5C3JA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 216
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c3jA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c3jA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c3jA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c3jA04
5LV9A 3AWIA 3ZYXA 3UKPA 2C67A 4IA6A 3D8XA 2VQ7A 2GV8A 3FIMB 3DMEA 2E1MA 3UKFA 1Y56A 3ICSA 3GDNA 3B6DA 5JCKA 3O0HA 4BURA 3NK0X 3NYFA 4B65A 1DODA 2YVGA 1GXFA 2IVDA 4K2XA 4PABA 4IV9A 1H6VA 2B9XA 1TDEA 3ALMA 3NHOX 4J56A 4EMJA 1TDFA 3UOVA 4GRTA 2BS2A 4KPRA 3EANA 3G5QA 4YSZA 1JNRA 2FJAA 3AECA 1L0VA 3GD3A 3OZ2A 5CKUA 3R9UA 4RG3A 1GTEA 4BJYA 3H8IA 3FG2P 3ICTA 3BNUA 3ZDNA 1S3EA 2C66A 3NG7X 4LA1A 2O9ZA 5KVHA 3NK1X 3UOZA 5FS6A 1JRYA 2WP6A 2GR0A 2FJEA 3SUCA 3PVCA 2WOWA 1ONFA 2BC1A 1OJDA 2JAEA 1GRGA 4CNJA 1GTHA 2GR2A 2V61A 4NZHA 4YKGA 4J34A 4C5OA 4U2SA 1NHQA 4O5QA 1GRBA 1SEZA 1OJ9A 3JSKA 4HB9A 1D7LA 3CNSA 2XFNA 3AEBA 1PBEA 4J57A 4B66A 3CPIG 2JBVA 4H4RA 4YXDA 3Q6JA 4EQXA 2EQ6A 3LOVA 1KNPA 1XHCA 2YLXA 3UTFA 4B1BA 1TDKA 1TDNA 2BABA 2R45A 2BS4A 2C70A 3GMBA 3P4SA 1GRFA 2BXRA 4I58A 3ATRA 3URHA 2XVJA 1CBOA 1ZMCA 4I59A 1N4WA 3ALLA 5M10A 2C64A 3FBSA 4GCMA 1K4QA 4B68A 4OPTA 4A7AA 4H2NA 3AD9B 3NGCX 1CL0A 3C4AA 2YG6A 3GSIA 4ZCDA 5KOXA 2WOIA 1CJ2A 4YSYA 3REDA 3CNDA 4YSXA 4TLZA 1IUVA 1XANA 4P9SA 3UOXA 2I0ZA 3EF6A 3RP8A 3KA7A 3HZLA 3I6DA 2VVMA 4BK3A 1EL5A 3NYCA 4TM1A 4OPCA 3EPTA 3GRSA 1PS9A 2GAHB 3II4A 2XCGA 3CTYA 3B3RA 5HY5A 3BNMA 2OALA 1B4VA 2BYBA 3AEGA 3NYEA 4EQSA 1ZOVA 5GRTA 1DXLA 5TR3A 3KVEA 2E4GA 1GT8A 1BF3A 2C75A 4OPDA 1YQZA 3NT6A 1LTXR 2BA9A 3BI5A 1EL9A 2OLNA 4Z2UA 2A87A 2RABA 2WOVA 3BI2A 3NTDA 3G5SA 2BXSA 3ICRA 3K30A 3NKSA 3KD9A 4Z43A 1OJTA 3IHGA 3LZXA 4OPIA 2FJBA 1NENA 4H4PA 4YWOA 4A6NB 1N1PA 4XXGA 2YR5A 4A65A 3K7MX 2F5ZA 2R0GA 3CN8A 5EB5A 4NTCA 4DNAA 2C3CA 4USQA 2GF3A 3AXBA 4OPLA 4U8KA 3BHFA 1PXBA 1E1MA 2B76A 1GESA 5JCMA 1BKWA 4J33A 2WP9A 2WPFA 2GQWA 2YAUA 2WBAA 1PBCA 5KOWA 1P2HA 4YTMA 1TRBA 2A89A 4DSHA 2XLRA 1S3BA 3E1TA 2E5VA 4PAAA 3K7TA 1ZMDA 4U2LA 1IUUA 4H4VA 2DKIA 4H4YA 3GYXA 3IWAA 5CQFA 3AEEA 3ADAB 4U8OA 1H83A 2X8GA 2GQFA 2AAQA 3COXA 3UP5A 2R4JA 2V3BA 1IUSA 3QSEA 3VRBA 3KPFA 2V60A 2QA2A 1IUWA 3WE0A 3L1RA 1B8SA 1CC6A 2RGOA 2V3AA 4JQ9A 3QFAA 2C73A 2BCPA 2X8CA 1JRXA 4H4UA 1GRTA 1YY5A 3AE1A 2CDUA 1PBDA 1W4XA 3BHKA 3AEAA 4NEVA 4O5UA 3VRDB 1ZOYA 4X4JA 3AE3A 2XLSA 3V76A 4UDQA 1GV4A 3AE5A 1E7PA 2WU5A 3CGCA 2XFOA 4LIIA 1NPXA 3UCLA 1D4DA 1NAAA 4MJWA 4TM3A 1TDOA 3RP6A 3DK4A 4XWZA 4AP1A 1YQ3A 1D4CA 3QVRA 2BK4A 1NG4A 1NG3A 3ITJA 5FS7A 2BCGG 2YVFA 4ECHA 2B9YA 2RGHA 5BUKA 5IPYA 5L46A 4Y4NA 1NHRA 3I3LA 1Y56B 2JB3A 3UKQA 4B69A 1QLBA 4Z2TA 5KXJA 5J60A 2ACZA 3RHAA 3AYJA 1E6EA 1H84A 2X8HA 1GETA 3GDPA 3P4QA 2R4EA 2GRTA 3KLJA 3IHMA 2RGJA 4A79A 1DOBA 1E39A 1PBFA 4Z24A 4GDEA 1PXAA 1GSNA 3C96A 2R0CA 4YTPA 2Z5YA 4UP3A 2WPEA 5EBKA 2FJDA 3NLCA 4YTNA 1D7YA 3AE7A 4EQRA 1CC2A 1JEHA 2Y6QA 1GEUA 2YM2A 3GWFA 4TM4A 3S5WA 4GR1A 3RP7A 4C77A 4LU6A 1L9EA 1OJCA 2YM1A 4ZN0A 3NK2X 2CULA 5IQ4A 2GVCA 3Q9TA 4FDCB 4A99A 2JB2A 3KU9A 4JY2A 4EIQA 1GERA 2AQJA 4NTDA 2EQ8A 4NTEA 1M64A 3LB8A 2X50A 1KDGA 1GRHA 3CGEA 3P1WA 1E1LA 1REOA 2Z5XA 5FS8A 1O95A 1VDCA 3NRNA 4KX6A 1B5QA 4JN9A 4U8JA 1OJAA 1KFYA 3LJPA 4CRTA 1DNCA 4IA5A 4K5RA 3SQPA 2XFQA 4OVIA 4GDPA 1N4VA 1N4UA 1HYUA 4ZCCA 1CJCA 3DH9A 4H4SA 2J3NA 1FCDA 5GSNA 4C3YA 2YR4A 1CJ4A 4J36A 4K7ZA 3H4KA 5U1OA 3AE2A 3NIXA 4H2PA 3RNMA 4Z26A 3NN6X 2VRLA 1DOEA 4UDPA 5KVIA 2XDOA 4JNAA 2XVFA 1PJ6A 2WDRA 2R0PA 3AE6A 2V6OA 5J7XA 1NHSA 3DK9A 4H4TA 3AE4A 2ARDA 1BWCA 3CPJG 2GEWA 1TYPA 2FBWA 1TYTA 2WETA 4U8NA 4A6NA 1ZY8A 2XLPA 4U8MA 4U2TA 2YVJA 3IC9A 2GMJA 4ADWA 3SFEA 4IVMB 4AP3A 4C74A 1ZDLA 4U8LA 4M52A 1F3PA 1ZX9A 2VVLA 4Y4LA 3EAOA 3GWDA 4AOSA 4YSHA 3UKAA 1CC4A 1D5TA 4N9XA 3T37A 2QA1A 4GF7A 4APNA 3PO7A 2UZZA 2H88A 3P9UA 1RSGA 2JB1A 2XLUA 3G5RA 1BZLA 3AEFA 4Z2RA 3UKHA 2YLZA 4FK1A 2XFUA 2B7SA 2Q6UA 1JOAA 4UDRA 1PN0A 1JNZA 2EQ9A 3QJ4A 3QSMA 1GALA 3LZWA 1XDIA 2R46A 4AT2A 3AD7B 1ZK7A 4K22A 4E0VA 1H7XA 4H4XA 2C7GA 1KNRA 1D4EA 3F8DA 4H2QA 1FECA 5M0ZA 3GQHA 1M6IA 5BRTA 2WQYA 3IF9A 2YG3A 4JDRA 4C3XA 2X3NA 2WEUA 1NHPA 4EM4A 4RSLA 2C65A 5KRQA 3AEDA 1RYIA 1LJ1A 3BI4A 4B63A 1JRZA 1V59A 2B9WA 4CY8A 3S61A 1LQTA 1LVLA 3CNTA 4JY3A 1EL7A 2VVLG 2EQ7A 4YT0A 5BULA 3GMCA 2R9ZA 4RG4A 5HHFA 4CY6A 5DBJA 2GAGB 1H81A 3L8KA 2WS3A 2YG5A 2ZZ0A 3NN0X 4ICYA 4EMWA 1GOSA 1L9DA 2GR1A 1F8SA 1BGJA 3F8PA 5EOWA 1L9CA 2TPRA 2NVKX 2YLSA 4D04A 2YQUA 4Z25A 4BV6A 1LV0A 1CJ3A 1PJ5A 4A5LA 2HQMA 2A8XA 3CGDA 2YG7A 2VRMA 4J2WA 2ZZCA 2OA1A 4FK1C 3GQKA 1Z6LA 3M0OA 2OLOA 2ZBWA 3D1CA 5C3JA 3AYLA 1S2YA 3ALJA 2V5ZA 1K0LA 3UKKA 4B64A 2XYOA 1JU2A 4USRA 2GB0A 2B7RA 3GYJA 3NTAA 4YKFA 4H7UA 4K5SA 4CNKA 2Q0KA 5ER0A 1ELIA 3V3OA 2Y6RA 1O5WA 1UKVG 4DGKA 5U63A 5IQ1A 3DA1A 1PDHA 2GMHA 3P4RA 1MXTA 3VR8A 4Y4MA 3CGBA 4Z44A 2C72A 4CCQA 1COYA 3AD8B 5U25A 2WU2A 1E1KA 1QJDA 3DJGX 4HA6A 4BJZA 4A9WA 2YLTA 4U8PA 1O94A 3OC4A 2XFPA 2WHDA 2X99A 1KSUA 1DJNA 5EB4A 1GPEA 3LXDA 1BGNA 4EQWA 2Q7VA 3PS9A 1IJHA 1VG9A 1NDAA 2OAMA 2GR3A 4BK1A 5JCLA 1H86A 1YKJA 1LPFA 5JCIA 3ISHA 5FMHA 1PHHA 3SFDA 2QCUA 3CIRA 2TMDA 2BK3A 3M13A 4AT0A 4BK2A 1H7WA 3SM8A 2BK5A 3K7QX 1KSSA 3DK8A 1ZKQA 2VOUA 1DOCA 1VG0A 1E1NA 5KWFA 3QFBA 1IUXA 2NPXA 2XVIA 2YLWA 2WDVA 2YG4A 1H82A 1AOGA 3H8LA 1Y0PA 2XVHA 4GUVA 4OPGA 1NEKA 2WP5A 1GRAA 2BS3A 2YWLA 5FS9A 2JK6A 3NNEA 2CVJA 4AOXA 1F6MA 2APGA 5BVAA 4OPUA 3FPZA 4TM0A 3UOYA 2LFCA 1RP0A 3M12A 1FOHA 1S2QA 3UTGA 1EL8A 4REKA 1LQUA 1CF3A 3DJDA 4K8DA 1K0JA 1VQWA 4TLXA 4H2RA 4WCTA 3ABVA 5JCNA 1B37A 4WX1A 1Q1RA 3DGZA 2W0HA 3AYIA 3GD4A 3C4NA 2ZZBA 4EIPA 3QSSA 2JKCA 3LADA 1DJQA 1FL2A 1XPQA 4DSGA 3AE8A 2WESA 2C3DA 4NEWA 4XWRA 3KKJA 1GREA 2CFYA 3DJJA 3NH3X 2BC0A 3UP4A 1ZP0A 3ATQA 2VQBA 5HXIA 1QO8A 3CNJA 1GNDA 2WPCA 2PHHA 3SGLA 1YQ4A 3VRAA 1IUTA 2QAEA 3DJEA 4IVOB 2VZ2A 3VQRA 1K0IA 4X9NA 4H4ZA 4D03A 1KF6A 2WDQA 2IIDA 4JNQA 1P2EA 5C2TA 3VR9A 2BACA 1Q9IA 3GYIA 1MOKA 4H50A 1EBDA 1PBBA 2IVEA 2DKHA 1F8RA 5HYMA 1PJ7A 2AR8A 4H4WA 1FEAA 1Q1WA 4OCGA 4CBQA 4X9MA 3UKLA 3UTEA 4U8IA 1FEBA 4CCRA 3CNPA 2Q0LA 3GRTA 2YLRA 2YR6A 4J31A 2H89A 4EMIA 1CHUA 1F8WA 2C76A 3DGHA 3V3NA 2XLTA 1VRQB 4H4QA 3FMWA 3UTHA 4FX9A 3AE9A 2PYXA 4B67A 2XVEA 3QVPA 3CPHG 3F8RA 4EM3A 3AB1A 3P4PA 2GH5A 1MO9A 1PXCA 1X31B
chains in the Genus database with same CATH superfamily
5HAXA 3W15B 1IJ6A 2NWBA 2XJ7A 5ABGA 3ZYXA 1HF8A 3UFGA 3RH3A 5JRCB 1OXZA 3DMEA 1VCSA 3ZPOA 2RM24 4CN4A 4QX8B 1GXFA 4K2XA 4IV9A 1H6VA 2B9XA 4HFHA 1TDEA 1TDFA 3UOVA 1SHZC 2BS2A 3SX6A 3EANA 3G5QA 3ZC1A 4FJOA 3R9UA 4HWFA 1Y64B 1VBB4 4BJYA 3H8IA 1JRYA 1UGOA 2FJEA 3PVCA 2BC1A 2JAEA 1OJDA 2ODUA 4G63A 5J0ZA 2XUEA 2R044 2C5IT 1LVKA 3JSKA 1D7LA 3CNSA 3UTKA 2EHOD 4QXHB 4B66A 2JQKA 4G6GA 4EQXA 3LOVA 2VVNA 1KNPA 3H37A 4ZI3C 3UTFA 4ZS2A 2LHNA 1TDNA 5L4EA 2R45A 2BS4A 3ATRA 1CBOA 1ZMCA 1X9BA 3FBSA 4LF5T 4B68A 2NTYA 4P09A 2LE8A 1XHXA 4A7AA 3PV0F 1UUSA 3C4AA 1G8XA 1HRI4 2BRYA 5AQTB 2H7VC 2LSJA 4DMVA 2W63A 2E5LT 1CJ2A 3REDA 1SE7A 3SOLA 4UVCB 3CQCB 4P9SA 2NW9A 5EK3A 3EF6A 3I6DA 1EL5A 2IC6A 3OYZA 4ILUA 2XQ6A 2W0GA 2UXNB 2XAHB 3CTYA 3BNMA 3WAKA 2OALA 3NYEA 4TNVA 5LJMA 3R84B 5TR3A 3KVEA 1BF3A 1YQZA 4LF4T 1LTXR 2BA9A 3BI5A 2RABA 3K30A 4Z43A 3IHGA 1NENA 4YWOA 1N1PA 4A65A 1J5ET 2VQFT 2R0GA 1OEDC 2C3CA 4IHJE 3RIFA 2W00A 1MQTD 2WPFA 1HCIA 5J1GA 1PBCA 1UURA 2A89A 2BZBA 3ZCIA 2MBGA 2E5VA 3O1HA 4NUVA 5L2LA 3K3NA 3ZSSA 3NVOA 2ES0A 2H7OA 3AEEA 2K48A 1H83A 2J4GA 3HKCE 2Y6XA 2GQFA 2AAQA 3COXA 3UP5A 2R4JA 3HL6A 2XAQB 4ZOLE 4JEUB 4JYAT 1WR0A 3CK6A 3QFAA 2J47A 1HX8A 2M6IA 4TZ4C 2BCPA 4CN6A 1QUUA 3A7MA 3A8YC 2CBIA 1YY5A 3AE1A 1PBDA 3BHKA 4IIJE 3ZT5A 3AXJA 1NAFA 1XNRT 3AE3A 3V76A 4UDQA 4DMWA 2Y8DA 4ADZA 4UV9B 3AE5A 2EHOB 2GK9A 3JAEA 3UCLA 1D4DA 4HWCA 3RP6A 3UU4A 3ONLC 1VRH4 4E7ZA 2XAJB 2B9YA 5BUKA 5IPYA 3KV5A 4Z2TA 5J60A 2ACZA 1ZHCA 5FMNA 3RHAA 3AYJA 3P4QA 3AXJB 3KLJA 4B3TT 3IHMA 4Z24A 3PUQA 3C96A 4UP3A 3D0TA 1BR2A 3NLCA 1NWMX 2CLYB 1D7YA 2F4VT 1JEHA 5KX5E 4GR1A 2I59A 1OJCA 2WCAA 4FDCB 2IMLA 2JB2A 3DTOA 3PU3A 1GERA 3LB8A 3P1WA 3FBZA 1O95A 2WMOA 1KFYA 4X20E 3UU3A 2XFQA 4GDPA 3DH9A 4H4SA 1QSDA 3RYFE 2J3NA 4C3YA 2YR4A 3RRCA 4PK6A 5ABFB 1ZV4X 1DOEA 1MIVA 2A72A 1NHSA 3DK9A 4H4TA 5LHGB 1FJGT 2MPKA 1TYTA 2WETA 4A6NA 3N9OA 4U2TA 2GMJA 3SFEA 3I0OA 2XSBA 4U8LA 4IL4A 2VVLA 5H6QB 3N5LA 4TX5A 4CQIA 3T1YT 4GYRA 4AOSA 2IUBA 4OFZA 1CC4A 1D5TA 2UZZA 2YDRA 2XLUA 3NRYA 3AEFA 4HWIB 3OTOT 2VKOA 2Q6UA 