5C3JA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
616
structure length
616
Chain Sequence
b'SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 216
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c3jA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c3jA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c3jA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c3jA04
3AECA 4Z2RA 3ALLA 3D8XA 5IQ4A 1EL5A 1Q1RA 1KNPA 2ARDA 2C7GA 2VRMA 3DK9A 4HA6A 1H82A 1E1LA 3V76A 4H4ZA 1E1MA 2A87A 1E1KA 3NG7X 4FX9A 1OJCA 2YWLA 2LFCA 1ZK7A 4B69A 2XLRA 1PJ6A 3IHGA 2XFNA 3M12A 3P4QA 2VRLA 4EQXA 5C3JA 2Q0LA 3ALMA 3CNTA 2FJDA 2Q7VA 3GMBA 2VQBA 1GRTA 3GYXA 4J57A 2GQFA 3GD4A 4H4YA 5JCIA 2BK3A 1PBBA 1NPXA 4LU6A 2WQYA 3L8KA 1CBOA 1CL0A 4H4VA 3P9UA 2WDVA 2WOWA 4O5QA 5BUKA 3VRAA 4YTPA 3DJDA 1GTHA 2BK4A 2GMJA 2GR1A 3AEGA 4J56A 5JCMA 3EPTA 2GMHA 4J33A 4Y4MA 3ZDNA 3DJGX 1ZOYA 3IWAA 4HB9A 3FMWA 4EM3A 1YQZA 1GRBA 1YQ4A 4EQRA 4KX6A 4B66A 2IVEA 4YSXA 1QJDA 3NN0X 2WPCA 2C67A 3UTFA 3BI5A 4H4TA 1GPEA 2R45A 3QJ4A 2A89A 3AE5A 3G5SA 4OCGA 3CGBA 1TDFA 3G5RA 2RGHA 3II4A 3WE0A 3DGZA 3KLJA 4AT0A 3JSKA 2JB2A 2OA1A 3VR9A 3UKLA 5GRTA 4Z26A 2R4EA 2YLSA 3ITJA 1K4QA 2XVEA 3UTGA 2JBVA 2NVKX 1VQWA 5DBJA 1BGNA 4BK2A 1ZMDA 3ATRA 3AD7B 3NYEA 1DOCA 1NENA 2CFYA 1ZX9A 4NEVA 3QFBA 4O5UA 2IVDA 1RYIA 4UDQA 1N4WA 2X50A 2EQ8A 2XVIA 1BZLA 2TMDA 3H8LA 3DJEA 1ZOVA 1GRGA 4H2QA 4USQA 2APGA 4Z44A 2BK5A 2H89A 3AE9A 4ZN0A 2FJBA 1D7YA 1H6VA 2YLZA 4U2TA 4B64A 2VVLA 2YVFA 3P1WA 3AE7A 1PBCA 3CNSA 3KPFA 4H4RA 2A8XA 4D03A 3UP5A 2O9ZA 1O95A 3EANA 1TDOA 1LTXR 3GYIA 1CJCA 4XWRA 2JKCA 2XVFA 4K2XA 3B6DA 4U8PA 1PXBA 1Q9IA 5KWFA 2GRTA 2E4GA 2RGJA 2BS3A 1B37A 1VRQB 1CJ2A 1GXFA 2AR8A 3KU9A 1FEBA 2E5VA 1D7LA 2WP9A 4JNQA 4AT2A 3GD3A 4Z2UA 3BHFA 3M13A 5LV9A 1GRFA 2BCGG 3QVPA 3DGHA 3REDA 1H86A 2B9WA 3RP8A 1ONFA 3KD9A 4OPCA 3RP7A 1GOSA 4X9NA 2R9ZA 2YR4A 1B5QA 1PBEA 3NNEA 2PHHA 1PJ7A 1Y56A 4B63A 1S2YA 1H83A 1CC2A 4H4QA 4H2PA 2Y6RA 3AB1A 4C3XA 1CHUA 1EL7A 1PXAA 4J2WA 3IF9A 4ICYA 4NTDA 4U8IA 3F8DA 2OLNA 2E1MA 2YG3A 4UDPA 5FS8A 3AYIA 3AYLA 4IVOB 4K22A 3AE2A 3UTEA 3CGCA 2Z5YA 1BKWA 4YKGA 1CJ3A 4X4JA 2RABA 2XVJA 1IUUA 2Z5XA 2ZZBA 4EQWA 4DSGA 3AEDA 3EF6A 2XVHA 2BS2A 1L9EA 2YG5A 4M52A 1JNRA 1OJDA 2WETA 2C66A 1S2QA 3AWIA 4YKFA 3BI4A 3COXA 1PHHA 1GEUA 4A5LA 2JB1A 4GCMA 1CF3A 2BACA 1K0IA 2R0PA 1PJ5A 2YLTA 3I3LA 3F8PA 3UKAA 1YKJA 3QVRA 2WHDA 4EIPA 4AOXA 2EQ7A 1RSGA 3UP4A 3VRDB 4TM4A 4B1BA 3DK4A 4Z25A 2QA1A 1JRXA 1PDHA 2GAHB 5TR3A 3AE3A 1LQTA 1GTEA 1E6EA 1TDKA 4NTEA 4H4SA 4Y4NA 1FOHA 2WP5A 4YSYA 4YT0A 2IIDA 1YY5A 2NPXA 4TLXA 5JCNA 2PYXA 3C96A 3CNJA 1B4VA 3UTHA 2B9XA 1E1NA 4CBQA 2FBWA 2EQ6A 2WPEA 4RG4A 3AE4A 4EMIA 2WDQA 3SUCA 2WS3A 3T37A 3CPIG 3CN8A 1NHRA 4U8NA 4B65A 4BJYA 3UCLA 2X8CA 2QA2A 3ATQA 3GDPA 3AE8A 1XHCA 5IPYA 5KVHA 4OPLA 4CCRA 4TM1A 1NHSA 4OPUA 4Z24A 4TM0A 3GQKA 1LQUA 3C4AA 2XCGA 2VVMA 3AEFA 3LJPA 4AP1A 4A6NA 3ADAB 1CC6A 4CRTA 3ZYXA 1JRZA 3GRSA 4TLZA 4BJZA 3UKFA 1Y0PA 1LV0A 1W4XA 4A7AA 1REOA 1GT8A 2H88A 2W0HA 5FMHA 1KDGA 4H2NA 2BC1A 1B8SA 2CVJA 3UKHA 1K0JA 3AXBA 4GDEA 2JAEA 2WU2A 2BCPA 1NG3A 2WESA 4AOSA 4ZCCA 5M0ZA 3V3OA 2YR5A 4DSHA 4JNAA 3GSIA 3NTDA 3IC9A 1F8SA 2QAEA 4FK1C 4U2LA 2FJAA 2XFQA 3CPJG 2X8HA 1LVLA 3B3RA 1O5WA 3GDNA 3GWFA 1TYTA 3P4SA 2GF3A 2WP6A 1SEZA 3GRTA 3NK2X 2AAQA 2Q0KA 5EB4A 5HY5A 2YLWA 1LPFA 5FS9A 4D04A 3NYCA 4GRTA 1TRBA 5EBKA 4FK1A 1MXTA 5KOXA 3OZ2A 3NLCA 1GNDA 2YVGA 2YG7A 2Y6QA 2V61A 4A79A 2WU5A 2C75A 4IA5A 2YVJA 3M0OA 4U8OA 1CC4A 4E0VA 1V59A 4ECHA 1H7WA 4REKA 3RNMA 2XLSA 1LJ1A 1GETA 1GESA 2BC0A 2XLTA 1GERA 1PXCA 3DJJA 3AYJA 1N4UA 2B9YA 4JN9A 3ICRA 3KA7A 5KOWA 2QCUA 2XDOA 3FIMB 5U63A 5J7XA 4YTMA 4JY3A 1JRYA 3K7MX 4H4UA 5BULA 3K30A 1TYPA 3SM8A 1JEHA 1O94A 1D4EA 4AP3A 4PAAA 4GR1A 4UP3A 2EQ9A 1L9DA 3FPZA 4JQ9A 4DNAA 4NZHA 3P4RA 3Q6JA 1KNRA 2WOVA 2X8GA 2YM1A 1ZMCA 2BS4A 4YSZA 3NIXA 4OPTA 4Z43A 3CNDA 1BF3A 2V5ZA 1L0VA 2UZZA 4WX1A 5L46A 3VR8A 3NHOX 1DXLA 3HZLA 1GRAA 2R0CA 4LA1A 5U25A 2X99A 3AD9B 1D4CA 1JNZA 1P2EA 3EAOA 2WEUA 1P2HA 1DNCA 1ELIA 2R4JA 1QO8A 3P4PA 1MOKA 2WBAA 1JOAA 2F5ZA 4Z2TA 4EM4A 1GALA 2C65A 4BURA 3VRBA 4NTCA 1K0LA 5KVIA 4WCTA 3AE6A 1AOGA 2C76A 2GQWA 4ZCDA 4A65A 4U8JA 4XXGA 1H81A 3FG2P 3BI2A 5HXIA 4EMJA 3AD8B 1RP0A 4OPGA 1Z6LA 4K5RA 2GR2A 1ZDLA 2C64A 4BV6A 2HQMA 1BGJA 3URHA 2Q6UA 4OPIA 3ICSA 2GEWA 3RHAA 1DJQA 3NRNA 3QSMA 2GAGB 5ER0A 2YLRA 1COYA 2VOUA 4GF7A 1L9CA 1HYUA 1UKVG 1PBDA 2C73A 4NEWA 4TM3A 1PN0A 2VZ2A 3NTAA 1DJNA 1M64A 4KPRA 1XPQA 4CNKA 4K8DA 1M6IA 3LXDA 2TPRA 3SQPA 2YG4A 4C3YA 1ZKQA 3BNMA 3UOYA 1IUTA 3CTYA 4U8LA 3E1TA 2GV8A 3Q9TA 4U2SA 3I6DA 3LZXA 4CY6A 5KRQA 3NN6X 2CDUA 3C4NA 4I59A 5M10A 1CJ4A 4H4WA 3AEBA 1GV4A 2J3NA 4I58A 2GR0A 2V3BA 3CGEA 2YLXA 2R46A 3BNUA 1YQ3A 4RG3A 5EB5A 3UOVA 3V3NA 1F8WA 1FEAA 4YSHA 2GR3A 4MJWA 3H4KA 4P9SA 4CNJA 5HHFA 2C70A 1OJTA 1D5TA 1F3PA 2V6OA 3PO7A 4H4PA 2BYBA 4YWOA 4J31A 1E39A 2YR6A 5J60A 2XFPA 1Q1WA 1NHPA 3ICTA 1FECA 2OLOA 3UOXA 2C72A 3SFDA 1NHQA 2XLPA 3IHMA 3NKSA 5JCLA 1KFYA 1ZY8A 1E7PA 1EL8A 1S3EA 3QFAA 4FDCB 4JDRA 4EMWA 1VG0A 3FBSA 2C3CA 1XDIA 4U8MA 1PS9A 1N1PA 1BWCA 4H4XA 5CKUA 3DA1A 1H84A 2JB3A 2VVLG 4GUVA 1QLBA 1NDAA 4A6NB 1DOBA 4CCQA 1DODA 4XWZA 2CULA 3SGLA 4X9MA 3UKKA 4EQSA 5FS7A 1GREA 1XANA 3G5QA 1KF6A 3GMCA 3NK1X 4C74A 2OALA 4H2RA 2GH5A 5BVAA 2GVCA 2XYOA 2C3DA 1TDEA 3LADA 3F8RA 1IUSA 4C77A 3NGCX 2YQUA 4Y4LA 3DH9A 2ZZ0A 3ISHA 4IVMB 4N9XA 2JK6A 1F8RA 4APNA 2R0GA 5JCKA 2ACZA 2WPFA 3NK0X 4IV9A 2V60A 2YAUA 4USRA 1H7XA 4C5OA 3DMEA 1KSUA 1OJ9A 5IQ1A 3BHKA 5U1OA 4U8KA 2XFUA 4OPDA 2XFOA 5FS6A 2AQJA 3SFEA 1IUVA 2X3NA 4YXDA 1KSSA 4K5SA 3H8IA 3O0HA 1VDCA 4H50A 1N4VA 2XLUA 3PVCA 4ADWA 5BRTA 1EBDA 2YM2A 1PBFA 1TDNA 1X31B 2V3AA 5C2TA 1IUXA 3K7QX 5CQFA 1F6MA 1MO9A 2BXSA 2YG6A 4YTNA 3PS9A 3S61A 3UKPA 3NH3X 4JY2A 3GYJA 1IUWA 5EOWA 1NEKA 4RSLA 5KXJA 1GSNA 1FL2A 3KVEA 2BABA 3VQRA 2B76A 3L1RA 4LIIA 2B7SA 4UDRA 2FJEA 3LOVA 2WOIA 1JU2A 2GB0A 3AE1A 4GDPA 3OC4A 1DOEA 4B68A 4BK1A 3KKJA 3CIRA 3CNPA 1VG9A 1EL9A 3NT6A 4A9WA 3DK8A 3UOZA 4BK3A 3CPHG 2B7RA 5HYMA 3QSSA 4K7ZA 4A99A 4DGKA 1D4DA 3NYFA 5GSNA 3UKQA 3QSEA 2BA9A 4H7UA 2DKIA 3D1CA 2OAMA 1Y56B 2RGOA 1OJAA 3ALJA 4OVIA 4J36A 1NAAA 3S5WA 3LZWA 3RP6A 2VQ7A 1IJHA 4B67A 1FCDA 1ZP0A 2WDRA 2ZZCA 4PABA 3R9UA 1S3BA 4CY8A 3GWDA 1GRHA 3GQHA 3CGDA 2ZBWA 4J34A 2I0ZA 3K7TA 3LB8A 4EIQA 3AEEA 1NG4A 2BXRA 3ABVA 3AEAA 4IA6A 2DKHA
chains in the Genus database with same CATH superfamily
4Z2RA 5CA0E 3ALLA 4WYVA 1KNPA 2C7GA 3E22E 4GAPA 4H4ZA 1E1MA 1OJCA 3IHGA 1PJ6A 2R064 3HYXA 5C3JA 3CNTA 2FJDA 5FXZA 4COFA 3HKDE 3C4ZA 4H4YA 1PBBA 5KX5E 4LU6A 2P9BA 2V7MA 4GIWA 1CL0A 1XHZA 4OFZA 2WOWA 2PW9A 3VRAA 2C4CA 3BQKA 2GK9A 1D4M4 3WI3A 3AEGA 5JCMA 2X9XA 4QH4A 3EPTA 3IWAA 1GRBA 2C67A 5F8PA 2XQAA 4H9SE 5HEUA 3AE5A 3G5SA 4P1NA 2UUAT 4XBFB 4GK0E 2R6GF 3DGZA 1LKXA 4AT0A 3VR9A 4H9NC 1K4QA 2XVEA 2X9YA 1VQWA 4A56A 2WWVA 4HKAA 2CFYA 1ZX9A 4O2BE 4QKNA 2YU2A 3A5XA 5FYMA 3QFBA 4QX7B 3U3IA 2XVIA 1BZLA 2TMDA 2W0GA 1ZOVA 2CWOA 1GRGA 4USQA 4Z44A 1SE7A 2BK5A 4ILBA 4YY3T 2FJBA 3N9LA 1H6VA 4U2TA 1POV0 4B64A 2XY8B 1DU2A 3QB5K 4ZI2D 5AQTB 4BA9A 3L09A 1O95A 1TDOA 5JDMA 4K2XA 1OWAA 1PXBA 3CQXC 2HPJA 5KWFA 4FI5A 4M1PA 3OTOT 3UULA 3RHWA 4JNQA 1ASJ4 3BHFA 1GRFA 2JQKA 4H63V 3DGHA 3REDA 3GMIA 1ONFA 3KD9A 2BZBA 3JCFA 4DV6T 3AXJB 4ZS3A 2F4VT 1SHZC 2YR4A 1QSDA 1PBEA 1Y56A 4K0UA 1H83A 3ZC1A 1CC2A 2VVNA 4DBRA 4C3XA 1PO24 1WLXA 4ICYA 2BG9A 2OLNA 4UDPA 3AYLA 4G63A 4DV7T 4K22A 3CGCA 1RUE4 2Z5YA 1SA0E 1BKWA 3J8F4 4X4JA 4ANJA 2RABA 5F3JA 2HHHT 3Q5DA 2XVJA 2Z5XA 2ZZBA 3LDQB 4IDQA 3EF6A 2FUPA 3HKBE 2V1DB 2YU1A 1JNRA 3UU6A 2DNXA 4HFHA 1S2QA 4YKFA 5BR8T 5L4EA 5JRCB 4LF9T 3UKAA 3F8PA 2Y48B 5AFUL 4WBOA 2E9XB 2KLQA 4UELA 4QXCB 4Z91A 2CHNA 2HN2A 2QA1A 4KUMB 1PDHA 3D0TA 4UV8B 3PUZF 2WP5A 5JR9B 4YT0A 2UXBT 4DVDA 1D0XA 4TLXA 2LKHA 4HFBA 2PYLA 1W0BA 1RUD4 2B9XA 2FBWA 2EQ6A 2WPEA 3FZLB 3SUCA 4II2A 2WS3A 4JUYA 2LSGA 3CN8A 4U8NA 4B65A 4BJYA 3UCLA 2JPFA 2QA2A 3ATQA 1XHCA 5KVHA 2VVSA 4TM1A 4KI0F 1OXZA 3C4WA 4TM0A 3GQKA 2VVMA 3RQWA 1CC6A 4CRTA 3GRSA 4TLZA 4BJZA 2LE8A 1W4XA 2IC9A 5L2LA 2W0HA 4QHOA 1K5MD 2LHRA 2M67A 2CVJA 4MHCA 3ZMTB 3N2OA 1K0JA 2H3RA 2JAEA 2WU2A 4TNWA 2HWB4 3ZJ1A 2WESA 4ZCCA 3GSIA 3RC3A 3IC9A 3MJXA 2XFQA 1S94A 3L39A 2R074 4WW0A 1O5WA 3O9XA 3GDNA 3ZLIA 5A1LA 1HR0T 3GRTA 3NK2X 2H7OA 2Q0KA 2YOEA 5FNVE 4XZCA 2LSJA 3ZYKA 5EBKA 1MXTA 3IHRA 4IA5A 3LFMA 4U8OA 3KV4A 4U2YA 5EK3A 1PXCA 2MAWA 2X66A 