5C3MA

Crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
434
structure length
410
Chain Sequence
LKMATIGGGSSYTPELVEGLIKRYHELPVGELWLVDIPEGKEKLEIVGALAKRMVEKAGVPIEIHLTLDRRRALEGADFVTTQFRVGGLEARAKDERIPLKYGVIGQETNGPGGLFKGLRTIPVILDIIRDMEELCPDAWLINFTNPAGMVTEAVLRYTKQEKVVGLCNVPIGMRMGVAKLLGVDADRVHIDFAGLNHMVFGLHVYLDGVEVTEKVIDLVAHPLGWEPDFLKGLKVLPCPYHRYYYQTDKMLAEELEAAKTKGTRAEVVQQLEKELFELYKDPGGAYYSDAACSLISSIYNDKRDIQPVNTRNNGAIASIPPESAVEVNCVITKDGPKPIAVGDLPVAVRGLVQQIKSFERVAAEAAVTGDYQTALVAMTINPLVPSDTIAKQMLDEMLEAHKEHLPQFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-glucosidase
total genus 138
structure length 410
sequence length 434
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.86: 6-phospho-beta-glucosidase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02056 Glyco_hydro_4 Family 4 glycosyl hydrolase
A PF11975 Glyco_hydro_4C Family 4 glycosyl hydrolase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5c3mA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5c3mA02
1ONOA 2WYVA 4A2CA 4CQMB 3B1FA 3U4DA 2GGSA 3BMQA 4U0KA 5DOZA 4J1QA 5KJ6A 1QYWA 4YEDA 3I5MA 1YKFA 5F1KA 4UUMA 2H9IA 3A28A 2Y1GA 3SBOA 2Q46A 5ICSA 2BKAA 5CAEA 2GERA 4NFSA 1UDBA 3QQPA 5CDTA 3TF5A 1Z82A 3W6ZA 4LCJA 3FNGA 4OSOA 4R16A 1OI7A 1VJTA 4QUKA 1H6BA 4G2NA 2EHDA 3JQ7B 1IHYA 4DC1A 4Z9YA 4Z0TA 1O94A 4OIMA 5HWSA 3L4BA 1ZJZA 4YJDA 4CM5A 5JY1A 2JKVA 1TA4A 5JFOA 3TWOA 2PZLA 1ZJYA 1DLJA 3BHMA 4BNXA 1MLDA 1KEPA 5I9NA 1TVEA 2Z5LA 2AHRA 4FDAA 3NV9A 4GGPA 1LEHA 1DC3A 1YQDA 5TS3A 1SB8A 5KJFA 3F5SA 2C7GA 5I9MA 1HRDA 1PEDA 4E5PA 3AUSA 3GLQA 4FN4A 4CQLA 1FDWA 1A5ZA 1B3BA 1H6AA 4EUHA 4JQCA 4PG6A 5EIOA 2W98A 3FWNA 3F6YA 3GAFA 2AQ8A 3F47A 3VKVA 1ZK2A 2H63A 4CMHA 5IDYA 4EBFA 1R4NB 1A9ZA 1EE9A 3G0OA 1IUKA 1X1TA 3DONA 4M54A 4NU6A 3FN4A 3A9WA 1XU7A 