4LF8T 3C50A 4UDRA 1PN0A 2EQ9A 4PDWD 5GONE 3CX6B 3GMIA 1KNZA 3AD7B 1ZK7A 2N9DA 2CRBA 2ZLYA 1FECA 1M6IA 2V26A 4UF0B 3P4WA 3ZYMA 2YG3A 4JDRA 1HRV4 3O1IA 3UUBA 1LJ1A 4B63A 4CY8A 3B13A 1D1BA 4QKNA 3GWHA 4JY3A 2EQ7A 1WLXA 3JCFA 5BULA 2WSSV 4L5GA 2L9QA 4G9KA 2GAGB 1H81A 3L8KA 2G0UA 4U74A 5L3EB 4EMWA 1GOSA 4EEBA 3O1JA 1L9CA 1R8IA 2YLSA 5LNKA 4A5LA 2A8XA 2UUBT 3CGDA 2ZZCA 2OA1A 4FK1C 3GQKA 1Z8UA 3D1CA 5C3JA 3IHRA 3OBVE 4X1YE 2YK0A 1S2YA 5HCJA 1POV0 1BR0A 4DR2T 4B64A 3K3OA 1JU2A 2XM1A 3NTAA 3UT5E 4TWDA 2XQ8A 1XDOA 1ELIA 3V3OA 2Y6RA 4DR4T 2LRLA 5U63A 1ZEEA 3VR8A 2CXLA 3CGBA 4Z44A 3EDUA 4KBMB 2BVLA 2BG9C 1HFAA 1QJDA 2VKDA 2BDEA 2A2FX 4O4LE 2XFPA 1DJNA 2XQ4A 1GPEA 2Q7VA 1IJHA 4U2ZA 3RYHE 2YOEA 1H86A 3KV9A 1YKJA 1LPFA 5FMHA 4PK4A 2E9XD 1PHHA 1RUD4 3M13A 2BK5A 1XDPA 4DR1T 1YD8G 2VOUA 2XVIA 3T31A 1R084 2JRKA 5J2UE 3H8LA 5KMSA 1V9DA 2D5UA 4OPGA 4A5XA 5L4HA 4X65T 2IC9A 2D2SA 3NNEA 2JQQA 4ZI2C 4AOXA 5BVAA 4HE8A 4LF6T 3UOYA 4G73A 4KHZF 3VKHA 3M12A 1VOMA 4P0AA 1EL8A 1CF3A 5LYJE 3DJDA 5E0OA 4DV7T 3C64A 4NXMT 5KNLA 3TLUA 5JCNA 1B37A 4WX1A 5LGUB 3DGZA 1FMWA 4IDQA 4IE4A 4ZZCA 2X0YA 3J8F4 2BKOA 2CLYC 3QSSA 2JKCA 2LSYA 1M7KA 1AR74 4NEWA 3PUGA 1CUNA 3DJJA 3NH3X 3PU8A 2VQBA 4PJJA 3SGLA 3VRAA 4EYYR 4IVOB 2MTQA 3UQ4A 5FL1A 1RHI4 4AXPA 3SWHA 4BJMA 3GYIA 4H50A 1PIV4 2CXFA 2DKHA 2K3WA 4OCGA 4ZHQE 4X9MA 3NKZA 5LA6E 4DIDB 2DHRA 3Q9DA 5HXEA 1MNDA 3TLWA 2YLRA 4EMIA 1CHUA 3DGHA 2C76A 3OPCA 2XLTA 5AQFB 3FMWA 4IE0A 4FX9A 3AE9A 2PYXA 4B67A 5JREA 2HPJA 4EM3A 3IF9A 2X3NA 1PXCA 5LV9A 3AWIA 2C67A 2QVAA 2UU9T 4IA6A 2GV8A 3NZPA 2VL8A 1Y56A 3GDNA 4Q4V4 3NYFA 4DBRA 4GK5E 3ALMA 5ABEA 3ETVA 4KPRA 2NOXA 3ZT7A 3CQXC 1HG2A 4YSZA 4B3RT 2N2NA 3HKEE 3L8RA 4UEMA 4J2CA 4HTEA 3ZDNA 1S3EA 5KVHA 3NK1X 3UOZA 2HPLA 5FS6A 1AR94 4PW8A 4EV6A 3RIAA 4EIWA 2WOWA 4NUUA 2V61A 4YKGA 4Q4Y4 4U2SA 3JC6C 1NHQA 1G73A 1SEZA 3NWIA 1KEYA 1OJ9A 5JDQA 4I50E 3TKLB 2BRAA 3MK7C 4LF9T 1PVC4 3AEBA 4J57A 4ZI7E 2JBVA 4H4RA 3N2KE 4EB6E 2EQ6A 4GKKT 1XHCA 1ASJ4 3GMBA 3Q5XA 5FXXA 3URHA 3FZHB 4XAXB 2XVJA 4DV3T 2RA1A 3M3ZB 1OEDA 2HH7A 2C64A 4GCMA 3IF8B 4PNIA 1K4QA 3AD9B 4TWFA 3UQ7A 1RVF4 2YG6A 3GSIA 4ZCDA 2WOIA 2N1GA 3CNDA 4CI2B 4EZHA 2LJLA 1IUVA 3UOXA 5L3FB 2LSIA 2FUPA 3KA7A 2EHOA 3NYCA 4OPCA 1J5WA 3GRSA 3II4A 2X0HA 1RUH4 3AEGA 1ZOVA 2E4GA 3NT6A 1RUG4 4QHOA 3IEEA 2KLQA 3BI2A 1YW0A 3G5SA 5AQHB 2BXSA 3ICRA 1OJTA 1OEDB 4U33A 4H4PA 4A6NB 3ZLIA 4XXGA 2YR5A 2IHR1 3CN8A 2P9BA 2AXDS 5FYMA 3KVAA 4OPLA 3DP7A 3BHFA 3AA7B 1GESA 3MJXA 4J33A 4HGAA 2GQWA 4ERRA 4DSHA 4DUYT 5L3BB 2IW5B 2I6HA 3E1TA 5LB7B 1ZMDA 4U2LA 2EX3A 5DQWA 4H4YA 2X68A 2X9HA 5FXZA 2YU2A 4EGWA 2UUCT 4B6XA 3MKDA 3KV4A 1IUWA 3FB2A 2L3LA 5LHIB 2UXXB 4YJ3E 1CC6A 1VBA4 2CM0A 2RGOA 2V3AA 3HKDE 2X8CA 1JRXA 2MYSA 1AR64 3UFEA 4O5UA 3VRDB 4X4JA 2XLSA 4WYVA 3PURA 4JI5T 3T1HT 3SRZA 4EXTA 3CGCA 2XFOA 5IUXA 1NAAA 5DJQC 4M1PA 1YQ3A 1D4CA 2D9DA 1NG4A 1NG3A 3ITJA 4ECHA 3LBXB 2JB3A 3UKQA 4B69A 1QLBA 5FY7A 5KXJA 2QRXA 2XQ3A 4AQFC 3SYIA 2YDSA 3CKDA 1GETA 2GRTA 1DOBA 4GDEA 1EV14 2WB5A 2M6BA 2Z6EA 4UF0A 2Z5YA 2W66A 5EBKA 2FJDA 3C4XA 4JI7T 4U2YA 2VWAA 3RX6A 4DVDA 2Y6QA 1GEUA 3GWFA 2UXCT 4LU6A 5FNVE 2YM1A 3RPUA 5IHYA 3UU6A 2CULA 3NK2X 1T98A 4EIQA 2EQ8A 2VASA 2CHOA 3RLFF 1KDGA 3LSVA 2C5KT 4JLEA 1REOA 5FS8A 4Q25A 1VDCA 3J9X1 3PJAA 4KX6A 4JN9A 2RR14 1OJAA 4F6RC 2YN6A 4K5RA 4X62T 4OVIA 4PJLA 2DL1A 2W2UA 4KHPT 4J36A 4K7ZA 5U1OA 5F5WA 3K1SA 3NN6X 4GYSA 4UDPA 2XDOA 1PJ6A 2R0PA 3BQLA 2FBWA 2ZM8A 4U8MA 4ILBA 3IC9A 2H3RA 2YDQA 1ZDLA 3H3MA 1DU2A 4M52A 3FXEB 1E1HB 1F3PA 1ZX9A 3EAOA 3GWDA 5ETWA 1IBLT 5HXHA 5J2TE 4N9XA 3T37A 4YY3T 4PAGA 4GF7A 4HKAA 4APNA 3PO7A 2H88A 5FKYA 3P9UA 3L09A 2JB1A 1WR6A 3G5RA 4HWDA 2I0MA 2X0LB 3E22E 1S35A 2RS34 4FK1A 5JRCA 4AKHA 4L9IA 5LBQB 4G74A 4AQGA 1U4QA 3QSMA 5FVKA 4AT2A 4CN1A 1HS7A 4MHCA 3F8DA 3ANWB 4H2QA 4CXWA 2WQYA 2CHNA 4TN7B 1D0YA 2WEUA 1RUE4 5KRQA 3AEDA 2IAKA 4WBOA 4QXCB 3RQUA 3FZLB 2B9WA 4Q4W4 3RGLA 2Q9QD 1WFDA 3B5MA 3FZFB 1LVLA 3S61A 3FI7A 5DABA 1EL7A 5LGTB 3QB5K 2LEHA 2R9ZA 4RG4A 2X67A 4ANJA 3PUYF 4H63H 2JQHA 4H9RC 3MZKB 1L9DA 2PY5A 3F8PA 2TPRA 3RI5A 2NVKX 4D04A 3AAEB 2YQUA 1LV0A 1CJ3A 2V7MA 1N34T 4J2WA 2YG7A 1YKHB 3EVYA 1Z6LA 3M0OA 3GA8A 2OLOA 2XYOA 2ODVA 4H7UA 4CNKA 3CX8B 1HG5A 5IQ1A 2W4XA 1PDHA 2GMHA 4Y4MA 4CCQA 5U25A 3DJGX 3AB3B 3B57A 4TNWA 3GN5A 2YLTA 4A9WA 3OC4A 1MIYA 3QOFA 3E08A 5EB4A 3WAJA 2PFVA 1VG9A 1FMVA 5CB4E 1NDAA 4BK1A 2VURA 4HFBA 4DV6T 2XAGB 1MMAA 5LXTE 4DR6T 4PJMA 4K0UA 4AQYT 1FIOA 4G6HA 2JPFA 3CIRA 2TMDA 3I0QA 3SM8A 3ONJA 5H6RB 3I9WA 1ZKQA 2DI4A 1DOCA 5CA0E 3TLSA 2D0TA 3LG7A 2YLWA 3GN5B 4Z90A 2WDVA 5HEUA 2YG4A 1Y0PA 3N9PA 4HFEA 4UV8B 4DV5T 1NEKA 2WP5A 2YWLA 5FS9A 4JEHB 4JUYA 2KMFA 3DJBA 3KVBA 3UUMA 5DQVA 1RP0A 2C4CA 4REKA 3LJCA 4HWHA 5AFUL 4IDPA 4U31A 4H2RA 3PUXF 1D1CA 4GB34 5CGMA 2ZZBA 2DWKA 4EIPA 2QA7A 3Q5EA 1FL2A 1XPQA 3SZWA 1RUJ4 3T14A 1GREA 3RC8A 1K5MD 4HEAA 2WPCA 3N9LA 3DJEA 2VZ2A 4JI3T 3VQRA 3IBPA 2XQ5A 2ZMAA 4JI0T 5L3GB 1KF6A 2IIDA 3VR9A 5C2TA 2BACA 3ZSTA 2V1DB 1T8BA 2IVEA 3SZCA 1F8RA 5JR9C 2AR8A 4LFCT 3UKLA 2W67A 3UTEA 3AA0B 5EZYE 4AI6A 5HEOA 3CNPA 4O4IE 2H89A 5TAOA 1F8WA 4IDZA 4UVAB 3LK42 3UTHA 3RKOA 3QVPA 1W9RA 3P4PA 4B3ST 4GKJT 1X31B 4II3A 3HYVA 2X9YA 3D8XA 2VQ7A 3FIMB 3UKFA 3ICSA 5JCKA 1BR4A 2CA5A 2CWOA 1T72A 1O3XA 3VHLA 3O0HA 4TUYE 3RIUC 2YVGA 4FI5A 5HXCA 2IVDA 4H63V 3NHOX 3TLVA 4GRTA 5LHHB 3GD3A 2FJAA 2ACXA 3AECA 2NW7A 1XHZA 5JDHA 1H8TD 1US7B 5LOVE 3FG2P 3BNUA 3ICTA 3NG7X 2D0UA 4WZXA 2WM9A 4H9OC 2WP6A 3KFWX 2GR0A 2XY8B 5EK4A 3FBLA 1GRGA 4J34A 4O5QA 3EAMA 4LMLA 4PFOA 2CCQA 5IYZE 2XFNA 5AQQB 1PBEA 1EAH4 4IREA 4HFCA 1HTJF 4LMJA 2XZEA 4WBNE 3PTRB 1I6ZA 2KXPB 2BABA 1W0AA 4GIWA 3C4WA 3Q5WA 5M10A 1N4WA 3ALLA 4H2NA 4JV5T 4WNKA 4C90A 2KZ7B 2XQYA 1N36T 1CL0A 2V6YB 1ZKEA 5KMGP 2K9AA 3FHNA 5KOXA 4H9PC 2VKHA 4QH1A 3TLTA 4JI2T 5CJ5A 5AQJB 4TLZA 2LOSA 3UU5A 1XANA 3RP8A 2JQ9A 3HZLA 2KNDA 4P1NA 2VVMA 4BK3A 2UXBT 4TM1A 2VB6A 3Q5DA 4OK0A 1PS9A 4C91A 2HN1A 2XCGA 3LK3B 4I4TE 1XI1A 1B4VA 4EQSA 3X1DA 1B7TA 5GRTA 1DXLA 1GT8A 2C75A 4OPDA 3ZMVB 3NKSA 4ISTA 3KD9A 4Q4X4 4OPIA 2F5ZA 5EB5A 4NTCA 4DNAA 3WI3A 1HX1B 4CI1B 2V6YA 2XASB 3AXBA 4U8KA 1E1MA 4YLHA 3RRWA 1BEV4 1BKWA 5L3CB 4JI1T 2YAUA 2XHEB 5KOWA 1P2HA 2HHHT 4YTMA 3ZMZB 1S3BA 3K7TA 3ZC0A 1OWAA 4BAYB 3I1AA 1IUUA 4H4VA 2DKIA 3JC6D 1VBC4 5CQFA 3SZ0A 4AQFA 5LMUT 4U8OA 3ADAB 4A97A 2BKPA 1WYBA 2JIWA 3PUSA 2V3BA 1IUSA 1COV4 3KPFA 2V60A 2QA2A 3J7Yq 1B8SA 4GK0E 4NWZA 4H4UA 1GRTA 4ILAA 2CDUA 5JH7E 4V1Av 2KINB 2J62A 5FP3A 2HN2A 3S4UA 5L3DB 2E9XA 4LIIA 1NPXA 4YFSA 4TM3A 1TDOA 3PUZF 4KMCA 2BCGG 4DV0T 2YVFA 5L46A 4Y4NA 1NHRA 5JQGE 4ILCA 3ZYKA 5AQMB 1E6EA 2DWGA 5HYAA 2R4EA 2LOPA 4ZEYA 2RGJA 4A79A 4EZ4A 2VVSA 1Z7S4 4QX7B 2X9WA 5ADXL 4UELA 3AE7A 1CC2A 4IGUA 1T7SA 3SXIA 2W61A 4U72A 1WYCA 4AKGA 4C77A 1L9EA 4KI0F 2IIUA 4ZN0A 5IQ4A 3UU8A 2X5ID 3ANWA 3P7IA 3E0ZA 4JY2A 3BQKA 4NTEA 2LM9A 1M64A 2X66A 2X50A 4DV2T 4DR7T 2Z5XA 4U8JA 2V5CA 4OYJA 4CRTA 3LJPA 4TV9E 1DNCA 4IA5A 3SQPA 1W0BA 1GQEA 1N4UA 1PO24 4HN9A 4ZCCA 4EAHA 1CJCA 5AQSB 4F8HA 3NIXA 3RNMA 2BVMA 2VRLA 2M67A 4H9QC 1XMOT 4JNAA 3ZJ1A 2WDRA 2V6OA 5AQKB 3AE4A 2ARDA 1BWCA 4IDNA 3CPJG 2GEWA 1OOPD 4U8NA 2XLPA 2PG8A 2V5DA 3ESLA 3FZMB 4AP3A 5FY1A 3ZT6A 3CWZB 1BR1A 4Y4LA 3H3AA 2LLYA 5FL0A 2QA1A 4ZI3D 1XMQT 3BK9A 5AQOB 5CA1E 1SA0E 3UKHA 4NIQA 3EUHA 3OYXA 2B7SA 2Q9QC 1JOAA 1VBE4 3HKBE 4MBQA 3QJ4A 2X9XA 3ZCJA 3OJAA 2R46A 4E0VA 1H7XA 2UUAT 4H4XA 1D4EA 5JDNA 4H9NC 2YU1A 3ZJ2A 4X1KE 3ZMTB 5BRTA 4BJNA 4C3XA 5CFBA 1NHPA 5IWAT 4RSLA 1RYIA 2BG9A 4WW0A 2OA5A 1V59A 2E2AA 3PUWF 4QH4A 3KINB 1XNQT 2VVLG 4YT0A 3GMCA 1N32T 5HHFA 1W09A 5DBJA 1NA1D 4ICYA 2ZZ0A 2K5BB 1F8SA 1LRZA 4X5TA 1BGJA 5EOWA 4HFIA 4Z25A 4BV6A 2LT3A 2HQMA 3RYCE 2VRMA 5LGNB 1MNEA 2LKHA 2W62A 2V5ZA 4YKFA 2CPTA 4K5SA 2Q0KA 2KT9A 3CX7B 3RYIE 1UKVG 2LRKA 1AJ3A 2BG9B 3DA1A 3P4RA 1MXTA 4I43B 2XTLA 4JI8T 2C72A 2CBJA 1COYA 2YKSA 2WU2A 4HA6A 4BJZA 3K3QC 2XQ9A 5JR9B 1RUI4 1R094 2X99A 1KSUA 4EQWA 3LXDA 1BGNA 5A1LA 1XWMA 2OAMA 2GR3A 3R6NA 3RKGA 5JCIA 3ISHA 1HNXT 5F8PA 3SFDA 2BK3A 4O4JE 4DV4T 1D0ZA 1H7WA 1RUC4 3K7QX 2MOZA 2XPKA 1KSSA 3DK8A 1E1NA 2DNXA 3QFBA 5JR9A 1AOGA 4GUVA 2BS3A 2CWYA 4COFA 1F6MA 3LBXA 2LFCA 3O4XE 2WBLA 2PLV4 1FOHA 5FXVA 1S2QA 3UTGA 2WWUA 3NZQA 4K8DA 1K0JA 1H7CA 5HCMA 4TLXA 2V6XA 5AQNB 2A3DA 4WCTA 3C98B 3ABVA 2R064 4EOZB 3KDSE 1IAPA 4X1IE 2XM2A 2V7LA 4AIUA 3LADA 1DJQA 2IDOB 4DSGA 2C3DA 3P50A 3KKJA 2CFYA 1ZP0A 3KBTA 3RIUA 3ZKRA 3ATQA 