3ICRA 5AQSB 3KA7A 3OYZA 5KOWA 3KDSE 2XDOA 4PFOA 5U63A 4IE7A 2VKJA 4YTMA 4JY3A 3C51A 3K7MX 4L5GA 3K30A 1JEHA 4GR1A 2XSAA 4Z8XA 5C8YE 3UUNA 3DJBA 3P4WA 1ZMCA 4Z43A 1BF3A 1L0VA 2UZZA 5L46A 2PG8A 3VR8A 4U33A 1P2EA 1JNZA 1H7CA 1BR2A 1P2HA 2WBAA 1JOAA 2EHOC 2QVAA 3PDYA 2LLYA 1XNQT 2WZHA 2WB5A 3PUQA 4I50E 3FBLA 4NTCA 5KVIA 2BG9B 2X67A 2GQWA 1J5ET 3KBUA 5BMVE 1CUNA 5HAXA 5HXIA 2GR2A 3EUHA 1XMQT 3URHA 4A5XA 4H9RC 1COV4 1DJQA 4Z90A 3WAKA 2GAGB 5ER0A 2A3DA 4NUVA 3JC6C 1HX1B 1HYUA 1PBDA 4NEWA 4JI8T 3KV6A 3Q5XA 3NTAA 4KPRA 4CNKA 4EV6A 4C3YA 2XQYA 3UOYA 1IUTA 1J1JA 3E1TA 3NVOA 2KSRA 3I6DA 3LZXA 5JDLA 4B3RT 4NXNT 1CJ4A 4O8SA 1MMNA 2V3BA 3UOVA 3ZJ2A 4RG3A 4UXNB 4YSHA 4MJWA 3VHLA 2W00A 2J62A 4CNJA 1OJTA 1D5TA 1F3PA 2V6OA 4CN4A 1E39A 5LJNA 3UOXA 1HTJF 3I0OA 1NHQA 3IHMA 5JCLA 1E7PA 2ACXA 4FDCB 3FBSA 4CQIA 3ZYLA 2VVLG 3GN5A 5AQNB 4XWZA 2A72A 5FS7A 2MPKA 2VQET 3FZMB 2LT3A 3NK1X 4C74A 2OALA 4H2RA 2GVCA 2IDOB 4EGWA 4C77A 2YQUA 3DH9A 5JDQA 3AAAB 2ACZA 2WPFA 3PE0A 5H6QB 3DMEA 4ASKA 4B3ST 5IQ1A 5ABGA 1H8TD 2NTYA 3BHKA 2XFUA 2AQJA 3SFEA 4WNKA 1B7TA 2YDSA 1LRZA 4YXDA 4G9KA 3H8IA 3ZN1B 3O0HA 2NTXA 2XLUA 4ADWA 1X31B 2V3AA 5DJQC 1IUXA 3K7QX 3O1HA 2X0LB 3S61A 5EOWA 1IUWA 1Z0PA 3NRYA 3E08A 5KXJA 3EVYA 4CXWA 4HE8A 3VQRA 4UDRA 2FJEA 1JU2A 2GB0A 1DOEA 4B68A 4A9WA 4BK3A 3UOZA 3RYIE 4LF5T 2Q9QD 4PJJA 3ALJA 3I9YA 3S5WA 4U74A 4K0KT 1R8IA 2QA7A 2V6XA 3GWDA 4X1YE 5TAOA 3K7TA 3LB8A 4EIQA 1NG4A 2BXRA 3LBXA 5JVDE 4HA6A 2W4XA 3OYXA 4FX9A 3NG7X 2LFCA 3O1IA 5HXCA 2YWLA 2XJ7A 5HEJA 4V1Av 3FZHB 2K48A 4PW8A 3SZ0A 3P4QA 2VRLA 4PFPA 1QUUA 4HN9A 2XASB 2DL1A 1YD8G 5LG4A 2Q7VA 3GMBA 1OEDC 1HNZT 2PLV4 5FVKA 2GQFA 5JCIA 2WQYA 2LRLA 3E0ZA 2XAJB 4JI1T 2WDVA 4O5QA 2N2NA 3FZFB 3AVSA 3FHNA 4QH1A 2GMJA 5L3BB 5L4HA 1VCSA 1KNZA 4HB9A 4EM3A 3OVUA 3RKOA 4IHJE 4YSXA 3NN0X 2PY5A 4EIWA 3ZMZB 4JBWF 5L3GB 4H4TA 2V6YA 3LK3B 2R45A 3T2KA 4OCGA 1TDFA 3G5RA 3II4A 1VRH4 3UKLA 3ETUA 4Z26A 4LF7T 2R4EA 2YLSA 2E2AA 4OHFA 3UTGA 2JBVA 3N9NA 3IF8B 3ATRA 1DOCA 4U7IA 1N32T 2KWHA 4O5UA 4L0RA 2X50A 2V5DA 4AQFC 3SZCA 5LXTE 1NA1D 5KMGP 2VVLA 4ILUA 3AE7A 3FXDB 1PBCA 3CQGB 5AQHB 4TN7B 3UP5A 3CK6A 1LTXR 4A98A 2HH7A 4MALA 4XWRA 2JKCA 2XVFA 4U3CA 3NZQA 3FXEB 3ZYMA 4PJMA 2E4GA 2VKHA 3EDUA 2BS3A 1UUSA 2C5KT 2WBLA 4I43B 2EHOD 4EZHA 2WP9A 4ZXLA 2BCGG 3PV0F 2ES0A 4PJLA 3TLUA 3TLVA 4JI2T 1H86A 5LYJE 4OPCA 2R9ZA 5KMPA 4UV9B 4LF8T 1XWMA 2VKDA 4YHJA 2X68A 4DV5T 4H2PA 1EL7A 2NW7A 3JC6D 4J2WA 3PUWF 4NTDA 4U8IA 3F8DA 2YG3A 2BKNA 3HI2A 3AE2A 4IE6A 4ZI3C 3SXIA 5J2UE 3ZPOA 3AEDA 2XVHA 1L9EA 4M52A 3ZKRA 2WETA 5LMNT 5FVLA 4H9QC 3OBVE 2RMU4 1GEUA 3ZC0A 1CF3A 1EV14 1PVC4 1PJ5A 3L8RA 2DCFA 1YKJA 1V9DA 4PDWD 3UP4A 1RSGA 3VRDB 1IJ6A 5CJ5A 3K3NA 2LKGA 2MYSA 3RRCA 3AE3A 2EX3A 1GTEA 5EK2A 1HRI4 1MNDA 1TDKA 4IREA 2CMRA 4CN6A 4X64T 5JCNA 3LBXB 3C96A 4GYRA 3CNJA 1XI1A 3UTHA 3N9MA 1WRDA 3HR0A 2VQFT 3AE4A 1UX4A 2WDQA 3UUMA 4QX8B 3T37A 3CPIG 4GAVA 2V7IA 1NHRA 2BBJA 3J7Yq 3GDPA 2ZM8A 4ZI7E 1NHSA 4OPUA 4Z24A 3ESLA 4H9OC 2KZ7B 2I59A 2XQ6A 4ISTA 4U2ZA 1I6ZA 3ZYXA 4AKLA 2QYWA 4DR2T 2XTLA 4CI2B 2JJ9A 4A7AA 2PYJA 4JI0T 3P50A 2H88A 1OEDB 5HEOA 2CXDA 2WM9A 4EEBA 3K3QC 4GDEA 1EAH4 2KNDA 2BCPA 5M0ZA 3V3OA 2YR5A 1G73A 4JNAA 3NTDA 4QWNB 2QAEA 5FXVA 1UK5A 4DO0A 1N34T 3LK42 4U2LA 5LBQB 3FB2A 4MFRA 1BR1A 3HYWA 3GA8A 3KVBA 1ZV4X 3B3RA 2MOZA 4DNDA 3JBG4 3GWFA 1TYTA 2BVMA 3UU8A 2AAQA 2J1DG 4G6GA 3T1YT 2MBGA 4GRTA 4NUUA 1AR64 3OZ2A 3UQ7A 2Y6QA 2V61A 4A79A 2XQ8A 1XDPA 3A7MA 2ZM2A 4EYYR 2BG9C 3I1AA 4Q4Y4 1T8BA 3DJJA 3T2YA 2YN6A 3AYJA 2LJLA 1N4UA 2B9YA 4CI1B 2YDQA 3PUGA 4DV1T 4O2AE 3A8YC 3UUXB 4AP3A 4HTEA 4ZOLE 1L9DA 4DR4T 3UUBA 4ILCA 4NZHA 3Q6JA 1KNRA 1GQEA 2YM1A 4OPTA 2C0SA 2V5ZA 5FY7A 5ABHA 3NHOX 3HZLA 1GRAA 2R0CA 2NR4A 2WZIA 2WSSV 4DV0T 4LF6T 4TNVA 3CMLA 2X99A 2Y8DA 2R4JA 3ANWA 4Z2TA 4JYAT 4DV3T 2C65A 4BURA 5L47A 1K0LA 4WCTA 1AR84 1AOGA 3MXZA 4U8JA 4XXGA 2L8KA 3FG2P 2E8IA 2CXFA 1RP0A 2G0UA 4K5RA 3T2ZA 1ZDLA 2C5IT 2V5CA 4X20E 3AAIA 2Q6UA 2K9AA 1O3XA 3RHAA 2V8SV 4DBQA 3QSMA 2HPLA 3N9QA 1COYA 2VOUA 3ZEFB 5HEGA 2C73A 2UUBT 4UVAB 1UX5A 2I0MA 1D1BA 3QB5A 2YG4A 4TWHA 2ODUA 1ZKQA 3S4UA 3BNMA 2SPCA 4NXMT 5CB4E 3CTYA 4U8LA 4EAHA 3Q9TA 4U2SA 5KRQA 3NN6X 2CDUA 4AI6A 3C4NA 4I59A 5M10A 2RP4A 4DR7T 3RKGA 4YJ3E 4L9IA 1YQ3A 5IUXA 1UURA 1NWMX 2KINB 5GONE 2GR3A 5KDMC 5HHFA 2C70A 3CMMA 3PO7A 4H4PA 3LSVA 1Q1WA 3PUVF 2Q9QA 2OLOA 3SFDA 2XLPA 2ZMAA 3NKSA 3SX6A 1S3EA 4EMWA 4P09A 2CE7A 3R84B 2E9XD 1BWCA 3DA1A 4QH5A 1DOBA 1DODA 4PJNA 2CULA 3Q5EA 1GREA 3GMCA 1KF6A 2I6HA 1IUSA 3V5SA 4DR3T 2PJQA 4EXTA 2ZZ0A 1F8RA 3PUAA 2V60A 2YAUA 4Q4W4 1VBD4 1OJ9A 4OPDA 5FS6A 2RR14 4ZHQE 2CA5A 2HWC4 4B6XA 4H50A 1N4VA 3RRWA 3PVCA 2XQ3A 3RI5A 5BRTA 4I0UA 1PBFA 1TDNA 3UT5E 2BG9E 3NWIA 5CQFA 1MO9A 2LEHA 4X5TA 4A97A 4YTNA 2RS14 1PO14 1MMAA 1GSNA 2UXDT 2YK0A 1IBKT 3H3MA 5LG3A 3LOVA 4GDPA 5JDNA 1BEV4 5DABA 3CIRA 3N9PA 1R084 3ZCJA 3QSSA 1D4DA 3NYFA 5GSNA 1N33T 4ERRA 4X65T 2DKIA 2WMNA 4LFCT 2OAMA 1Y56B 2RGOA 1NAAA 2PFVA 2QRXA 1NCQD 1FCDA 2VB6A 2WDRA 3FI7A 1WFDA 5AQMB 2DHRA 4AKRB 2I0ZA 3QC9A 3AEEA 2PZSA 4HEAA 3AECA 3D8XA 5IQ4A 5HXRA 1Q1RA 2ARDA 2VRMA 5HEHA 3V76A 3ETVA 4TZ4C 1E1KA 1ZK7A 2UXCT 2X0YA 2XFNA 5JDHA 4DV4T 2BKPA 3ANWB 4EQXA 2Q0LA 3ALMA 1GRTA 4DMVA 3GD4A 2BK3A 1NPXA 3P7IA 4WBNE 1VCTA 3L8KA 2NWBA 4H4VA 5LCYA 5BUKA 4TV8E 4ILAA 4YTPA 3BK9A 1HG5A 2BK4A 4KBMB 2GMHA 1KEYA 4Y4MA 3ZDNA 3GQHA 3FMWA 1YQZA 1YQ4A 3L3PA 4KX6A 3KBTA 2IVEA 3BI5A 5LBMA 3RX6A 5E0OA 4HWDA 3QJ4A 3ZT5A 2X51A 3CGBA 5CFBA 1G8XA 3MA9A 3WE0A 2ZM6T 2VK9A 2VL8A 3KLJA 3JSKA 2OA1A 5HYAA 3C98B 3ITJA 3Q2MA 1M7KA 5LNKA 1BGNA 3T1HT 1ZMDA 1HX8A 3UU3A 3AD7B 1NENA 2CXLA 3CVRA 3B57A 4NEVA 2IVDA 2EQ8A 3G06A 3H8LA 1R094 3HKCE 4H2QA 3TLTA 1ZHCA 4TUYE 4ZN0A 1D7YA 1YW0A 3BQLA 3ONXA 3P1WA 4D03A 2A8XA 2XQ4A 1W0AA 3NRXA 3ZMVB 2AE9A 3SOLA 2O9ZA 4EEDA 1ZEEA 5AQUB 3EANA 1CJCA 5EK4A 3LK2B 3B6DA 1Q9IA 5IHYA 3V5UA 2CCQA 4X62T 3FZKB 4JV5T 1IZNB 4TV9E 5LOVE 1B37A 3F2EA 1CJ2A 1VRQB 2E5VA 4U72A 4AT2A 1YXRA 3GD3A 5LV9A 2A9UA 1MIYA 1W9RA 5JDGA 2V26A 4Q25A 2B9WA 5KNLA 2LOPA 3GWHA 5AQJB 3RP7A 4X1KE 3ZT6A 4F6RC 1T7SA 1B5QA 3NNEA 2PHHA 2E5LT 4B63A 5AQQB 1S2YA 4YHHT 3SZWA 2CHOA 1CHUA 2NW8A 1PXAA 3VKGA 4YFSA 2VL0A 2WMOA 4IVOB 3KINB 4YKGA 3VKHA 2DWKA 2W62A 2XQ9A 4ZI2C 4JI7T 1IUUA 1KK7A 4EQWA 3AA0B 4BAYB 2BS2A 2M6IA 2PBIA 2KXPB 5AQGB 3WAJA 1HXS4 3K8PC 3BI4A 4O4JE 3T14A 1YKEB 4A5LA 4GCMA 3N2GE 1K0IA 3I3LA 3RYCE 2IW5B 2WHDA 3RC8A 3F57A 4AOXA 3QK6A 5L3EB 4TM4A 5IWAT 3DK4A 4B1BA 4Z25A 5LHHB 3TKLB 4X66T 1RHI4 2RS34 1E6EA 1IBMT 4Q4X4 4NTEA 2OLTA 4H4SA 4Y4NA 1I94T 1FOHA 2NPXA 3OPCA 2JRKA 3MK7C 3MACA 4EYUA 4UEMA 4UF0A 1E1NA 4CBQA 3JAEA 3C4XA 2L3LA 3X1DA 5KMRA 4C91A 4ADZA 4GB34 2A2FX 3K3OA 1FIOA 3N9OA 4HFCA 3ZSTA 3AE8A 3PJAA 5IPYA 1ZKEA 3SRZA 1RUJ4 2IMLA 4IL9A 2XQ7A 2VWAA 1LQUA 3C4AA 2CBJA 5AQVB 3LJPA 4I4TE 3ADAB 2RS54 3JD74 3UKFA 4CXYA 1LV0A 5AQIB 5FMHA 4PNIA 2JIWA 4H2NA 2WY2A 1RUI4 2BC1A 3UFEA 4DUYT 3UKHA 2UXNB 1XZYA 1NG3A 4AOSA 4UIGA 3QNUA 2K24A 5JH7E 2FJAA 3RIUA 3CPJG 5FP3A 2X8HA 4EB6E 2N1GA 3P4SA 2GF3A 2CBIA 2WP6A 1SEZA 1VBE4 1S35A 5EB4A 5HY5A 2XAGB 3GN5B 2YLWA 2W67A 1TRBA 1U4QA 4CZZB 1VBC4 1GNDA 4PK4A 2YG7A 2YVGA 1HCIA 2WU5A 4AXPA 1CC4A 4E0VA 1V59A 1MMGA 1WYCA 2K3WA 3JAFA 2D2SA 3RNMA 2XLSA 2BC0A 2D0UA 4DR6T 4JLEA 2NOXA 5AQRB 5LHGB 2XM1A 2AXDS 2QCUA 2D5UA 1HG2A 3FIMB 2JMKA 1UCUA 4GKKT 1OOPD 3SM8A 1O94A 1D4EA 4PAAA 4UP3A 2EQ9A 3FPZA 4CXXA 4JQ9A 4DNAA 3EHZA 3CPZA 4H9PC 3U78A 2WOVA 2X8GA 1VBA4 2BS4A 2XPKA 1LVKA 5M4YA 3AAEB 1AJ3A 4O4LE 3CX8B 2YEVC 3B5MA 4LA1A 1RUH4 5U25A 3AD9B 1Y64B 4ZZCA 5JRCA 3EAOA 5HXEA 2D0TA 3EI0A 4OX9T 3P4PA 1MOKA 2F5ZA 4OYKA 4EM4A 1GALA 4IDPA 3VRBA 3AE6A 2ZLYA 4FJOA 3PJAJ 4ZCDA 3RYFE 4A65A 3UQ4A 3F31A 1H81A 3BI2A 2N9DA 1E2AA 1Z6LA 4OPGA 5JR9A 2C64A 4E7ZA 4BV6A 5HWXA 4OPIA 2GEWA 4KHZF 3NRNA 4NPPA 3IA3A 4RHV4 2CLYB 1OEDE 3VU7H 1L9CA 1UKVG 3I9WA 4TM3A 2VZ2A 2XAHB 1M64A 2RA1A 1XPQA 4MLKA 4K8DA 1M6IA 3LXDA 3AA6B 5FKYA 3QUJA 2TPRA 3SQPA 3C50A 3CKDA 1E1HB 2CPTA 3PUSA 4HWCA 2GV8A 3JADA 3KVAA 4CY6A 3T31A 2CRBA 1M62A 4P0BA 1RVF4 4HFEA 1RUG4 4H4WA 2J3NA 2GR0A 3CGEA 5EB5A 2C5JA 1F8WA 5J1GA 3H4KA 4IE5A 1MQTD 3M3ZB 2BYBA 4J31A 4UF0B 2YR6A 3ICTA 1T98A 3KFWX 2UXXB 1UGOA 4DIDB 1KFYA 1N36T 2V6YB 4JDRA 2BKOA 3PTRB 2XAQB 3ZT7A 1XDIA 2XHEB 4U8MA 4H4XA 5CKUA 4GUVA 1QLBA 4CCQA 2IAKA 2LOSA 4X9MA 3UKKA 4EQSA 2GH5A 5BVAA 2W61A 3OKQA 1TDEA 3F8RA 2XQ5A 3NGCX 4N9XA 5JDFA 3IBPA 2R0GA 4IV9A 1HNXT 3T8OA 4USRA 1H7XA 3UU4A 1U5PA 2CM0A 