1RM5A 4CMGA 1VJ0A 3WOHA 3VH2A 2VWHA 5JLAA 2WM3A 2DPHA 3KUXA 3AOGA 4BNYA 1WW8A 1M6HA 3WJAA 3MWEB 3WYEA 4DLAA 2EJWA 2DKNA 5DCYA 1MA0A 1UDAA 2I76A 4D79A 3LT1A 2R6JA 4M55A 4YAJA 1ISIA 2VT3A 3GK3A 3BHJA 1YRLA 4OXYA 3E5MA 4XGKA 5T8KC 2YQ5A 3BMOB 1R0KA 1DEHA 2WD7B 1EK5A 5IXSA 3BMNB 1ZK3A 2SCUA 3HFGA 4WUVA 2YHUA 5T6BA 5G2OA 2PD4A 3WBFA 5CDYA 3I4CA 3ZW8A 1DPGA 4YYZA 3I3OA 3V2UA 4CM4A 2A4KA 2Q1WA 3WTBA 4FGSA 3DDNA 4QFDA 3DEYX 4BKPA 4ALMA 3FPCA 2F00A 4XX0A 1PR3A 4BNJA 1CERA 1DC4A 1UP7A 3JYPA 1PQPA 4HFRA 4BNZA 4RQTA 2GLXA 2VN8A 2VHVA 4R1NA 2ZATA 4TKMA 3H5AA 2I67A 3JQAB 3PFFA 1B8UA 1MFZA 4BO4A 3AFMA 1NVGA 3BMQB 5F3RA 1DIRA 1ZIDA 2UDPA 4D42A 3U3XA 1QYXA 5B37A 1S6YA 4TKLA 2QIOA 3H9GA 1IULA 4Z9FA 1LUAA 3QWHA 1O9BA 1YE3A 3NRCA 2JFHA 3PZRA 3ORFA 2EW2A 4IS2A 1KS9A 2AEFA 3MTJA 3DBVO 3VZQA 2ZJ1A 1NWHA 2BLLA 5TRTA 2EG9A 2WE8A 4Y6RA 1GZ3A 3HDHA 3ZNPA 3UCFA 4I9UA 4IS3A 1WAMA 1ONPA 2C82A 4BGUA 3MJSA 2BGMA 2GN9A 3NAQA 1P44A 5LCXA 3QVSA 4ALLA 5A4DA 3I9OA 5JO9A 3S1LA 1MX3A 4UUPA 1JVBA 1ZSYA 2XPCA 4IDGA 3JQCA 4XA8A 3KEOA 3LQFA 3AW9A 1KVRA 3WR5A 3SC4A 3B70A 4JNKA 1MV8A 4P8RA 3TJRA 1LNQA 4LRSB 2H1SA 4BNFA 1MGOA 4IXTA 1U4OA 3UXYA 1VJ1A 1YBVA 1EVYA 1T26A 1EUCA 2ZYDA 1BW9B 2P68A 4CQMA 2DBRA 1QRRA 1DOHA 3HB4X 4IQGA 4J4TA 1V6AA 4UAGA 4FC7A 1FDSA 2NVWA 4QECA 3H9QA 4QTZA 1GCOA 4XYLA 4ZU3A 4B3JA 5TGDA 3U49A 5HRUA 1CQIA 4J1NA 2O23A 3RKUA 4WASA 3WFJA 2GN4A 3VH3A 1UUFA 4OOEA 2W2LD 3RU9A 1XELA 4WE3A 3WGOA 5C7IO 4TRMA 4CMBA 4XD2A 2GF2A 4X54A 2R2GA 4QX6A 3PHGA 3TN7A 1ENOA 3QWBA 4Y98A 4RJTA 2CFCA 1U1IA 2PD6A 4ILKA 1ZH8A 3PIDA 3S55A 3WMXA 4AG3A 5JC1A 1EVZA 1LBEA 2NV6A 5BSGA 4IIVA 2VQ3A 4NBTA 3S2IA 5K6AA 4O5OA 1EMDA 1D1SA 1BGVA 1HWYA 3JQEA 1P74A 3E6AA 5EQDA 4OHUA 4J4HA 2DBVO 1TB4A 1HYEA 1GZ4A 1H94A 2IXAA 3GF4A 2C54A 4I9NA 4AJIA 1Q7GA 4RZIA 3F1KA 