5HXIA 1X79A 3L39A 1YQ4A 1IUTA 4U7YA 3ONXA 4UR9A 4D03A 1I94T 3U3IA 4JNQA 2WAUA 2DLRA 5L47A 1Q9IA 1FEWA 1MOKA 1EBDA 5HYMA 2QYWA 4LFBT 1PJ7A 1LVFA 2YEVC 4CBQA 1FEBA 4CCRA 1KK7A 3QUJA 2CE7A 4LF7T 1D1AA 1NCQD 4A56A 3V3NA 3RC3A 4H4QA 4MLKA 3QB5A 3CPHG 4TWHA 3AB1A 4II2A 3CVRA 2GH5A 3KV6A 3B3RA 5KMQA 5ABHA 4IE5A 3SZFA 2V7JA 2LM2A 3UKPA 5KMRA 4QH5A 1UK5A 2E1MA 3A5XA 2C0SA 3B6DA 2XSAA 3KPKA 4BURA 3NBXX 3NK0X 4B65A 1DODA 2ZM2A 4ZXLA 4PABA 4Z8XA 1RMU4 3T0KA 4J56A 4EMJA 3VU7H 5JDLA 5CKUA 1JNRA 1L0VA 1S94A 3OZ2A 3ETUA 4YHJA 1YXRA 4RG3A 1GTEA 4MFRA 3AVRA 5AQVB 5C8YE 4LA1A 2C66A 3AA1B 5JVDE 2O9ZA 4GAVA 4PK5A 3LK2B 3QNUA 5LG3A 4OX9T 3SUCA 1AR84 2YINA 1ONFA 2E9XB 4CNJA 1GTHA 2GR2A 4NZHA 4C5OA 1GRBA 4OHFA 4X64T 4HB9A 2RS54 1HXS4 4I0UA 3K8PC 3L3PA 2KWIB 3HA4A 3CPIG 4YXDA 3Q6JA 1VBD4 2VQET 2YLXA 4B1BA 1TDKA 1YKEB 2LSGA 4L0RA 2C70A 3P4SA 1VRBA 5JDGA 1GRFA 2BXRA 2LKGA 4I58A 4GAPA 5KMPA 2WMNA 2PYJA 4I59A 3F31A 4O4HE 4LFAT 4OPTA 4YHHT 4UVBB 3NGCX 4PJNA 3PUVF 1WCRA 3RF1A 4YSYA 3EDVA 4GOUA 3RQWA 4YSXA 4DNDA 2I0ZA 3CQGB 3PUAA 4A98A 3I9YA 2E8IA 3EPTA 4EYUA 2GAHB 4AKIA 5HY5A 3FXDB 2BYBA 5HEJA 3OKQA 1EL9A 2OLNA 4Z2UA 2A87A 4P0BA 2WOVA 3NTDA 5AQGB 1HNWT 5AQUB 3LZXA 2FJBA 1Z0PA 3K7MX 4NPPA 1PO14 2V8SV 4AKLA 2J1DG 4USQA 3RHWA 2GF3A 3ZMSB 2ZM0A 3JAFA 1PXBA 4ISSA 2B76A 5JCMA 2E9XC 3N2GE 2WP9A 2WBAA 2BBJA 1TRBA 2XLRA 2RPAA 4PAAA 3T2YA 3HYXA 1Y01A 2RP4A 4CXYA 1IBKT 3GYXA 2EHOC 1M62A 1WRDA 3IWAA 2X8GA 3PDYA 3QSEA 5FVLA 4IT4A 1VCTA 1UX5A 3VRBA 2NR4A 3WE0A 3L1RA 2MAWA 4JQ9A 2C73A 3ZN0B 4QWNB 2UXDT 3VKGA 2RMU4 2JJ9A 2NTXA 3HI2A 2KWHA 2PW9A 1W4XA 3AEAA 3MACA 4KP3C 4NEVA 1ZOYA 3FZKB 2HWB4 2V7IA 3V5SA 1GV4A 3G06A 4AISA 3AAIA 1E7PA 3U78A 2WU5A 1IJ5A 3JBG4 4MJWA 2Q9QB 4ZZBA 3DK4A 4XWZA 3EHZA 3NRXA 4AP1A 2VKJA 3QVRA 4DO0A 2BK4A 5FS7A 2RGHA 1UCUA 5KDMC 3I3LA 5LP6E 5HXRA 1Y56B 5AQPB 3SS1A 1H84A 3EABA 4NXNT 2X8HA 3GDPA 4U7IA 5M4YA 1E39A 1PBFA 4IL9A 4B3MT 1PXAA 1GSNA 2R0CA 2WZHA 2X51A 2WY2A 4YTPA 2WPEA 5LJNA 5HXSA 4YTNA 2K24A 4EQRA 4ZS3A 2YM2A 3ZEFB 4TM4A 3S5WA 1J1JA 1EZ3A 3RP7A 2XQ7A 2WZIA 3N9NA 4O2AE 4QXBB 3Q9TA 4KUMB 5JDMA 4A99A 5HEHA 3KU9A 2AQJA 4O8SA 3MA9A 4NTDA 3HYWA 2Q9QA 1IZNB 1GRHA 3CGEA 2C5JA 1E1LA 3IA3A 3NRNA 1B5QA 4XBFB 5EK2A 2CMRA 3ZMUB 1N33T 1N4VA 5AQRB 4NNJA 1HYUA 2DCFA 2WWVA 4CZZB 5GSNA 1FCDA 5FY0A 1CJ4A 2HWC4 5FXWA 3H4KA 3AE2A 4H2PA 4Z26A 4XZCA 5KVIA 4DBQA 4HFDA 4E7SA 2XVFA 3P8CD 3AE6A 5J7XA 4YJ2E 3T8OA 1E2AA 1TYPA 4JBWF 4G2AA 3ZN1B 4BA9A 1ZY8A 2R074 2YVJA 4ADWA 2PZSA 2CXDA 1D4M4 4IVMB 4C74A 4DR5T 4Z91A 4LMKA 4YSHA 3UKAA 2SPCA 1RSGA 2XAFB 1BZLA 4Z2RA 1AL24 2YLZA 4ASKA 2OLTA 2XFUA 1JNZA 4K0KT 4CI3B 1GALA 3LZWA 1XDIA 3OVUA 3O9XA 4K22A 2PBIA 4AKRB 5BMVE 2C7GA 1KNRA 3T2ZA 2XQAA 5M0ZA 3GQHA 4IDOA 2QGSA 4RHV4 4EM4A 2C65A 2ZM6T 3PE0A 2L8KA 3BI4A 3F2EA 3MXZA 5JDFA 1JRZA 3CMMA 3C51A 1LQTA 3CNTA 2VK9A 3M65A 3PJAJ 1MIWA 4UXNB 4CY6A 2WS3A 2YG5A 3NN0X 4U3CA 2GR1A 5LG4A 5HWXA 2OV9A 4DR3T 3N9QA 1PJ5A 3T2KA 1IBMT 1HR0T 2ZBWA 1LKXA 3AYLA 3ALJA 1RUF4 1K0LA 5ABFA 3UKKA 4H9SE 4USRA 2BBHA 2GB0A 3N2OA 2B7RA 3GYJA 5HWYA 4X66T 5ER0A 1O5WA 3UUNA 4DGKA 3ZYLA 3CMLA 4MALA 3AD8B 1U5PA 5LBMA 1E1KA 3UULA 4JI4T 4U8PA 1O94A 2NW8A 1MMDA 4TV8E 2WHDA 3PS9A 4I55E 5JCLA 4ZI2D 2B1EA 4EEDA 3JADA 3F57A 2QCUA 3LDQB 4AT0A 4JI6T 4BK2A 3QC9A 2JMKA 2A9UA 3Q2MA 5HEGA 5F3JA 1VG0A 5KWFA 1IUXA 2NPXA 1H82A 3AA6B 4O2BE 1HNZT 2XVHA 2V7KA 1SUMB 1GRAA 2KSRA 3UUXB 4PFPA 4DV1T 2JK6A 3LFMA 2CVJA 2APGA 2AE9A 2VL0A 1OEDE 2Y48B 3FPZA 4OPUA 4TM0A 3KBUA 1LQUA 1VQWA 2LHRA 3SY4A 1Q1RA 2W0HA 3AYIA 3GD4A 3C4NA 2R6GF 4OYKA 5BR8T 3AE8A 4DUZT 1D0XA 2WESA 4XWRA 3EI0A 2LSKA 2BC0A 3UP4A 3HR0A 5LCYA 2RS14 3C4ZA 1QO8A 3CNJA 1GNDA 2NP9A 2PHHA 5JTGA 1UX4A 3AAAB 2QAEA 4UIGA 1XZYA 1K0IA 4IE6A 4X9NA 4HFVA 2BKNA 4H4ZA 3BQIA 2WDQA 2R7FA 1P2EA 5LMNT 3AVSA 1PBBA 1MMGA 3V5UA 2PTFA 4H4WA 1FEAA 1Q1WA 2PJQA 5AQIB 4U8IA 1MMNA 2PYLA 2Q0LA 3GRTA 4N78D 2YR6A 4J31A 5AQLB 3N9MA 3QK6A 4CXXA 3JD74 3CPZA 1VRQB 2CEAA 2JMHA 2XVEA 2BG9E 4IE7A 3F8RA 2GVCA 1MO9A
chains in the Genus database with same CATH topology
5LV9A 3AWIA 3SZFA 3HYVA 3ZYXA 3UKPA 2C67A 5KMRA 4IA6A 3D8XA 2VQ7A 2GV8A 3FIMB 3DMEA 2E1MA 3UKFA 1Y56A 3ICSA 3GDNA 3B6DA 3KPKA 5JCKA 3O0HA 4BURA 3NK0X 3NYFA 4B65A 1DODA 2YVGA 1GXFA 2IVDA 4K2XA 4PABA 4IV9A 1H6VA 2B9XA 1TDEA 3ALMA 3NHOX 4J56A 3T0KA 4EMJA 1TDFA 3UOVA 4GRTA 2BS2A 4KPRA 3SX6A 3EANA 3G5QA 4YSZA 1JNRA 2FJAA 3AECA 1L0VA 3GD3A 3OZ2A 5CKUA 3R9UA 4RG3A 1GTEA 4BJYA 3H8IA 3FG2P 3ICTA 3BNUA 3ZDNA 1S3EA 2C66A 3NG7X 4LA1A 2O9ZA 5KVHA 3NK1X 4GAVA 3UOZA 5FS6A 1JRYA 2WP6A 2GR0A 2FJEA 3SUCA 3PVCA 2WOWA 1ONFA 2BC1A 1OJDA 2JAEA 1GRGA 4CNJA 1GTHA 2GR2A 2V61A 4NZHA 4YKGA 4J34A 4C5OA 4U2SA 1NHQA 4O5QA 1GRBA 1SEZA 1OJ9A 3JSKA 4HB9A 1D7LA 2BRAA 3CNSA 2XFNA 3AEBA 1PBEA 4J57A 4B66A 3CPIG 2JBVA 4G6GA 4YXDA 3Q6JA 4H4RA 4EQXA 2EQ6A 3LOVA 1KNPA 1XHCA 2YLXA 3UTFA 4B1BA 1TDKA 1TDNA 2BABA 2R45A 2BS4A 2C70A 3GMBA 3P4SA 1GRFA 2BXRA 4I58A 4GAPA 3ATRA 3URHA 5KMPA 2XVJA 1CBOA 1ZMCA 4I59A 1N4WA 3ALLA 5M10A 2C64A 3FBSA 4GCMA 1K4QA 4B68A 4OPTA 4A7AA 4H2NA 3AD9B 3NGCX 1CL0A 3C4AA 2YG6A 2BRYA 3GSIA 4ZCDA 5KOXA 2WOIA 1CJ2A 4YSYA 3REDA 3CNDA 4YSXA 4TLZA 1IUVA 1XANA 4P9SA 3UOXA 2I0ZA 3EF6A 3RP8A 3KA7A 3HZLA 3I6DA 2VVMA 4BK3A 1EL5A 3NYCA 4TM1A 4OPCA 3EPTA 3GRSA 1PS9A 2GAHB 3II4A 2XCGA 3CTYA 3B3RA 5HY5A 3BNMA 2OALA 1B4VA 2BYBA 3AEGA 3NYEA 4EQSA 1ZOVA 5GRTA 1DXLA 5TR3A 3KVEA 2E4GA 1GT8A 1BF3A 2C75A 4OPDA 1YQZA 3NT6A 1LTXR 2BA9A 3BI5A 1EL9A 2OLNA 4Z2UA 2A87A 2RABA 2WOVA 3BI2A 3NTDA 3G5SA 2BXSA 3ICRA 3K30A 3NKSA 3KD9A 4Z43A 1OJTA 3IHGA 3LZXA 4OPIA 2FJBA 1NENA 4H4PA 4YWOA 4A6NB 1N1PA 4XXGA 2YR5A 4A65A 3K7MX 2F5ZA 2R0GA 3CN8A 5EB5A 4NTCA 4DNAA 2C3CA 4USQA 2GF3A 3AXBA 4OPLA 4U8KA 3BHFA 1PXBA 1E1MA 2B76A 1GESA 5JCMA 1BKWA 4J33A 2WP9A 2WPFA 2GQWA 2YAUA 2WBAA 1PBCA 5KOWA 1P2HA 4YTMA 1TRBA 2A89A 4DSHA 2XLRA 1S3BA 3E1TA 2E5VA 4PAAA 3K7TA 3T2YA 3HYXA 1ZMDA 4U2LA 1IUUA 4H4VA 2DKIA 4H4YA 3GYXA 3IWAA 5CQFA 3SZ0A 4II3A 3AEEA 3ADAB 4U8OA 1H83A 2X8GA 2GQFA 2AAQA 3COXA 3UP5A 2R4JA 2V3BA 1IUSA 3QSEA 3VRBA 3KPFA 2V60A 2QA2A 1IUWA 3WE0A 3L1RA 1B8SA 1CC6A 2RGOA 2V3AA 4JQ9A 3QFAA 2C73A 2BCPA 2X8CA 1JRXA 4NWZA 4H4UA 1GRTA 1YY5A 3AE1A 2CDUA 1PBDA 1W4XA 3BHKA 3AEAA 4NEVA 4O5UA 3VRDB 1ZOYA 4X4JA 3AE3A 2XLSA 3V76A 4UDQA 1GV4A 3AE5A 1E7PA 2WU5A 3CGCA 2XFOA 4LIIA 1NPXA 3UCLA 1D4DA 1NAAA 4MJWA 4TM3A 1TDOA 3RP6A 3DK4A 4XWZA 4AP1A 1YQ3A 1D4CA 3QVRA 2BK4A 1NG4A 1NG3A 3ITJA 5FS7A 2BCGG 2YVFA 4ECHA 2B9YA 2RGHA 5BUKA 5IPYA 5L46A 4Y4NA 1NHRA 3I3LA 1Y56B 2JB3A 3UKQA 4B69A 1QLBA 4Z2TA 5KXJA 5J60A 2ACZA 3RHAA 3AYJA 1E6EA 1H84A 3SYIA 2X8HA 1GETA 3GDPA 3P4QA 2R4EA 2GRTA 3KLJA 3IHMA 2RGJA 4A79A 1DOBA 1E39A 1PBFA 4Z24A 4GDEA 1PXAA 1GSNA 3C96A 2R0CA 4YTPA 2Z5YA 4UP3A 2WPEA 5EBKA 2FJDA 3NLCA 4YTNA 1D7YA 3AE7A 4EQRA 1CC2A 1JEHA 2Y6QA 1GEUA 2YM2A 3SXIA 3GWFA 4TM4A 3S5WA 4GR1A 3RP7A 4C77A 4LU6A 1L9EA 1OJCA 2YM1A 4ZN0A 3NK2X 2CULA 5IQ4A 2GVCA 3Q9TA 4FDCB 4A99A 2JB2A 3KU9A 4JY2A 4EIQA 1GERA 2AQJA 4NTDA 2EQ8A 4NTEA 3HYWA 1M64A 3LB8A 2X50A 1KDGA 1GRHA 3CGEA 3P1WA 1E1LA 1REOA 2Z5XA 5FS8A 1O95A 1VDCA 3NRNA 4KX6A 1B5QA 4JN9A 4U8JA 1OJAA 1KFYA 3LJPA 4CRTA 1DNCA 4IA5A 4K5RA 3SQPA 2XFQA 4OVIA 4GDPA 1N4VA 1N4UA 4NNJA 1HYUA 4ZCCA 1CJCA 3DH9A 4H4SA 2J3NA 1FCDA 5GSNA 4C3YA 2YR4A 1CJ4A 4J36A 4K7ZA 3H4KA 5U1OA 3AE2A 3NIXA 4H2PA 3RNMA 4Z26A 3NN6X 2VRLA 1DOEA 4UDPA 5KVIA 2XDOA 4JNAA 2XVFA 1PJ6A 2WDRA 2R0PA 3AE6A 2V6OA 5J7XA 1NHSA 3DK9A 4H4TA 3AE4A 2ARDA 1BWCA 3CPJG 2GEWA 1TYPA 2FBWA 1TYTA 2WETA 4U8NA 4A6NA 1ZY8A 2XLPA 4U8MA 4U2TA 2YVJA 3IC9A 2GMJA 4ADWA 3SFEA 4IVMB 4AP3A 4C74A 1ZDLA 4U8LA 4M52A 1F3PA 1ZX9A 2VVLA 4Y4LA 3EAOA 3GWDA 4AOSA 4YSHA 3UKAA 1CC4A 1D5TA 4N9XA 3T37A 2QA1A 4GF7A 4APNA 3PO7A 2UZZA 2H88A 3P9UA 1RSGA 2JB1A 2XLUA 3G5RA 1BZLA 3AEFA 4Z2RA 3UKHA 2YLZA 4FK1A 2XFUA 2B7SA 2Q6UA 1JOAA 4UDRA 4G74A 1PN0A 1JNZA 2EQ9A 3QJ4A 3QSMA 1GALA 3LZWA 1XDIA 2R46A 4AT2A 3AD7B 1ZK7A 4K22A 4E0VA 1H7XA 4H4XA 2C7GA 1KNRA 1D4EA 3F8DA 4H2QA 3T2ZA 1FECA 5M0ZA 3GQHA 1M6IA 5BRTA 2WQYA 3IF9A 2YG3A 4JDRA 4C3XA 2X3NA 2WEUA 1NHPA 4EM4A 4RSLA 2C65A 5KRQA 3AEDA 1RYIA 1LJ1A 3BI4A 4B63A 1JRZA 1V59A 2B9WA 3CMMA 4CY8A 3S61A 1LQTA 1LVLA 3CNTA 4JY3A 1EL7A 2VVLG 2EQ7A 4YT0A 5BULA 3GMCA 2R9ZA 4RG4A 5HHFA 4CY6A 5DBJA 4G9KA 2GAGB 1H81A 3L8KA 2WS3A 2YG5A 2ZZ0A 3NN0X 4ICYA 4EMWA 1GOSA 1L9DA 2GR1A 1F8SA 1BGJA 3F8PA 5EOWA 1L9CA 2TPRA 2NVKX 2YLSA 4D04A 2YQUA 4Z25A 4BV6A 1LV0A 1CJ3A 1PJ5A 4A5LA 2HQMA 