4OK0A 4U8KA 4GOUA 5FL1A 2X3NA 4K5SA 4HWIB 1HF8A 1VDCA 5LGTB 1EBDA 2YM2A 2XAFB 5LGNB 1FMVA 2CEAA 4IT4A 4DUZT 2LRKA 1HNWT 3UKPA 2IHR1 4JY2A 3GYJA 1NEKA 2IC6A 4RSLA 1BR0A 2PTFA 3KVEA 2BABA 4TWDA 5AQLB 2Y6XA 2B7SA 5FY1A 4ZEYA 3CNPA 3CPHG 2B7RA 4UVBB 5HYMA 4DGKA 3UKQA 2JQ9A 2BA9A 3H3AA 5LJMA 3RGLA 1PIV4 3D1CA 3CQCB 3EABA 5LA6E 2JQQA 2Z6EA 4LMKA 4MBQA 4PABA 1ZP0A 2ZZCA 3R9UA 1S3BA 3MKDA 4JEUB 4O4HE 1GRHA 3CGDA 2ZBWA 3KPKA 4J34A 4TWFA 5KMQA 3SY4A 1VRBA 3ABVA 3AEAA 3Q9DA 5ABFA 4WZXA 2DKHA 4IA6A 1X79A 2YKSA 3RQUA 2DLRA 1EL5A 4BJNA 4QXBB 1IAPA 3DK9A 1H82A 1E1LA 2YDRA 3N5LA 2A87A 5JQGE 4II3A 5FXXA 3R6NA 5L3DB 3O1JA 4B69A 2XLRA 3M12A 1VBB4 3HKEE 2VQBA 3RIAA 3GYXA 4J57A 5J0ZA 1X9BA 1CBOA 2Q9QC 3P9UA 4KP3C 2ZM0A 1W09A 3ZSSA 1YKHB 3DJDA 4HWHA 2UU9T 3HA4A 5FY0A 1GTHA 2HN1A 2GR1A 4J56A 4J33A 3DJGX 1ZOYA 4DR5T 4AQYT 4EQRA 1XDOA 4LMLA 4B66A 1QJDA 1NAFA 2WPCA 3ZN0B 3UTFA 1GPEA 2A89A 2D9DA 4AQGA 3SWHA 3EDVA 2RGHA 3Q5WA 3RH3A 3RF1A 4EZ4A 2JB2A 5GRTA 2OV9A 2XSBA 2NVKX 5DBJA 4BK2A 3NBXX 4NNJA 3NYEA 1J5WA 5F5WA 5HCJA 2VURA 1RMU4 3H37A 3KV5A 4CI3B 1RYIA 4UDQA 4H63H 1N4WA 4UVCB 1IBLT 3DJEA 1Z7S4 4IL4A 2APGA 4NIQA 2H89A 3AE9A 4AKIA 2YLZA 2YVFA 3KPFA 3CNSA 4ZI3D 4H4RA 2LM2A 5HWYA 4P0AA 2J47A 3GYIA 5LGUB 2CWYA 4U8PA 2V7KA 4B3TT 2GRTA 3ZMSB 4HFIA 2RGJA 1GXFA 3KU9A 2AR8A 1FEBA 5LP6E 1D7LA 4Z2UA 3M13A 4AKGA 3QVPA 3RP8A 2V7LA 1GOSA 5H6RB 4X9NA 4OYJA 2VKOA 3KV9A 3J9X1 4KHPT 1EZ3A 1MIVA 1PJ7A 4H4QA 5LB7B 2Y6RA 5EZYE 1IJ5A 3AB1A 3ONJA 3IF9A 3PUXF 4YLHA 2LSKA 4N78D 4AISA 2E1MA 5FS8A 3AYIA 3UTEA 1CJ3A 1WR6A 4DSGA 2YG5A 4JI6T 1OJDA 2C66A 1RUF4 4DMWA 4ZZBA 3AWIA 5FXWA 4C90A 3HYVA 3COXA 4PK6A 1PHHA 2JB1A 3TLWA 1AR74 2BACA 4TX5A 2YLTA 2R0PA 3LG7A 3QVRA 1FMWA 4EIPA 4LF4T 3HL6A 2EQ7A 4IDOA 3UU5A 2LHNA 2LSYA 3QOFA 3OJAA 4HFVA 1JRXA 2GAHB 5TR3A 1LQTA 3UTKA 3SZFA 3DP7A 2EHOA 4YSYA 1MIWA 5ABFB 1YY5A 2IIDA 1HRV4 3PUYF 2PYXA 2X9HA 4GK5E 1FEWA 5AQKB 1B4VA 3T0KA 1RUC4 4BJMA 4RG4A 4EMIA 3ONLC 4IE0A 2M6BA 2X8CA 4IE4A 4OPLA 2LSIA 4CCRA 1US7B 3AA1B 3W15B 2XCGA 3AEFA 4AP1A 4A6NA 4KMCA 4U31A 1JRZA 3TLSA 1BR4A 2WCAA 1XHXA 1Y0PA 4AIUA 1REOA 1D1CA 2VASA 1GT8A 5IYZE 1KDGA 5AQFB 4G74A 1B8SA 4E7SA 3M65A 3AXBA 2X0HA 5ETWA 3PU3A 5CGMA 5HCMA 4DSHA 2Q9QB 1T72A 1F8SA 4FK1C 5FL0A 2WAUA 4QXHB 1LVLA 5JREA 2UUCT 1MNEA 3IEEA 2BVLA 1LPFA 5FS9A 4D04A 3NYCA 1AR94 4FK1A 5KOXA 5AQPB 2W63A 3NLCA 5ABEA 2C75A 2B1EA 3FBZA 5DQVA 2YVJA 4LFAT 3M0OA 2X9WA 5AQOB 4ECHA 1H7WA 2RM24 5DQWA 4IDNA 2R044 4REKA 1LJ1A 1GETA 1GESA 2XLTA 1GERA 3NZPA 2XM2A 3CWZB 4JN9A 3ZMUB 5FMNA 2BRAA 5J7XA 1JRYA 2IIUA 2CLYC 4H4UA 5BULA 1TYPA 4U7YA 2LM9A 1Z8UA 2XUEA 3P4RA 3UFGA 3NIXA 4YSZA 3CNDA 2NP9A 2WWUA 4LMJA 4WX1A 2X5ID 4JI4T 4XAXB 1FJGT 4YJ2E 1DXLA 2W2UA 3C64A 1D4CA 2WEUA 1DNCA 4GKJT 3CX7B 2W66A 1ELIA 1QO8A 4G73A 3LJCA 4PK5A 3AB3B 2MTQA 2C76A 4DR1T 4EMJA 3AD8B 1XMOT 3SYIA 4LFBT 2KT9A 2HQMA 1BGJA 3SS1A 2H7VC 3RLFF 3I0QA 2K5BB 2YINA 2OA5A 4ISSA 3ICSA 4I55E 4B3MT 2YLRA 4GF7A 4JI5T 2V7JA 5LHIB 2JQHA 1PN0A 4F8HA 1DJNA 4AKHA 3AA7B 3RIFA 1D0ZA 4Q4V4 2JMHA 2ODVA 4O4IE 4UR9A 3RPUA 3N2KE 4X1IE 3AEBA 1GV4A 4I58A 1WR0A 2EHOB 3PU8A 2YLXA 2R46A 3BNUA 4J2CA 3V3NA 1VOMA 1FEAA 1OEDA 4P9SA 3RIUC 2QGSA 5L3FB 1AL24 3DTOA 4YWOA 3PURA 5J60A 2XFPA 1NHPA 1FECA 2C72A 1ZY8A 1EL8A 4EOZB 3QFAA 1VG0A 5HXSA 1HFAA 2C3CA 5KMSA 3RYHE 1PS9A 1N1PA 1H84A 2JB3A 4CN1A 1NDAA 4A6NB 3SGLA 4NWZA 3P8CD 1XANA 4HFDA 4IDZA 3G5QA 3O4XE 2KWIB 2XYOA 2C3DA 3LADA 3MZKB 4Y4LA 3ISHA 4IVMB 1Y01A 2DWGA 2JK6A 4APNA 5JCKA 3NKZA 5L3CB 3NK0X 2RPAA 4C5OA 5LMUT 1KSUA 4PAGA 4G2AA 3AXJA 1WYBA 5U1OA 2XZEA 2XFOA 1IUVA 4G6HA 2L9QA 1KSSA 2DI4A 1WCRA 4AQFA 1D1AA 1D0YA 3BQIA 1LVFA 5C2TA 4DV2T 4IIJE 1F6MA 2BXSA 2YG6A 3PS9A 3NH3X 5CA1E 5HXHA 5JTGA 1FL2A 2E9XC 2J4GA 4JEHB 2B76A 3L1RA 4LIIA 3ZCIA 4IGUA 5J2TE 1XNRT 2WOIA 2R7FA 3AE1A 3OC4A 4BK1A 3KKJA 3NT6A 1VG9A 1EL9A 3EAMA 3DK8A 2BRYA 1HS7A 4K7ZA 4A99A 3QSEA 4H7UA 5JR9C 2BDEA 4GYSA 4HGAA 3CX6B 4ZS2A 5ADXL 3AVRA 1SUMB 2E9XA 1OJAA 2BBHA 4JI3T 4OVIA 4J36A 1MMDA 4HWFA 3LZWA 3RP6A 2VQ7A 1IJHA 2NW9A 4B67A 4CY8A 2KMFA 3B13A 2IUBA 3K1SA
chains in the Genus database with same CATH topology
3AECA 4Z2RA 3ALLA 3D8XA 5IQ4A 1EL5A 1Q1RA 1KNPA 2ARDA 2C7GA 2VRMA 3DK9A 4HA6A 1H82A 1E1LA 4GAPA 3V76A 4H4ZA 1E1MA 2A87A 1E1KA 3NG7X 4FX9A 1OJCA 2YWLA 4II3A 2LFCA 1ZK7A 4B69A 2XLRA 1PJ6A 3IHGA 2XFNA 3M12A 3SZ0A 3P4QA 2VRLA 4EQXA 3HYXA 5C3JA 2Q0LA 3ALMA 3CNTA 2FJDA 2Q7VA 3GMBA 2VQBA 1GRTA 3GYXA 4J57A 2GQFA 3GD4A 4H4YA 5JCIA 2BK3A 1PBBA 1NPXA 4LU6A 2WQYA 3L8KA 1CBOA 1CL0A 4H4VA 3P9UA 2WDVA 2WOWA 4O5QA 5BUKA 3VRAA 4YTPA 2C4CA 3DJDA 1GTHA 2BK4A 2GMJA 2GR1A 3AEGA 4J56A 5JCMA 3EPTA 2GMHA 4J33A 4Y4MA 3ZDNA 3DJGX 1ZOYA 3IWAA 4HB9A 3FMWA 4EM3A 1YQZA 1GRBA 1YQ4A 4EQRA 4KX6A 4B66A 2IVEA 4YSXA 1QJDA 3NN0X 2WPCA 2C67A 3UTFA 3BI5A 4H4TA 1GPEA 2R45A 3QJ4A 2A89A 3T2KA 3AE5A 3G5SA 4OCGA 3CGBA 1TDFA 3G5RA 2RGHA 3II4A 3WE0A 3DGZA 3KLJA 4AT0A 3JSKA 2JB2A 2OA1A 3VR9A 3UKLA 5GRTA 4Z26A 2R4EA 2YLSA 3ITJA 1K4QA 2XVEA 3UTGA 2JBVA 2NVKX 1VQWA 5DBJA 1BGNA 4BK2A 1ZMDA 4NNJA 3ATRA 3AD7B 3NYEA 1DOCA 1NENA 2CFYA 1ZX9A 4NEVA 3QFBA 4O5UA 2IVDA 1RYIA 4UDQA 1N4WA 2X50A 2EQ8A 2XVIA 1BZLA 2TMDA 3H8LA 3DJEA 1ZOVA 1GRGA 4H2QA 4USQA 2APGA 4Z44A 3SZCA 2BK5A 2H89A 3AE9A 4ZN0A 2FJBA 1D7YA 1H6VA 2YLZA 4U2TA 4B64A 2VVLA 2YVFA 3P1WA 3AE7A 1PBCA 3CNSA 3KPFA 4H4RA 2A8XA 4D03A 3UP5A 2O9ZA 1O95A 3EANA 1TDOA 1LTXR 3GYIA 1CJCA 4XWRA 2JKCA 2XVFA 4K2XA 3B6DA 4U8PA 1PXBA 1Q9IA 5KWFA 2GRTA 2E4GA 2RGJA 2BS3A 1B37A 1VRQB 1CJ2A 1GXFA 2AR8A 3KU9A 1FEBA 2E5VA 1D7LA 2WP9A 4JNQA 4AT2A 3GD3A 4Z2UA 3BHFA 3M13A 5LV9A 1GRFA 2BCGG 3QVPA 3DGHA 3REDA 1H86A 2B9WA 3RP8A 1ONFA 3KD9A 5KNLA 4OPCA 3RP7A 1GOSA 4X9NA 2R9ZA 5KMPA 2YR4A 1B5QA 1PBEA 3NNEA 2PHHA 1PJ7A 1Y56A 4B63A 1S2YA 1H83A 3SZWA 1CC2A 4H4QA 4H2PA 2Y6RA 3AB1A 4C3XA 1CHUA 1EL7A 1PXAA 4J2WA 3IF9A 4ICYA 4NTDA 4U8IA 3F8DA 2OLNA 2E1MA 2YG3A 4UDPA 5FS8A 3AYIA 3AYLA 4IVOB 4K22A 3AE2A 3UTEA 3CGCA 2Z5YA 1BKWA 4YKGA 1CJ3A 4X4JA 2RABA 3SXIA 2XVJA 1IUUA 2Z5XA 2ZZBA 4EQWA 4DSGA 3AEDA 3EF6A 2XVHA 2BS2A 1L9EA 2YG5A 4M52A 1JNRA 1OJDA 2WETA 2C66A 1S2QA 3AWIA 4YKFA 3BI4A 3COXA 3HYVA 3T14A 1PHHA 1GEUA 4A5LA 2JB1A 4GCMA 1CF3A 2BACA 1K0IA 2R0PA 1PJ5A 2YLTA 3I3LA 3F8PA 3UKAA 1YKJA 3QVRA 2WHDA 4EIPA 4AOXA 2EQ7A 1RSGA 3UP4A 3VRDB 4TM4A 4B1BA 3DK4A 4Z25A 2QA1A 1JRXA 1PDHA 2GAHB 5TR3A 3AE3A 1LQTA 1GTEA 3SZFA 1E6EA 1TDKA 4NTEA 4H4SA 4Y4NA 1FOHA 2WP5A 4YSYA 4YT0A 2IIDA 1YY5A 2NPXA 4TLXA 5JCNA 2PYXA 3C96A 3CNJA 1B4VA 3T0KA 3UTHA 2B9XA 1E1NA 4CBQA 2FBWA 2EQ6A 2WPEA 4RG4A 3AE4A 4EMIA 2WDQA 4II2A 2WS3A 3SUCA 3T37A 3CPIG 5KMRA 4GAVA 3CN8A 1NHRA 4U8NA 4B65A 4BJYA 3UCLA 2X8CA 2QA2A 3ATQA 3GDPA 3AE8A 1XHCA 5IPYA 5KVHA 4OPLA 4CCRA 4TM1A 1NHSA 4OPUA 4Z24A 4TM0A 3GQKA 1LQUA 3C4AA 2XCGA 2VVMA 3AEFA 3LJPA 4AP1A 4A6NA 3ADAB 1CC6A 4CRTA 3ZYXA 1JRZA 3GRSA 4TLZA 4BJZA 3UKFA 1Y0PA 1LV0A 1W4XA 4A7AA 1REOA 1GT8A 2H88A 2W0HA 5FMHA 1KDGA 4G74A 4H2NA 2BC1A 1B8SA 2CVJA 3UKHA 1K0JA 3AXBA 4GDEA 2JAEA 2WU2A 2BCPA 1NG3A 2WESA 4AOSA 4ZCCA 5M0ZA 3V3OA 2YR5A 4DSHA 4JNAA 3GSIA 3NTDA 3IC9A 1F8SA 2QAEA 4FK1C 4U2LA 2FJAA 2XFQA 3CPJG 2X8HA 3HYWA 1LVLA 3B3RA 1O5WA 3GDNA 3GWFA 1TYTA 3P4SA 2GF3A 2WP6A 1SEZA 3GRTA 3NK2X 2AAQA 2Q0KA 5EB4A 5HY5A 2YLWA 4G6GA 1LPFA 5FS9A 4D04A 3NYCA 4GRTA 1TRBA 5EBKA 4FK1A 1MXTA 5KOXA 3OZ2A 3NLCA 1GNDA 2YVGA 2YG7A 2Y6QA 2V61A 4A79A 2WU5A 2C75A 4IA5A 2YVJA 3M0OA 4U8OA 1CC4A 4E0VA 1V59A 4ECHA 1H7WA 4REKA 3RNMA 2XLSA 1LJ1A 1GETA 1GESA 2BC0A 2XLTA 1GERA 1PXCA 3DJJA 3T2YA 3AYJA 1N4UA 2B9YA 5HYMA 4JN9A 3ICRA 3KA7A 5KOWA 2QCUA 2XDOA 2BRAA 3FIMB 5U63A 5J7XA 4YTMA 4JY3A 1JRYA 3K7MX 4H4UA 5BULA 3K30A 1TYPA 3SM8A 1JEHA 1O94A 1D4EA 4AP3A 4PAAA 4GR1A 4UP3A 2EQ9A 1L9DA 3FPZA 4JQ9A 4DNAA 4NZHA 3P4RA 3Q6JA 1KNRA 2WOVA 2X8GA 2YM1A 1ZMCA 2BS4A 4YSZA 3NIXA 4OPTA 4Z43A 3CNDA 1BF3A 2V5ZA 1L0VA 2UZZA 4WX1A 5L46A 3VR8A 3NHOX 1DXLA 3HZLA 1GRAA 2R0CA 4LA1A 5U25A 2X99A 3AD9B 1D4CA 1JNZA 1P2EA 3EAOA 2WEUA 1P2HA 1DNCA 1ELIA 2R4JA 1QO8A 3P4PA 1MOKA 2WBAA 1JOAA 2F5ZA 4G73A 4Z2TA 4EM4A 1GALA 2C65A 4BURA 3VRBA 4NTCA 1K0LA 5KVIA 4WCTA 3AE6A 1AOGA 2C76A 2GQWA 4ZCDA 4A65A 4U8JA 4XXGA 1H81A 3FG2P 3BI2A 5HXIA 4EMJA 3AD8B 1RP0A 4OPGA 1Z6LA 4K5RA 3SYIA 2GR2A 3T2ZA 1ZDLA 2C64A 4BV6A 2HQMA 1BGJA 3URHA 2Q6UA 4OPIA 3ICSA 2GEWA 3RHAA 1DJQA 3NRNA 3QSMA 2GAGB 5ER0A 2YLRA 1COYA 2VOUA 4GF7A 1L9CA 1HYUA 1UKVG 1PBDA 2C73A 4NEWA 4TM3A 1PN0A 2VZ2A 3NTAA 1DJNA 1M64A 4KPRA 1XPQA 4CNKA 4K8DA 1M6IA 3LXDA 