2WYWA 5KJ1A 4XWYA 4RDHA 3RSHA 4RQUA 4K6CA 5AVOA 3L0DA 3K2BA 4CM9A 4RVDA 5B12A 3A1NA 2BMAA 1E6UA 1HE3A 1ZUD1 1GUYA 4J16A 4NH4A 1CEQA 4L8VA 3KOUA 4PCVA 4R4JA 3DC2A 4KWIA 3DR3A 4IMPA 3WQQA 2J3KA 2GZ3A 3NT4A 2NTJA 2QZZA 1ZK1A 5LDGA 1M67A 2NTNA 4R68A 3CZRA 5JNLA 4DLBA 4XRGA 2W2KA 4GX5A 4WKGA 4E5NA 4ZQFA 3KLMX 3LLVA 1XA0A 3WIEA 1PZEA 4O0LA 3F3SA 1C0IA 3GGOA 1O5IA 5KKAA 4BO7A 4TRJA 1GTMA 3X2EA 3E9QA 3DHYA 1YVEI 1JWAB 2NU7A 3ZZNA 4IIUA 3JQ9C 3LU1A 3N7UA 3ROQA 4R5MA 1E1LA 1M75A 4IDCA 2JFFA 1SZJG 2WMDA 4AJKA 4PG8A 3ENNA 1N8KA 3A06A 1EFKA 2YY7A 3INTA 4N5NA 1BWSA 4G81A 1V3UA 4GAEA 1YJ8A 3K2EA 4RO0A 2J3HA 4XR4A 5T5QA 1LDNA 4NMHA 4J2OA 4FOSA 1OC2A 3WSVA 1DC6A 2J8ZA 5DBFA 5A9SA 3MJCA 1R6DA 4LGVA 4NZ9A 1LLDA 1L1FA 1PGNA 1PZFA 4FFMA 2B5WA 2X0JA 3DMTA 5JBIA 4L4XA 3L9XA 3CEAA 4QT0A 4XGNA 8LDHA 1DBVO 2VWPA 3H5RA 3LDHA 1C1XA 3OJFA 4B4VA 4HXYA 5KJEA 4FGWA 4WOJA 3DHNA 2VNAA 2G76A 1GD1O 5FI5A 2Q2WA 4ALJA 5JE8A 3PYXA 4JBHA 4EJ6A 4XB2A 1JLLA 3GZNB 1E3WA 2O4UX 3EYWA 4RVFA 3DOCA 4D7AA 1IPFA 3JQAA 3GRPA 5A06A 5L53A 2HU2A 3ROMA 3EDMA 1A4IA 4CMIA 2X8LA 3LF2A 3OP4A 1PR9A 4A10A 1HETA 4W99A 1XCBA 3MCVA 1AHIA 4CR8A 3AM5A 5BSEA 1WDMA 4W82A 4J43A 3ICPA 4OGWA 1E3JA 4A0SA 4MKZA 1Y8QB 1G0OA 1NAIA 4NBWA 1HSOA 3PFWO 1W4ZA 4RF5A 3NEPX 4E2XA 2PD3A 1E3LA 2NNLD 5MGBA 2HJSA 4FBGA 2RHCA 3D5TA 1LSJA 5FF9A 4J90A 4CMEA 4JGBA 3DZJA 3VTFA 4D0SA 1LQTA 1B8VA 1ZCJA 5L3ZA 4DIOA 2RAFA 1HDOA 5G4KA 2G5CA 2BHLA 1UR5A 4CLHA 3FNEA 4R3WA 2WDZA 5K9ZA 4KTTE 4YAGA 5A3VA 4IXWA 1B8PA 1Q2XA 1X1EA 1VLLA 1I2ZA 1E5LA 4BGEA 4DYVA 3V1YA 4R1SA 4DVJA 2J6IA 7MDHA 2BFAA 2RH8A 4IY1A 5H83A 2PKQP 3GGPA 4DQXA 5F1OA 3ZV6A 1VL0A 3UCXA 4F6LA 1JA9A 1JAXA 3HZZA 4E2WA 3O38A 3WLFA 3CE6A 3DMYA 1KIFA 4LVCA 1HZJA 5IF3A 1KVSA 4RVGA 5EINA 1ZK0A 2YJZA 3LYLA 1YDWA 1JN0A 1QLHA 1U8FO 4DQUA 1GEGA 