2A8XA 3T2KA 3CGDA 2YG7A 2VRMA 4J2WA 2ZZCA 2OA1A 4FK1C 3GQKA 1Z6LA 3M0OA 2OLOA 2ZBWA 3D1CA 5C3JA 3AYLA 1S2YA 3ALJA 2V5ZA 1K0LA 3UKKA 4B64A 2XYOA 1JU2A 4USRA 2GB0A 2B7RA 3GYJA 3NTAA 4YKFA 4H7UA 4K5SA 4CNKA 2Q0KA 5ER0A 1ELIA 3V3OA 2Y6RA 1O5WA 1UKVG 4DGKA 5U63A 5IQ1A 3DA1A 1PDHA 2GMHA 3P4RA 1MXTA 3VR8A 4Y4MA 3CGBA 4Z44A 2C72A 4CCQA 1COYA 3AD8B 5U25A 2WU2A 1E1KA 1QJDA 3DJGX 4HA6A 4BJZA 4A9WA 2YLTA 4U8PA 1O94A 3OC4A 2XFPA 2WHDA 2X99A 1KSUA 1DJNA 5EB4A 1GPEA 3LXDA 1BGNA 4EQWA 2Q7VA 3PS9A 1IJHA 1VG9A 1NDAA 2OAMA 2GR3A 4BK1A 5JCLA 1H86A 1YKJA 1LPFA 5JCIA 3ISHA 5FMHA 1PHHA 3SFDA 2QCUA 3CIRA 4G6HA 2TMDA 2BK3A 3M13A 4AT0A 4BK2A 1H7WA 3SM8A 2BK5A 3K7QX 1KSSA 3DK8A 1ZKQA 2VOUA 4II2A 1DOCA 1VG0A 1E1NA 5KWFA 3QFBA 1IUXA 2NPXA 2XVIA 2YLWA 3T31A 2WDVA 2YG4A 1H82A 5KMSA 3H8LA 1AOGA 1Y0PA 2XVHA 4GUVA 4OPGA 1NEKA 2WP5A 1GRAA 2BS3A 2YWLA 5FS9A 2JK6A 3NNEA 2CVJA 4AOXA 1F6MA 2APGA 5BVAA 4OPUA 3FPZA 4TM0A 3UOYA 2LFCA 4G73A 1RP0A 3M12A 1FOHA 1S2QA 2C4CA 3UTGA 1EL8A 4REKA 1LQUA 1CF3A 3DJDA 4K8DA 1K0JA 1VQWA 4TLXA 4H2RA 5KNLA 4WCTA 3SY4A 3ABVA 5JCNA 1B37A 4WX1A 1Q1RA 3DGZA 2W0HA 3AYIA 3GD4A 3C4NA 2ZZBA 4EIPA 3QSSA 2JKCA 3LADA 1DJQA 1FL2A 1XPQA 3SZWA 4DSGA 3AE8A 2WESA 2C3DA 3T14A 4NEWA 4XWRA 3KKJA 1GREA 2CFYA 3DJJA 3NH3X 2BC0A 3UP4A 1ZP0A 3ATQA 2VQBA 5HXIA 1QO8A 3CNJA 1GNDA 2WPCA 2PHHA 3SGLA 1YQ4A 3VRAA 1IUTA 2QAEA 3DJEA 4IVOB 2VZ2A 3VQRA 1K0IA 4X9NA 4H4ZA 4D03A 1KF6A 2WDQA 2IIDA 4JNQA 1P2EA 5C2TA 3VR9A 2BACA 1Q9IA 3GYIA 1MOKA 4H50A 1EBDA 1PBBA 2IVEA 2DKHA 1F8RA 3SZCA 5HYMA 1PJ7A 2AR8A 4H4WA 1FEAA 1Q1WA 4OCGA 4CBQA 4X9MA 3UKLA 3UTEA 4U8IA 1FEBA 5KMQA 4CCRA 3CNPA 2Q0LA 3GRTA 2YLRA 2YR6A 4J31A 2H89A 4EMIA 1CHUA 1F8WA 2C76A 3DGHA 3V3NA 2XLTA 1VRQB 4H4QA 3FMWA 3UTHA 4FX9A 3AE9A 2PYXA 4B67A 2XVEA 3QVPA 3CPHG 3F8RA 4EM3A 3AB1A 3P4PA 2GH5A 1MO9A 1PXCA 1X31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LV9 A;  3AWI A;  3ZYX A;  3UKP A;  2C67 A;  4IA6 A;  3D8X A;  2VQ7 A;  2GV8 A;  3FIM B;  3DME A;  2E1M A;  3UKF A;  1Y56 A;  3ICS A;  3GDN A;  3B6D A;  5JCK A;  3O0H A;  4BUR A;  3NK0 X;  3NYF A;  4B65 A;  1DOD A;  2YVG A;  1GXF A;  2IVD A;  4K2X A;  4PAB A;  4IV9 A;  1H6V A;  2B9X A;  1TDE A;  3ALM A;  3NHO X;  4J56 A;  4EMJ A;  1TDF A;  3UOV A;  4GRT A;  2BS2 A;  4KPR A;  3EAN A;  3G5Q A;  4YSZ A;  1JNR A;  2FJA A;  3AEC A;  1L0V A;  3GD3 A;  3OZ2 A;  5CKU A;  3R9U A;  4RG3 A;  1GTE A;  4BJY A;  3H8I A;  3FG2 P;  3ICT A;  3BNU A;  3ZDN A;  1S3E A;  2C66 A;  3NG7 X;  4LA1 A;  2O9Z A;  5KVH A;  3NK1 X;  3UOZ A;  5FS6 A;  1JRY A;  2WP6 A;  2GR0 A;  2FJE A;  3SUC A;  3PVC A;  2WOW A;  1ONF A;  2BC1 A;  1OJD A;  2JAE A;  1GRG A;  4CNJ A;  1GTH A;  2GR2 A;  2V61 A;  4NZH A;  4YKG A;  4J34 A;  4C5O A;  4U2S A;  1NHQ A;  4O5Q A;  1GRB A;  1SEZ A;  1OJ9 A;  3JSK A;  4HB9 A;  1D7L A;  3CNS A;  2XFN A;  3AEB A;  1PBE A;  4J57 A;  4B66 A;  3CPI G;  2JBV A;  4H4R A;  4YXD A;  3Q6J A;  4EQX A;  2EQ6 A;  3LOV A;  1KNP A;  1XHC A;  2YLX A;  3UTF A;  4B1B A;  1TDK A;  1TDN A;  2BAB A;  2R45 A;  2BS4 A;  2C70 A;  3GMB A;  3P4S A;  1GRF A;  2BXR A;  4I58 A;  3ATR A;  3URH A;  2XVJ A;  1CBO A;  1ZMC A;  4I59 A;  1N4W A;  3ALL A;  5M10 A;  2C64 A;  3FBS A;  4GCM A;  1K4Q A;  4B68 A;  4OPT A;  4A7A A;  4H2N A;  3AD9 B;  3NGC X;  1CL0 A;  3C4A A;  2YG6 A;  3GSI A;  4ZCD A;  5KOX A;  2WOI A;  1CJ2 A;  4YSY A;  3RED A;  3CND A;  4YSX A;  4TLZ A;  1IUV A;  1XAN A;  4P9S A;  3UOX A;  2I0Z A;  3EF6 A;  3RP8 A;  3KA7 A;  3HZL A;  3I6D A;  2VVM A;  4BK3 A;  1EL5 A;  3NYC A;  4TM1 A;  4OPC A;  3EPT A;  3GRS A;  1PS9 A;  2GAH B;  3II4 A;  2XCG A;  3CTY A;  3B3R A;  5HY5 A;  3BNM A;  2OAL A;  1B4V A;  2BYB A;  3AEG A;  3NYE A;  4EQS A;  1ZOV A;  5GRT A;  1DXL A;  5TR3 A;  3KVE A;  2E4G A;  1GT8 A;  1BF3 A;  2C75 A;  4OPD A;  1YQZ A;  3NT6 A;  1LTX R;  2BA9 A;  3BI5 A;  1EL9 A;  2OLN A;  4Z2U A;  2A87 A;  2RAB A;  2WOV A;  3BI2 A;  3NTD A;  3G5S A;  2BXS A;  3ICR A;  3K30 A;  3NKS A;  3KD9 A;  4Z43 A;  1OJT A;  3IHG A;  3LZX A;  4OPI A;  2FJB A;  1NEN A;  4H4P A;  4YWO A;  4A6N B;  1N1P A;  4XXG A;  2YR5 A;  4A65 A;  3K7M X;  2F5Z A;  2R0G A;  3CN8 A;  5EB5 A;  4NTC A;  4DNA A;  2C3C A;  4USQ A;  2GF3 A;  3AXB A;  4OPL A;  4U8K A;  3BHF A;  1PXB A;  1E1M A;  2B76 A;  1GES A;  5JCM A;  1BKW A;  4J33 A;  2WP9 A;  2WPF A;  2GQW A;  2YAU A;  2WBA A;  1PBC A;  5KOW A;  1P2H A;  4YTM A;  1TRB A;  2A89 A;  4DSH A;  2XLR A;  1S3B A;  3E1T A;  2E5V A;  4PAA A;  3K7T A;  1ZMD A;  4U2L A;  1IUU A;  4H4V A;  2DKI A;  4H4Y A;  3GYX A;  3IWA A;  5CQF A;  3AEE A;  3ADA B;  4U8O A;  1H83 A;  2X8G A;  2GQF A;  2AAQ A;  3COX A;  3UP5 A;  2R4J A;  2V3B A;  1IUS A;  3QSE A;  3VRB A;  3KPF A;  2V60 A;  2QA2 A;  1IUW A;  3WE0 A;  3L1R A;  1B8S A;  1CC6 A;  2RGO A;  2V3A A;  4JQ9 A;  3QFA A;  2C73 A;  2BCP A;  2X8C A;  1JRX A;  4H4U A;  1GRT A;  1YY5 A;  3AE1 A;  2CDU A;  1PBD A;  1W4X A;  3BHK A;  3AEA A;  4NEV A;  4O5U A;  3VRD B;  1ZOY A;  4X4J A;  3AE3 A;  2XLS A;  3V76 A;  4UDQ A;  1GV4 A;  3AE5 A;  1E7P A;  2WU5 A;  3CGC A;  2XFO A;  4LII A;  1NPX A;  3UCL A;  1D4D A;  1NAA A;  4MJW A;  4TM3 A;  1TDO A;  3RP6 A;  3DK4 A;  4XWZ A;  4AP1 A;  1YQ3 A;  1D4C A;  3QVR A;  2BK4 A;  1NG4 A;  1NG3 A;  3ITJ A;  5FS7 A;  2BCG G;  2YVF A;  4ECH A;  2B9Y A;  2RGH A;  5BUK A;  5IPY A;  5L46 A;  4Y4N A;  1NHR A;  3I3L A;  1Y56 B;  2JB3 A;  3UKQ A;  4B69 A;  1QLB A;  4Z2T A;  5KXJ A;  5J60 A;  2ACZ A;  3RHA A;  3AYJ A;  1E6E A;  1H84 A;  2X8H A;  1GET A;  3GDP A;  3P4Q A;  2R4E A;  2GRT A;  3KLJ A;  3IHM A;  2RGJ A;  4A79 A;  1DOB A;  1E39 A;  1PBF A;  4Z24 A;  4GDE A;  1PXA A;  1GSN A;  3C96 A;  2R0C A;  4YTP A;  2Z5Y A;  4UP3 A;  2WPE A;  5EBK A;  2FJD A;  3NLC A;  4YTN A;  1D7Y A;  3AE7 A;  4EQR A;  1CC2 A;  1JEH A;  2Y6Q A;  1GEU A;  2YM2 A;  3GWF A;  4TM4 A;  3S5W A;  4GR1 A;  3RP7 A;  4C77 A;  4LU6 A;  1L9E A;  1OJC A;  2YM1 A;  4ZN0 A;  3NK2 X;  2CUL A;  5IQ4 A;  2GVC A;  3Q9T A;  4FDC B;  4A99 A;  2JB2 A;  3KU9 A;  4JY2 A;  4EIQ A;  1GER A;  2AQJ A;  4NTD A;  2EQ8 A;  4NTE A;  1M64 A;  3LB8 A;  2X50 A;  1KDG A;  1GRH A;  3CGE A;  3P1W A;  1E1L A;  1REO A;  2Z5X A;  5FS8 A;  1O95 A;  1VDC A;  3NRN A;  4KX6 A;  1B5Q A;  4JN9 A;  4U8J A;  1OJA A;  1KFY A;  3LJP A;  4CRT A;  1DNC A;  4IA5 A;  4K5R A;  3SQP A;  2XFQ A;  4OVI A;  4GDP A;  1N4V A;  1N4U A;  1HYU A;  4ZCC A;  1CJC A;  3DH9 A;  4H4S A;  2J3N A;  1FCD A;  5GSN A;  4C3Y A;  2YR4 A;  1CJ4 A;  4J36 A;  4K7Z A;  3H4K A;  5U1O A;  3AE2 A;  3NIX A;  4H2P A;  3RNM A;  4Z26 A;  3NN6 X;  2VRL A;  1DOE A;  4UDP A;  5KVI A;  2XDO A;  4JNA A;  2XVF A;  1PJ6 A;  2WDR A;  2R0P A;  3AE6 A;  2V6O A;  5J7X A;  1NHS A;  3DK9 A;  4H4T A;  3AE4 A;  2ARD A;  1BWC A;  3CPJ G;  2GEW A;  1TYP A;  2FBW A;  1TYT A;  2WET A;  4U8N A;  4A6N A;  1ZY8 A;  2XLP A;  4U8M A;  4U2T A;  2YVJ A;  3IC9 A;  2GMJ A;  4ADW A;  3SFE A;  4IVM B;  4AP3 A;  4C74 A;  1ZDL A;  4U8L A;  4M52 A;  1F3P A;  1ZX9 A;  2VVL A;  4Y4L A;  3EAO A;  3GWD A;  4AOS A;  4YSH A;  3UKA A;  1CC4 A;  1D5T A;  4N9X A;  3T37 A;  2QA1 A;  4GF7 A;  4APN A;  3PO7 A;  2UZZ A;  2H88 A;  3P9U A;  1RSG A;  2JB1 A;  2XLU A;  3G5R A;  1BZL A;  3AEF A;  4Z2R A;  3UKH A;  2YLZ A;  4FK1 A;  2XFU A;  2B7S A;  2Q6U A;  1JOA A;  4UDR A;  1PN0 A;  1JNZ A;  2EQ9 A;  3QJ4 A;  3QSM A;  1GAL A;  3LZW A;  1XDI A;  2R46 A;  4AT2 A;  3AD7 B;  1ZK7 A;  4K22 A;  4E0V A;  1H7X A;  4H4X A;  2C7G A;  1KNR A;  1D4E A;  3F8D A;  4H2Q A;  1FEC A;  5M0Z A;  3GQH A;  1M6I A;  5BRT A;  2WQY A;  3IF9 A;  2YG3 A;  4JDR A;  4C3X A;  2X3N A;  2WEU A;  1NHP A;  4EM4 A;  4RSL A;  2C65 A;  5KRQ A;  3AED A;  1RYI A;  1LJ1 A;  3BI4 A;  4B63 A;  1JRZ A;  1V59 A;  2B9W A;  4CY8 A;  3S61 A;  1LQT A;  1LVL A;  3CNT A;  4JY3 A;  1EL7 A;  2VVL G;  2EQ7 A;  4YT0 A;  5BUL A;  3GMC A;  2R9Z A;  4RG4 A;  5HHF A;  4CY6 A;  5DBJ A;  2GAG B;  1H81 A;  3L8K A;  2WS3 A;  2YG5 A;  2ZZ0 A;  3NN0 X;  4ICY A;  4EMW A;  1GOS A;  1L9D A;  2GR1 A;  1F8S A;  1BGJ A;  3F8P A;  5EOW A;  1L9C A;  2TPR A;  2NVK X;  2YLS A;  4D04 A;  2YQU A;  4Z25 A;  4BV6 A;  1LV0 A;  1CJ3 A;  1PJ5 A;  4A5L A;  2HQM A;  2A8X A;  3CGD A;  2YG7 A;  2VRM A;  4J2W A;  2ZZC A;  2OA1 A;  4FK1 C;  3GQK A;  1Z6L A;  3M0O A;  2OLO A;  2ZBW A;  3D1C A;  5C3J A;  3AYL A;  1S2Y A;  3ALJ A;  2V5Z A;  1K0L A;  3UKK A;  4B64 