2TPRA 3SQPA 2YG4A 4C3YA 1ZKQA 3BNMA 3UOYA 1IUTA 3CTYA 4U8LA 3E1TA 2GV8A 3Q9TA 4U2SA 3I6DA 3LZXA 4CY6A 5KRQA 3T31A 3NN6X 2CDUA 3C4NA 4I59A 5M10A 1CJ4A 4H4WA 3AEBA 1GV4A 2J3NA 4I58A 2GR0A 2V3BA 3CGEA 2YLXA 2R46A 3BNUA 1YQ3A 4RG3A 5EB5A 3UOVA 3V3NA 1F8WA 1FEAA 4YSHA 2GR3A 4MJWA 3H4KA 4P9SA 4CNJA 5HHFA 2C70A 1OJTA 1D5TA 1F3PA 2V6OA 3CMMA 3PO7A 4H4PA 2BYBA 4YWOA 4J31A 1E39A 2YR6A 5J60A 2XFPA 1Q1WA 1NHPA 3ICTA 1FECA 2OLOA 3UOXA 2C72A 3SFDA 1NHQA 2XLPA 3IHMA 3NKSA 5JCLA 3SX6A 1KFYA 1ZY8A 1E7PA 1EL8A 1S3EA 3QFAA 4FDCB 4JDRA 4EMWA 1VG0A 3FBSA 2C3CA 1XDIA 4U8MA 5KMSA 1PS9A 1N1PA 1BWCA 4H4XA 5CKUA 3DA1A 1H84A 2JB3A 2VVLG 4GUVA 1QLBA 1NDAA 4A6NB 1DOBA 4CCQA 1DODA 4XWZA 2CULA 3SGLA 4X9MA 3UKKA 4EQSA 5FS7A 4NWZA 1GREA 1XANA 3G5QA 1KF6A 3GMCA 3NK1X 4C74A 2OALA 4H2RA 2GH5A 5BVAA 2GVCA 2XYOA 2C3DA 1TDEA 3LADA 3F8RA 1IUSA 4C77A 3NGCX 2YQUA 4Y4LA 3DH9A 2ZZ0A 3ISHA 4IVMB 4N9XA 2JK6A 1F8RA 4APNA 2R0GA 5JCKA 2ACZA 2WPFA 3NK0X 4IV9A 2V60A 2YAUA 4USRA 1H7XA 4C5OA 3DMEA 1KSUA 1OJ9A 5IQ1A 3BHKA 5U1OA 4U8KA 2XFUA 4OPDA 2XFOA 5FS6A 2AQJA 3SFEA 1IUVA 2X3NA 4G6HA 4YXDA 4G9KA 1KSSA 4K5SA 3H8IA 3O0HA 1VDCA 4H50A 1N4VA 2XLUA 3PVCA 4ADWA 5BRTA 1EBDA 2YM2A 1PBFA 1TDNA 1X31B 2V3AA 5C2TA 1IUXA 3K7QX 5CQFA 1F6MA 1MO9A 2BXSA 2YG6A 4YTNA 3PS9A 3S61A 3UKPA 3NH3X 4JY2A 3GYJA 1IUWA 5EOWA 1NEKA 4RSLA 5KXJA 1GSNA 1FL2A 3KVEA 2BABA 3VQRA 2B76A 3L1RA 4LIIA 2B7SA 4UDRA 2FJEA 3LOVA 2WOIA 1JU2A 2GB0A 3AE1A 4GDPA 3OC4A 1DOEA 4B68A 4BK1A 3KKJA 3CIRA 3CNPA 1VG9A 1EL9A 3NT6A 4A9WA 3DK8A 3UOZA 4BK3A 3CPHG 2B7RA 2BRYA 3QSSA 4K7ZA 4A99A 4DGKA 1D4DA 3NYFA 5GSNA 3UKQA 3QSEA 2BA9A 4H7UA 2DKIA 3D1CA 2OAMA 1Y56B 2RGOA 1OJAA 3ALJA 4OVIA 4J36A 1NAAA 3S5WA 3LZWA 3RP6A 2VQ7A 1IJHA 4B67A 1FCDA 1ZP0A 2WDRA 2ZZCA 4PABA 3R9UA 1S3BA 4CY8A 3GWDA 1GRHA 3GQHA 3CGDA 2ZBWA 3KPKA 4J34A 5KMQA 2I0ZA 3K7TA 3LB8A 3SY4A 4EIQA 3AEEA 1NG4A 2BXRA 3ABVA 3AEAA 4IA6A 2DKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEC A;  4Z2R A;  3ALL A;  3D8X A;  5IQ4 A;  1EL5 A;  1Q1R A;  1KNP A;  2ARD A;  2C7G A;  2VRM A;  3DK9 A;  4HA6 A;  1H82 A;  1E1L A;  3V76 A;  4H4Z A;  1E1M A;  2A87 A;  1E1K A;  3NG7 X;  4FX9 A;  1OJC A;  2YWL A;  2LFC A;  1ZK7 A;  4B69 A;  2XLR A;  1PJ6 A;  3IHG A;  2XFN A;  3M12 A;  3P4Q A;  2VRL A;  4EQX A;  5C3J A;  2Q0L A;  3ALM A;  3CNT A;  2FJD A;  2Q7V A;  3GMB A;  2VQB A;  1GRT A;  3GYX A;  4J57 A;  2GQF A;  3GD4 A;  4H4Y A;  5JCI A;  2BK3 A;  1PBB A;  1NPX A;  4LU6 A;  2WQY A;  3L8K A;  1CBO A;  1CL0 A;  4H4V A;  3P9U A;  2WDV A;  2WOW A;  4O5Q A;  5BUK A;  3VRA A;  4YTP A;  3DJD A;  1GTH A;  2BK4 A;  2GMJ A;  2GR1 A;  3AEG A;  4J56 A;  5JCM A;  3EPT A;  2GMH A;  4J33 A;  4Y4M A;  3ZDN A;  3DJG X;  1ZOY A;  3IWA A;  4HB9 A;  3FMW A;  4EM3 A;  1YQZ A;  1GRB A;  1YQ4 A;  4EQR A;  4KX6 A;  4B66 A;  2IVE A;  4YSX A;  1QJD A;  3NN0 X;  2WPC A;  2C67 A;  3UTF A;  3BI5 A;  4H4T A;  1GPE A;  2R45 A;  3QJ4 A;  2A89 A;  3AE5 A;  3G5S A;  4OCG A;  3CGB A;  1TDF A;  3G5R A;  2RGH A;  3II4 A;  3WE0 A;  3DGZ A;  3KLJ A;  4AT0 A;  3JSK A;  2JB2 A;  2OA1 A;  3VR9 A;  3UKL A;  5GRT A;  4Z26 A;  2R4E A;  2YLS A;  3ITJ A;  1K4Q A;  2XVE A;  3UTG A;  2JBV A;  2NVK X;  1VQW A;  5DBJ A;  1BGN A;  4BK2 A;  1ZMD A;  3ATR A;  3AD7 B;  3NYE A;  1DOC A;  1NEN A;  2CFY A;  1ZX9 A;  4NEV A;  3QFB A;  4O5U A;  2IVD A;  1RYI A;  4UDQ A;  1N4W A;  2X50 A;  2EQ8 A;  2XVI A;  1BZL A;  2TMD A;  3H8L A;  3DJE A;  1ZOV A;  1GRG A;  4H2Q A;  4USQ A;  2APG A;  4Z44 A;  2BK5 A;  2H89 A;  3AE9 A;  4ZN0 A;  2FJB A;  1D7Y A;  1H6V A;  2YLZ A;  4U2T A;  4B64 A;  2VVL A;  2YVF A;  3P1W A;  3AE7 A;  1PBC A;  3CNS A;  3KPF A;  4H4R A;  2A8X A;  4D03 A;  3UP5 A;  2O9Z A;  1O95 A;  3EAN A;  1TDO A;  1LTX R;  3GYI A;  1CJC A;  4XWR A;  2JKC A;  2XVF A;  4K2X A;  3B6D A;  4U8P A;  1PXB A;  1Q9I A;  5KWF A;  2GRT A;  2E4G A;  2RGJ A;  2BS3 A;  1B37 A;  1VRQ B;  1CJ2 A;  1GXF A;  2AR8 A;  3KU9 A;  1FEB A;  2E5V A;  1D7L A;  2WP9 A;  4JNQ A;  4AT2 A;  3GD3 A;  4Z2U A;  3BHF A;  3M13 A;  5LV9 A;  1GRF A;  2BCG G;  3QVP A;  3DGH A;  3RED A;  1H86 A;  2B9W A;  3RP8 A;  1ONF A;  3KD9 A;  4OPC A;  3RP7 A;  1GOS A;  4X9N A;  2R9Z A;  2YR4 A;  1B5Q A;  1PBE A;  3NNE A;  2PHH A;  1PJ7 A;  1Y56 A;  4B63 A;  1S2Y A;  1H83 A;  1CC2 A;  4H4Q A;  4H2P A;  2Y6R A;  3AB1 A;  4C3X A;  1CHU A;  1EL7 A;  1PXA A;  4J2W A;  3IF9 A;  4ICY A;  4NTD A;  4U8I A;  3F8D A;  2OLN A;  2E1M A;  2YG3 A;  4UDP A;  5FS8 A;  3AYI A;  3AYL A;  4IVO B;  4K22 A;  3AE2 A;  3UTE A;  3CGC A;  2Z5Y A;  1BKW A;  4YKG A;  1CJ3 A;  4X4J A;  2RAB A;  2XVJ A;  1IUU A;  2Z5X A;  2ZZB A;  4EQW A;  4DSG A;  3AED A;  3EF6 A;  2XVH A;  2BS2 A;  1L9E A;  2YG5 A;  4M52 A;  1JNR A;  1OJD A;  2WET A;  2C66 A;  1S2Q A;  3AWI A;  4YKF A;  3BI4 A;  3COX A;  1PHH A;  1GEU A;  4A5L A;  2JB1 A;  4GCM A;  1CF3 A;  2BAC A;  1K0I A;  2R0P A;  1PJ5 A;  2YLT A;  3I3L A;  3F8P A;  3UKA A;  1YKJ A;  3QVR A;  2WHD A;  4EIP A;  4AOX A;  2EQ7 A;  1RSG A;  3UP4 A;  3VRD B;  4TM4 A;  4B1B A;  3DK4 A;  4Z25 A;  2QA1 A;  1JRX A;  1PDH A;  2GAH B;  5TR3 A;  3AE3 A;  1LQT A;  1GTE A;  1E6E A;  1TDK A;  4NTE A;  4H4S A;  4Y4N A;  1FOH A;  2WP5 A;  4YSY A;  4YT0 A;  2IID A;  1YY5 A;  2NPX A;  4TLX A;  5JCN A;  2PYX A;  3C96 A;  3CNJ A;  1B4V A;  3UTH A;  2B9X A;  1E1N A;  4CBQ A;  2FBW A;  2EQ6 A;  2WPE A;  4RG4 A;  3AE4 A;  4EMI A;  2WDQ A;  3SUC A;  2WS3 A;  3T37 A;  3CPI G;  3CN8 A;  1NHR A;  4U8N A;  4B65 A;  4BJY A;  3UCL A;  2X8C A;  2QA2 A;  3ATQ A;  3GDP A;  3AE8 A;  1XHC A;  5IPY A;  5KVH A;  4OPL A;  4CCR A;  4TM1 A;  1NHS A;  4OPU A;  4Z24 A;  4TM0 A;  3GQK A;  1LQU A;  3C4A A;  2XCG A;  2VVM A;  3AEF A;  3LJP A;  4AP1 A;  4A6N A;  3ADA B;  1CC6 A;  4CRT A;  3ZYX A;  1JRZ A;  3GRS A;  4TLZ A;  4BJZ A;  3UKF A;  1Y0P A;  1LV0 A;  1W4X A;  4A7A A;  1REO A;  1GT8 A;  2H88 A;  2W0H A;  5FMH A;  1KDG A;  4H2N A;  2BC1 A;  1B8S A;  2CVJ A;  3UKH A;  1K0J A;  3AXB A;  4GDE A;  2JAE A;  2WU2 A;  2BCP A;  1NG3 A;  2WES A;  4AOS A;  4ZCC A;  5M0Z A;  3V3O A;  2YR5 A;  4DSH A;  4JNA A;  3GSI A;  3NTD A;  3IC9 A;  1F8S A;  2QAE A;  4FK1 C;  4U2L A;  2FJA A;  2XFQ A;  3CPJ G;  2X8H A;  1LVL A;  3B3R A;  1O5W A;  3GDN A;  3GWF A;  1TYT A;  3P4S A;  2GF3 A;  2WP6 A;  1SEZ A;  3GRT A;  3NK2 X;  2AAQ A;  2Q0K A;  5EB4 A;  5HY5 A;  2YLW A;  1LPF A;  5FS9 A;  4D04 A;  3NYC A;  4GRT A;  1TRB A;  5EBK A;  4FK1 A;  1MXT A;  5KOX A;  3OZ2 A;  3NLC A;  1GND A;  2YVG A;  2YG7 A;  2Y6Q A;  2V61 A;  4A79 A;  2WU5 A;  2C75 A;  4IA5 A;  2YVJ A;  3M0O A;  4U8O A;  1CC4 A;  4E0V A;  1V59 A;  4ECH A;  1H7W A;  4REK A;  3RNM A;  2XLS A;  1LJ1 A;  1GET A;  1GES A;  2BC0 A;  2XLT A;  1GER A;  1PXC A;  3DJJ A;  3AYJ A;  1N4U A;  2B9Y A;  4JN9 A;  3ICR A;  3KA7 A;  5KOW A;  2QCU A;  2XDO A;  3FIM B;  5U63 A;  5J7X A;  4YTM A;  4JY3 A;  1JRY A;  3K7M X;  4H4U A;  5BUL A;  3K30 A;  1TYP A;  3SM8 A;  1JEH A;  1O94 A;  1D4E A;  4AP3 A;  4PAA A;  4GR1 A;  4UP3 A;  2EQ9 A;  1L9D A;  3FPZ A;  4JQ9 A;  4DNA A;  4NZH A;  3P4R A;  3Q6J A;  1KNR A;  2WOV A;  2X8G A;  2YM1 A;  1ZMC A;  2BS4 A;  4YSZ A;  3NIX A;  4OPT A;  4Z43 A;  3CND A;  1BF3 A;  2V5Z A;  1L0V A;  2UZZ A;  4WX1 A;  5L46 A;  3VR8 A;  3NHO X;  1DXL A;  3HZL A;  1GRA A;  2R0C A;  4LA1 A;  5U25 A;  2X99 A;  3AD9 B;  1D4C A;  1JNZ A;  1P2E A;  3EAO A;  2WEU A;  1P2H A;  1DNC A;  1ELI A;  2R4J A;  1QO8 A;  3P4P A;  1MOK A;  2WBA A;  1JOA A;  2F5Z A;  4Z2T A;  4EM4 A;  1GAL A;  2C65 A;  4BUR A;  3VRB A;  4NTC A;  1K0L A;  5KVI A;  4WCT A;  3AE6 A;  1AOG A;  2C76 A;  2GQW A;  4ZCD A;  4A65 A;  4U8J A;  4XXG A;  1H81 A;  3FG2 P;  3BI2 A;  5HXI A;  4EMJ A;  3AD8 B;  1RP0 A;  4OPG A;  1Z6L A;  4K5R A;  2GR2 A;  1ZDL A;  2C64 A;  4BV6 A;  2HQM A;  1BGJ A;  3URH A;  2Q6U A;  4OPI A;  3ICS A;  2GEW A;  3RHA A;  1DJQ A;  3NRN A;  3QSM A;  2GAG B;  5ER0 A;  2YLR A;  1COY A;  2VOU A;  4GF7 A;  1L9C A;  1HYU A;  1UKV G;  1PBD A;  2C73 A;  4NEW A;  4TM3 A;  1PN0 A;  2VZ2 A;  3NTA A;  1DJN A;  1M64 A;  4KPR A;  1XPQ A;  4CNK A;  4K8D A;  1M6I A;  3LXD A;  2TPR A;  3SQP A;  2YG4 A;  4C3Y A;  1ZKQ A;  3BNM A;  3UOY A;  1IUT A;  3CTY A;  4U8L A;  3E1T A;  2GV8 A;  3Q9T A;  4U2S A;  3I6D A;  3LZX A;  4CY6 A;  5KRQ A;  3NN6 X;  2CDU A;  3C4N A;  4I59 A;  5M10 A;  1CJ4 A;  4H4W A;  3AEB A;  1GV4 A;  2J3N A;  4I58 A;  2GR0 A;  2V3B