1XU9A 1PQWA 3KHUA 2OP0A 3M1LA 2ZB8A 1Q0QA 2A94A 2PH3A 5G4LA 1I3MA 4PLPA 3VKUA 1XIVA 1QV6A 2WEKA 4BS9A 1YDEA 3FBGA 4KP7A 5AOVA 2Y1CA 5JO0A 4EEZA 3OM9A 4MP3A 4AVYA 1KYQA 3IJRA 2DBZA 4J9VA 1WMBA 1PL6A 1PQUA 1ZZEA 1E5QA 1JKJA 1N1EA 3FWZA 3GH3A 3KYCA 3OJOA 3OMLA 5HA5A 1HLPA 2RH4A 4UREA 1EVIA 4F46A 1I36A 1U7HA 4NJMB 4BGIA 3C8MA 1DHRA 1N9GA 3I4FA 3PHHA 4BMNA 4UEJA 5J23A 4ITUA 4K6FA 4LN1A 2C07A 4P4NA 4BNVA 1X0XA 2X0RA 4CUZA 2X86A 3VZSA 2CDCA 3VAZA 4CM6A 3ASUA 5BSHA 2UVDA 2O2YA 5TIIA 1E0DA 1R4MA 4ID9A 2PGJA 3WNQA 5IZCC 1GYRA 2Q1SA 1VL6A 2Q45A 1Q1NA 1I2BA 4XCVA 1YONA 4RPKA 4ZD6A 4E5YA 1ISHA 1NAHA 2ZKLA 1BW9A 2BGKA 2IEBA 1NASA 5EERA 4RPJA 2YFHA 1NBOA 3D3WA 1E7SA 4U8GA 4E4YA 5BNIA 3KVOA 1JW9B 4OL9A 2PK3A 5KVCA 4BMVA 5JDIC 3IMFA 3WJ7A 1NVMB 1NXQA 4II3A 4HWKA 4UEOA 2D4AA 1NFFA 3K6JA 3FF4A 4XQGA 4BVAA 1O0SA 1D4FA 4IMRA 3D4PA 4EGFA 4FFNA 2C0CA 2DBQA 2WD8A 4LW8A 1DHTA 4E5KA 1UXJA 4INAA 2D0IA 4FIZA 3TZ6A 3ONFA 1AUPA 5A05A 4JJGA 3JD2A 5EPOA 1MB4A 1R12A 2X58A 1JKIA 4EDFA 1XKQA 1K6IA 1QSGA 2DUUA 4OYRA 1Z45A 1GEEA 3ZU4A 1G0NA 4I1IA 1OZAA 2E6UX 3RC1A 4F45A 2P91A 1HE2A 2EV9A 5F21A 1H2HA 2JD0A 2D2IA 4JIGA 5I7FA 2HK7A 3K31A 4YT8A 2FZEA 3QVOA 5JDCC 4OQYA 1CIVA 1PJ2A 3OJLA 4TRRA 4L76A 4WLFA 4DRYA 4YPOA 1IZ9A 1U3UA 4B4OA 4TSKA 3DAFA 3RAJA 2JAPA 3HG7A 4EYEA 3TOZA 3BTVA 3DTYA 1NP3A 2YV3A 3P5SA 3GT0A 3H9EO 4KDEA 3WGGA 5L4SA 4YA6A 1I3NA 3H4VA 3PRJA 4WCFB 1BHSA 1ENPA 4YRAA 4QO7A 2O3SA 1DRUA 5CDSA 2ZCVA 4FJ1A 4JCOA 1SPXA 1Z6ZA 1I5RA 2D3TA 3UICA 3AUUA 3HJAA 4M49A 3X2FA 2HMSA 1DAOA 4IINA 4DTIA 4XYGA 1IY8A 1DDOA 1H6DA 1GYPA 3PLNA 4UVEA 4FB5A 2BRUA 2BD0A 1KC3A 1PSDA 4BB6A 5A1TA 4Y6PA 5IXYA 2AG8A 4PLWA 1XSEA 2VUSA 3WG9A 3IJPA 1PS9A 1YB1A 2Q99A 5U4QA 4CLRA 4HX5A 4IDFA 3D1LA 4FS3A 1DIBA 5G0TA 1ENZA 3IS3A 1ZEMA 1ORRA 2EIHA 1BTOA 2VWGA 1DLIA 