9B A;  3CGC A;  3PVC A;  5AQM B;  1Y56 B;  2CXL A;  1ZV4 X;  1XDP A;  4NZH A;  5JDM A;  2RGH A;  1AR6 4;  3AEA A;  1I94 T;  2ZM0 A;  3CN8 A;  3LXD A;  4A56 A;  3LBX A;  4K2X A;  2VZ2 A;  2Q9Q D;  1O95 A;  4APN A;  2R45 A;  4H4Y A;  4IDZ A;  4PW8 A;  2CLY C;  1UGO A;  4CI1 B;  4PDW D;  1JNZ A;  1GAL A;  5HWX A;  2C7G A;  1R08 4;  3KA7 A;  3TLU A;  4L9I A;  1KNR A;  4PFP A;  2CXD A;  4K8D A;  2YLS A;  2XVI A;  1ASJ 4;  2PY5 A;  3AA6 B;  2WET A;  4X65 T;  4IE5 A;  1N33 T;  4AKR B;  3PUS A;  2BK3 A;  3UOY A;  1BWC A;  3GQK A;  2ZM8 A;  2XJ7 A;  2OA1 A;  1D4D A;  3NGC X;  1NA1 D;  3LOV A;  1AR8 4;  1B4V A;  3AB1 A;  1EL5 A;  1BEV 4;  3UUN A;  2GVC A;  2X3N A;  4GKJ T;  2UXD T;  1IJ5 A;  3GRS A;  2E1M A;  4M52 A;  3SWH A;  2Q9Q B;  1HFA A;  3OTO T;  3NVO A;  3X1D A;  3DK9 A;  3HKE E;  2Q9Q C;  2WWV A;  2XLU A;  5L47 A;  4JI4 T;  2QRX A;  2RM2 4;  3GYX A;  1GXF A;  1UUR A;  4J31 A;  2QA7 A;  2GR0 A;  4DSG A;  4ZOL E;  1YD8 G;  1PJ7 A;  2YQU A;  2G0U A;  4A5L A;  2BBH A;  5HEG A;  1T72 A;  4DMV A;  2YR4 A;  1WYC A;  2I6H A;  3SZF A;  2RA1 A;  2XVF A;  3WAJ A;  4B67 A;  3UOX A;  3MK7 C;  1LQT A;  3ICR A;  5FS6 A;  3AAE B;  3RHW A;  2YWL A;  4LU6 A;  2GMJ A;  1BR2 A;  3CND A;  1HNZ T;  1OJT A;  1RMU 4;  4IL9 A;  3EAM A;  5ABE A;  3BHK A;  5HXH A;  2JPF A;  4NUU A;  2XQ3 A;  4X5T A;  2VB6 A;  4UDP A;  4HWD A;  3L1R A;  1YXR A;  5FXW A;  1JNR A;  1F6M A;  3DH9 A;  2BVM A;  3RIA A;  3IF8 B;  2QAE A;  3P4S A;  2CVJ A;  4RG3 A;  3DJJ A;  1B37 A;  2DKH A;  2WCA A;  1WLX A;  5JRC B;  1IUX A;  3K3N A;  1FJG T;  1FIO A;  2A8X A;  5AQR B;  4BJM A;  4YSX A;  4OPL A;  2LSI A;  3N9O A;  3SFE A;  5FS8 A;  3UKH A;  4OPI A;  3DP7 A;  4OPC A;  2LLY A;  1HF8 A;  1MOK A;  2E8I A;  3AXJ B;  2CA5 A;  4AIU A;  4JI0 T;  1VG0 A;  2L9Q A;  2Q7V A;  2VVN A;  3H4K A;  3UP5 A;  3TLT A;  2CWO A;  4P0B A;  4HWI B;  4QX8 B;  5HEJ A;  4M1P A;  4X1Y E;  3C50 A;  1DJN A;  2C72 A;  1IJ6 A;  1DOC A;  3OC4 A;  2UUB T;  1DOD A;  1TDF A;  2VVL A;  3SYI A;  1S35 A;  5FXV A;  2XDO A;  5IUX A;  2XAG B;  4X9N A;  1BGJ A;  4MAL A;  2P9B A;  2WQY A;  4J56 A;  1GTE A;  2PLV 4;  1RYI A;  4UP3 A;  4IE4 A;  1H83 A;  2KZ7 B;  5JDQ A;  4GUV A;  3OKQ A;  4PK4 A;  5L4H A;  1UK5 A;  2KSR A;  3UTG A;  3P4R A;  2XAH B;  4B6X A;  1H86 A;  1SA0 E;  4IVM B;  4UF0 B;  3BI5 A;  4AOX A;  1Z0P A;  2BKN A;  3LFM A;  3DA1 A;  3PUG A;  1Y01 A;  3AXB A;  3RNM A;  1PDH A;  3EVY A;  2YDR A;  1RUE 4;  2JK6 A;  2K5B B;  1IBK T;  3Q5D A;  5AQH B;  4G6H A;  4HEA A;  3OBV E;  4LML A;  3IA3 A;  3JBG 4;  2X66 A;  1RUH 4;  2AQJ A;  3GA8 A;  1R09 4;  4H9R C;  5AQG B;  4YXD A;  1HR0 T;  3II4 A;  3SFD A;  3PV0 F;  2HPL A;  2B1E A;  1KNZ A;  1MIW A;  1IZN B;  1FEA A;  2YLZ A;  2MOZ A;  2JQH A;  2LM9 A;  4KBM B;  4EV6 A;  1KK7 A;  3FI7 A;  2PZS A;  2WZI A;  2Y8D A;  1KSS A;  2E9X A;  2XQ7 A;  4E7S A;  2PHH A;  4U2Y A;  1MND A;  1HYU A;  2J47 A;  2R07 4;  2YDS A;  4H50 A;  1TDE A;  4IA6 A;  3SRZ A;  2A87 A;  3T0K A;  3Q5W A;  3F8P A;  2OV9 A;  2XAF B;  4V1A v;  1G73 A;  1RP0 A;  4X66 T;  3ALJ A;  5CQF A;  3TLS A;  3ZMZ B;  3SZ0 A;  1U4Q A;  3LB8 A;  3BNM A;  4PFO A;  4I58 A;  2BYB A;  2AE9 A;  4A98 A;  1FOH A;  3C96 A;  2RS5 4;  2ZZ0 A;  2CRB A;  2MYS A;  1CJ4 A;  3VR8 A;  4TM4 A;  4BJZ A;  4LFA T;  4HWC A;  3UOV A;  5KOW A;  5FL0 A;  5EB4 A;  4X64 T;  1CL0 A;  4JI1 T;  4OYJ A;  4NXN T;  4EIQ A;  4HFE