A;  2XYO A;  1JU2 A;  4USR A;  2GB0 A;  2B7R A;  3GYJ A;  3NTA A;  4YKF A;  4H7U A;  4K5S A;  4CNK A;  2Q0K A;  5ER0 A;  1ELI A;  3V3O A;  2Y6R A;  1O5W A;  1UKV G;  4DGK A;  5U63 A;  5IQ1 A;  3DA1 A;  1PDH A;  2GMH A;  3P4R A;  1MXT A;  3VR8 A;  4Y4M A;  3CGB A;  4Z44 A;  2C72 A;  4CCQ A;  1COY A;  3AD8 B;  5U25 A;  2WU2 A;  1E1K A;  1QJD A;  3DJG X;  4HA6 A;  4BJZ A;  4A9W A;  2YLT A;  4U8P A;  1O94 A;  3OC4 A;  2XFP A;  2WHD A;  2X99 A;  1KSU A;  1DJN A;  5EB4 A;  1GPE A;  3LXD A;  1BGN A;  4EQW A;  2Q7V A;  3PS9 A;  1IJH A;  1VG9 A;  1NDA A;  2OAM A;  2GR3 A;  4BK1 A;  5JCL A;  1H86 A;  1YKJ A;  1LPF A;  5JCI A;  3ISH A;  5FMH A;  1PHH A;  3SFD A;  2QCU A;  3CIR A;  2TMD A;  2BK3 A;  3M13 A;  4AT0 A;  4BK2 A;  1H7W A;  3SM8 A;  2BK5 A;  3K7Q X;  1KSS A;  3DK8 A;  1ZKQ A;  2VOU A;  1DOC A;  1VG0 A;  1E1N A;  5KWF A;  3QFB A;  1IUX A;  2NPX A;  2XVI A;  2YLW A;  2WDV A;  2YG4 A;  1H82 A;  1AOG A;  3H8L A;  1Y0P A;  2XVH A;  4GUV A;  4OPG A;  1NEK A;  2WP5 A;  1GRA A;  2BS3 A;  2YWL A;  5FS9 A;  2JK6 A;  3NNE A;  2CVJ A;  4AOX A;  1F6M A;  2APG A;  5BVA A;  4OPU A;  3FPZ A;  4TM0 A;  3UOY A;  2LFC A;  1RP0 A;  3M12 A;  1FOH A;  1S2Q A;  3UTG A;  1EL8 A;  4REK A;  1LQU A;  1CF3 A;  3DJD A;  4K8D A;  1K0J A;  1VQW A;  4TLX A;  4H2R A;  4WCT A;  3ABV A;  5JCN A;  1B37 A;  4WX1 A;  1Q1R A;  3DGZ A;  2W0H A;  3AYI A;  3GD4 A;  3C4N A;  2ZZB A;  4EIP A;  3QSS A;  2JKC A;  3LAD A;  1DJQ A;  1FL2 A;  1XPQ A;  4DSG A;  3AE8 A;  2WES A;  2C3D A;  4NEW A;  4XWR A;  3KKJ A;  1GRE A;  2CFY A;  3DJJ A;  3NH3 X;  2BC0 A;  3UP4 A;  1ZP0 A;  3ATQ A;  2VQB A;  5HXI A;  1QO8 A;  3CNJ A;  1GND A;  2WPC A;  2PHH A;  3SGL A;  1YQ4 A;  3VRA A;  1IUT A;  2QAE A;  3DJE A;  4IVO B;  2VZ2 A;  3VQR A;  1K0I A;  4X9N A;  4H4Z A;  4D03 A;  1KF6 A;  2WDQ A;  2IID A;  4JNQ A;  1P2E A;  5C2T A;  3VR9 A;  2BAC A;  1Q9I A;  3GYI A;  1MOK A;  4H50 A;  1EBD A;  1PBB A;  2IVE A;  2DKH A;  1F8R A;  5HYM A;  1PJ7 A;  2AR8 A;  4H4W A;  1FEA A;  1Q1W A;  4OCG A;  4CBQ A;  4X9M A;  3UKL A;  3UTE A;  4U8I A;  1FEB A;  4CCR A;  3CNP A;  2Q0L A;  3GRT A;  2YLR A;  2YR6 A;  4J31 A;  2H89 A;  4EMI A;  1CHU A;  1F8W A;  2C76 A;  3DGH A;  3V3N A;  2XLT A;  1VRQ B;  4H4Q A;  3FMW A;  3UTH A;  4FX9 A;  3AE9 A;  2PYX A;  4B67 A;  2XVE A;  3QVP A;  3CPH G;  3F8R A;  4EM3 A;  3AB1 A;  3P4P A;  2GH5 A;  1MO9 A;  1PXC A;  1X31 B; 
#chains in the Genus database with same CATH topology
 5HAX A;  3W15 B;  1IJ6 A;  2NWB A;  2XJ7 A;  5ABG A;  3ZYX A;  1HF8 A;  3UFG A;  3RH3 A;  5JRC B;  1OXZ A;  3DME A;  1VCS A;  3ZPO A;  2RM2 4;  4CN4 A;  4QX8 B;  1GXF A;  4K2X A;  4IV9 A;  1H6V A;  2B9X A;  4HFH A;  1TDE A;  1TDF A;  3UOV A;  1SHZ C;  2BS2 A;  3SX6 A;  3EAN A;  3G5Q A;  3ZC1 A;  4FJO A;  3R9U A;  4HWF A;  1Y64 B;  1VBB 4;  4BJY A;  3H8I A;  1JRY A;  1UGO A;  2FJE A;  3PVC A;  2BC1 A;  2JAE A;  1OJD A;  2ODU A;  4G63 A;  5J0Z A;  2XUE A;  2R04 4;  2C5I T;  1LVK A;  3JSK A;  1D7L A;  3CNS A;  3UTK A;  2EHO D;  4QXH B;  4B66 A;  2JQK A;  4G6G A;  4EQX A;  3LOV A;  2VVN A;  1KNP A;  3H37 A;  4ZI3 C;  3UTF A;  4ZS2 A;  2LHN A;  1TDN A;  5L4E A;  2R45 A;  2BS4 A;  3ATR A;  1CBO A;  1ZMC A;  1X9B A;  3FBS A;  4LF5 T;  4B68 A;  2NTY A;  4P09 A;  2LE8 A;  1XHX A;  4A7A A;  3PV0 F;  1UUS A;  3C4A A;  1G8X A;  1HRI 4;  2BRY A;  5AQT B;  2H7V C;  2LSJ A;  4DMV A;  2W63 A;  2E5L T;  1CJ2 A;  3RED A;  1SE7 A;  3SOL A;  4UVC B;  3CQC B;  4P9S A;  2NW9 A;  5EK3 A;  3EF6 A;  3I6D A;  1EL5 A;  2IC6 A;  3OYZ A;  4ILU A;  2XQ6 A;  2W0G A;  2UXN B;  2XAH B;  3CTY A;  3BNM A;  3WAK A;  2OAL A;  3NYE A;  4TNV A;  5LJM A;  3R84 B;  5TR3 A;  3KVE A;  1BF3 A;  1YQZ A;  4LF4 T;  1LTX R;  2BA9 A;  3BI5 A;  2RAB A;  3K30 A;  4Z43 A;  3IHG A;  1NEN A;  4YWO A;  1N1P A;  4A65 A;  1J5E T;  2VQF T;  2R0G A;  1OED C;  2C3C A;  4IHJ E;  3RIF A;  2W00 A;  1MQT D;  2WPF A;  1HCI A;  5J1G A;  1PBC A;  1UUR A;  2A89 A;  2BZB A;  3ZCI A;  2MBG A;  2E5V A;  3O1H A;  4NUV A;  5L2L A;  3K3N A;  3ZSS A;  3NVO A;  2ES0 A;  2H7O A;  3AEE A;  2K48 A;  1H83 A;  2J4G A;  3HKC E;  2Y6X A;  2GQF A;  2AAQ A;  3COX A;  3UP5 A;  2R4J A;  3HL6 A;  2XAQ B;  4ZOL E;  4JEU B;  4JYA T;  1WR0 A;  3CK6 A;  3QFA A;  2J47 A;  1HX8 A;  2M6I A;  4TZ4 C;  2BCP A;  4CN6 A;  1QUU A;  3A7M A;  3A8Y C;  2CBI A;  1YY5 A;  3AE1 A;  1PBD A;  3BHK A;  4IIJ E;  3ZT5 A;  3AXJ A;  1NAF A;  1XNR T;  3AE3 A;  3V76 A;  4UDQ A;  4DMW A;  2Y8D A;  4ADZ A;  4UV9 B;  3AE5 A;  2EHO B;  2GK9 A;  3JAE A;  3UCL A;  1D4D A;  4HWC A;  3RP6 A;  3UU4 A;  3ONL C;  1VRH 4;  4E7Z A;  2XAJ B;  2B9Y A;  5BUK A;  5IPY A;  3KV5 A;  4Z2T A;  5J60 A;  2ACZ A;  1ZHC A;  5FMN A;  3RHA A;  3AYJ A;  3P4Q A;  3AXJ B;  3KLJ A;  4B3T T;  3IHM A;  4Z24 A;  3PUQ A;  3C96 A;  4UP3 A;  3D0T A;  1BR2 A;  3NLC A;  1NWM X;  2CLY B;  1D7Y A;  2F4V T;  1JEH A;  5KX5 E;  4GR1 A;  2I59 A;  1OJC A;  2WCA A;  4FDC B;  2IML A;  2JB2 A;  3DTO A;  3PU3 A;  1GER A;  3LB8 A;  3P1W A;  3FBZ A;  1O95 A;  2WMO A;  1KFY A;  4X20 E;  3UU3 A;  2XFQ A;  4GDP A;  3DH9 A;  4H4S A;  1QSD A;  3RYF E;  2J3N A;  4C3Y A;  2YR4 A;  3RRC A;  4PK6 A;  5ABF B;  1ZV4 X;  1DOE A;  1MIV A;  2A72 A;  1NHS A;  3DK9 A;  4H4T A;  5LHG B;  1FJG T;  2MPK A;  1TYT A;  2WET A;  4A6N A;  3N9O A;  4U2T A;  2GMJ A;  3SFE A;  3I0O A;  2XSB A;  4U8L A;  4IL4 A;  2VVL A;  5H6Q B;  3N5L A;  4TX5 A;  4CQI A;  3T1Y T;  4GYR A;  4AOS A;  2IUB A;  4OFZ A;  1CC4 A;  1D5T A;  2UZZ A;  2YDR A;  2XLU A;  3NRY A;  3AEF A;  4HWI B;  3OTO T;  2VKO A;  2Q6U A;  4LF8 T;  3C50 A;  4UDR A;  1PN0 A;  2EQ9 A;  4PDW D;  5GON E;  3CX6 B;  3GMI A;  1KNZ A;  3AD7 B;  1ZK7 A;  2N9D A;  2CRB A;  2ZLY A;  1FEC A;  1M6I A;  2V26 A;  4UF0 B;  3P4W A;  3ZYM A;  2YG3 A;  4JDR A;  1HRV 4;  3O1I A;  3UUB A;  1LJ1 A;  4B63 A;  4CY8 A;  3B13 A;  1D1B A;  4QKN A;  3GWH A;  4JY3 A;  2EQ7 A;  1WLX A;  3JCF A;  5BUL A;  2WSS V;  4L5G A;  2L9Q A;  4G9K A;  2GAG B;  1H81 A;  3L8K A;  2G0U A;  4U74 A;  5L3E B;  4EMW A;  1GOS A;  4EEB A;  3O1J A;  1L9C A;  1R8I A;  2YLS A;  5LNK A;  4A5L A;  2A8X A;  2UUB T;  3CGD A;  2ZZC A;  2OA1 A;  4FK1 C;  3GQK A;  1Z8U A;  3D1C A;  5C3J A;  3IHR A;  3OBV E;  4X1Y E;  2YK0 A;  1S2Y A;  5HCJ A;  1POV 0;  1BR0 A;  4DR2 T;  4B64 A;  3K3O A;  1JU2 A;  2XM1 A;  3NTA A;  3UT5 E;  4TWD A;  2XQ8 A;  1XDO A;  1ELI A;  3V3O A;  2Y6R A;  4DR4 T;  2LRL A;  5U63 A;  1ZEE A;  3VR8 A;  2CXL A;  3CGB A;  4Z44 A;  3EDU A;  4KBM B;  2BVL A;  2BG9 C;  1HFA A;  1QJD A;  2VKD A;  2BDE A;  2A2F X;  4O4L E;  2XFP A;  1DJN A;  2XQ4 A;  1GPE A;  2Q7V A;  1IJH A;  4U2Z A;  3RYH E;  2YOE A;  1H86 A;  3KV9 A;  1YKJ A;  1LPF A;  5FMH A;  4PK4 A;  2E9X D;  1PHH A;  1RUD 4;  3M13 A;  2BK5 A;  1XDP A;  4DR1 T;  1YD8 G;  2VOU A;  2XVI A;  3T31 A;  1R08 4;  2JRK A;  5J2U E;  3H8L A;  5KMS A;  1V9D A;  2D5U A;  4OPG A;  4A5X A;  5L4H A;  4X65 T;  2IC9 A;  2D2S A;  3NNE A;  2JQQ A;  4ZI2 C;  4AOX A;  5BVA A;  4HE8 A;  4LF6 T;  3UOY A;  4G73 A;  4KHZ F;  3VKH A;  3M12 A;  1VOM A;  4P0A A;  1EL8 A;  1CF3 A;  5LYJ E;  3DJD A;  5E0O A;  4DV7 T;  3C64 A;  4NXM T;  5KNL A;  3TLU A;  5JCN A;  1B37 A;  4WX1 A;  5LGU B;  3DGZ A;  1FMW A;  4IDQ A;  4IE4 A;  4ZZC A;  2X0Y A;  3J8F 4;  2BKO A;  2CLY C;  3QSS A;  2JKC A;  2LSY A;  1M7K A;  1AR7 4;  4NEW A;  3PUG A;  1CUN A;  3DJJ A;  3NH3 X;  3PU8 A;  2VQB A;  4PJJ A;  3SGL A;  3VRA A;  4EYY R;  4IVO B;  2MTQ A;  3UQ4 A;  5FL1 A;  1RHI 4;  4AXP A;  3SWH A;  4BJM A;  3GYI A;  4H50 A;  1PIV 4;  2CXF A;  2DKH A;  2K3W A;  4OCG A;  4ZHQ E;  4X9M A;  3NKZ A;  5LA6 E;  4DID B;  2DHR A;  3Q9D A;  5HXE A;  1MND A;  3TLW A;  2YLR A;  4EMI A;  1CHU A;  3DGH A;  2C76 A;  3OPC A;  2XLT A;  5AQF B;  3FMW A;  4IE0 A;  4FX9 A;  3AE9 A;  2PYX A;  4B67 A;  5JRE A;  2HPJ A;  4EM3 A;  3IF9 A;  2X3N A;  1PXC A;  5LV9 A;  3AWI A;  2C67 A;  2QVA A;  2UU9 T;  4IA6 A;  2GV8 A;  3NZP A;  2VL8 A;  1Y56 A;  3GDN A;  4Q4V 4;  3NYF A;  4DBR A;  4GK5 E;  3ALM A;  5ABE A;  3ETV A;  4KPR A;  2NOX A;  3ZT7 A;  3CQX C;  1HG2 A;  4YSZ A;  4B3R T;  2N2N A;  3HKE E;  3L8R A;  4UEM A;  4J2C A;  4HTE A;  3ZDN A;  1S3E A;  5KVH A;  3NK1 X;  3UOZ A;  2HPL A;  5FS6 A;  1AR9 4;  4PW8 A;  4EV6 A;  3RIA A;  4EIW A;  2WOW A;  4NUU A;  2V61 A;  4YKG A;  4Q4Y 4;  4U2S A;  3JC6 C;  1NHQ A;  1G73 A;  