3GVIA 4WLVA 1YBAA 1SNYA 3JSAA 3OF2A 2B83A 4CLXA 1H5QA 3V1TC 4MDHA 2IZZA 3TRIA 4GWKA 4YT5A 4BKQA 1ZW1A 4I5DA 4JP3A 3CTMA 2Q2QA 5BT9A 3ZU2A 3DZGA 4RPHA 3RUFA 2FR8A 4BNKA 4YWJA 2JJYA 3PWZA 2FR0A 3RUAA 2GDZA 1E7QA 1N92A 1N1GA 2C2YA 1CDOA 3CZMA 3M2TA 5L95A 3PQDA 3ZWWA 1L7EA 3Q2IA 3OEWA 4IBOA 1LDYA 5IN4A 4NIMA 1HSZA 3PDUA 3ZHBA 2FSSA 1PWXA 4CR7A 2AQIA 3JQ8B 3IQDB 4DUPA 1UXKA 3AI3A 1PJCA 3BMCA 3GDGA 3GNSA 2HKIA 3PJEA 4BNNA 1PS8A 1LJ8A 2YV1A 1U4SA 2FN7A 3QW2A 1GZ6A 4YQYA 3C1AA 3FNFA 1A7KA 2NU6A 3E9MA 1WDKA 1SAYA 1ZMOA 1ZXBA 4GX2A 4HBGA 1T1SA 1FDUA 1H9BA 1ENYA 2AA3A 2AXQA 3ASVA 3JQBA 3Q11A 2H5LA 5EMHA 3FR8A 1X0VA 2ZYAA 2V6GA 2Y1EA 1BRMA 4DGSA 3SJUA 3K9QO 4DA9A 2PZMA 2FHSA 4DMMA 3INGA 2VOJA 3H9JA 3JQDA 2B5VA 4OJNA 5A9TA 4J91A 2LDBA 4IM7A 1LLQA 5C7OO 3FCOA 4N7RA 4AJPA 3GMDA 3ZGYA 2JHGA 2OO5A 2X5KO 4GVLA 2OMEA 1LC3A 4FQ8A 5BNFA 5AXBA 5I7EA 2CD9A 3ENKA 1E3IA 4UVIA 3N74A 4RF2A 4HV4A 4YB8A 4YQZA 1BSVA 1DFGA 4HFMA 4G65A 3CH6A 3MJTA 4MVJD 2O48X 1E7WA 2QYTA 1MC4A 3MWDB 4AJ1A 3QY9A 3CKYA 3JQFA 3H5NA 1YL6A 1E1MA 2HMVA 4WGGA 3EVNA 2C20A 3PXXA 5A3JA 1D7OA 1NR7A 4CMJA 3B6ZA 2O7QA 3JQGA 1PTJA 4OXKA 3VDRA 3RFXA 3BTUA 3W4IA 3MZ0A 3GNQA 2IDZA 4OH1A 1GCUA 3H3JA 3O8QA 2BFPA 4FFRA 2V7PA 3MJVA 2NM0A 3HN7A 3JYQA 3BAZA 5A5EA 2ZB4A 3TZKA 2I66A 3LC7O 1PJLA 4PVCA 3RU7A 2OORA 1QR6A 4B79A 2CDBA 3OJEA 1GQYA 4HFNA 3I9LA 1YWGO 4CM4B 2D1YA 2WWRA 5IZCA 5GZ6A 1LSUA 3ADPA 4NBVA 1KERA 1KC1A 3QWIA 1K89A 1NX6A 4EUEA 3PQFA 2VRCA 4PRKA 4RGBA 1FDTA 2B4RO 3GNTA 5MDHA 3HB5X 1LRKA 3PJFA 1Q0HA 4XIJA 4BNLA 2CVZA 3NTQA 3GA0A 3I9KA 1AN9A 1N7GA 3GVCA 4ZGWA 3TZCA 4H15A 2YV2A 2VZ8A 2NWQA 4CUKA 3GVXA 2FR1A 1NYTA 4DPLA 5CPFA 3PWKA 3FSRA 3VHRA 1T2EA 2OBNA 1CQJA 4LISA 2IZ0A 4ND3A 1QYVA 3FI9A 2PZJA 1B14A 2E48A 1OMOA 2PKRA 3C85A 4IZHA 5TLSA 1BVUA 1OC4A 2EP7A 1OFGA 