A;  3HYW A;  2YEV C;  1UUS A;  4LF8 T;  5LGT B;  4G6G A;  4J2W A;  4OX9 T;  4QH1 A;  2RAB A;  2YG6 A;  2CE7 A;  4HE8 A;  4CY6 A;  2XY8 B;  5KMS A;  2BZB A;  1H82 A;  1WFD A;  2Q6U A;  2WOV A;  3UP4 A;  1E2A A;  2V6O A;  4U7Y A;  4DR5 T;  4CCQ A;  4JEH B;  1WR0 A;  2MAW A;  1CJC A;  4YLH A;  3BHF A;  2N2N A;  3ZCI A;  1EL7 A;  2LFC A;  3T1H T;  3W15 B;  1VCS A;  4XBF B;  4H4W A;  1VBC 4;  2UUC T;  4J34 A;  5JCL A;  3UKA A;  3AA0 B;  2VQ7 A;  3HKD E;  2ODV A;  1IUS A;  3FXD B;  3ZN0 B;  4J36 A;  3NK2 X;  1GET A;  1QJD A;  2X8H A;  4IDQ A;  3NHO X;  2JQK A;  5DQV A;  2VKD A;  3VKG A;  2IDO B;  2IUB A;  1T7S A;  5ABH A;  1NHR A;  4Y4L A;  1T8B A;  3P1W A;  2I0Z A;  2JIW A;  2LM2 A;  3UUX B;  3PE0 A;  5J2U E;  5JDH A;  2B9Y A;  1XAN A;  3RYI E;  4EQR A;  1GPE A;  1H81 A;  4WBO A;  2WP6 A;  4I55 E;  1ZOY A;  2YG3 A;  3NYC A;  4WW0 A;  3RRW A;  4OVI A;  4XWR A;  4EQS A;  2BKP A;  3E08 A;  3BQK A;  3ANW B;  2VQF T;  4TV9 E;  4IGU A;  3FPZ A;  4NTD A;  1IAP A;  1BZL A;  3ESL A;  2XLR A;  5M10 A;  2CDU A;  3N9M A;  4TM3 A;  3S61 A;  3F57 A;  5AQF B;  3ONL C;  1Z6L A;  3VKH A;  1BGN A;  3FG2 P;  2CMR A;  2WMN A;  4TZ4 C;  1TYT A;  2JB2 A;  2MBG A;  1ZHC A;  3ZT6 A;  2V5C A;  2WY2 A;  3LSV A;  4K7Z A;  2XAS B;  5CA1 E;  3RP7 A;  2X99 A;  3U78 A;  3EDV A;  1E1N A;  2XQ9 A;  3F8D A;  1HRV 4;  1IUV A;  2RPA A;  3RKO A;  1OWA A;  1UX5 A;  1E1L A;  1HG5 A;  3OYX A;  4EEB A;  3RP6 A;  2YN6 A;  2Q0L A;  3AE4 A;  5CA0 E;  1KEY A;  2WS3 A;  1ZOV A;  4B3T T;  2W61 A;  3KV9 A;  5CGM A;  4EYY R;  2ZBW A;  5JTG A;  3K7Q X;  5JDL A;  3P7I A;  2LOP A;  2Y48 B;  3CNJ A;  3LK3 B;  2PYL A;  3RIU C;  1AOG A;  5FY0 A;  1ZMD A;  4DR7 T;  1HG2 A;  1NG3 A;  3FBZ A;  4REK A;  4CNJ A;  3ZLI A;  3QB5 K;  4EMJ A;  1GES A;  4KPR A;  4U8N A;  4H4U A;  1D0Z A;  2C5I T;  4PJL A;  3DJG X;  5IYZ E;  1NHQ A;  4O2B E;  2N1G A;  4P0A A;  2E5L T;  4D04 A;  4GKK T;  3V5U A;  3ZJ1 A;  2NWB A;  2LKG A;  3D1C A;  1JU2 A;  4H9P C;  4LF4 T;  1DJQ A;  1O94 A;  3PUR A;  3BQL A;  1HX1 B;  5FMN A;  2V3A A;  1HX8 A;  4H9O C;  4HFV A;  1AL2 4;  4JYA T;  3CGB A;  3SQP A;  2R0P A;  3HI2 A;  4QH5 A;  4NXM T;  1PBB A;  1COV 4;  5TR3 A;  3DK8 A;  4HFB A;  4JI3 T;  2NR4 A;  2K24 A;  2GH5 A;  2C76 A;  1EL8 A;  2E9X D;  3UTH A;  3QVR A;  2HWB 4;  2XYO A;  4CNK A;  4LF9 T;  3Q5E A;  3O0H A;  5LMN T;  3EAN A;  2CWY A;  3UKK A;  3KLJ A;  2UUA T;  1RUG 4;  3CPZ A;  3P4Q A;  4O4H E;  3MA9 A;  1T98 A;  3RED A;  5KOX A;  2D5U A;  1U5P A;  4HTE A;  5L3F B;  1GT8 A;  4USR A;  1EL9 A;  1DU2 A;  1PIV 4;  1POV 0;  1UCU A;  2XQY A;  3GYI A;  4GF7 A;  4YWO A;  1CF3 A;  1LPF A;  4ADW A;  4XXG A;  2NPX A;  2ZM2 A;  1D4E A;  2LHR A;  2IHR 1;  2SPC A;  1S2Q A;  3PUZ F;  1XNQ T;  2QA1 A;  1XMQ T;  1LVL A;  4TLZ A;  1YKH B;  3AE8 A;  3UT5 E;  4CI2 B;  2XQ6 A;  1D7Y A;  3K1S A;  3MKD A;  4HA6 A;  3LK4 2;  4N78 D;  3DTO A;  1WRD A;  3UUM A;  5J2T E;  1VDC A;  1PXC A;  4UVC B;  4AKL A;  4I43 B;  1E39 A;  4Z24 A;  4A6N A;  5LHG B;  4RG4 A;  4KUM B;  3UU5 A;  2K9A A;  1N4U A;  1TRB A;  1D7L A;  2E9X B;  1J5W A;  1P2H A;  4U74 A;  2XUE A;  1VRQ B;  4AP1 A;  1PBE A;  2E9X C;  3K8P C;  2MTQ A;  3M13 A;  4Q4W 4;  2IML A;  5JR9 A;  2BA9 A;  4K0U A;  4JI5 T;  2I0M A;  1US7 B;  3E0Z A;  3CMM A;  5HXE A;  4BV6 A;  4OK0 A;  4ISS A;  2RMU 4;  2WSS V;  5U63 A;  2W0G A;  5IWA T;  2BXR A;  3ZYL A;  1NG4 A;  1IUU A;  