1SEZ A;  3NWI A;  1KEY A;  1OJ9 A;  5JDQ A;  4I50 E;  3TKL B;  2BRA A;  3MK7 C;  4LF9 T;  1PVC 4;  3AEB A;  4J57 A;  4ZI7 E;  2JBV A;  4H4R A;  3N2K E;  4EB6 E;  2EQ6 A;  4GKK T;  1XHC A;  1ASJ 4;  3GMB A;  3Q5X A;  5FXX A;  3URH A;  3FZH B;  4XAX B;  2XVJ A;  4DV3 T;  2RA1 A;  3M3Z B;  1OED A;  2HH7 A;  2C64 A;  4GCM A;  3IF8 B;  4PNI A;  1K4Q A;  3AD9 B;  4TWF A;  3UQ7 A;  1RVF 4;  2YG6 A;  3GSI A;  4ZCD A;  2WOI A;  2N1G A;  3CND A;  4CI2 B;  4EZH A;  2LJL A;  1IUV A;  3UOX A;  5L3F B;  2LSI A;  2FUP A;  3KA7 A;  2EHO A;  3NYC A;  4OPC A;  1J5W A;  3GRS A;  3II4 A;  2X0H A;  1RUH 4;  3AEG A;  1ZOV A;  2E4G A;  3NT6 A;  1RUG 4;  4QHO A;  3IEE A;  2KLQ A;  3BI2 A;  1YW0 A;  3G5S A;  5AQH B;  2BXS A;  3ICR A;  1OJT A;  1OED B;  4U33 A;  4H4P A;  4A6N B;  3ZLI A;  4XXG A;  2YR5 A;  2IHR 1;  3CN8 A;  2P9B A;  2AXD S;  5FYM A;  3KVA A;  4OPL A;  3DP7 A;  3BHF A;  3AA7 B;  1GES A;  3MJX A;  4J33 A;  4HGA A;  2GQW A;  4ERR A;  4DSH A;  4DUY T;  5L3B B;  2IW5 B;  2I6H A;  3E1T A;  5LB7 B;  1ZMD A;  4U2L A;  2EX3 A;  5DQW A;  4H4Y A;  2X68 A;  2X9H A;  5FXZ A;  2YU2 A;  4EGW A;  2UUC T;  4B6X A;  3MKD A;  3KV4 A;  1IUW A;  3FB2 A;  2L3L A;  5LHI B;  2UXX B;  4YJ3 E;  1CC6 A;  1VBA 4;  2CM0 A;  2RGO A;  2V3A A;  3HKD E;  2X8C A;  1JRX A;  2MYS A;  1AR6 4;  3UFE A;  4O5U A;  3VRD B;  4X4J A;  2XLS A;  4WYV A;  3PUR A;  4JI5 T;  3T1H T;  3SRZ A;  4EXT A;  3CGC A;  2XFO A;  5IUX A;  1NAA A;  5DJQ C;  4M1P A;  1YQ3 A;  1D4C A;  2D9D A;  1NG4 A;  1NG3 A;  3ITJ A;  4ECH A;  3LBX B;  2JB3 A;  3UKQ A;  4B69 A;  1QLB A;  5FY7 A;  5KXJ A;  2QRX A;  2XQ3 A;  4AQF C;  3SYI A;  2YDS A;  3CKD A;  1GET A;  2GRT A;  1DOB A;  4GDE A;  1EV1 4;  2WB5 A;  2M6B A;  2Z6E A;  4UF0 A;  2Z5Y A;  2W66 A;  5EBK A;  2FJD A;  3C4X A;  4JI7 T;  4U2Y A;  2VWA A;  3RX6 A;  4DVD A;  2Y6Q A;  1GEU A;  3GWF A;  2UXC T;  4LU6 A;  5FNV E;  2YM1 A;  3RPU A;  5IHY A;  3UU6 A;  2CUL A;  3NK2 X;  1T98 A;  4EIQ A;  2EQ8 A;  2VAS A;  2CHO A;  3RLF F;  1KDG A;  3LSV A;  2C5K T;  4JLE A;  1REO A;  5FS8 A;  4Q25 A;  1VDC A;  3J9X 1;  3PJA A;  4KX6 A;  4JN9 A;  2RR1 4;  1OJA A;  4F6R C;  2YN6 A;  4K5R A;  4X62 T;  4OVI A;  4PJL A;  2DL1 A;  2W2U A;  4KHP T;  4J36 A;  4K7Z A;  5U1O A;  5F5W A;  3K1S A;  3NN6 X;  4GYS A;  4UDP A;  2XDO A;  1PJ6 A;  2R0P A;  3BQL A;  2FBW A;  2ZM8 A;  4U8M A;  4ILB A;  3IC9 A;  2H3R A;  2YDQ A;  1ZDL A;  3H3M A;  1DU2 A;  4M52 A;  3FXE B;  1E1H B;  1F3P A;  1ZX9 A;  3EAO A;  3GWD A;  5ETW A;  1IBL T;  5HXH A;  5J2T E;  4N9X A;  3T37 A;  4YY3 T;  4PAG A;  4GF7 A;  4HKA A;  4APN A;  3PO7 A;  2H88 A;  5FKY A;  3P9U A;  3L09 A;  2JB1 A;  1WR6 A;  3G5R A;  4HWD A;  2I0M A;  2X0L B;  3E22 E;  1S35 A;  2RS3 4;  4FK1 A;  5JRC A;  4AKH A;  4L9I A;  5LBQ B;  4G74 A;  4AQG A;  1U4Q A;  3QSM A;  5FVK A;  4AT2 A;  4CN1 A;  1HS7 A;  4MHC A;  3F8D A;  3ANW B;  4H2Q A;  4CXW A;  2WQY A;  2CHN A;  4TN7 B;  1D0Y A;  2WEU A;  1RUE 4;  5KRQ A;  3AED A;  2IAK A;  4WBO A;  4QXC B;  3RQU A;  3FZL B;  2B9W A;  4Q4W 4;  3RGL A;  2Q9Q D;  1WFD A;  3B5M A;  3FZF B;  1LVL A;  3S61 A;  3FI7 A;  5DAB A;  1EL7 A;  5LGT B;  3QB5 K;  2LEH A;  2R9Z A;  4RG4 A;  2X67 A;  4ANJ A;  3PUY F;  4H63 H;  2JQH A;  4H9R C;  3MZK B;  1L9D A;  2PY5 A;  3F8P A;  2TPR A;  3RI5 A;  2NVK X;  4D04 A;  3AAE B;  2YQU A;  1LV0 A;  1CJ3 A;  2V7M A;  1N34 T;  4J2W A;  2YG7 A;  1YKH B;  3EVY A;  1Z6L A;  3M0O A;  3GA8 A;  2OLO A;  2XYO A;  2ODV A;  4H7U A;  4CNK A;  3CX8 B;  1HG5 A;  5IQ1 A;  2W4X A;  1PDH A;  2GMH A;  4Y4M A;  4CCQ A;  5U25 A;  3DJG X;  3AB3 B;  3B57 A;  4TNW A;  3GN5 A;  2YLT A;  4A9W A;  3OC4 A;  1MIY A;  3QOF A;  3E08 A;  5EB4 A;  3WAJ A;  2PFV A;  1VG9 A;  1FMV A;  5CB4 E;  1NDA A;  4BK1 A;  2VUR A;  4HFB A;  4DV6 T;  2XAG B;  1MMA A;  5LXT E;  4DR6 T;  4PJM A;  4K0U A;  4AQY T;  1FIO A;  4G6H A;  2JPF A;  3CIR A;  2TMD A;  3I0Q A;  3SM8 A;  3ONJ A;  5H6R B;  3I9W A;  1ZKQ A;  2DI4 A;  1DOC A;  5CA0 E;  3TLS A;  2D0T A;  3LG7 A;  2YLW A;  3GN5 B;  4Z90 A;  2WDV A;  5HEU A;  2YG4 A;  1Y0P A;  3N9P A;  4HFE A;  4UV8 B;  4DV5 T;  1NEK A;  2WP5 A;  2YWL A;  5FS9 A;  4JEH B;  4JUY A;  2KMF A;  3DJB A;  3KVB A;  3UUM A;  5DQV A;  1RP0 A;  2C4C A;  4REK A;  3LJC A;  4HWH A;  5AFU L;  4IDP A;  4U31 A;  4H2R A;  3PUX F;  1D1C A;  4GB3 4;  5CGM A;  2ZZB A;  2DWK A;  4EIP A;  2QA7 A;  3Q5E A;  1FL2 A;  1XPQ A;  3SZW A;  1RUJ 4;  3T14 A;  1GRE A;  3RC8 A;  1K5M D;  4HEA A;  2WPC A;  3N9L A;  3DJE A;  2VZ2 A;  4JI3 T;  3VQR A;  3IBP A;  2XQ5 A;  2ZMA A;  4JI0 T;  5L3G B;  1KF6 A;  2IID A;  3VR9 A;  5C2T A;  2BAC A;  3ZST A;  2V1D B;  1T8B A;  2IVE A;  3SZC A;  1F8R A;  5JR9 C;  2AR8 A;  4LFC T;  3UKL A;  2W67 A;  3UTE A;  3AA0 B;  5EZY E;  4AI6 A;  5HEO A;  3CNP A;  4O4I E;  2H89 A;  5TAO A;  1F8W A;  4IDZ A;  4UVA B;  3LK4 2;  3UTH A;  3RKO A;  3QVP A;  1W9R A;  3P4P A;  4B3S T;  4GKJ T;  1X31 B;  4II3 A;  3HYV A;  2X9Y A;  3D8X A;  2VQ7 A;  3FIM B;  3UKF A;  3ICS A;  5JCK A;  1BR4 A;  2CA5 A;  2CWO A;  1T72 A;  1O3X A;  3VHL A;  3O0H A;  4TUY E;  3RIU C;  2YVG A;  4FI5 A;  5HXC A;  2IVD A;  4H63 V;  3NHO X;  3TLV A;  4GRT A;  5LHH B;  3GD3 A;  2FJA A;  2ACX A;  3AEC A;  2NW7 A;  1XHZ A;  5JDH A;  1H8T D;  1US7 B;  5LOV E;  3FG2 P;  3BNU A;  3ICT A;  3NG7 X;  2D0U A;  4WZX A;  2WM9 A;  4H9O C;  2WP6 A;  3KFW X;  2GR0 A;  2XY8 B;  5EK4 A;  3FBL A;  1GRG A;  4J34 A;  4O5Q A;  3EAM A;  4LML A;  4PFO A;  2CCQ A;  5IYZ E;  2XFN A;  5AQQ B;  1PBE A;  1EAH 4;  4IRE A;  4HFC A;  1HTJ F;  4LMJ A;  2XZE A;  4WBN E;  3PTR B;  1I6Z A;  2KXP B;  2BAB A;  1W0A A;  4GIW A;  3C4W A;  3Q5W A;  5M10 A;  1N4W A;  3ALL A;  4H2N A;  4JV5 T;  4WNK A;  4C90 A;  2KZ7 B;  2XQY A;  1N36 T;  1CL0 A;  2V6Y B;  1ZKE A;  5KMG P;  2K9A A;  3FHN A;  5KOX A;  4H9P C;  2VKH A;  4QH1 A;  3TLT A;  4JI2 T;  5CJ5 A;  5AQJ B;  4TLZ A;  2LOS A;  3UU5 A;  1XAN A;  3RP8 A;  2JQ9 A;  3HZL A;  2KND A;  4P1N A;  2VVM A;  4BK3 A;  2UXB T;  4TM1 A;  2VB6 A;  3Q5D A;  4OK0 A;  1PS9 A;  4C91 A;  2HN1 A;  2XCG A;  3LK3 B;  4I4T E;  1XI1 A;  1B4V A;  4EQS A;  3X1D A;  1B7T A;  5GRT A;  1DXL A;  1GT8 A;  2C75 A;  4OPD A;  3ZMV B;  3NKS A;  4IST A;  3KD9 A;  4Q4X 4;  4OPI A;  2F5Z A;  5EB5 A;  4NTC A;  4DNA A;  3WI3 A;  1HX1 B;  4CI1 B;  2V6Y A;  2XAS B;  3AXB A;  4U8K A;  1E1M A;  4YLH A;  3RRW A;  1BEV 4;  1BKW A;  5L3C B;  4JI1 T;  2YAU A;  2XHE B;  5KOW A;  1P2H A;  2HHH T;  4YTM A;  3ZMZ B;  1S3B A;  3K7T A;  3ZC0 A;  1OWA A;  4BAY B;  3I1A A;  1IUU A;  4H4V A;  2DKI A;  3JC6 D;  1VBC 4;  5CQF A;  3SZ0 A;  4AQF A;  5LMU T;  4U8O A;  3ADA B;  4A97 A;  2BKP A;  1WYB A;  2JIW A;  3PUS A;  2V3B A;  1IUS A;  1COV 4;  3KPF A;  2V60 A;  2QA2 A;  3J7Y q;  1B8S A;  4GK0 E;  4NWZ A;  4H4U A;  1GRT A;  4ILA A;  2CDU A;  5JH7 E;  4V1A v;  2KIN B;  2J62 A;  5FP3 A;  2HN2 A;  3S4U A;  5L3D B;  2E9X A;  4LII A;  1NPX A;  4YFS A;  4TM3 A;  1TDO A;  3PUZ F;  4KMC A;  2BCG G;  4DV0 T;  2YVF A;  5L46 A;  4Y4N A;  1NHR A;  5JQG E;  4ILC A;  3ZYK A;  5AQM B;  1E6E A;  2DWG A;  5HYA A;  2R4E A;  2LOP A;  4ZEY A;  2RGJ A;  4A79 A;  4EZ4 A;  2VVS A;  1Z7S 4;  4QX7 B;  2X9W A;  5ADX L;  4UEL A;  3AE7 A;  1CC2 A;  4IGU A;  1T7S A;  3SXI A;  2W61 A;  4U72 A;  1WYC A;  4AKG A;  4C77 A;  1L9E A;  4KI0 F;  2IIU A;  4ZN0 A;  5IQ4 A;  3UU8 A;  2X5I D;  3ANW A;  3P7I A;  3E0Z A;  4JY2 A;  3BQK A;  4NTE A;  2LM9 A;  1M64 A;  2X66 A;  2X50 A;  4DV2 T;  4DR7 T;  2Z5X A;  4U8J A;  2V5C A;  4OYJ A;  4CRT A;  3LJP A;  4TV9 E;  1DNC A;  4IA5 A;  3SQP A;  1W0B A;  1GQE A;  1N4U A;  1PO2 4;  4HN9 A;  4ZCC A;  4EAH A;  1CJC A;  5AQS B;  4F8H A;  3NIX A;  3RNM A;  2BVM A;  2VRL A;  2M67 A;  4H9Q C;  1XMO T;  4JNA A;  3ZJ1 A;  2WDR A;  2V6O A;  5AQK B;  3AE4 A;  2ARD A;  1BWC A;  4IDN A;  3CPJ G;  2GEW A;  1OOP D;  4U8N A;  2XLP A;  2PG8 A;  2V5D A;  3ESL A;  3FZM B;  4AP3 A;  5FY1 A;  3ZT6 A;  3CWZ B;  1BR1 A;  4Y4L A;  3H3A A;  2LLY A;  5FL0 A;  2QA1 A;  4ZI3 D;  1XMQ T;  3BK9 A;  5AQO B;  5CA1 E;  1SA0 E;  3UKH A;  4NIQ A;  3EUH A;  3OYX A;  2B7S A;  2Q9Q C;  1JOA A;  1VBE 4;  3HKB E;  4MBQ A;  3QJ4 A;  2X9X A;  3ZCJ A;  3OJA A;  2R46 A;  4E0V A;  1H7X A;  2UUA T;  4H4X A;  1D4E A;  5JDN A;  4H9N C;  2YU1 A;  3ZJ2 A;  4X1K E;  3ZMT B;  5BRT A;  4BJN A;  4C3X A;  5CFB A;  1NHP A;  5IWA T;  