4EW6A 1VRWA 4B3HA 4BIIA 2G17A 3L6EA 3T4EA 3ZNOA 4IGEA 4I08A 3MJ4A 3RUDA 5B4UA 3Q6IA 2O2SA 4MVJI 4FJ2A 4GSLA 1F06A 4BO6A 3H2ZA 9LDBA 2H6EA 1OBFO 3RJ9A 2FPIA 1BDMA 2D8AA 3DOOA 1HXHA 1R15A 1OAAA 1XLTA 3R0IA 3LVFO 4CM3A 3OIGA 2NQ8A 3ETDA 5DDIP 2X4GA 2C29D 4R9RA 2CUKA 2FRDA 4RVSA 1PJ3A 3EZLA 4GX0A 3CMCO 2ZB7A 3UVEA 1FF9A 2NVUA 3KEQA 3KXDA 4GKVA 3WGTA 3DBRB 1U28A 2DUWA 1KVTA 9LDTA 4FFPA 1LDEA 5TX7A 4EITA 3HFSA 1DIGA 4WNCA 3BZUA 2LDXA 4BO5A 1ULUA 2HLPA 3VTZA 1LDGA 1DC5A 3AM4A 3DBLB 3H9UA 2QG4A 2DVMA 1TT5A 4A7PA 2DQ4A 4I5GA 4NK5A 1E1NA 3F46A 2O7SA 2PKQO 4CMEC 4P22A 3ZWYA 4HFJA 1YBMA 4J0EA 3IP3A 3U62A 3OBBA 4C7KA 3QVTA 3EHEA 3FRJA 4JXKA 1BXZA 2EF1A 1AE1A 3AY7A 5IG2A 2ZQZA 1TI7A 2DTEA 2O3RA 2R00C 4WECA 5KWEA 1KBZA 2JAHA 4DMLA 1DO8A 4GI2A 1MFPA 2WSBA 3EUWA 3HN2A 5L4LA 4DBVO 3IKVA 1N2SA 2C5EA 4BQRA 3H2SA 3B20A 4ND1A 1LX6A 1J4AA 4J1TA 5DCWA 5EJ2A 3ANMA 2EGGA 4BGVA 4HY3A 4DPMA 3RBZA 1F17A 2OHXA 5ER9A 1JQBA 2P5UA 1KEVA 3KYBA 4YJGA 5TF4A 5IDXA 3SLGA 2YHIA 5I7SA 1HE5A 2P9CA 4I9HA 2Q4BA 4KWHA 4CMCA 3VVBA 3I1JA 4J7CA 3LK7A 1PJSA 5ILOA 3P19A 1TLTA 1I33A 1B16A 3KO8A 4BNWA 4YRBA 1LRJA 4NPCA 4CMKA 1C0LA 2NTVA 4ESOA 2OL4A 3RC9A 4IJVA 4NFHA 4E33A 4R01A 1NTOA 1U3WA 3JD4A 4KDFA 1HT0A 3RUIA 3ZHZA 1O89A 4XIYA 4CLEA 1NM5A 2Y93A 5G0SA 3WTCA 2YUTA 5I8ZA 5CFZA 4H7PA 3AY6A 3AU9A 4U6SA 2YYYA 3JYNA 1T2FA 2C7VA 3LC2O 4B8WA 1H0KA 1Y8RB 1E3WB 2V6MA 1YL7A 1XQ1A 2VOEA 4J7UA 2FY8A 2OBYA 3I23A 4HNHA 3ZDFA 2BFMA 4J6FA 5COBA 2UUOA 1WWKA 3E82A 1HYHA 3CINA 4CPDA 3EMKA 3UFXA 2NVUB 1JAYA 1GDHA 1HDZA 4XYMA 3FD8A 3ZNQA 3GC6A 3PHJA 2GZ1A 3OIDA 5EN4A 4PLHA 1QKIA 5TQVA 2CMDA 5A9SB 4HKTA 3ZWMA 3C7AA 1P1FA 3IUSA 5JCJA 1U5CA 4MPDA 3NDJA 1FDVA 1ZSVA 3EW7A 4U0JA 5CPBA 4MO2A 2YDXA 4D44A 4RORA 1QLJA 2VZ0A 4LCEA 4TMFA 4L4RA 3NKLA 4KMSA 4XZ3A 1K5HA 1Z73A 1EZ4A 