3ZN1 B;  3IBP A;  2UXC T;  5LGU B;  5JDF A;  2W63 A;  2RR1 4;  5AQJ B;  5M0Z A;  2PTF A;  1RUF 4;  2UU9 T;  1JRZ A;  2AR8 A;  3FZH B;  4H63 H;  2V6X A;  4J2C A;  3ZMS B;  5FKY A;  4JI6 T;  3FXE B;  1FEW A;  4MFR A;  2H88 A;  4UR9 A;  4GR1 A;  3RC8 A;  4JI2 T;  1W4X A;  1SUM B;  5BUL A;  1JOA A;  1HRI 4;  1H8T D;  2J3N A;  4CXW A;  3D0T A;  3PJA J;  3ZMT B;  3CNS A;  3AE2 A;  4JNQ A;  1BR0 A;  2BVL A;  2XM2 A;  2BRY A;  2LHN A;  5HAX A;  3M3Z B;  2EQ9 A;  2YM2 A;  3UOZ A;  4H4T A;  2OAM A;  5KX5 E;  1F8W A;  4NPP A;  5L3E B;  5ABF A;  4II3 A;  4ZHQ E;  1WR6 A;  4WNK A;  4CN4 A;  4AKI A;  1YKE B;  1GER A;  3SY4 A;  3UTF A;  4ERR A;  2C0S A;  3KBU A;  3NRX A;  4X1I E;  1E1H B;  1NPX A;  5HEH A;  2YLT A;  3T2Y A;  4CY8 A;  4U8O A;  5JDN A;  5CB4 E;  4ZI3 D;  3QFB A;  4Z25 A;  1B7T A;  5BR8 T;  3AB3 B;  5JQG E;  4LMJ A;  4BK3 A;  4G74 A;  3FBS A;  4UDQ A;  1P2E A;  1MMA A;  3I9Y A;  4NEW A;  4DUY T;  1QLB A;  2XVJ A;  1ZKE A;  2F5Z A;  1GRF A;  2JB3 A;  5F3J A;  2E4G A;  4AIS A;  5J7X A;  2WB5 A;  2R7F A;  4DSH A;  3AEC A;  1OED B;  3IWA A;  5HCM A;  4H4Q A;  4EMI A;  2XZE A;  1TDN A;  3SGL A;  1PHH A;  2RP4 A;  4HKA A;  1OED C;  3H3M A;  1E1M A;  2WDQ A;  2KMF A;  4AQF A;  4ZCD A;  4FK1 A;  2DI4 A;  5AQS B;  4TX5 A;  1QUU A;  3DJB A;  4B63 A;  4CXY A;  2BG9 A;  4Z2T A;  5LA6 E;  1TYP A;  2QA2 A;  3R9U A;  2C70 A;  4F6R C;  4IV9 A;  5L46 A;  4HWH A;  3NK1 X;  1LV0 A;  1WYB A;  3ETV A;  3IC9 A;  4ZZC A;  4CN1 A;  5JRE A;  4HFC A;  3PJA A;  4ZS3 A;  4Q25 A;  5L3G B;  1AR9 4;  4IE6 A;  1Z7S 4;  2ES0 A;  1PBF A;  2D9D A;  3LDQ B;  2GRT A;  1GSN A;  4B66 A;  4USQ A;  2CBJ A;  4IDN A;  3B57 A;  2GMH A;  1G8X A;  2VWA A;  3J8F 4;  1YW0 A;  4LF7 T;  2X9X A;  4EXT A;  4IDP A;  4TLX A;  1H7C A;  4U8I A;  3B5M A;  1OJC A;  4UEM A;  2HWC 4;  2KND A;  1FCD A;  1R8I A;  2V5Z A;  3UU4 A;  2A89 A;  2QVA A;  3RI5 A;  2OLT A;  4C3X A;  2KIN B;  5FNV E;  4HN9 A;  1H7W A;  2R0G A;  1J5E T;  1EBD A;  5KMQ A;  3QJ4 A;  1GRB A;  4DO0 A;  2C4C A;  3CX7 B;  1GRG A;  1TDK A;  5L3D B;  4AKH A;  2AXD S;  2IVD A;  2JKC A;  2YIN A;  3C4W A;  1YKJ A;  2VKJ A;  1K0I A;  1S94 A;  3SOL A;  5GSN A;  2EHO A;  4ILC A;  3WAK A;  4ICY A;  4YHJ A;  5FXZ A;  1L9C A;  1L0V A;  3TKL B;  4JN9 A;  2WOW A;  5ETW A;  1L9D A;  3I6D A;  3AE9 A;  3UFG A;  5ABG A;  1AR7 4;  1MO9 A;  4YKF A;  4H9S E;  4MJW A;  3L39 A;  5FMH A;  4L5G A;  4C3Y A;  3GMB A;  2WM9 A;  5KMR A;  1MMG A;  4UXN B;  4H2R A;  1Q1W A;  3NYE A;  4A7A A;  3CQX C;  3ZC0 A;  4TWF A;  3ZYM A;  3FIM B;  1FEC A;  2H7V C;  2X68 A;  2IC6 A;  3KVA A;  5HEU A;  5CKU A;  1UKV G;  4O2A E;  1LQU A;  4NWZ A;  3ZYK A;  2QCU A;  2HH7 A;  3CVR A;  4DR6 T;  1GRA A;  4H4P A;  1W09 A;  4LMK A;  3RP8 A;  3L09 A;  4G2A A;  2QYW A;  4U8L A;  3KKJ A;  1MIY A;  3PO7 A;  3RKG A;  4EOZ B;  1HS7 A;  4DV7 T;  2V7L A;  4IRE A;  4YJ3 E;  4DV3 T;  3C4A A;  1RUC 4;  2W62 A;  4DBQ A;  2D0U A;  1JRY A;  1XZY A;  3FZK B;  1SE7 A;  1HTJ F;  3T1Y T;  1W9R A;  3UKL A;  3CGD A;  4YJ2 E;  3O1H A;  2X9H A;  4DND A;  1PJ5 A;  4IST A;  1XPQ A;  1ZY8 A;  4DUZ T;  5M4Y A;  2FUP A;  2GV8 A;  3QUJ A;  2W2U A;  1Y64 B;  2LOS A;  3URH A;  2J1D G;  1D4M 4;  4Z44 A;  2FJB A;  3HA4 A;  2YLX A;  2BBJ A;  1XHZ A;  3EUH A;  3JCF A;  4EQX A;  1NEK A;  4EM3 A;  3UFE A;  2HHH T;  5HCJ A;  1H7X A;  5CFB A;  1W0A A;  4C91 A;  4B68 A;  1NCQ D;  3FMW A;  