A;  3CGE A;  2YLX A;  2R46 A;  3BNU A;  1YQ3 A;  4RG3 A;  5EB5 A;  3UOV A;  3V3N A;  1F8W A;  1FEA A;  4YSH A;  2GR3 A;  4MJW A;  3H4K A;  4P9S A;  4CNJ A;  5HHF A;  2C70 A;  1OJT A;  1D5T A;  1F3P A;  2V6O A;  3PO7 A;  4H4P A;  2BYB A;  4YWO A;  4J31 A;  1E39 A;  2YR6 A;  5J60 A;  2XFP A;  1Q1W A;  1NHP A;  3ICT A;  1FEC A;  2OLO A;  3UOX A;  2C72 A;  3SFD A;  1NHQ A;  2XLP A;  3IHM A;  3NKS A;  5JCL A;  1KFY A;  1ZY8 A;  1E7P A;  1EL8 A;  1S3E A;  3QFA A;  4FDC B;  4JDR A;  4EMW A;  1VG0 A;  3FBS A;  2C3C A;  1XDI A;  4U8M A;  1PS9 A;  1N1P A;  1BWC A;  4H4X A;  5CKU A;  3DA1 A;  1H84 A;  2JB3 A;  2VVL G;  4GUV A;  1QLB A;  1NDA A;  4A6N B;  1DOB A;  4CCQ A;  1DOD A;  4XWZ A;  2CUL A;  3SGL A;  4X9M A;  3UKK A;  4EQS A;  5FS7 A;  1GRE A;  1XAN A;  3G5Q A;  1KF6 A;  3GMC A;  3NK1 X;  4C74 A;  2OAL A;  4H2R A;  2GH5 A;  5BVA A;  2GVC A;  2XYO A;  2C3D A;  1TDE A;  3LAD A;  3F8R A;  1IUS A;  4C77 A;  3NGC X;  2YQU A;  4Y4L A;  3DH9 A;  2ZZ0 A;  3ISH A;  4IVM B;  4N9X A;  2JK6 A;  1F8R A;  4APN A;  2R0G A;  5JCK A;  2ACZ A;  2WPF A;  3NK0 X;  4IV9 A;  2V60 A;  2YAU A;  4USR A;  1H7X A;  4C5O A;  3DME A;  1KSU A;  1OJ9 A;  5IQ1 A;  3BHK A;  5U1O A;  4U8K A;  2XFU A;  4OPD A;  2XFO A;  5FS6 A;  2AQJ A;  3SFE A;  1IUV A;  2X3N A;  4YXD A;  1KSS A;  4K5S A;  3H8I A;  3O0H A;  1VDC A;  4H50 A;  1N4V A;  2XLU A;  3PVC A;  4ADW A;  5BRT A;  1EBD A;  2YM2 A;  1PBF A;  1TDN A;  1X31 B;  2V3A A;  5C2T A;  1IUX A;  3K7Q X;  5CQF A;  1F6M A;  1MO9 A;  2BXS A;  2YG6 A;  4YTN A;  3PS9 A;  3S61 A;  3UKP A;  3NH3 X;  4JY2 A;  3GYJ A;  1IUW A;  5EOW A;  1NEK A;  4RSL A;  5KXJ A;  1GSN A;  1FL2 A;  3KVE A;  2BAB A;  3VQR A;  2B76 A;  3L1R A;  4LII A;  2B7S A;  4UDR A;  2FJE A;  3LOV A;  2WOI A;  1JU2 A;  2GB0 A;  3AE1 A;  4GDP A;  3OC4 A;  1DOE A;  4B68 A;  4BK1 A;  3KKJ A;  3CIR A;  3CNP A;  1VG9 A;  1EL9 A;  3NT6 A;  4A9W A;  3DK8 A;  3UOZ A;  4BK3 A;  3CPH G;  2B7R A;  5HYM A;  3QSS A;  4K7Z A;  4A99 A;  4DGK A;  1D4D A;  3NYF A;  5GSN A;  3UKQ A;  3QSE A;  2BA9 A;  4H7U A;  2DKI A;  3D1C A;  2OAM A;  1Y56 B;  2RGO A;  1OJA A;  3ALJ A;  4OVI A;  4J36 A;  1NAA A;  3S5W A;  3LZW A;  3RP6 A;  2VQ7 A;  1IJH A;  4B67 A;  1FCD A;  1ZP0 A;  2WDR A;  2ZZC A;  4PAB A;  3R9U A;  1S3B A;  4CY8 A;  3GWD A;  1GRH A;  3GQH A;  3CGD A;  2ZBW A;  4J34 A;  2I0Z A;  3K7T A;  3LB8 A;  4EIQ A;  3AEE A;  1NG4 A;  2BXR A;  3ABV A;  3AEA A;  4IA6 A;  2DKH A; 
#chains in the Genus database with same CATH topology
 4Z2R A;  5CA0 E;  3ALL A;  4WYV A;  1KNP A;  2C7G A;  3E22 E;  4GAP A;  4H4Z A;  1E1M A;  1OJC A;  3IHG A;  1PJ6 A;  2R06 4;  3HYX A;  5C3J A;  3CNT A;  2FJD A;  5FXZ A;  4COF A;  3HKD E;  3C4Z A;  4H4Y A;  1PBB A;  5KX5 E;  4LU6 A;  2P9B A;  2V7M A;  4GIW A;  1CL0 A;  1XHZ A;  4OFZ A;  2WOW A;  2PW9 A;  3VRA A;  2C4C A;  3BQK A;  2GK9 A;  1D4M 4;  3WI3 A;  3AEG A;  5JCM A;  2X9X A;  4QH4 A;  3EPT A;  3IWA A;  1GRB A;  2C67 A;  5F8P A;  2XQA A;  4H9S E;  5HEU A;  3AE5 A;  3G5S A;  4P1N A;  2UUA T;  4XBF B;  4GK0 E;  2R6G F;  3DGZ A;  1LKX A;  4AT0 A;  3VR9 A;  4H9N C;  1K4Q A;  2XVE A;  2X9Y A;  1VQW A;  4A56 A;  2WWV A;  4HKA A;  2CFY A;  1ZX9 A;  4O2B E;  4QKN A;  2YU2 A;  3A5X A;  5FYM A;  3QFB A;  4QX7 B;  3U3I A;  2XVI A;  1BZL A;  2TMD A;  2W0G A;  1ZOV A;  2CWO A;  1GRG A;  4USQ A;  4Z44 A;  1SE7 A;  2BK5 A;  4ILB A;  4YY3 T;  2FJB A;  3N9L A;  1H6V A;  4U2T A;  1POV 0;  4B64 A;  2XY8 B;  1DU2 A;  3QB5 K;  4ZI2 D;  5AQT B;  4BA9 A;  3L09 A;  1O95 A;  1TDO A;  5JDM A;  4K2X A;  1OWA A;  1PXB A;  3CQX C;  2HPJ A;  5KWF A;  4FI5 A;  4M1P A;  3OTO T;  3UUL A;  3RHW A;  4JNQ A;  1ASJ 4;  3BHF A;  1GRF A;  2JQK A;  4H63 V;  3DGH A;  3RED A;  3GMI A;  1ONF A;  3KD9 A;  2BZB A;  3JCF A;  4DV6 T;  3AXJ B;  4ZS3 A;  2F4V T;  1SHZ C;  2YR4 A;  1QSD A;  1PBE A;  1Y56 A;  4K0U A;  1H83 A;  3ZC1 A;  1CC2 A;  2VVN A;  4DBR A;  4C3X A;  1PO2 4;  1WLX A;  4ICY A;  2BG9 A;  2OLN A;  4UDP A;  3AYL A;  4G63 A;  4DV7 T;  4K22 A;  3CGC A;  1RUE 4;  2Z5Y A;  1SA0 E;  1BKW A;  3J8F 4;  4X4J A;  4ANJ A;  2RAB A;  5F3J A;  2HHH T;  3Q5D A;  2XVJ A;  2Z5X A;  2ZZB A;  3LDQ B;  4IDQ A;  3EF6 A;  2FUP A;  3HKB E;  2V1D B;  2YU1 A;  1JNR A;  3UU6 A;  2DNX A;  4HFH A;  1S2Q A;  4YKF A;  5BR8 T;  5L4E A;  5JRC B;  4LF9 T;  3UKA A;  3F8P A;  2Y48 B;  5AFU L;  4WBO A;  2E9X B;  2KLQ A;  4UEL A;  4QXC B;  4Z91 A;  2CHN A;  2HN2 A;  2QA1 A;  4KUM B;  1PDH A;  3D0T A;  4UV8 B;  3PUZ F;  2WP5 A;  5JR9 B;  4YT0 A;  2UXB T;  4DVD A;  1D0X A;  4TLX A;  2LKH A;  4HFB A;  2PYL A;  1W0B A;  1RUD 4;  2B9X A;  2FBW A;  2EQ6 A;  2WPE A;  3FZL B;  3SUC A;  4II2 A;  2WS3 A;  4JUY A;  2LSG A;  3CN8 A;  4U8N A;  4B65 A;  4BJY A;  3UCL A;  2JPF A;  2QA2 A;  3ATQ A;  1XHC A;  5KVH A;  2VVS A;  4TM1 A;  4KI0 F;  1OXZ A;  3C4W A;  4TM0 A;  3GQK A;  2VVM A;  3RQW A;  1CC6 A;  4CRT A;  3GRS A;  4TLZ A;  4BJZ A;  2LE8 A;  1W4X A;  2IC9 A;  5L2L A;  2W0H A;  4QHO A;  1K5M D;  2LHR A;  2M67 A;  2CVJ A;  4MHC A;  3ZMT B;  3N2O A;  1K0J A;  2H3R A;  2JAE A;  2WU2 A;  4TNW A;  2HWB 4;  3ZJ1 A;  2WES A;  4ZCC A;  3GSI A;  3RC3 A;  3IC9 A;  3MJX A;  2XFQ A;  1S94 A;  3L39 A;  2R07 4;  4WW0 A;  1O5W A;  3O9X A;  3GDN A;  3ZLI A;  5A1L A;  1HR0 T;  3GRT A;  3NK2 X;  2H7O A;  2Q0K A;  2YOE A;  5FNV E;  4XZC A;  2LSJ A;  3ZYK A;  5EBK A;  1MXT A;  3IHR A;  4IA5 A;  3LFM A;  4U8O A;  3KV4 A;  4U2Y A;  5EK3 A;  1PXC A;  2MAW A;  2X66 A;  3ICR A;  5AQS B;  3KA7 A;  3OYZ A;  5KOW A;  3KDS E;  2XDO A;  4PFO A;  5U63 A;  4IE7 A;  2VKJ A;  4YTM A;  4JY3 A;  3C51 A;  3K7M X;  4L5G A;  3K30 A;  1JEH A;  4GR1 A;  2XSA A;  4Z8X A;  5C8Y E;  3UUN A;  3DJB A;  3P4W A;  1ZMC A;  4Z43 A;  1BF3 A;  1L0V A;  2UZZ A;  5L46 A;  2PG8 A;  3VR8 A;  4U33 A;  1P2E A;  1JNZ A;  1H7C A;  1BR2 A;  1P2H A;  2WBA A;  1JOA A;  2EHO C;  2QVA A;  3PDY A;  2LLY A;  1XNQ T;  2WZH A;  2WB5 A;  3PUQ A;  4I50 E;  3FBL A;  4NTC A;  5KVI A;  2BG9 B;  2X67 A;  2GQW A;  1J5E T;  3KBU A;  5BMV E;  1CUN A;  5HAX A;  5HXI A;  2GR2 A;  3EUH A;  1XMQ T;  3URH A;  4A5X A;  4H9R C;  1COV 4;  1DJQ A;  4Z90 A;  3WAK A;  2GAG B;  5ER0 A;  2A3D A;  4NUV A;  3JC6 C;  1HX1 B;  1HYU A;  1PBD A;  4NEW A;  4JI8 T;  3KV6 A;  3Q5X A;  3NTA A;  4KPR A;  4CNK A;  4EV6 A;  4C3Y A;  2XQY A;  3UOY A;  1IUT A;  1J1J A;  3E1T A;  3NVO A;  2KSR A;  3I6D A;  3LZX A;  5JDL A;  4B3R T;  4NXN T;  1CJ4 A;  4O8S A;  1MMN A;  2V3B A;  3UOV A;  3ZJ2 A;  4RG3 A;  4UXN B;  4YSH A;  4MJW A;  3VHL A;  2W00 A;  2J62 A;  4CNJ A;  1OJT A;  1D5T A;  1F3P A;  2V6O A;  4CN4 A;  1E39 A;  5LJN A;  3UOX A;  1HTJ F;  3I0O A;  1NHQ A;  3IHM A;  5JCL A;  1E7P A;  2ACX A;  4FDC B;  3FBS A;  4CQI A;  3ZYL A;  2VVL G;  3GN5 A;  5AQN B;  4XWZ A;  2A72 A;  5FS7 A;  2MPK A;  2VQE T;  3FZM B;  2LT3 A;  3NK1 X;  4C74 A;  2OAL A;  4H2R A;  2GVC A;  2IDO B;  4EGW A;  4C77 A;  2YQU A;  3DH9 A;  5JDQ A;  3AAA B;  2ACZ A;  2WPF A;  3PE0 A;  5H6Q B;  3DME A;  4ASK A;  4B3S T;  5IQ1 A;  5ABG A;  1H8T D;  2NTY A;  3BHK A;  2XFU A;  2AQJ A;  3SFE A;  4WNK A;  1B7T A;  2YDS A;  1LRZ A;  4YXD A;  4G9K A;  3H8I A;  3ZN1 B;  3O0H A;  2NTX A;  2XLU A;  4ADW A;  1X31 B;  2V3A A;  5DJQ C;  1IUX A;  3K7Q X;  3O1H A;  2X0L B;  3S61 A;  5EOW A;  1IUW A;  1Z0P A;  3NRY A;  3E08 A;  5KXJ A;  3EVY A;  4CXW A;  4HE8 A;  3VQR A;  4UDR A;  2FJE A;  1JU2 A;  2GB0 A;  1DOE A;  4B68 A;  4A9W A;  4BK3 A;  3UOZ A;  3RYI E;  4LF5 T;  2Q9Q D;  4PJJ A;  3ALJ A;  3I9Y A;  3S5W A;  4U74 A;  4K0K T;  1R8I A;  2QA7 A;  2V6X A;  3GWD A;  4X1Y E;  5TAO A;  3K7T A;  3LB8 A;  4EIQ A;  1NG4 A;  2BXR A;  3LBX A;  5JVD E;  4HA6 A;  2W4X A;  3OYX A;  4FX9 A;  3NG7 X;  2LFC A;  3O1I A;  5HXC A;  2YWL A;  2XJ7 A;  5HEJ A;  4V1A v;  3FZH B;  2K48 A;  4PW8 A;  3SZ0 A;  3P4Q A;  2VRL A;  4PFP A;  1QUU A;  4HN9 A;  2XAS B;  2DL1 A;  1YD8 G;  5LG4 A;  2Q7V A;  3GMB A;  1OED C;  1HNZ T;  2PLV 4;  5FVK A;  2GQF A;  5JCI A;  2WQY A;  2LRL A;  3E0Z A;  2XAJ B;  4JI1 T;  2WDV A;  4O5Q A;  2N2N A;  3FZF B;  3AVS A;  3FHN A;  4QH1 A;  2GMJ A;  5L3B B;  5L4H A;  1VCS A;  1KNZ A;  4HB9 A;  4EM3 A;  3OVU A;  3RKO A;  4IHJ E;  4YSX A;  3NN0 X;  2PY5 A;  4EIW A;  3ZMZ B;  4JBW F;  5L3G B;  4H4T A;  2V6Y A;  3LK3 B;  2R45 A;  3T2K A;  4OCG A;  1TDF A;  3G5R A;  3II4 A;  1VRH 4;  3UKL A;  3ETU A;  