4RSL A;  1RYI A;  2BG9 A;  4WW0 A;  2OA5 A;  1V59 A;  2E2A A;  3PUW F;  4QH4 A;  3KIN B;  1XNQ T;  2VVL G;  4YT0 A;  3GMC A;  1N32 T;  5HHF A;  1W09 A;  5DBJ A;  1NA1 D;  4ICY A;  2ZZ0 A;  2K5B B;  1F8S A;  1LRZ A;  4X5T A;  1BGJ A;  5EOW A;  4HFI A;  4Z25 A;  4BV6 A;  2LT3 A;  2HQM A;  3RYC E;  2VRM A;  5LGN B;  1MNE A;  2LKH A;  2W62 A;  2V5Z A;  4YKF A;  2CPT A;  4K5S A;  2Q0K A;  2KT9 A;  3CX7 B;  3RYI E;  1UKV G;  2LRK A;  1AJ3 A;  2BG9 B;  3DA1 A;  3P4R A;  1MXT A;  4I43 B;  2XTL A;  4JI8 T;  2C72 A;  2CBJ A;  1COY A;  2YKS A;  2WU2 A;  4HA6 A;  4BJZ A;  3K3Q C;  2XQ9 A;  5JR9 B;  1RUI 4;  1R09 4;  2X99 A;  1KSU A;  4EQW A;  3LXD A;  1BGN A;  5A1L A;  1XWM A;  2OAM A;  2GR3 A;  3R6N A;  3RKG A;  5JCI A;  3ISH A;  1HNX T;  5F8P A;  3SFD A;  2BK3 A;  4O4J E;  4DV4 T;  1D0Z A;  1H7W A;  1RUC 4;  3K7Q X;  2MOZ A;  2XPK A;  1KSS A;  3DK8 A;  1E1N A;  2DNX A;  3QFB A;  5JR9 A;  1AOG A;  4GUV A;  2BS3 A;  2CWY A;  4COF A;  1F6M A;  3LBX A;  2LFC A;  3O4X E;  2WBL A;  2PLV 4;  1FOH A;  5FXV A;  1S2Q A;  3UTG A;  2WWU A;  3NZQ A;  4K8D A;  1K0J A;  1H7C A;  5HCM A;  4TLX A;  2V6X A;  5AQN B;  2A3D A;  4WCT A;  3C98 B;  3ABV A;  2R06 4;  4EOZ B;  3KDS E;  1IAP A;  4X1I E;  2XM2 A;  2V7L A;  4AIU A;  3LAD A;  1DJQ A;  2IDO B;  4DSG A;  2C3D A;  3P50 A;  3KKJ A;  2CFY A;  1ZP0 A;  3KBT A;  3RIU A;  3ZKR A;  3ATQ A;  5HXI A;  1X79 A;  3L39 A;  1YQ4 A;  1IUT A;  4U7Y A;  3ONX A;  4UR9 A;  4D03 A;  1I94 T;  3U3I A;  4JNQ A;  2WAU A;  2DLR A;  5L47 A;  1Q9I A;  1FEW A;  1MOK A;  1EBD A;  5HYM A;  2QYW A;  4LFB T;  1PJ7 A;  1LVF A;  2YEV C;  4CBQ A;  1FEB A;  4CCR A;  1KK7 A;  3QUJ A;  2CE7 A;  4LF7 T;  1D1A A;  1NCQ D;  4A56 A;  3V3N A;  3RC3 A;  4H4Q A;  4MLK A;  3QB5 A;  3CPH G;  4TWH A;  3AB1 A;  4II2 A;  3CVR A;  2GH5 A;  3KV6 A;  3B3R A;  5KMQ A;  5ABH A;  4IE5 A;  3SZF A;  2V7J A;  2LM2 A;  3UKP A;  5KMR A;  4QH5 A;  1UK5 A;  2E1M A;  3A5X A;  2C0S A;  3B6D A;  2XSA A;  3KPK A;  4BUR A;  3NBX X;  3NK0 X;  4B65 A;  1DOD A;  2ZM2 A;  4ZXL A;  4PAB A;  4Z8X A;  1RMU 4;  3T0K A;  4J56 A;  4EMJ A;  3VU7 H;  5JDL A;  5CKU A;  1JNR A;  1L0V A;  1S94 A;  3OZ2 A;  3ETU A;  4YHJ A;  1YXR A;  4RG3 A;  1GTE A;  4MFR A;  3AVR A;  5AQV B;  5C8Y E;  4LA1 A;  2C66 A;  3AA1 B;  5JVD E;  2O9Z A;  4GAV A;  4PK5 A;  3LK2 B;  3QNU A;  5LG3 A;  4OX9 T;  3SUC A;  1AR8 4;  2YIN A;  1ONF A;  2E9X B;  4CNJ A;  1GTH A;  2GR2 A;  4NZH A;  4C5O A;  1GRB A;  4OHF A;  4X64 T;  4HB9 A;  2RS5 4;  1HXS 4;  4I0U A;  3K8P C;  3L3P A;  2KWI B;  3HA4 A;  3CPI G;  4YXD A;  3Q6J A;  1VBD 4;  2VQE T;  2YLX A;  4B1B A;  1TDK A;  1YKE B;  2LSG A;  4L0R A;  2C70 A;  3P4S A;  1VRB A;  5JDG A;  1GRF A;  2BXR A;  2LKG A;  4I58 A;  4GAP A;  5KMP A;  2WMN A;  2PYJ A;  4I59 A;  3F31 A;  4O4H E;  4LFA T;  4OPT A;  4YHH T;  4UVB B;  3NGC X;  4PJN A;  3PUV F;  1WCR A;  3RF1 A;  4YSY A;  3EDV A;  4GOU A;  3RQW A;  4YSX A;  4DND A;  2I0Z A;  3CQG B;  3PUA A;  4A98 A;  3I9Y A;  2E8I A;  3EPT A;  4EYU A;  2GAH B;  4AKI A;  5HY5 A;  3FXD B;  2BYB A;  5HEJ A;  3OKQ A;  1EL9 A;  2OLN A;  4Z2U A;  2A87 A;  4P0B A;  2WOV A;  3NTD A;  5AQG B;  1HNW T;  5AQU B;  3LZX A;  2FJB A;  1Z0P A;  3K7M X;  4NPP A;  1PO1 4;  2V8S V;  4AKL A;  2J1D G;  4USQ A;  3RHW A;  2GF3 A;  3ZMS B;  2ZM0 A;  3JAF A;  1PXB A;  4ISS A;  2B76 A;  5JCM A;  2E9X C;  3N2G E;  2WP9 A;  2WBA A;  2BBJ A;  1TRB A;  2XLR A;  2RPA A;  4PAA A;  3T2Y A;  3HYX A;  1Y01 A;  2RP4 A;  4CXY A;  1IBK T;  3GYX A;  2EHO C;  1M62 A;  1WRD A;  3IWA A;  2X8G A;  3PDY A;  3QSE A;  5FVL A;  4IT4 A;  1VCT A;  1UX5 A;  3VRB A;  2NR4 A;  3WE0 A;  3L1R A;  2MAW A;  4JQ9 A;  2C73 A;  3ZN0 B;  4QWN B;  2UXD T;  3VKG A;  2RMU 4;  2JJ9 A;  2NTX A;  3HI2 A;  2KWH A;  2PW9 A;  1W4X A;  3AEA A;  3MAC A;  4KP3 C;  4NEV A;  1ZOY A;  3FZK B;  2HWB 4;  2V7I A;  3V5S A;  1GV4 A;  3G06 A;  4AIS A;  3AAI A;  1E7P A;  3U78 A;  2WU5 A;  1IJ5 A;  3JBG 4;  4MJW A;  2Q9Q B;  4ZZB A;  3DK4 A;  4XWZ A;  3EHZ A;  3NRX A;  4AP1 A;  2VKJ A;  3QVR A;  4DO0 A;  2BK4 A;  5FS7 A;  2RGH A;  1UCU A;  5KDM C;  3I3L A;  5LP6 E;  5HXR A;  1Y56 B;  5AQP B;  3SS1 A;  1H84 A;  3EAB A;  4NXN T;  2X8H A;  3GDP A;  4U7I A;  5M4Y A;  1E39 A;  1PBF A;  4IL9 A;  4B3M T;  1PXA A;  1GSN A;  2R0C A;  2WZH A;  2X51 A;  2WY2 A;  4YTP A;  2WPE A;  5LJN A;  5HXS A;  4YTN A;  2K24 A;  4EQR A;  4ZS3 A;  2YM2 A;  3ZEF B;  4TM4 A;  3S5W A;  1J1J A;  1EZ3 A;  3RP7 A;  2XQ7 A;  2WZI A;  3N9N A;  4O2A E;  4QXB B;  3Q9T A;  4KUM B;  5JDM A;  4A99 A;  5HEH A;  3KU9 A;  2AQJ A;  4O8S A;  3MA9 A;  4NTD A;  3HYW A;  2Q9Q A;  1IZN B;  1GRH A;  3CGE A;  2C5J A;  1E1L A;  3IA3 A;  3NRN A;  1B5Q A;  4XBF B;  5EK2 A;  2CMR A;  3ZMU B;  1N33 T;  1N4V A;  5AQR B;  4NNJ A;  1HYU A;  2DCF A;  2WWV A;  4CZZ B;  5GSN A;  1FCD A;  5FY0 A;  1CJ4 A;  2HWC 4;  5FXW A;  3H4K A;  3AE2 A;  4H2P A;  4Z26 A;  4XZC A;  5KVI A;  4DBQ A;  4HFD A;  4E7S A;  2XVF A;  3P8C D;  3AE6 A;  5J7X A;  4YJ2 E;  3T8O A;  1E2A A;  1TYP A;  4JBW F;  4G2A A;  3ZN1 B;  4BA9 A;  1ZY8 A;  2R07 4;  2YVJ A;  4ADW A;  2PZS A;  2CXD A;  1D4M 4;  4IVM B;  4C74 A;  4DR5 T;  4Z91 A;  4LMK A;  4YSH A;  3UKA A;  2SPC A;  1RSG A;  2XAF B;  1BZL A;  4Z2R A;  1AL2 4;  2YLZ A;  4ASK A;  2OLT A;  2XFU A;  1JNZ A;  4K0K T;  4CI3 B;  1GAL A;  3LZW A;  1XDI A;  3OVU A;  3O9X A;  4K22 A;  2PBI A;  4AKR B;  5BMV E;  2C7G A;  1KNR A;  3T2Z A;  2XQA A;  5M0Z A;  3GQH A;  4IDO A;  2QGS A;  4RHV 4;  4EM4 A;  2C65 A;  2ZM6 T;  3PE0 A;  2L8K A;  3BI4 A;  3F2E A;  3MXZ A;  5JDF A;  1JRZ A;  3CMM A;  3C51 A;  1LQT A;  3CNT A;  2VK9 A;  3M65 A;  3PJA J;  1MIW A;  4UXN B;  4CY6 A;  2WS3 A;  2YG5 A;  3NN0 X;  4U3C A;  2GR1 A;  5LG4 A;  5HWX A;  2OV9 A;  4DR3 T;  3N9Q A;  1PJ5 A;  3T2K A;  1IBM T;  1HR0 T;  2ZBW A;  1LKX A;  3AYL A;  3ALJ A;  1RUF 4;  1K0L A;  5ABF A;  3UKK A;  4H9S E;  4USR A;  2BBH A;  2GB0 A;  3N2O A;  2B7R A;  3GYJ A;  5HWY A;  4X66 T;  5ER0 A;  1O5W A;  3UUN A;  4DGK A;  3ZYL A;  3CML A;  4MAL A;  3AD8 B;  1U5P A;  5LBM A;  1E1K A;  3UUL A;  4JI4 T;  4U8P A;  1O94 A;  2NW8 A;  1MMD A;  4TV8 E;  2WHD A;  3PS9 A;  4I55 E;  5JCL A;  4ZI2 D;  2B1E A;  4EED A;  3JAD A;  3F57 A;  2QCU A;  3LDQ B;  4AT0 A;  4JI6 T;  4BK2 A;  3QC9 A;  2JMK A;  2A9U A;  3Q2M A;  5HEG A;  5F3J A;  1VG0 A;  5KWF A;  1IUX A;  2NPX A;  1H82 A;  3AA6 B;  4O2B E;  1HNZ T;  2XVH A;  2V7K A;  1SUM B;  1GRA A;  2KSR A;  3UUX B;  4PFP A;  4DV1 T;  2JK6 A;  3LFM A;  2CVJ A;  2APG A;  2AE9 A;  2VL0 A;  1OED E;  2Y48 B;  3FPZ A;  4OPU A;  4TM0 A;  3KBU A;  1LQU A;  1VQW A;  2LHR A;  3SY4 A;  1Q1R A;  2W0H A;  3AYI A;  3GD4 A;  3C4N A;  2R6G F;  4OYK A;  5BR8 T;  3AE8 A;  4DUZ T;  1D0X A;  2WES A;  4XWR A;  3EI0 A;  2LSK A;  2BC0 A;  3UP4 A;  3HR0 A;  5LCY A;  2RS1 4;  3C4Z A;  1QO8 A;  3CNJ A;  1GND A;  2NP9 A;  2PHH A;  5JTG A;  1UX4 A;  3AAA B;  2QAE A;  4UIG A;  1XZY A;  1K0I A;  4IE6 A;  4X9N A;  4HFV A;  2BKN A;  4H4Z A;  3BQI A;  2WDQ A;  2R7F A;  1P2E A;  5LMN T;  3AVS A;  1PBB A;  1MMG A;  3V5U A;  2PTF A;  4H4W A;  1FEA A;  1Q1W A;  2PJQ A;  5AQI B;  4U8I A;  1MMN A;  2PYL A;  2Q0L A;  3GRT A;  4N78 D;  2YR6 A;  4J31 A;  5AQL B;  3N9M A;  3QK6 A;  4CXX A;  3JD7 4;  3CPZ A;  1VRQ B;  2CEA A;  2JMH A;  2XVE A;  2BG9 E;  4IE7 A;  3F8R A;  2GVC A;  1MO9 A; 
#chains in the Genus database with same CATH homology