2E5V A;  2V3B A;  1ZP0 A;  4Z2R A;  2YU1 A;  2EQ6 A;  5JR9 B;  4IA5 A;  4NNJ A;  4ZXL A;  3Q2M A;  3KVE A;  5J60 A;  4CI3 B;  3RYH E;  3RH3 A;  2GAG B;  3MAC A;  3JSK A;  1XHX A;  1RUD 4;  2R04 4;  3CQG B;  2BG9 E;  4U8M A;  1ZKQ A;  4EZH A;  4ILA A;  1OJ9 A;  4PJN A;  5L4E A;  5FS7 A;  3RIF A;  4DV6 T;  5IQ1 A;  2MPK A;  1NHS A;  3PUA A;  5JVD E;  4GAP A;  4U33 A;  4ZS2 A;  3C98 B;  1VG9 A;  4JDR A;  3SZC A;  4ECH A;  3BQI A;  3I9W A;  4DV1 T;  1ZDL A;  4PAA A;  2VAS A;  4ASK A;  4OFZ A;  5HXI A;  3MZK B;  3JD7 4;  4EMW A;  3FZM B;  3O9X A;  3UU3 A;  3G5S A;  3H3A A;  4MBQ A;  3ETU A;  1PXB A;  4L0R A;  2BK4 A;  2XHE B;  2DNX A;  2XLP A;  2NW8 A;  1PBC A;  4O8S A;  2RGO A;  2XQA A;  4HB9 A;  4YTN A;  2LT3 A;  3NN6 X;  1LJ1 A;  2UXN B;  4X62 T;  3RF1 A;  3PS9 A;  3N2G E;  3LBX B;  3AD7 B;  3AVR A;  1N32 T;  3AED A;  3GSI A;  1UX4 A;  1GRT A;  2ZZC A;  5A1L A;  3P4W A;  3D8X A;  3S5W A;  1JRX A;  4UEL A;  2X8C A;  5HXR A;  4JV5 T;  3NH3 X;  4JY3 A;  2M6B A;  4KI0 F;  3LZW A;  4OPU A;  4Y4M A;  4Q4X 4;  1DXL A;  3KFW X;  3K3Q C;  5LNK A;  1B8S A;  2Y6X A;  5AQQ B;  5HY5 A;  2A2F X;  2BCP A;  4DV2 T;  4U8J A;  1XDI A;  5EBK A;  4JY2 A;  3QNU A;  5JH7 E;  1SEZ A;  4HGA A;  3OPC A;  1FMW A;  2R9Z A;  5LHI B;  1XMO T;  4BJN A;  1HNX T;  5JCM A;  4NIQ A;  2PYJ A;  4TM1 A;  1CC4 A;  3NT6 A;  2WPE A;  1KFY A;  1EZ3 A;  2BKO A;  1B5Q A;  2YG7 A;  2PW9 A;  2BC0 A;  5H6Q B;  2M67 A;  3B13 A;  1LTX R;  4DGK A;  5JDG A;  2IVE A;  2YVF A;  2VKO A;  3UUL A;  3RLF F;  2WHD A;  5JCK A;  4GCM A;  4JNA A;  3AD9 B;  4A79 A;  5FXX A;  4O4I E;  3WE0 A;  4A97 A;  1F8R A;  2BG9 B;  2CEA A;  3V3O A;  4DV4 T;  5KRQ A;  2VQB A;  3H37 A;  2YLR A;  2Z5X A;  2CBI A;  2PBI A;  2X0L B;  1PBD A;  3UTK A;  1GTH A;  1VOM A;  2PYX A;  2WP9 A;  4JQ9 A;  3UQ7 A;  1E7P A;  4H7U A;  1OOP D;  3NNE A;  4TWH A;  3G5Q A;  4AOS A;  2Q9Q A;  3VRB A;  2DWG A;  1HXS 4;  3JC6 D;  3CGE A;  2EHO D;  2DL1 A;  4DV0 T;  1TDO A;  1KNP A;  1ZX9 A;  2Z6E A;  2Y6Q A;  2UZZ A;  3IHR A;  4B1B A;  4K22 A;  3A5X A;  5LG4 A;  4DNA A;  1H6V A;  3NK0 X;  3NN0 X;  2FBW A;  3ZCJ A;  4BK2 A;  3IHM A;  4AXP A;  4EIP A;  5KWF A;  3KV5 A;  3ATR A;  2VRL A;  1CBO A;  4AP3 A;  3RGL A;  1YQZ A;  1RVF 4;  1O3X A;  1ONF A;  4U8P A;  2CM0 A;  4YFS A;  2V7J A;  3T8O A;  1MIV A;  2NP9 A;  2V61 A;  2BC1 A;  5LG3 A;  3KVB A;  4GYS A;  4H4V A;  4CCR A;  2NVK X;  4IE0 A;  5AQK B;  2H3R A;  4LFC T;  3RRC A;  3FB2 A;  5EZY E;  5LGN B;  2VOU A;  2CHO A;  3PU3 A;  2X51 A;  3NWI A;  3HYX A;  3I0Q A;  2IID A;  3GWH A;  4DMW A;  4XAX B;  2WBL A;  4WYV A;  2EQ8 A;  2EHO B;  5EK3 A;  2WEU A;  2EX3 A;  4UVB B;  1O5W A;  3DJD A;  5KVI A;  2XAQ B;  4ADZ A;  5AQV B;  2EHO C;  3CX6 B;  5EK2 A;  2GAH B;  2LSJ A;  3QOF A;  4KHP T;  1CJ2 A;  3ABV A;  1S3B A;  2FJE A;  2LSG A;  4AKG A;  3KV6 A;  1IBL T;  4HFH A;  3M12 A;  5LJN A;  4TWD A;  5GRT A;  1YQ4 A;  3N9N A;  1IUW A;  4YSH A;  2V7K A;  3GDP A;  4TUY E;  4EGW A;  1XDO A;  3DME A;  1DOB A;  4CN6 A;  4YT0 A;  3G5R A;  4Z26 A;  4PK5 A;  2XQ5 A;  1K0L A;  3RQU A;  1MMD A;  5HYA A;  4AI6 A;  3KPF A;  3PUV F;  4B64 A;  2YG4 A;  2N9D A;  1CC2 A;  5F8P A;  3SXI A;  3VQR A;  1VRH 4;  4WZX A;  5AQT B;  4OCG A;  3T14 A;  2BS4 A;  1K0J A;  3L8R A;  3RQW A;  1K4Q A;  2WES A;  3H8I A;  4PK6 A;  2RS1 4;  2JRK A;  2RGJ A;  2XSB A;  3AVS A;  5AQI B;  3GD4 A;  4LF5 T;  2YK0 