4Z26 A;  4LF7 T;  2R4E A;  2YLS A;  2E2A A;  4OHF A;  3UTG A;  2JBV A;  3N9N A;  3IF8 B;  3ATR A;  1DOC A;  4U7I A;  1N32 T;  2KWH A;  4O5U A;  4L0R A;  2X50 A;  2V5D A;  4AQF C;  3SZC A;  5LXT E;  1NA1 D;  5KMG P;  2VVL A;  4ILU A;  3AE7 A;  3FXD B;  1PBC A;  3CQG B;  5AQH B;  4TN7 B;  3UP5 A;  3CK6 A;  1LTX R;  4A98 A;  2HH7 A;  4MAL A;  4XWR A;  2JKC A;  2XVF A;  4U3C A;  3NZQ A;  3FXE B;  3ZYM A;  4PJM A;  2E4G A;  2VKH A;  3EDU A;  2BS3 A;  1UUS A;  2C5K T;  2WBL A;  4I43 B;  2EHO D;  4EZH A;  2WP9 A;  4ZXL A;  2BCG G;  3PV0 F;  2ES0 A;  4PJL A;  3TLU A;  3TLV A;  4JI2 T;  1H86 A;  5LYJ E;  4OPC A;  2R9Z A;  5KMP A;  4UV9 B;  4LF8 T;  1XWM A;  2VKD A;  4YHJ A;  2X68 A;  4DV5 T;  4H2P A;  1EL7 A;  2NW7 A;  3JC6 D;  4J2W A;  3PUW F;  4NTD A;  4U8I A;  3F8D A;  2YG3 A;  2BKN A;  3HI2 A;  3AE2 A;  4IE6 A;  4ZI3 C;  3SXI A;  5J2U E;  3ZPO A;  3AED A;  2XVH A;  1L9E A;  4M52 A;  3ZKR A;  2WET A;  5LMN T;  5FVL A;  4H9Q C;  3OBV E;  2RMU 4;  1GEU A;  3ZC0 A;  1CF3 A;  1EV1 4;  1PVC 4;  1PJ5 A;  3L8R A;  2DCF A;  1YKJ A;  1V9D A;  4PDW D;  3UP4 A;  1RSG A;  3VRD B;  1IJ6 A;  5CJ5 A;  3K3N A;  2LKG A;  2MYS A;  3RRC A;  3AE3 A;  2EX3 A;  1GTE A;  5EK2 A;  1HRI 4;  1MND A;  1TDK A;  4IRE A;  2CMR A;  4CN6 A;  4X64 T;  5JCN A;  3LBX B;  3C96 A;  4GYR A;  3CNJ A;  1XI1 A;  3UTH A;  3N9M A;  1WRD A;  3HR0 A;  2VQF T;  3AE4 A;  1UX4 A;  2WDQ A;  3UUM A;  4QX8 B;  3T37 A;  3CPI G;  4GAV A;  2V7I A;  1NHR A;  2BBJ A;  3J7Y q;  3GDP A;  2ZM8 A;  4ZI7 E;  1NHS A;  4OPU A;  4Z24 A;  3ESL A;  4H9O C;  2KZ7 B;  2I59 A;  2XQ6 A;  4IST A;  4U2Z A;  1I6Z A;  3ZYX A;  4AKL A;  2QYW A;  4DR2 T;  2XTL A;  4CI2 B;  2JJ9 A;  4A7A A;  2PYJ A;  4JI0 T;  3P50 A;  2H88 A;  1OED B;  5HEO A;  2CXD A;  2WM9 A;  4EEB A;  3K3Q C;  4GDE A;  1EAH 4;  2KND A;  2BCP A;  5M0Z A;  3V3O A;  2YR5 A;  1G73 A;  4JNA A;  3NTD A;  4QWN B;  2QAE A;  5FXV A;  1UK5 A;  4DO0 A;  1N34 T;  3LK4 2;  4U2L A;  5LBQ B;  3FB2 A;  4MFR A;  1BR1 A;  3HYW A;  3GA8 A;  3KVB A;  1ZV4 X;  3B3R A;  2MOZ A;  4DND A;  3JBG 4;  3GWF A;  1TYT A;  2BVM A;  3UU8 A;  2AAQ A;  2J1D G;  4G6G A;  3T1Y T;  2MBG A;  4GRT A;  4NUU A;  1AR6 4;  3OZ2 A;  3UQ7 A;  2Y6Q A;  2V61 A;  4A79 A;  2XQ8 A;  1XDP A;  3A7M A;  2ZM2 A;  4EYY R;  2BG9 C;  3I1A A;  4Q4Y 4;  1T8B A;  3DJJ A;  3T2Y A;  2YN6 A;  3AYJ A;  2LJL A;  1N4U A;  2B9Y A;  4CI1 B;  2YDQ A;  3PUG A;  4DV1 T;  4O2A E;  3A8Y C;  3UUX B;  4AP3 A;  4HTE A;  4ZOL E;  1L9D A;  4DR4 T;  3UUB A;  4ILC A;  4NZH A;  3Q6J A;  1KNR A;  1GQE A;  2YM1 A;  4OPT A;  2C0S A;  2V5Z A;  5FY7 A;  5ABH A;  3NHO X;  3HZL A;  1GRA A;  2R0C A;  2NR4 A;  2WZI A;  2WSS V;  4DV0 T;  4LF6 T;  4TNV A;  3CML A;  2X99 A;  2Y8D A;  2R4J A;  3ANW A;  4Z2T A;  4JYA T;  4DV3 T;  2C65 A;  4BUR A;  5L47 A;  1K0L A;  4WCT A;  1AR8 4;  1AOG A;  3MXZ A;  4U8J A;  4XXG A;  2L8K A;  3FG2 P;  2E8I A;  2CXF A;  1RP0 A;  2G0U A;  4K5R A;  3T2Z A;  1ZDL A;  2C5I T;  2V5C A;  4X20 E;  3AAI A;  2Q6U A;  2K9A A;  1O3X A;  3RHA A;  2V8S V;  4DBQ A;  3QSM A;  2HPL A;  3N9Q A;  1COY A;  2VOU A;  3ZEF B;  5HEG A;  2C73 A;  2UUB T;  4UVA B;  1UX5 A;  2I0M A;  1D1B A;  3QB5 A;  2YG4 A;  4TWH A;  2ODU A;  1ZKQ A;  3S4U A;  3BNM A;  2SPC A;  4NXM T;  5CB4 E;  3CTY A;  4U8L A;  4EAH A;  3Q9T A;  4U2S A;  5KRQ A;  3NN6 X;  2CDU A;  4AI6 A;  3C4N A;  4I59 A;  5M10 A;  2RP4 A;  4DR7 T;  3RKG A;  4YJ3 E;  4L9I A;  1YQ3 A;  5IUX A;  1UUR A;  1NWM X;  2KIN B;  5GON E;  2GR3 A;  5KDM C;  5HHF A;  2C70 A;  3CMM A;  3PO7 A;  4H4P A;  3LSV A;  1Q1W A;  3PUV F;  2Q9Q A;  2OLO A;  3SFD A;  2XLP A;  2ZMA A;  3NKS A;  3SX6 A;  1S3E A;  4EMW A;  4P09 A;  2CE7 A;  3R84 B;  2E9X D;  1BWC A;  3DA1 A;  4QH5 A;  1DOB A;  1DOD A;  4PJN A;  2CUL A;  3Q5E A;  1GRE A;  3GMC A;  1KF6 A;  2I6H A;  1IUS A;  3V5S A;  4DR3 T;  2PJQ A;  4EXT A;  2ZZ0 A;  1F8R A;  3PUA A;  2V60 A;  2YAU A;  4Q4W 4;  1VBD 4;  1OJ9 A;  4OPD A;  5FS6 A;  2RR1 4;  4ZHQ E;  2CA5 A;  2HWC 4;  4B6X A;  4H50 A;  1N4V A;  3RRW A;  3PVC A;  2XQ3 A;  3RI5 A;  5BRT A;  4I0U A;  1PBF A;  1TDN A;  3UT5 E;  2BG9 E;  3NWI A;  5CQF A;  1MO9 A;  2LEH A;  4X5T A;  4A97 A;  4YTN A;  2RS1 4;  1PO1 4;  1MMA A;  1GSN A;  2UXD T;  2YK0 A;  1IBK T;  3H3M A;  5LG3 A;  3LOV A;  4GDP A;  5JDN A;  1BEV 4;  5DAB A;  3CIR A;  3N9P A;  1R08 4;  3ZCJ A;  3QSS A;  1D4D A;  3NYF A;  5GSN A;  1N33 T;  4ERR A;  4X65 T;  2DKI A;  2WMN A;  4LFC T;  2OAM A;  1Y56 B;  2RGO A;  1NAA A;  2PFV A;  2QRX A;  1NCQ D;  1FCD A;  2VB6 A;  2WDR A;  3FI7 A;  1WFD A;  5AQM B;  2DHR A;  4AKR B;  2I0Z A;  3QC9 A;  3AEE A;  2PZS A;  4HEA A;  3AEC A;  3D8X A;  5IQ4 A;  5HXR A;  1Q1R A;  2ARD A;  2VRM A;  5HEH A;  3V76 A;  3ETV A;  4TZ4 C;  1E1K A;  1ZK7 A;  2UXC T;  2X0Y A;  2XFN A;  5JDH A;  4DV4 T;  2BKP A;  3ANW B;  4EQX A;  2Q0L A;  3ALM A;  1GRT A;  4DMV A;  3GD4 A;  2BK3 A;  1NPX A;  3P7I A;  4WBN E;  1VCT A;  3L8K A;  2NWB A;  4H4V A;  5LCY A;  5BUK A;  4TV8 E;  4ILA A;  4YTP A;  3BK9 A;  1HG5 A;  2BK4 A;  4KBM B;  2GMH A;  1KEY A;  4Y4M A;  3ZDN A;  3GQH A;  3FMW A;  1YQZ A;  1YQ4 A;  3L3P A;  4KX6 A;  3KBT A;  2IVE A;  3BI5 A;  5LBM A;  3RX6 A;  5E0O A;  4HWD A;  3QJ4 A;  3ZT5 A;  2X51 A;  3CGB A;  5CFB A;  1G8X A;  3MA9 A;  3WE0 A;  2ZM6 T;  2VK9 A;  2VL8 A;  3KLJ A;  3JSK A;  2OA1 A;  5HYA A;  3C98 B;  3ITJ A;  3Q2M A;  1M7K A;  5LNK A;  1BGN A;  3T1H T;  1ZMD A;  1HX8 A;  3UU3 A;  3AD7 B;  1NEN A;  2CXL A;  3CVR A;  3B57 A;  4NEV A;  2IVD A;  2EQ8 A;  3G06 A;  3H8L A;  1R09 4;  3HKC E;  4H2Q A;  3TLT A;  1ZHC A;  4TUY E;  4ZN0 A;  1D7Y A;  1YW0 A;  3BQL A;  3ONX A;  3P1W A;  4D03 A;  2A8X A;  2XQ4 A;  1W0A A;  3NRX A;  3ZMV B;  2AE9 A;  3SOL A;  2O9Z A;  4EED A;  1ZEE A;  5AQU B;  3EAN A;  1CJC A;  5EK4 A;  3LK2 B;  3B6D A;  1Q9I A;  5IHY A;  3V5U A;  2CCQ A;  4X62 T;  3FZK B;  4JV5 T;  1IZN B;  4TV9 E;  5LOV E;  1B37 A;  3F2E A;  1CJ2 A;  1VRQ B;  2E5V A;  4U72 A;  4AT2 A;  1YXR A;  3GD3 A;  5LV9 A;  2A9U A;  1MIY A;  1W9R A;  5JDG A;  2V26 A;  4Q25 A;  2B9W A;  5KNL A;  2LOP A;  3GWH A;  5AQJ B;  3RP7 A;  4X1K E;  3ZT6 A;  4F6R C;  1T7S A;  1B5Q A;  3NNE A;  2PHH A;  2E5L T;  4B63 A;  5AQQ B;  1S2Y A;  4YHH T;  3SZW A;  2CHO A;  1CHU A;  2NW8 A;  1PXA A;  3VKG A;  4YFS A;  2VL0 A;  2WMO A;  4IVO B;  3KIN B;  4YKG A;  3VKH A;  2DWK A;  2W62 A;  2XQ9 A;  4ZI2 C;  4JI7 T;  1IUU A;  1KK7 A;  4EQW A;  3AA0 B;  4BAY B;  2BS2 A;  2M6I A;  2PBI A;  2KXP B;  5AQG B;  3WAJ A;  1HXS 4;  3K8P C;  3BI4 A;  4O4J E;  3T14 A;  1YKE B;  4A5L A;  4GCM A;  3N2G E;  1K0I A;  3I3L A;  3RYC E;  2IW5 B;  2WHD A;  3RC8 A;  3F57 A;  4AOX A;  3QK6 A;  5L3E B;  4TM4 A;  5IWA T;  3DK4 A;  4B1B A;  4Z25 A;  5LHH B;  3TKL B;  4X66 T;  1RHI 4;  2RS3 4;  1E6E A;  1IBM T;  4Q4X 4;  4NTE A;  2OLT A;  4H4S A;  4Y4N A;  1I94 T;  1FOH A;  2NPX A;  3OPC A;  2JRK A;  3MK7 C;  3MAC A;  4EYU A;  4UEM A;  4UF0 A;  1E1N A;  4CBQ A;  3JAE A;  3C4X A;  2L3L A;  3X1D A;  5KMR A;  4C91 A;  4ADZ A;  4GB3 4;  2A2F X;  3K3O A;  1FIO A;  3N9O A;  4HFC A;  3ZST A;  3AE8 A;  3PJA A;  5IPY A;  1ZKE A;  3SRZ A;  1RUJ 4;  2IML A;  4IL9 A;  2XQ7 A;  2VWA A;  1LQU A;  3C4A A;  2CBJ A;  5AQV B;  3LJP A;  4I4T E;  3ADA B;  2RS5 4;  3JD7 4;  3UKF A;  4CXY A;  1LV0 A;  5AQI B;  5FMH A;  4PNI A;  2JIW A;  4H2N A;  2WY2 A;  1RUI 4;  2BC1 A;  3UFE A;  4DUY T;  3UKH A;  2UXN B;  1XZY A;  1NG3 A;  4AOS A;  4UIG A;  3QNU A;  2K24 A;  5JH7 E;  2FJA A;  3RIU A;  3CPJ G;  5FP3 A;  2X8H A;  4EB6 E;  2N1G A;  3P4S A;  2GF3 A;  2CBI A;  2WP6 A;  1SEZ A;  1VBE 4;  1S35 A;  5EB4 A;  5HY5 A;  2XAG B;  3GN5 B;  2YLW A;  2W67 A;  1TRB A;  1U4Q A;  4CZZ B;  1VBC 4;  1GND A;  4PK4 A;  2YG7 A;  2YVG A;  1HCI A;  2WU5 A;  4AXP A;  1CC4 A;  4E0V A;  1V59 A;  1MMG A;  1WYC A;  2K3W A;  3JAF A;  2D2S A;  3RNM A;  2XLS A;  2BC0 A;  2D0U A;  4DR6 T;  4JLE A;  2NOX A;  5AQR B;  5LHG B;  2XM1 A;  2AXD S;  2QCU A;  2D5U A;  1HG2 A;  3FIM B;  2JMK A;  1UCU A;  4GKK T;  1OOP D;  3SM8 A;  1O94 A;  1D4E A;  4PAA A;  4UP3 A;  2EQ9 A;  3FPZ A;  4CXX A;  4JQ9 A;  4DNA A;  3EHZ A;  3CPZ A;  4H9P C;  3U78 A;  2WOV A;  2X8G A;  1VBA 4;  2BS4 A;  2XPK A;  1LVK A;  5M4Y A;  3AAE B;  1AJ3 A;  4O4L E;  3CX8 B;  2YEV C;  3B5M A;  4LA1 A;  1RUH 4;  5U25 A;  3AD9 B;  1Y64 B;  4ZZC A;  5JRC A;  3EAO A;  5HXE A;  2D0T