 5LV9 A;  3AWI A;  3SZF A;  3HYV A;  3ZYX A;  3UKP A;  2C67 A;  5KMR A;  4IA6 A;  3D8X A;  2VQ7 A;  2GV8 A;  3FIM B;  3DME A;  2E1M A;  3UKF A;  1Y56 A;  3ICS A;  3GDN A;  3B6D A;  3KPK A;  5JCK A;  3O0H A;  4BUR A;  3NK0 X;  3NYF A;  4B65 A;  1DOD A;  2YVG A;  1GXF A;  2IVD A;  4K2X A;  4PAB A;  4IV9 A;  1H6V A;  2B9X A;  1TDE A;  3ALM A;  3NHO X;  4J56 A;  3T0K A;  4EMJ A;  1TDF A;  3UOV A;  4GRT A;  2BS2 A;  4KPR A;  3SX6 A;  3EAN A;  3G5Q A;  4YSZ A;  1JNR A;  2FJA A;  3AEC A;  1L0V A;  3GD3 A;  3OZ2 A;  5CKU A;  3R9U A;  4RG3 A;  1GTE A;  4BJY A;  3H8I A;  3FG2 P;  3ICT A;  3BNU A;  3ZDN A;  1S3E A;  2C66 A;  3NG7 X;  4LA1 A;  2O9Z A;  5KVH A;  3NK1 X;  4GAV A;  3UOZ A;  5FS6 A;  1JRY A;  2WP6 A;  2GR0 A;  2FJE A;  3SUC A;  3PVC A;  2WOW A;  1ONF A;  2BC1 A;  1OJD A;  2JAE A;  1GRG A;  4CNJ A;  1GTH A;  2GR2 A;  2V61 A;  4NZH A;  4YKG A;  4J34 A;  4C5O A;  4U2S A;  1NHQ A;  4O5Q A;  1GRB A;  1SEZ A;  1OJ9 A;  3JSK A;  4HB9 A;  1D7L A;  2BRA A;  3CNS A;  2XFN A;  3AEB A;  1PBE A;  4J57 A;  4B66 A;  3CPI G;  2JBV A;  4G6G A;  4YXD A;  3Q6J A;  4H4R A;  4EQX A;  2EQ6 A;  3LOV A;  1KNP A;  1XHC A;  2YLX A;  3UTF A;  4B1B A;  1TDK A;  1TDN A;  2BAB A;  2R45 A;  2BS4 A;  2C70 A;  3GMB A;  3P4S A;  1GRF A;  2BXR A;  4I58 A;  4GAP A;  3ATR A;  3URH A;  5KMP A;  2XVJ A;  1CBO A;  1ZMC A;  4I59 A;  1N4W A;  3ALL A;  5M10 A;  2C64 A;  3FBS A;  4GCM A;  1K4Q A;  4B68 A;  4OPT A;  4A7A A;  4H2N A;  3AD9 B;  3NGC X;  1CL0 A;  3C4A A;  2YG6 A;  2BRY A;  3GSI A;  4ZCD A;  5KOX A;  2WOI A;  1CJ2 A;  4YSY A;  3RED A;  3CND A;  4YSX A;  4TLZ A;  1IUV A;  1XAN A;  4P9S A;  3UOX A;  2I0Z A;  3EF6 A;  3RP8 A;  3KA7 A;  3HZL A;  3I6D A;  2VVM A;  4BK3 A;  1EL5 A;  3NYC A;  4TM1 A;  4OPC A;  3EPT A;  3GRS A;  1PS9 A;  2GAH B;  3II4 A;  2XCG A;  3CTY A;  3B3R A;  5HY5 A;  3BNM A;  2OAL A;  1B4V A;  2BYB A;  3AEG A;  3NYE A;  4EQS A;  1ZOV A;  5GRT A;  1DXL A;  5TR3 A;  3KVE A;  2E4G A;  1GT8 A;  1BF3 A;  2C75 A;  4OPD A;  1YQZ A;  3NT6 A;  1LTX R;  2BA9 A;  3BI5 A;  1EL9 A;  2OLN A;  4Z2U A;  2A87 A;  2RAB A;  2WOV A;  3BI2 A;  3NTD A;  3G5S A;  2BXS A;  3ICR A;  3K30 A;  3NKS A;  3KD9 A;  4Z43 A;  1OJT A;  3IHG A;  3LZX A;  4OPI A;  2FJB A;  1NEN A;  4H4P A;  4YWO A;  4A6N B;  1N1P A;  4XXG A;  2YR5 A;  4A65 A;  3K7M X;  2F5Z A;  2R0G A;  3CN8 A;  5EB5 A;  4NTC A;  4DNA A;  2C3C A;  4USQ A;  2GF3 A;  3AXB A;  4OPL A;  4U8K A;  3BHF A;  1PXB A;  1E1M A;  2B76 A;  1GES A;  5JCM A;  1BKW A;  4J33 A;  2WP9 A;  2WPF A;  2GQW A;  2YAU A;  2WBA A;  1PBC A;  5KOW A;  1P2H A;  4YTM A;  1TRB A;  2A89 A;  4DSH A;  2XLR A;  1S3B A;  3E1T A;  2E5V A;  4PAA A;  3K7T A;  3T2Y A;  3HYX A;  1ZMD A;  4U2L A;  1IUU A;  4H4V A;  2DKI A;  4H4Y A;  3GYX A;  3IWA A;  5CQF A;  3SZ0 A;  4II3 A;  3AEE A;  3ADA B;  4U8O A;  1H83 A;  2X8G A;  2GQF A;  2AAQ A;  3COX A;  3UP5 A;  2R4J A;  2V3B A;  1IUS A;  3QSE A;  3VRB A;  3KPF A;  2V60 A;  2QA2 A;  1IUW A;  3WE0 A;  3L1R A;  1B8S A;  1CC6 A;  2RGO A;  2V3A A;  4JQ9 A;  3QFA A;  2C73 A;  2BCP A;  2X8C A;  1JRX A;  4NWZ A;  4H4U A;  1GRT A;  1YY5 A;  3AE1 A;  2CDU A;  1PBD A;  1W4X A;  3BHK A;  3AEA A;  4NEV A;  4O5U A;  3VRD B;  1ZOY A;  4X4J A;  3AE3 A;  2XLS A;  3V76 A;  4UDQ A;  1GV4 A;  3AE5 A;  1E7P A;  2WU5 A;  3CGC A;  2XFO A;  4LII A;  1NPX A;  3UCL A;  1D4D A;  1NAA A;  4MJW A;  4TM3 A;  1TDO A;  3RP6 A;  3DK4 A;  4XWZ A;  4AP1 A;  1YQ3 A;  1D4C A;  3QVR A;  2BK4 A;  1NG4 A;  1NG3 A;  3ITJ A;  5FS7 A;  2BCG G;  2YVF A;  4ECH A;  2B9Y A;  2RGH A;  5BUK A;  5IPY A;  5L46 A;  4Y4N A;  1NHR A;  3I3L A;  1Y56 B;  2JB3 A;  3UKQ A;  4B69 A;  1QLB A;  4Z2T A;  5KXJ A;  5J60 A;  2ACZ A;  3RHA A;  3AYJ A;  1E6E A;  1H84 A;  3SYI A;  2X8H A;  1GET A;  3GDP A;  3P4Q A;  2R4E A;  2GRT A;  3KLJ A;  3IHM A;  2RGJ A;  4A79 A;  1DOB A;  1E39 A;  1PBF A;  4Z24 A;  4GDE A;  1PXA A;  1GSN A;  3C96 A;  2R0C A;  4YTP A;  2Z5Y A;  4UP3 A;  2WPE A;  5EBK A;  2FJD A;  3NLC A;  4YTN A;  1D7Y A;  3AE7 A;  4EQR A;  1CC2 A;  1JEH A;  2Y6Q A;  1GEU A;  2YM2 A;  3SXI A;  3GWF A;  4TM4 A;  3S5W A;  4GR1 A;  3RP7 A;  4C77 A;  4LU6 A;  1L9E A;  1OJC A;  2YM1 A;  4ZN0 A;  3NK2 X;  2CUL A;  5IQ4 A;  2GVC A;  3Q9T A;  4FDC B;  4A99 A;  2JB2 A;  3KU9 A;  4JY2 A;  4EIQ A;  1GER A;  2AQJ A;  4NTD A;  2EQ8 A;  4NTE A;  3HYW A;  1M64 A;  3LB8 A;  2X50 A;  1KDG A;  1GRH A;  3CGE A;  3P1W A;  1E1L A;  1REO A;  2Z5X A;  5FS8 A;  1O95 A;  1VDC A;  3NRN A;  4KX6 A;  1B5Q A;  4JN9 A;  4U8J A;  1OJA A;  1KFY A;  3LJP A;  4CRT A;  1DNC A;  4IA5 A;  4K5R A;  3SQP A;  2XFQ A;  4OVI A;  4GDP A;  1N4V A;  1N4U A;  4NNJ A;  1HYU A;  4ZCC A;  1CJC A;  3DH9 A;  4H4S A;  2J3N A;  1FCD A;  5GSN A;  4C3Y A;  2YR4 A;  1CJ4 A;  4J36 A;  4K7Z A;  3H4K A;  5U1O A;  3AE2 A;  3NIX A;  4H2P A;  3RNM A;  4Z26 A;  3NN6 X;  2VRL A;  1DOE A;  4UDP A;  5KVI A;  2XDO A;  4JNA A;  2XVF A;  1PJ6 A;  2WDR A;  2R0P A;  3AE6 A;  2V6O A;  5J7X A;  1NHS A;  3DK9 A;  4H4T A;  3AE4 A;  2ARD A;  1BWC A;  3CPJ G;  2GEW A;  1TYP A;  2FBW A;  1TYT A;  2WET A;  4U8N A;  4A6N A;  1ZY8 A;  2XLP A;  4U8M A;  4U2T A;  2YVJ A;  3IC9 A;  2GMJ A;  4ADW A;  3SFE A;  4IVM B;  4AP3 A;  4C74 A;  1ZDL A;  4U8L A;  4M52 A;  1F3P A;  1ZX9 A;  2VVL A;  4Y4L A;  3EAO A;  3GWD A;  4AOS A;  4YSH A;  3UKA A;  1CC4 A;  1D5T A;  4N9X A;  3T37 A;  2QA1 A;  4GF7 A;  4APN A;  3PO7 A;  2UZZ A;  2H88 A;  3P9U A;  1RSG A;  2JB1 A;  2XLU A;  3G5R A;  1BZL A;  3AEF A;  4Z2R A;  3UKH A;  2YLZ A;  4FK1 A;  2XFU A;  2B7S A;  2Q6U A;  1JOA A;  4UDR A;  4G74 A;  1PN0 A;  1JNZ A;  2EQ9 A;  3QJ4 A;  3QSM A;  1GAL A;  3LZW A;  1XDI A;  2R46 A;  4AT2 A;  3AD7 B;  1ZK7 A;  4K22 A;  4E0V A;  1H7X A;  4H4X A;  2C7G A;  1KNR A;  1D4E A;  3F8D A;  4H2Q A;  3T2Z A;  1FEC A;  5M0Z A;  3GQH A;  1M6I A;  5BRT A;  2WQY A;  3IF9 A;  2YG3 A;  4JDR A;  4C3X A;  2X3N A;  2WEU A;  1NHP A;  4EM4 A;  4RSL A;  2C65 A;  5KRQ A;  3AED A;  1RYI A;  1LJ1 A;  3BI4 A;  4B63 A;  1JRZ A;  1V59 A;  2B9W A;  3CMM A;  4CY8 A;  3S61 A;  1LQT A;  1LVL A;  3CNT A;  4JY3 A;  1EL7 A;  2VVL G;  2EQ7 A;  4YT0 A;  5BUL A;  3GMC A;  2R9Z A;  4RG4 A;  5HHF A;  4CY6 A;  5DBJ A;  4G9K A;  2GAG B;  1H81 A;  3L8K A;  2WS3 A;  2YG5 A;  2ZZ0 A;  3NN0 X;  4ICY A;  4EMW A;  1GOS A;  1L9D A;  2GR1 A;  1F8S A;  1BGJ A;  3F8P A;  5EOW A;  1L9C A;  2TPR A;  2NVK X;  2YLS A;  4D04 A;  2YQU A;  4Z25 A;  4BV6 A;  1LV0 A;  1CJ3 A;  1PJ5 A;  4A5L A;  2HQM A;  2A8X A;  3T2K A;  3CGD A;  2YG7 A;  2VRM A;  4J2W A;  2ZZC A;  2OA1 A;  4FK1 C;  3GQK A;  1Z6L A;  3M0O A;  2OLO A;  2ZBW A;  3D1C A;  5C3J A;  3AYL A;  1S2Y A;  3ALJ A;  2V5Z A;  1K0L A;  3UKK A;  4B64 A;  2XYO A;  1JU2 A;  4USR A;  2GB0 A;  2B7R A;  3GYJ A;  3NTA A;  4YKF A;  4H7U A;  4K5S A;  4CNK A;  2Q0K A;  5ER0 A;  1ELI A;  3V3O A;  2Y6R A;  1O5W A;  1UKV G;  4DGK A;  5U63 A;  5IQ1 A;  3DA1 A;  1PDH A;  2GMH A;  3P4R A;  1MXT A;  3VR8 A;  4Y4M A;  3CGB A;  4Z44 A;  2C72 A;  4CCQ A;  1COY A;  3AD8 B;  5U25 A;  2WU2 A;  1E1K A;  1QJD A;  3DJG X;  4HA6 A;  4BJZ A;  4A9W A;  2YLT A;  4U8P A;  1O94 A;  3OC4 A;  2XFP A;  2WHD A;  2X99 A;  1KSU A;  1DJN A;  5EB4 A;  1GPE A;  3LXD A;  1BGN A;  4EQW A;  2Q7V A;  3PS9 A;  1IJH A;  1VG9 A;  1NDA A;  2OAM A;  2GR3 A;  4BK1 A;  5JCL A;  1H86 A;  1YKJ A;  1LPF A;  5JCI A;  3ISH A;  5FMH A;  1PHH A;  3SFD A;  2QCU A;  3CIR A;  4G6H A;  2TMD A;  2BK3 A;  3M13 A;  4AT0 A;  4BK2 A;  1H7W A;  3SM8 A;  2BK5 A;  3K7Q X;  1KSS A;  3DK8 A;  1ZKQ A;  2VOU A;  4II2 A;  1DOC A;  1VG0 A;  1E1N A;  5KWF A;  3QFB A;  1IUX A;  2NPX A;  2XVI A;  2YLW A;  3T31 A;  2WDV A;  2YG4 A;  1H82 A;  5KMS A;  3H8L A;  1AOG A;  1Y0P A;  2XVH A;  4GUV A;  4OPG A;  1NEK A;  2WP5 A;  1GRA A;  2BS3 A;  2YWL A;  5FS9 A;  2JK6 A;  3NNE A;  2CVJ A;  4AOX A;  1F6M A;  2APG A;  5BVA A;  4OPU A;  3FPZ A;  4TM0 A;  3UOY A;  2LFC A;  4G73 A;  1RP0 A;  3M12 A;  1FOH A;  1S2Q A;  2C4C A;  3UTG A;  1EL8 A;  4REK A;  1LQU A;  1CF3 A;  3DJD A;  4K8D A;  1K0J A;  1VQW A;  4TLX A;  4H2R A;  5KNL A;  4WCT A;  3SY4 A;  3ABV A;  5JCN A;  1B37 A;  4WX1 A;  1Q1R A;  3DGZ A;  2W0H A;  3AYI A;  3GD4 A;  3C4N A;  2ZZB A;  4EIP A;  3QSS A;  2JKC A;  3LAD A;  1DJQ A;  1FL2 A;  1XPQ A;  3SZW A;  4DSG A;  3AE8 A;  2WES A;  2C3D A;  3T14 A;  4NEW A;  4XWR A;  3KKJ A;  1GRE A;  2CFY A;  3DJJ A;  3NH3 X;  2BC0 A;  3UP4 A;  1ZP0 A;  3ATQ A;  2VQB A;  5HXI A;  1QO8 A;  3CNJ A;  1GND A;  2WPC A;  2PHH A;  3SGL A;  1YQ4 A;  3VRA A;  1IUT A;  2QAE A;  3DJE A;  4IVO B;  2VZ2 A;  3VQR A;  1K0I A;  4X9N A;  4H4Z A;  4D03 A;  1KF6 A;  2WDQ A;  2IID A;  4JNQ A;  1P2E A;  5C2T A;  3VR9 A;  2BAC A;  1Q9I A;  3GYI A;  1MOK A;  4H50 A;  1EBD A;  1PBB A;  2IVE A;  2DKH A;  1F8R A;  3SZC A;  5HYM A;  1PJ7 A;  2AR8 A;  4H4W A;  1FEA A;  1Q1W A;  4OCG A;  4CBQ A;  4X9M A;  3UKL A;  3UTE A;  4U8I A;  1FEB A;  5KMQ A;  4CCR A;  3CNP A;  2Q0L A;  3GRT A;  2YLR A;  2YR6 A;  4J31 A;  2H89 A;  4EMI A;  1CHU A;  1F8W A;  2C76 A;  3DGH A;  3V3N A;  2XLT A;  1VRQ B;  4H4Q A;  3FMW A;  3UTH A;  4FX9 A;  3AE9 A;  2PYX A;  4B67 A;  2XVE A;  3QVP A;  3CPH G;  3F8R A;  4EM3 A;  3AB1 A;  3P4P A;  2GH5 A;  1MO9 A;  1PXC A;  1X31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...