A;  2DCF A;  2ZMA A;  4IVO B;  2YKS A;  2DKI A;  4QXH B;  3V3N A;  4K5R A;  3GN5 A;  2W4X A;  2X67 A;  3AE7 A;  2GB0 A;  2OAL A;  4X4J A;  1VBD 4;  4NTE A;  1VRB A;  5LBQ B;  3MJX A;  2I59 A;  4BK1 A;  3QSE A;  2VKH A;  4AQY T;  3AE6 A;  1DOE A;  2D0T A;  1K5M D;  1E1K A;  3AAI A;  4GOU A;  4I59 A;  3GMI A;  2HN1 A;  3ZYX A;  3LAD A;  2HQM A;  3FHN A;  4YSY A;  2CPT A;  3L8K A;  2YR5 A;  2LE8 A;  3PU8 A;  1GQE A;  3LG7 A;  2V7I A;  3ZMU B;  3NRN A;  1I6Z A;  2L8K A;  3HL6 A;  1PN0 A;  2R0C A;  4U2T A;  4KP3 C;  4IDO A;  2YU2 A;  2TMD A;  1RSG A;  3CQC B;  2JAE A;  2WBA A;  5BUK A;  4U2Z A;  4DR2 T;  1N4W A;  4HFI A;  2WU5 A;  3EF6 A;  5DBJ A;  3N5L A;  5F5W A;  4YHH T;  4DR4 T;  5J0Z A;  3UU8 A;  3ZJ2 A;  3ZEF B;  4U2S A;  3EI0 A;  2WAU A;  4O5U A;  1ELI A;  3ZT7 A;  3HYV A;  1S3E A;  2DWK A;  3AYL A;  1E6E A;  4Q4V 4;  3BI4 A;  1REO A;  3FBL A;  2V7M A;  3B3R A;  4PNI A;  4LA1 A;  4AT2 A;  3ADA B;  1WCR A;  4H4X A;  3ALM A;  4JI8 T;  2ZM6 T;  5LJM A;  3T37 A;  2CHN A;  1PVC 4;  1FEB A;  2BDE A;  2YVJ A;  4CZZ B;  3C51 A;  2A72 A;  2W67 A;  5EK4 A;  5L2L A;  3U3I A;  3EAO A;  2R4E A;  1N34 T;  2WOI A;  4U31 A;  4JUY A;  1Q1R A;  2JB1 A;  3IEE A;  4OPT A;  5LV9 A;  3ZC1 A;  3SZW A;  5U1O A;  1NEN A;  3P8C D;  2XFO A;  3S4U A;  5C2T A;  3UTE A;  4A5X A;  4K0K T;  4JBW F;  3ZT5 A;  3CML A;  3NZQ A;  4U3C A;  1GOS A;  2CLY B;  2V26 A;  3P9U A;  2W66 A;  1GND A;  3BI2 A;  3GYJ A;  5KMG P;  2C5J A;  1X79 A;  2XSA A;  4H2P A;  2D2S A;  4E0V A;  1NWM X;  1VBA 4;  1BKW A;  3NKS A;  2B76 A;  4BJY A;  3KDS E;  2IIU A;  1CJ3 A;  2TPR A;  3ICT A;  3KIN B;  2NW7 A;  2GR3 A;  4YTP A;  4QH4 A;  2KLQ A;  2WMO A;  4IE7 A;  2E2A A;  5H6R B;  2PG8 A;  2XFP A;  3FZL B;  4CXX A;  2A3D A;  4YTM A;  2QGS A;  1GRE A;  4UVA B;  2O9Z A;  5ER0 A;  2C67 A;  2XAJ B;  3N9P A;  4X9M A;  5CJ5 A;  3VR9 A;  3AAA B;  3KBT A;  5BVA A;  4J33 A;  2LEH A;  1SHZ C;  2HPJ A;  4F8H A;  4BUR A;  2F4V T;  1F8S A;  2WZH A;  3GMC A;  1W0B A;  5FVL A;  5J1G A;  2DHR A;  3ANW A;  3J9X 1;  2R4J A;  4H4S A;  3ONJ A;  5DQW A;  4N9X A;  3KU9 A;  2H7O A;  4DR1 T;  4H4R A;  4II2 A;  1H84 A;  4KMC A;  2WPF A;  3LK2 B;  4OPD A;  1L9E A;  1ZMC A;  4TM0 A;  1D4C A;  4ZI3 C;  3NKZ A;  4AT0 A;  4EIW A;  5FL1 A;  3AYJ A;  3UQ4 A;  2XFU A;  4EM4 A;  2UXB T;  3C4X A;  3CIR A;  4ZI7 E;  2R06 4;  5AFU L;  2YG5 A;  3I0O A;  1GRH A;  4G63 A;  3CPJ G;  2GF3 A;  3PUQ A;  4C5O A;  4P09 A;  2YDQ A;  1NHP A;  2BS3 A;  1V9D A;  3QK6 A;  4G9K A;  4FI5 A;  3HZL A;  4I4T E;  3RIU A;  2WWU A;  3T2Z A;  3AYI A;  2C3D A;  4ANJ A;  1VBE 4;  2VL8 A;  3AEB A;  2LKH A;  3P4P A;  3NZP A;  4GDP A;  5LOV E;  1LVF A;  4DV5 T;  1F3P A;  1LRZ A;  4U7I A;  4X1K E;  3CTY A;  5IPY A;  3Q9T A;  2W00 A;  2LRL A;  4KHZ F;  2X0H A;  5JCN A;  3CPI G;  2LJL A;  4H4Z A;  1XNR T;  1FMV A;  4O4L E;  4B3M T;  2ACX A;  4K5S A;  3KD9 A;  3L3P A;  2NTY A;  3QC9 A;  5KNL A;  2XVH A;  3NLC A;  5L3C B;  4TN7 B;  2GQW A;  4J57 A;  4EB6 E;  2VVM A;  1DNC A;  4Q4Y 4;  2PJQ A;  2JJ9 A;  3Q6J A;  3VRD B;  3C4N A;  3OJA A;  2BRA A;  3GD3 A;  2XQ4 A;  1MQT D;  4H9N C;  4QKN A;  1XI1 A;  2FJA A;  2C66 A;  3SS1 A;  4UV9 B;  4Z2U A;  2XLS A;  3RYF E;  4H63 V;  4OHF A;  4P9S A;  2H89 A;  3V5S A;  5KMP A;  1X31 B;  4GAV A;  4C74 A;  2Y6R A;  3TLV A;  1N1P A;  2C73 A;  1AJ3 A;  3CNT A;  4PAG A;  4A6N B;  4XZC A;  2V60 A;  3KPK