A;  3EI0 A;  4OX9 T;  3P4P A;  1MOK A;  2F5Z A;  4OYK A;  4EM4 A;  1GAL A;  4IDP A;  3VRB A;  3AE6 A;  2ZLY A;  4FJO A;  3PJA J;  4ZCD A;  3RYF E;  4A65 A;  3UQ4 A;  3F31 A;  1H81 A;  3BI2 A;  2N9D A;  1E2A A;  1Z6L A;  4OPG A;  5JR9 A;  2C64 A;  4E7Z A;  4BV6 A;  5HWX A;  4OPI A;  2GEW A;  4KHZ F;  3NRN A;  4NPP A;  3IA3 A;  4RHV 4;  2CLY B;  1OED E;  3VU7 H;  1L9C A;  1UKV G;  3I9W A;  4TM3 A;  2VZ2 A;  2XAH B;  1M64 A;  2RA1 A;  1XPQ A;  4MLK A;  4K8D A;  1M6I A;  3LXD A;  3AA6 B;  5FKY A;  3QUJ A;  2TPR A;  3SQP A;  3C50 A;  3CKD A;  1E1H B;  2CPT A;  3PUS A;  4HWC A;  2GV8 A;  3JAD A;  3KVA A;  4CY6 A;  3T31 A;  2CRB A;  1M62 A;  4P0B A;  1RVF 4;  4HFE A;  1RUG 4;  4H4W A;  2J3N A;  2GR0 A;  3CGE A;  5EB5 A;  2C5J A;  1F8W A;  5J1G A;  3H4K A;  4IE5 A;  1MQT D;  3M3Z B;  2BYB A;  4J31 A;  4UF0 B;  2YR6 A;  3ICT A;  1T98 A;  3KFW X;  2UXX B;  1UGO A;  4DID B;  1KFY A;  1N36 T;  2V6Y B;  4JDR A;  2BKO A;  3PTR B;  2XAQ B;  3ZT7 A;  1XDI A;  2XHE B;  4U8M A;  4H4X A;  5CKU A;  4GUV A;  1QLB A;  4CCQ A;  2IAK A;  2LOS A;  4X9M A;  3UKK A;  4EQS A;  2GH5 A;  5BVA A;  2W61 A;  3OKQ A;  1TDE A;  3F8R A;  2XQ5 A;  3NGC X;  4N9X A;  5JDF A;  3IBP A;  2R0G A;  4IV9 A;  1HNX T;  3T8O A;  4USR A;  1H7X A;  3UU4 A;  1U5P A;  2CM0 A;  4OK0 A;  4U8K A;  4GOU A;  5FL1 A;  2X3N A;  4K5S A;  4HWI B;  1HF8 A;  1VDC A;  5LGT B;  1EBD A;  2YM2 A;  2XAF B;  5LGN B;  1FMV A;  2CEA A;  4IT4 A;  4DUZ T;  2LRK A;  1HNW T;  3UKP A;  2IHR 1;  4JY2 A;  3GYJ A;  1NEK A;  2IC6 A;  4RSL A;  1BR0 A;  2PTF A;  3KVE A;  2BAB A;  4TWD A;  5AQL B;  2Y6X A;  2B7S A;  5FY1 A;  4ZEY A;  3CNP A;  3CPH G;  2B7R A;  4UVB B;  5HYM A;  4DGK A;  3UKQ A;  2JQ9 A;  2BA9 A;  3H3A A;  5LJM A;  3RGL A;  1PIV 4;  3D1C A;  3CQC B;  3EAB A;  5LA6 E;  2JQQ A;  2Z6E A;  4LMK A;  4MBQ A;  4PAB A;  1ZP0 A;  2ZZC A;  3R9U A;  1S3B A;  3MKD A;  4JEU B;  4O4H E;  1GRH A;  3CGD A;  2ZBW A;  3KPK A;  4J34 A;  4TWF A;  5KMQ A;  3SY4 A;  1VRB A;  3ABV A;  3AEA A;  3Q9D A;  5ABF A;  4WZX A;  2DKH A;  4IA6 A;  1X79 A;  2YKS A;  3RQU A;  2DLR A;  1EL5 A;  4BJN A;  4QXB B;  1IAP A;  3DK9 A;  1H82 A;  1E1L A;  2YDR A;  3N5L A;  2A87 A;  5JQG E;  4II3 A;  5FXX A;  3R6N A;  5L3D B;  3O1J A;  4B69 A;  2XLR A;  3M12 A;  1VBB 4;  3HKE E;  2VQB A;  3RIA A;  3GYX A;  4J57 A;  5J0Z A;  1X9B A;  1CBO A;  2Q9Q C;  3P9U A;  4KP3 C;  2ZM0 A;  1W09 A;  3ZSS A;  1YKH B;  3DJD A;  4HWH A;  2UU9 T;  3HA4 A;  5FY0 A;  1GTH A;  2HN1 A;  2GR1 A;  4J56 A;  4J33 A;  3DJG X;  1ZOY A;  4DR5 T;  4AQY T;  4EQR A;  1XDO A;  4LML A;  4B66 A;  1QJD A;  1NAF A;  2WPC A;  3ZN0 B;  3UTF A;  1GPE A;  2A89 A;  2D9D A;  4AQG A;  3SWH A;  3EDV A;  2RGH A;  3Q5W A;  3RH3 A;  3RF1 A;  4EZ4 A;  2JB2 A;  5GRT A;  2OV9 A;  2XSB A;  2NVK X;  5DBJ A;  4BK2 A;  3NBX X;  4NNJ A;  3NYE A;  1J5W A;  5F5W A;  5HCJ A;  2VUR A;  1RMU 4;  3H37 A;  3KV5 A;  4CI3 B;  1RYI A;  4UDQ A;  4H63 H;  1N4W A;  4UVC B;  1IBL T;  3DJE A;  1Z7S 4;  4IL4 A;  2APG A;  4NIQ A;  2H89 A;  3AE9 A;  4AKI A;  2YLZ A;  2YVF A;  3KPF A;  3CNS A;  4ZI3 D;  4H4R A;  2LM2 A;  5HWY A;  4P0A A;  2J47 A;  3GYI A;  5LGU B;  2CWY A;  4U8P A;  2V7K A;  4B3T T;  2GRT A;  3ZMS B;  4HFI A;  2RGJ A;  1GXF A;  3KU9 A;  2AR8 A;  1FEB A;  5LP6 E;  1D7L A;  4Z2U A;  3M13 A;  4AKG A;  3QVP A;  3RP8 A;  2V7L A;  1GOS A;  5H6R B;  4X9N A;  4OYJ A;  2VKO A;  3KV9 A;  3J9X 1;  4KHP T;  1EZ3 A;  1MIV A;  1PJ7 A;  4H4Q A;  5LB7 B;  2Y6R A;  5EZY E;  1IJ5 A;  3AB1 A;  3ONJ A;  3IF9 A;  3PUX F;  4YLH A;  2LSK A;  4N78 D;  4AIS A;  2E1M A;  5FS8 A;  3AYI A;  3UTE A;  1CJ3 A;  1WR6 A;  4DSG A;  2YG5 A;  4JI6 T;  1OJD A;  2C66 A;  1RUF 4;  4DMW A;  4ZZB A;  3AWI A;  5FXW A;  4C90 A;  3HYV A;  3COX A;  4PK6 A;  1PHH A;  2JB1 A;  3TLW A;  1AR7 4;  2BAC A;  4TX5 A;  2YLT A;  2R0P A;  3LG7 A;  3QVR A;  1FMW A;  4EIP A;  4LF4 T;  3HL6 A;  2EQ7 A;  4IDO A;  3UU5 A;  2LHN A;  2LSY A;  3QOF A;  3OJA A;  4HFV A;  1JRX A;  2GAH B;  5TR3 A;  1LQT A;  3UTK A;  3SZF A;  3DP7 A;  2EHO A;  4YSY A;  1MIW A;  5ABF B;  1YY5 A;  2IID A;  1HRV 4;  3PUY F;  2PYX A;  2X9H A;  4GK5 E;  1FEW A;  5AQK B;  1B4V A;  3T0K A;  1RUC 4;  4BJM A;  4RG4 A;  4EMI A;  3ONL C;  4IE0 A;  2M6B A;  2X8C A;  4IE4 A;  4OPL A;  2LSI A;  4CCR A;  1US7 B;  3AA1 B;  3W15 B;  2XCG A;  3AEF A;  4AP1 A;  4A6N A;  4KMC A;  4U31 A;  1JRZ A;  3TLS A;  1BR4 A;  2WCA A;  1XHX A;  1Y0P A;  4AIU A;  1REO A;  1D1C A;  2VAS A;  1GT8 A;  5IYZ E;  1KDG A;  5AQF B;  4G74 A;  1B8S A;  4E7S A;  3M65 A;  3AXB A;  2X0H A;  5ETW A;  3PU3 A;  5CGM A;  5HCM A;  4DSH A;  2Q9Q B;  1T72 A;  1F8S A;  4FK1 C;  5FL0 A;  2WAU A;  4QXH B;  1LVL A;  5JRE A;  2UUC T;  1MNE A;  3IEE A;  2BVL A;  1LPF A;  5FS9 A;  4D04 A;  3NYC A;  1AR9 4;  4FK1 A;  5KOX A;  5AQP B;  2W63 A;  3NLC A;  5ABE A;  2C75 A;  2B1E A;  3FBZ A;  5DQV A;  2YVJ A;  4LFA T;  3M0O A;  2X9W A;  5AQO B;  4ECH A;  1H7W A;  2RM2 4;  5DQW A;  4IDN A;  2R04 4;  4REK A;  1LJ1 A;  1GET A;  1GES A;  2XLT A;  1GER A;  3NZP A;  2XM2 A;  3CWZ B;  4JN9 A;  3ZMU B;  5FMN A;  2BRA A;  5J7X A;  1JRY A;  2IIU A;  2CLY C;  4H4U A;  5BUL A;  1TYP A;  4U7Y A;  2LM9 A;  1Z8U A;  2XUE A;  3P4R A;  3UFG A;  3NIX A;  4YSZ A;  3CND A;  2NP9 A;  2WWU A;  4LMJ A;  4WX1 A;  2X5I D;  4JI4 T;  4XAX B;  1FJG T;  4YJ2 E;  1DXL A;  2W2U A;  3C64 A;  1D4C A;  2WEU A;  1DNC A;  4GKJ T;  3CX7 B;  2W66 A;  1ELI A;  1QO8 A;  4G73 A;  3LJC A;  4PK5 A;  3AB3 B;  2MTQ A;  2C76 A;  4DR1 T;  4EMJ A;  3AD8 B;  1XMO T;  3SYI A;  4LFB T;  2KT9 A;  2HQM A;  1BGJ A;  3SS1 A;  2H7V C;  3RLF F;  3I0Q A;  2K5B B;  2YIN A;  2OA5 A;  4ISS A;  3ICS A;  4I55 E;  4B3M T;  2YLR A;  4GF7 A;  4JI5 T;  2V7J A;  5LHI B;  2JQH A;  1PN0 A;  4F8H A;  1DJN A;  4AKH A;  3AA7 B;  3RIF A;  1D0Z A;  4Q4V 4;  2JMH A;  2ODV A;  4O4I E;  4UR9 A;  3RPU A;  3N2K E;  4X1I E;  3AEB A;  1GV4 A;  4I58 A;  1WR0 A;  2EHO B;  3PU8 A;  2YLX A;  2R46 A;  3BNU A;  4J2C A;  3V3N A;  1VOM A;  1FEA A;  1OED A;  4P9S A;  3RIU C;  2QGS A;  5L3F B;  1AL2 4;  3DTO A;  4YWO A;  3PUR A;  5J60 A;  2XFP A;  1NHP A;  1FEC A;  2C72 A;  1ZY8 A;  1EL8 A;  4EOZ B;  3QFA A;  1VG0 A;  5HXS A;  1HFA A;  2C3C A;  5KMS A;  3RYH E;  1PS9 A;  1N1P A;  1H84 A;  2JB3 A;  4CN1 A;  1NDA A;  4A6N B;  3SGL A;  4NWZ A;  3P8C D;  1XAN A;  4HFD A;  4IDZ A;  3G5Q A;  3O4X E;  2KWI B;  2XYO A;  2C3D A;  3LAD A;  3MZK B;  4Y4L A;  3ISH A;  4IVM B;  1Y01 A;  2DWG A;  2JK6 A;  4APN A;  5JCK A;  3NKZ A;  5L3C B;  3NK0 X;  2RPA A;  4C5O A;  5LMU T;  1KSU A;  4PAG A;  4G2A A;  3AXJ A;  1WYB A;  5U1O A;  2XZE A;  2XFO A;  1IUV A;  4G6H A;  2L9Q A;  1KSS A;  2DI4 A;  1WCR A;  4AQF A;  1D1A A;  1D0Y A;  3BQI A;  1LVF A;  5C2T A;  4DV2 T;  4IIJ E;  1F6M A;  2BXS A;  2YG6 A;  3PS9 A;  3NH3 X;  5CA1 E;  5HXH A;  5JTG A;  1FL2 A;  2E9X C;  2J4G A;  4JEH B;  2B76 A;  3L1R A;  4LII A;  3ZCI A;  4IGU A;  5J2T E;  1XNR T;  2WOI A;  2R7F A;  3AE1 A;  3OC4 A;  4BK1 A;  3KKJ A;  3NT6 A;  1VG9 A;  1EL9 A;  3EAM A;  3DK8 A;  2BRY A;  1HS7 A;  4K7Z A;  4A99 A;  3QSE A;  4H7U A;  5JR9 C;  2BDE A;  4GYS A;  4HGA A;  3CX6 B;  4ZS2 A;  5ADX L;  3AVR A;  1SUM B;  2E9X A;  1OJA A;  2BBH A;  4JI3 T;  4OVI A;  4J36 A;  1MMD A;  4HWF A;  3LZW A;  3RP6 A;  2VQ7 A;  1IJH A;  2NW9 A;  4B67 A;  4CY8 A;  2KMF A;  3B13 A;  2IUB A;  3K1S A; 
#chains in the Genus database with same CATH homology