A;  1Z8U A;  5HWY A;  1YY5 A;  1RHI 4;  2R46 A;  2V5D A;  3QSM A;  3LJC A;  3GN5 B;  4PAB A;  2VQE T;  3EDU A;  1OJD A;  2B7R A;  4ILU A;  4NUV A;  1IJH A;  1BR4 A;  3K3O A;  1GEU A;  3AE1 A;  2CXF A;  1ZEE A;  5IQ4 A;  4GYR A;  1D1C A;  4O5Q A;  3C64 A;  2V6Y A;  3VU7 H;  3UKF A;  3A8Y C;  3ATQ A;  3DK4 A;  3OVU A;  1CHU A;  2X9W A;  2B7S A;  4DVD A;  5AQP B;  4Y4N A;  2LSY A;  3K30 A;  2XPK A;  5JR9 C;  4QHO A;  3ZMV B;  3OZ2 A;  4CRT A;  2IAK A;  1NDA A;  3N9Q A;  2YR6 A;  3AE3 A;  5LMU T;  1PS9 A;  3BNU A;  4QWN B;  2BS2 A;  1D0Y A;  1OJA A;  2Z5Y A;  5HXS A;  4UDR A;  2KT9 A;  4EAH A;  4Z8X A;  2XTL A;  4OPG A;  3AD8 B;  3RPU A;  3BK9 A;  3J7Y q;  4U72 A;  4LII A;  2IW5 B;  1LKX A;  3NTD A;  3M0O A;  4BA9 A;  1MXT A;  3PUY F;  5BRT A;  2VVS A;  2AAQ A;  4GDE A;  2XFQ A;  4MLK A;  2C65 A;  2XLT A;  3NRY A;  3JAD A;  1Y0P A;  4GK0 E;  5FVK A;  2HN2 A; 
#chains in the Genus database with same CATH homology
 4RSL A;  2H88 A;  2YLW A;  2QAE A;  2VOU A;  3P4S A;  2CVJ A;  3CPH G;  4GR1 A;  4RG3 A;  3DJJ A;  1B37 A;  3HYX A;  2DKH A;  1W4X A;  2IID A;  1IUX A;  2EQ8 A;  4H2N A;  4A9W A;  5BUL A;  1JOA A;  2A8X A;  2C75 A;  3F8R A;  4YSX A;  4OPL A;  5FS8 A;  2GQF A;  3SFE A;  2J3N A;  3UKH A;  4OPI A;  3CNS A;  2WEU A;  3K7T A;  4OPC A;  3AE2 A;  4JNQ A;  1O5W A;  1MOK A;  3DJD A;  2BRY A;  5KVI A;  1VG0 A;  2Q7V A;  1KDG A;  3H4K A;  3UP5 A;  2EQ9 A;  2GAH B;  4D03 A;  4FX9 A;  2YM2 A;  1CJ2 A;  3UOZ A;  4H4T A;  4YKG A;  3ABV A;  1S3B A;  2OAM A;  1F8W A;  2FJE A;  2GR2 A;  4II3 A;  1DJN A;  3SY4 A;  2C72 A;  1Y56 A;  1GER A;  1DOC A;  3OC4 A;  3UTF A;  1Q9I A;  2Q0K A;  1DOD A;  1NPX A;  1TDF A;  2VVL A;  3M12 A;  3SYI A;  2XDO A;  5GRT A;  1YQ4 A;  1IUW A;  4YSH A;  4X9N A;  1BGJ A;  2YLT A;  3T2Y A;  2WQY A;  4J56 A;  1GTE A;  3GDP A;  1RYI A;  4UP3 A;  4CY8 A;  4U8O A;  4B65 A;  1H83 A;  3DME A;  1DOB A;  4YT0 A;  4GUV A;  3G5R A;  4Z26 A;  2FJD A;  3QFB A;  4Z25 A;  3NIX A;  1ZK7 A;  1K0L A;  3SX6 A;  3UTG A;  3P4R A;  1H86 A;  3KPF A;  4IVM B;  2YG4 A;  3FBS A;  4G74 A;  3ICS A;  4UDQ A;  4B64 A;  4BK3 A;  1CC2 A;  3VRA A;  1P2E A;  3ZDN A;  4H2Q A;  3BI5 A;  4AOX A;  3SXI A;  3VQR A;  4NEW A;  1QLB A;  2XVJ A;  4OCG A;  2F5Z A;  1GRF A;  2JB3 A;  3DA1 A;  3T14 A;  4C77 A;  3AXB A;  3RNM A;  2BS4 A;  1K0J A;  2VRM A;  1K4Q A;  3T31 A;  1PDH A;  2E4G A;  2WES A;  5J7X A;  5U25 A;  3H8I A;  3UKQ A;  4G73 A;  2JK6 A;  1KF6 A;  3NYF A;  4DSH A;  2RGJ A;  3AEC A;  3IWA A;  4G6H A;  4H4Q A;  2YM1 A;  3GD4 A;  4IVO B;  4EMI A;  3QVP A;  1TDN A;  2AQJ A;  2DKI A;  3SGL A;  4YXD A;  1M64 A;  1PHH A;  3SFD A;  3EPT A;  3II4 A;  3V3N A;  4K5R A;  1E1M A;  2WDQ A;  3AE7 A;  4FK1 C;  2GB0 A;  2OAL A;  4X4J A;  4ZCD A;  1FEA A;  4NTE A;  2YLZ A;  2W0H A;  4FK1 A;  2YAU A;  4BK1 A;  3QSE A;  3AE6 A;  1DOE A;  4B63 A;  1E1K A;  1KSS A;  2PHH A;  4I59 A;  4Z2T A;  1TYP A;  2BK5 A;  2QA2 A;  3R9U A;  2BXS A;  2C70 A;  1HYU A;  4IV9 A;  3ZYX A;  5L46 A;  3LAD A;  4KX6 A;  4H50 A;  1TDE A;  2BAC A;  2HQM A;  4IA6 A;  2A87 A;  3AWI A;  1LV0 A;  3NK1 X;  4NTC A;  3F8P A;  3T0K A;  4YSY A;  3IC9 A;  3L8K A;  1RP0 A;  3AEG A;  2YR5 A;  3ALJ A;  5CQF A;  3SZ0 A;  3NRN A;  3LB8 A;  3BNM A;  5FS9 A;  4I58 A;  1PN0 A;  2BYB A;  2R0C A;  1FOH A;  2WP5 A;  2XFN A;  3C96 A;  4U2T A;  5HYM A;  2ZZ0 A;  1COY A;  5KVH A;  1PBF A;  2TMD A;  1RSG A;  2GRT A;  1CJ4 A;  2JAE A;  3VR8 A;  2WBA A;  1GSN A;  4TM4 A;  4USQ A;  4B66 A;  4BJZ A;  1N4W A;  5BUK A;  5JCI A;  1IUT A;  2GMH A;  2WU5 A;  3COX A;  3LJP A;  3EF6 A;  4ZN0 A;  5DBJ A;  3UOV A;  5KOW A;  3GWF A;  3IHG A;  4U2S A;  5EB4 A;  1CL0 A;  4O5U A;  4TLX A;  1ELI A;  3GRT A;  1VQW A;  3HYV A;  1S3E A;  4U8I A;  1OJC A;  4EIQ A;  3H8L A;  3AYL A;  3HYW A;  1E6E A;  4XWZ A;  1FCD A;  2V5Z A;  3BI4 A;  1REO A;  2A89 A;  4G6G A;  4J2W A;  3B3R A;  2ACZ A;  2GEW A;  2EQ7 A;  2YVG A;  4LA1 A;  2RAB A;  4AT2 A;  3ADA B;  1XHC A;  4C3X A;  4H4X A;  3ALM A;  2YG6 A;  3ISH A;  1H7W A;  4CY6 A;  2R0G A;  3T37 A;  3UKP A;  1EBD A;  3CNP A;  4EQW A;  5KMQ A;  3QJ4 A;  5KMS A;  1GRB A;  2C4C A;  1H82 A;  2Q6U A;  4NEV A;  1GRG A;  2WOV A;  1QO8 A;  3E1T A;  1TDK A;  3UP4 A;  1FEB A;  2YVJ A;  2V6O A;  2IVD A;  4CCQ A;  2JKC A;  3EAO A;  2OLN A;  1YKJ A;  2R4E A;  2WOI A;  3QSS A;  3I3L A;  1K0I A;  5GSN A;  1CJC A;  3BHF A;  1JEH A;  2B9W A;  1Q1R A;  1EL7 A;  2C3C A;  2JB1 A;  4ICY A;  2LFC A;  4OPT A;  5EB5 A;  5LV9 A;  3SZW A;  1NAA A;  5U1O A;  3T2K A;  1NEN A;  3NG7 X;  1L9C A;  1L0V A;  2XFO A;  1JNR A;  4H4W A;  4JN9 A;  5C2T A;  2WOW A;  4J34 A;  3UCL A;  5JCL A;  4YSZ A;  3UTE A;  3QFA A;  3UKA A;  1L9D A;  3I6D A;  2VQ7 A;  3AE9 A;  2WU2 A;  1IUS A;  1BF3 A;  1MO9 A;  4YKF A;  1V59 A;  1FL2 A;  1GOS A;  2CUL A;  4J36 A;  4MJW A;  1PJ6 A;  5FMH A;  3NK2 X;  1GET A;  1KSU A;  1QJD A;  2X8H A;  3GMB A;  5EOW A;  4ZCC A;  2X8G A;  3NHO X;  4C3Y A;  3P9U A;  1GND A;  3BI2 A;  5KMR A;  2ARD A;  3GYJ A;  4WX1 A;  4H2R A;  1M6I A;  1Q1W A;  3NTA A;  3NYE A;  4U8K A;  4A7A A;  1NHR A;  3FIM B;  4A65 A;  1FEC A;  3DGH A;  4Y4L A;  3RHA A;  4H2P A;  3P1W A;  2I0Z A;  4E0V A;  2C64 A;  5CKU A;  1UKV G;  2B9Y A;  1LQU A;  4NWZ A;  1XAN A;  3SM8 A;  2QCU A;  1GRA A;  4H4P A;  1BKW A;  3NKS A;  2B76 A;  4BJY A;  4EQR A;  3RP8 A;  1GPE A;  1H81 A;  2JBV A;  1CJ3 A;  2TPR A;  1N4V A;  3ICT A;  4U8L A;  2WP6 A;  3KKJ A;  3PO7 A;  2GR3 A;  4YTP A;  2APG A;  1ZOY A;  2BAB A;  2XFP A;  3GDN A;  2YG3 A;  3NYC A;  1PXA A;  3C4A A;  3IF9 A;  4OVI A;  4YTM A;  3DJE A;  1GRE A;  4XWR A;  2O9Z A;  5ER0 A;  4EQS A;  2C67 A;  3GQH A;  3SUC A;  2XVE A;  4X9M A;  3VR9 A;  1JRY A;  4WCT A;  5BVA A;  3FPZ A;  4J33 A;  4NTD A;  3K7M X;  1BZL A;  2XLR A;  3UKL A;  5C3J A;  3CGD A;  4BUR A;  2CDU A;  5M10 A;  1F8S A;  3GMC A;  3AEF A;  4TM3 A;  1PJ5 A;  3S61 A;  1XPQ A;  1ZY8 A;  1YQ3 A;  1D5T A;  1Z6L A;  2GV8 A;  2R4J A;  3FG2 P;  1BGN A;  4H4S A;  4U2L A;  3URH A;  3ITJ A;  1GV4 A;  1TYT A;  5KXJ A;  2JB2 A;  4N9X A;  4Z44 A;  2FJB A;  2YLX A;  3KU9 A;  4H4R A;  4EQX A;  4II2 A;  1H84 A;  4K7Z A;  1NEK A;  3RP7 A;  2WDV A;  2WPF A;  2X99 A;  4EM3 A;  4B69 A;  1H7X A;  1E1N A;  4GRT A;  3F8D A;  4B68 A;  3FMW A;  2BCG G;  2E5V A;  4CBQ A;  1IUV A;  1S2Y A;  2GR1 A;  2V3B A;  1ZP0 A;  1E1L A;  1L9E A;  1ZMC A;  4OPD A;  4TM0 A;  2EQ6 A;  4Z2R A;  1D4C A;  4IA5 A;  3DGZ A;  3AEE A;  4NNJ A;  4AT0 A;  3RP6 A;  2Q0L A;  3KVE A;  5J60 A;  3AE4 A;  3AYJ A;  5HHF A;  2WS3 A;  1ZOV A;  2XFU A;  4EM4 A;  3CIR A;  2GAG B;  2ZBW A;  2VVL G;  3JSK A;  3K7Q X;  2CFY A;  2YG5 A;  1GRH A;  4A99 A;  3CPJ G;  4U8M A;  2GF3 A;  1ZKQ A;  3CNJ A;  4C5O A;  1OJ9 A;  2X50 A;  1NHP A;  2BS3 A;  5FS7 A;  3B6D A;  4G9K A;  3V76 A;  3HZL A;  1AOG A;  