 3AEC A;  4Z2R A;  3ALL A;  3D8X A;  5IQ4 A;  1EL5 A;  1Q1R A;  1KNP A;  2ARD A;  2C7G A;  2VRM A;  3DK9 A;  4HA6 A;  1H82 A;  1E1L A;  4GAP A;  3V76 A;  4H4Z A;  1E1M A;  2A87 A;  1E1K A;  3NG7 X;  4FX9 A;  1OJC A;  2YWL A;  4II3 A;  2LFC A;  1ZK7 A;  4B69 A;  2XLR A;  1PJ6 A;  3IHG A;  2XFN A;  3M12 A;  3SZ0 A;  3P4Q A;  2VRL A;  4EQX A;  3HYX A;  5C3J A;  2Q0L A;  3ALM A;  3CNT A;  2FJD A;  2Q7V A;  3GMB A;  2VQB A;  1GRT A;  3GYX A;  4J57 A;  2GQF A;  3GD4 A;  4H4Y A;  5JCI A;  2BK3 A;  1PBB A;  1NPX A;  4LU6 A;  2WQY A;  3L8K A;  1CBO A;  1CL0 A;  4H4V A;  3P9U A;  2WDV A;  2WOW A;  4O5Q A;  5BUK A;  3VRA A;  4YTP A;  2C4C A;  3DJD A;  1GTH A;  2BK4 A;  2GMJ A;  2GR1 A;  3AEG A;  4J56 A;  5JCM A;  3EPT A;  2GMH A;  4J33 A;  4Y4M A;  3ZDN A;  3DJG X;  1ZOY A;  3IWA A;  4HB9 A;  3FMW A;  4EM3 A;  1YQZ A;  1GRB A;  1YQ4 A;  4EQR A;  4KX6 A;  4B66 A;  2IVE A;  4YSX A;  1QJD A;  3NN0 X;  2WPC A;  2C67 A;  3UTF A;  3BI5 A;  4H4T A;  1GPE A;  2R45 A;  3QJ4 A;  2A89 A;  3T2K A;  3AE5 A;  3G5S A;  4OCG A;  3CGB A;  1TDF A;  3G5R A;  2RGH A;  3II4 A;  3WE0 A;  3DGZ A;  3KLJ A;  4AT0 A;  3JSK A;  2JB2 A;  2OA1 A;  3VR9 A;  3UKL A;  5GRT A;  4Z26 A;  2R4E A;  2YLS A;  3ITJ A;  1K4Q A;  2XVE A;  3UTG A;  2JBV A;  2NVK X;  1VQW A;  5DBJ A;  1BGN A;  4BK2 A;  1ZMD A;  4NNJ A;  3ATR A;  3AD7 B;  3NYE A;  1DOC A;  1NEN A;  2CFY A;  1ZX9 A;  4NEV A;  3QFB A;  4O5U A;  2IVD A;  1RYI A;  4UDQ A;  1N4W A;  2X50 A;  2EQ8 A;  2XVI A;  1BZL A;  2TMD A;  3H8L A;  3DJE A;  1ZOV A;  1GRG A;  4H2Q A;  4USQ A;  2APG A;  4Z44 A;  3SZC A;  2BK5 A;  2H89 A;  3AE9 A;  4ZN0 A;  2FJB A;  1D7Y A;  1H6V A;  2YLZ A;  4U2T A;  4B64 A;  2VVL A;  2YVF A;  3P1W A;  3AE7 A;  1PBC A;  3CNS A;  3KPF A;  4H4R A;  2A8X A;  4D03 A;  3UP5 A;  2O9Z A;  1O95 A;  3EAN A;  1TDO A;  1LTX R;  3GYI A;  1CJC A;  4XWR A;  2JKC A;  2XVF A;  4K2X A;  3B6D A;  4U8P A;  1PXB A;  1Q9I A;  5KWF A;  2GRT A;  2E4G A;  2RGJ A;  2BS3 A;  1B37 A;  1VRQ B;  1CJ2 A;  1GXF A;  2AR8 A;  3KU9 A;  1FEB A;  2E5V A;  1D7L A;  2WP9 A;  4JNQ A;  4AT2 A;  3GD3 A;  4Z2U A;  3BHF A;  3M13 A;  5LV9 A;  1GRF A;  2BCG G;  3QVP A;  3DGH A;  3RED A;  1H86 A;  2B9W A;  3RP8 A;  1ONF A;  3KD9 A;  5KNL A;  4OPC A;  3RP7 A;  1GOS A;  4X9N A;  2R9Z A;  5KMP A;  2YR4 A;  1B5Q A;  1PBE A;  3NNE A;  2PHH A;  1PJ7 A;  1Y56 A;  4B63 A;  1S2Y A;  1H83 A;  3SZW A;  1CC2 A;  4H4Q A;  4H2P A;  2Y6R A;  3AB1 A;  4C3X A;  1CHU A;  1EL7 A;  1PXA A;  4J2W A;  3IF9 A;  4ICY A;  4NTD A;  4U8I A;  3F8D A;  2OLN A;  2E1M A;  2YG3 A;  4UDP A;  5FS8 A;  3AYI A;  3AYL A;  4IVO B;  4K22 A;  3AE2 A;  3UTE A;  3CGC A;  2Z5Y A;  1BKW A;  4YKG A;  1CJ3 A;  4X4J A;  2RAB A;  3SXI A;  2XVJ A;  1IUU A;  2Z5X A;  2ZZB A;  4EQW A;  4DSG A;  3AED A;  3EF6 A;  2XVH A;  2BS2 A;  1L9E A;  2YG5 A;  4M52 A;  1JNR A;  1OJD A;  2WET A;  2C66 A;  1S2Q A;  3AWI A;  4YKF A;  3BI4 A;  3COX A;  3HYV A;  3T14 A;  1PHH A;  1GEU A;  4A5L A;  2JB1 A;  4GCM A;  1CF3 A;  2BAC A;  1K0I A;  2R0P A;  1PJ5 A;  2YLT A;  3I3L A;  3F8P A;  3UKA A;  1YKJ A;  3QVR A;  2WHD A;  4EIP A;  4AOX A;  2EQ7 A;  1RSG A;  3UP4 A;  3VRD B;  4TM4 A;  4B1B A;  3DK4 A;  4Z25 A;  2QA1 A;  1JRX A;  1PDH A;  2GAH B;  5TR3 A;  3AE3 A;  1LQT A;  1GTE A;  3SZF A;  1E6E A;  1TDK A;  4NTE A;  4H4S A;  4Y4N A;  1FOH A;  2WP5 A;  4YSY A;  4YT0 A;  2IID A;  1YY5 A;  2NPX A;  4TLX A;  5JCN A;  2PYX A;  3C96 A;  3CNJ A;  1B4V A;  3T0K A;  3UTH A;  2B9X A;  1E1N A;  4CBQ A;  2FBW A;  2EQ6 A;  2WPE A;  4RG4 A;  3AE4 A;  4EMI A;  2WDQ A;  4II2 A;  2WS3 A;  3SUC A;  3T37 A;  3CPI G;  5KMR A;  4GAV A;  3CN8 A;  1NHR A;  4U8N A;  4B65 A;  4BJY A;  3UCL A;  2X8C A;  2QA2 A;  3ATQ A;  3GDP A;  3AE8 A;  1XHC A;  5IPY A;  5KVH A;  4OPL A;  4CCR A;  4TM1 A;  1NHS A;  4OPU A;  4Z24 A;  4TM0 A;  3GQK A;  1LQU A;  3C4A A;  2XCG A;  2VVM A;  3AEF A;  3LJP A;  4AP1 A;  4A6N A;  3ADA B;  1CC6 A;  4CRT A;  3ZYX A;  1JRZ A;  3GRS A;  4TLZ A;  4BJZ A;  3UKF A;  1Y0P A;  1LV0 A;  1W4X A;  4A7A A;  1REO A;  1GT8 A;  2H88 A;  2W0H A;  5FMH A;  1KDG A;  4G74 A;  4H2N A;  2BC1 A;  1B8S A;  2CVJ A;  3UKH A;  1K0J A;  3AXB A;  4GDE A;  2JAE A;  2WU2 A;  2BCP A;  1NG3 A;  2WES A;  4AOS A;  4ZCC A;  5M0Z A;  3V3O A;  2YR5 A;  4DSH A;  4JNA A;  3GSI A;  3NTD A;  3IC9 A;  1F8S A;  2QAE A;  4FK1 C;  4U2L A;  2FJA A;  2XFQ A;  3CPJ G;  2X8H A;  3HYW A;  1LVL A;  3B3R A;  1O5W A;  3GDN A;  3GWF A;  1TYT A;  3P4S A;  2GF3 A;  2WP6 A;  1SEZ A;  3GRT A;  3NK2 X;  2AAQ A;  2Q0K A;  5EB4 A;  5HY5 A;  2YLW A;  4G6G A;  1LPF A;  5FS9 A;  4D04 A;  3NYC A;  4GRT A;  1TRB A;  5EBK A;  4FK1 A;  1MXT A;  5KOX A;  3OZ2 A;  3NLC A;  1GND A;  2YVG A;  2YG7 A;  2Y6Q A;  2V61 A;  4A79 A;  2WU5 A;  2C75 A;  4IA5 A;  2YVJ A;  3M0O A;  4U8O A;  1CC4 A;  4E0V A;  1V59 A;  4ECH A;  1H7W A;  4REK A;  3RNM A;  2XLS A;  1LJ1 A;  1GET A;  1GES A;  2BC0 A;  2XLT A;  1GER A;  1PXC A;  3DJJ A;  3T2Y A;  3AYJ A;  1N4U A;  2B9Y A;  5HYM A;  4JN9 A;  3ICR A;  3KA7 A;  5KOW A;  2QCU A;  2XDO A;  2BRA A;  3FIM B;  5U63 A;  5J7X A;  4YTM A;  4JY3 A;  1JRY A;  3K7M X;  4H4U A;  5BUL A;  3K30 A;  1TYP A;  3SM8 A;  1JEH A;  1O94 A;  1D4E A;  4AP3 A;  4PAA A;  4GR1 A;  4UP3 A;  2EQ9 A;  1L9D A;  3FPZ A;  4JQ9 A;  4DNA A;  4NZH A;  3P4R A;  3Q6J A;  1KNR A;  2WOV A;  2X8G A;  2YM1 A;  1ZMC A;  2BS4 A;  4YSZ A;  3NIX A;  4OPT A;  4Z43 A;  3CND A;  1BF3 A;  2V5Z A;  1L0V A;  2UZZ A;  4WX1 A;  5L46 A;  3VR8 A;  3NHO X;  1DXL A;  3HZL A;  1GRA A;  2R0C A;  4LA1 A;  5U25 A;  2X99 A;  3AD9 B;  1D4C A;  1JNZ A;  1P2E A;  3EAO A;  2WEU A;  1P2H A;  1DNC A;  1ELI A;  2R4J A;  1QO8 A;  3P4P A;  1MOK A;  2WBA A;  1JOA A;  2F5Z A;  4G73 A;  4Z2T A;  4EM4 A;  1GAL A;  2C65 A;  4BUR A;  3VRB A;  4NTC A;  1K0L A;  5KVI A;  4WCT A;  3AE6 A;  1AOG A;  2C76 A;  2GQW A;  4ZCD A;  4A65 A;  4U8J A;  4XXG A;  1H81 A;  3FG2 P;  3BI2 A;  5HXI A;  4EMJ A;  3AD8 B;  1RP0 A;  4OPG A;  1Z6L A;  4K5R A;  3SYI A;  2GR2 A;  3T2Z A;  1ZDL A;  2C64 A;  4BV6 A;  2HQM A;  1BGJ A;  3URH A;  2Q6U A;  4OPI A;  3ICS A;  2GEW A;  3RHA A;  1DJQ A;  3NRN A;  3QSM A;  2GAG B;  5ER0 A;  2YLR A;  1COY A;  2VOU A;  4GF7 A;  1L9C A;  1HYU A;  1UKV G;  1PBD A;  2C73 A;  4NEW A;  4TM3 A;  1PN0 A;  2VZ2 A;  3NTA A;  1DJN A;  1M64 A;  4KPR A;  1XPQ A;  4CNK A;  4K8D A;  1M6I A;  3LXD A;  2TPR A;  3SQP A;  2YG4 A;  4C3Y A;  1ZKQ A;  3BNM A;  3UOY A;  1IUT A;  3CTY A;  4U8L A;  3E1T A;  2GV8 A;  3Q9T A;  4U2S A;  3I6D A;  3LZX A;  4CY6 A;  5KRQ A;  3T31 A;  3NN6 X;  2CDU A;  3C4N A;  4I59 A;  5M10 A;  1CJ4 A;  4H4W A;  3AEB A;  1GV4 A;  2J3N A;  4I58 A;  2GR0 A;  2V3B A;  3CGE A;  2YLX A;  2R46 A;  3BNU A;  1YQ3 A;  4RG3 A;  5EB5 A;  3UOV A;  3V3N A;  1F8W A;  1FEA A;  4YSH A;  2GR3 A;  4MJW A;  3H4K A;  4P9S A;  4CNJ A;  5HHF A;  2C70 A;  1OJT A;  1D5T A;  1F3P A;  2V6O A;  3CMM A;  3PO7 A;  4H4P A;  2BYB A;  4YWO A;  4J31 A;  1E39 A;  2YR6 A;  5J60 A;  2XFP A;  1Q1W A;  1NHP A;  3ICT A;  1FEC A;  2OLO A;  3UOX A;  2C72 A;  3SFD A;  1NHQ A;  2XLP A;  3IHM A;  3NKS A;  5JCL A;  3SX6 A;  1KFY A;  1ZY8 A;  1E7P A;  1EL8 A;  1S3E A;  3QFA A;  4FDC B;  4JDR A;  4EMW A;  1VG0 A;  3FBS A;  2C3C A;  1XDI A;  4U8M A;  5KMS A;  1PS9 A;  1N1P A;  1BWC A;  4H4X A;  5CKU A;  3DA1 A;  1H84 A;  2JB3 A;  2VVL G;  4GUV A;  1QLB A;  1NDA A;  4A6N B;  1DOB A;  4CCQ A;  1DOD A;  4XWZ A;  2CUL A;  3SGL A;  4X9M A;  3UKK A;  4EQS A;  5FS7 A;  4NWZ A;  1GRE A;  1XAN A;  3G5Q A;  1KF6 A;  3GMC A;  3NK1 X;  4C74 A;  2OAL A;  4H2R A;  2GH5 A;  5BVA A;  2GVC A;  2XYO A;  2C3D A;  1TDE A;  3LAD A;  3F8R A;  1IUS A;  4C77 A;  3NGC X;  2YQU A;  4Y4L A;  3DH9 A;  2ZZ0 A;  3ISH A;  4IVM B;  4N9X A;  2JK6 A;  1F8R A;  4APN A;  2R0G A;  5JCK A;  2ACZ A;  2WPF A;  3NK0 X;  4IV9 A;  2V60 A;  2YAU A;  4USR A;  1H7X A;  4C5O A;  3DME A;  1KSU A;  1OJ9 A;  5IQ1 A;  3BHK A;  5U1O A;  4U8K A;  2XFU A;  4OPD A;  2XFO A;  5FS6 A;  2AQJ A;  3SFE A;  1IUV A;  2X3N A;  4G6H A;  4YXD A;  4G9K A;  1KSS A;  4K5S A;  3H8I A;  3O0H A;  1VDC A;  4H50 A;  1N4V A;  2XLU A;  3PVC A;  4ADW A;  5BRT A;  1EBD A;  2YM2 A;  1PBF A;  1TDN A;  1X31 B;  2V3A A;  5C2T A;  1IUX A;  3K7Q X;  5CQF A;  1F6M A;  1MO9 A;  2BXS A;  2YG6 A;  4YTN A;  3PS9 A;  3S61 A;  3UKP A;  3NH3 X;  4JY2 A;  3GYJ A;  1IUW A;  5EOW A;  1NEK A;  4RSL A;  5KXJ A;  1GSN A;  1FL2 A;  3KVE A;  2BAB A;  3VQR A;  2B76 A;  3L1R A;  4LII A;  2B7S A;  4UDR A;  2FJE A;  3LOV A;  2WOI A;  1JU2 A;  2GB0 A;  3AE1 A;  4GDP A;  3OC4 A;  1DOE A;  4B68 A;  4BK1 A;  3KKJ A;  3CIR A;  3CNP A;  1VG9 A;  1EL9 A;  3NT6 A;  4A9W A;  3DK8 A;  3UOZ A;  4BK3 A;  3CPH G;  2B7R A;  2BRY A;  3QSS A;  4K7Z A;  4A99 A;  4DGK A;  1D4D A;  3NYF A;  5GSN A;  3UKQ A;  3QSE A;  2BA9 A;  4H7U A;  2DKI A;  3D1C A;  2OAM A;  1Y56 B;  2RGO A;  1OJA A;  3ALJ A;  4OVI A;  4J36 A;  1NAA A;  3S5W A;  3LZW A;  3RP6 A;  2VQ7 A;  1IJH A;  4B67 A;  1FCD A;  1ZP0 A;  2WDR A;  2ZZC A;  4PAB A;  3R9U A;  1S3B A;  4CY8 A;  3GWD A;  1GRH A;  3GQH A;  3CGD A;  2ZBW A;  3KPK A;  4J34 A;  5KMQ A;  2I0Z A;  3K7T A;  3LB8 A;  3SY4 A;  4EIQ A;  3AEE A;  1NG4 A;  2BXR A;  3ABV A;  3AEA A;  4IA6 A;  2DKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...