3ALL A;  1ZMD A;  5IQ1 A;  1NG3 A;  1NHS A;  3AE5 A;  4FDC B;  2WPC A;  4GAP A;  4REK A;  4CNJ A;  3SZC A;  3T2Z A;  1VG9 A;  3AYI A;  1GES A;  2C3D A;  4JDR A;  2ZZB A;  4KPR A;  1ZDL A;  4U8N A;  4PAA A;  4EMJ A;  4H4U A;  2OLO A;  3AEB A;  5HXI A;  3P4P A;  3DJG X;  4EMW A;  1NHQ A;  3LZX A;  4D04 A;  4GDP A;  3G5S A;  2XCG A;  1F3P A;  1JU2 A;  3D1C A;  1PXB A;  1DJQ A;  1O94 A;  2BK4 A;  2B9X A;  2XLP A;  3CTY A;  5IPY A;  1PBC A;  2V3A A;  2RGO A;  3Q9T A;  4HB9 A;  1CC6 A;  4YTN A;  3NN6 X;  1LJ1 A;  3CGB A;  3SQP A;  3GWD A;  2R0P A;  5JCN A;  2WDR A;  3CPI G;  4H4Z A;  3PS9 A;  3AD7 B;  3CGC A;  3PVC A;  1PBB A;  3AED A;  1Y56 B;  3DK8 A;  3GSI A;  5TR3 A;  1GRT A;  2ZZC A;  4K5S A;  3KD9 A;  4NZH A;  2RGH A;  3S5W A;  3D8X A;  1JRX A;  5KNL A;  2X8C A;  2XVH A;  3AEA A;  3NLC A;  3NH3 X;  4JY3 A;  3CN8 A;  2GQW A;  3LXD A;  3LZW A;  4J57 A;  4OPU A;  2VVM A;  4K2X A;  1DNC A;  2VZ2 A;  2GH5 A;  4Y4M A;  1DXL A;  1EL8 A;  1O95 A;  2C76 A;  4APN A;  2R45 A;  3Q6J A;  3QVR A;  4H4Y A;  3UTH A;  2XYO A;  1B8S A;  3C4N A;  3VRD B;  4CNK A;  5HY5 A;  2BCP A;  1JNZ A;  2BRA A;  3GD3 A;  4U8J A;  1GAL A;  1XDI A;  2C7G A;  2FJA A;  3O0H A;  5EBK A;  2C66 A;  4JY2 A;  3EAN A;  3KA7 A;  4Z2U A;  2XLS A;  1SEZ A;  3UKK A;  1KNR A;  3KLJ A;  4P9S A;  4ECH A;  3P4Q A;  2H89 A;  2R9Z A;  4K8D A;  2YLS A;  3RED A;  5KOX A;  2XVI A;  5KMP A;  1X31 B;  4GAV A;  2WET A;  4C74 A;  1GT8 A;  4USR A;  5JCM A;  4TM1 A;  1EL9 A;  2Y6R A;  2BK3 A;  1CC4 A;  3NT6 A;  3GYI A;  1BWC A;  3UOY A;  1N1P A;  3GQK A;  4GF7 A;  2WPE A;  2OA1 A;  1D4D A;  1KFY A;  2C73 A;  1CF3 A;  1LPF A;  3NGC X;  3CNT A;  4XXG A;  4YWO A;  2NPX A;  4ADW A;  4A6N B;  1B5Q A;  1D4E A;  2V60 A;  1S2Q A;  2YG7 A;  3KPK A;  3LOV A;  2BC0 A;  1B4V A;  2QA1 A;  3AB1 A;  1LVL A;  1EL5 A;  1YY5 A;  4TLZ A;  3AE8 A;  2R46 A;  1D7Y A;  3QSM A;  4HA6 A;  1LTX R;  4DGK A;  4PAB A;  2GVC A;  2IVE A;  2YVF A;  2X3N A;  5JCK A;  1OJD A;  2WHD A;  2B7R A;  4GCM A;  1VDC A;  1PXC A;  4JNA A;  1E39 A;  3AD9 B;  4Z24 A;  4A6N A;  4A79 A;  4Z43 A;  3GRS A;  4RG4 A;  2E1M A;  3WE0 A;  1IJH A;  1N4U A;  1TRB A;  4M52 A;  1GEU A;  3AE1 A;  1D7L A;  1F8R A;  3V3O A;  5IQ4 A;  5KRQ A;  2VQB A;  1P2H A;  2YLR A;  2Z5X A;  4O5Q A;  1PBD A;  1GTH A;  3UKF A;  3DK9 A;  2PYX A;  2WP9 A;  1VRQ B;  3ATQ A;  3DK4 A;  4JQ9 A;  1E7P A;  4H7U A;  1CHU A;  3NNE A;  4AP1 A;  1PBE A;  2XLU A;  3G5Q A;  4AOS A;  2B7S A;  3VRB A;  3M13 A;  4Y4N A;  3CGE A;  3GYX A;  1GXF A;  3K30 A;  1TDO A;  4J31 A;  1KNP A;  1ZX9 A;  2Y6Q A;  2GR0 A;  4DSG A;  2UZZ A;  3OZ2 A;  4B1B A;  2BA9 A;  1PJ7 A;  1NDA A;  2YQU A;  4K22 A;  4CRT A;  4A5L A;  2YR6 A;  3AE3 A;  1PS9 A;  4DNA A;  1H6V A;  4BV6 A;  2YR4 A;  3CMM A;  3NK0 X;  3BNU A;  3NN0 X;  2FBW A;  2BS2 A;  4BK2 A;  3IHM A;  3SZF A;  2XVF A;  1OJA A;  2Z5Y A;  5U63 A;  4B67 A;  4UDR A;  2BXR A;  3UOX A;  5KWF A;  1LQT A;  3ICR A;  5FS6 A;  4EIP A;  4LU6 A;  2YWL A;  3ATR A;  4OPG A;  2VRL A;  3AD8 B;  1CBO A;  4AP3 A;  4LII A;  1YQZ A;  2GMJ A;  3NTD A;  1NG4 A;  3M0O A;  3CND A;  1OJT A;  1IUU A;  1MXT A;  1ONF A;  4U8P A;  5BRT A;  2AAQ A;  4GDE A;  3BHK A;  2XFQ A;  2V61 A;  2BC1 A;  2C65 A;  2XLT A;  5M0Z A;  1JRZ A;  4H4V A;  2AR8 A;  2NVK X;  4UDP A;  4CCR A;  1Y0P A;  3L1R A;  1F6M A;  3DH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...