3WLEA 1EDOA 2QRKA 1ONNA 3GFGA 4QO8A 4YT4A 2IYOA 1LDBA 5G4KB 2I99A 3L4SO 4CUJA 1IPEA 1Y7TA 3MTGA 4E2YA 4PZEA 4Z0PA 1OOEA 4PLFA 1J0XO 3LSYA 2AEMA 4XB1A 5JAQA 1AHHA 1Z7BA 4ZJUA 1IYZA 1CYDA 3QV1A 4Z0HO 2BF7A 2GZ2A 4J4BA 4D3SA 2NQTA 3RUHA 1YB4A 5COQA 1PJBA 5ILGA 1F8FA 4WEQA 3KB6A 4GVXA 1DIHA 2CY0A 1HDRA 1GPDG 3O4RA 5JSFA 4AJOA 2ZQYA 2O3JA 3NGXA 4ALKA 4K1LA 3TQHA 2Z95A 2CSUA 3JD3A 4JROA 1MXFA 1YS4A 2HCTA 1E6WA 2C2XA 4D0RA 4EJMA 1Y8QA 1DXYA 3V1UA 4RCVA 4E21A 3CXRA 4B7CA 5KVVA 5IAAA 3GN1A 5T64A 3KYDB 2I3AA 3EK2A 3KLPX 3RBXA 3RI3A 4DQVA 4E5MA 1YOVA 3E03A 4DPKA 4KUEA 4JBIA 1JKFA 1X7HA 2ZTVA 2DPGA 3DXFA 2VUTA 4N54A 5CP8A 1E3EA 3HNPA 2CVQA 4IJUA 4PLZA 1KOLA 2GYYA 4YAKA 1RM3A 3RKRA 4R1UA 4JLWA 5H82A 3RC7A 5KTKA 4H16A 1HTBA 3ZWBA 5IDQA 1W73A 1WNTA 4WK6A 5IN5A 5HBRA 3ULKA 3DZIA 4MVJP 3DHEA 3C7DB 3F5QA 3HDYA 5DP1A 1RM4A 4UUOA 3KSDO 4XYBA 5JAMA 3OETA 3NJ8A 4DBZA 2HUNA 1IB6A 3GOHA 5ENDA 1E7RA 4E13A 3HDJA 2QRLA 3EGOA 3F4BA 4DIFA 5JPIA 3PTZA 4HNGA 5GZ3A 1R0LA 4L74A 5A9RA 3QJ5A 3JD1A 4GX1A 3KSZO 2FMUA 5U1PA 3ZWAA 3PYMA 3WQRA 3ZNNA 4NDNE 5KVSA 1T1RA 1WXDA 4GGOA 1IOLA 4L73A 4UVDA 5L40A 1D1TA 3NJ4A 4ZRMA 4PLYA 2P9GA 5IJZA 4U7WA 4E3ZA 1GUFA 4NI5A 3FPLA 5CDUA 1Y5MA 4NQZA 4ROSA 1HLDA 4XQCA 1KVQA 2HQ1A 3I6IA 1LTHR 2ZTLA 3DOJA 3G1UA 3GEMA 3SJ7A 3O03A 1ID1A 1ISFA 4BO9A 4BO8A 4DREA 2JL1A 2WE7A 4OOFA 3BTSA 5FEUA 3AOEA 4CM1A 4HADA 3JQFC 4K28A 5TT1A 1UJMA 2PR2A 4IDEA 1F0YA 3V2HA 3BTOA 4YTEA 3WYCA 1I8TA 4MP8A 3MOIA 3C1TA 2B4QA 2J5KA 2A9FA 2PGLA 1DRVA 5G0WA 1RYEA 2YDYA 1R16A 2AMFA 3O9ZA 4E2ZA 4GLOA 3C7CB 1C0PA 3GPDG 5DF1A 4AJJA 4DYDA 4XGIA 3GRKA 3ITKA 4J3FA 2P5YA 4TROA 4BO3A 3ZI0A 4M86A 5A04A 4YJGB 4BB5A 3W8FA 4EI2A 2CVOA 4F3YA 3PGJA 3QP9A 4GL4A 3I9NA 1WZIA 2JFGA 4Q3AA 3WYBA 2AG5A 1ZVMA 4DXHA 1BG6A 1LSOA 1PGJA 3BA1A 3HWRA 4YJFA 2JCVA 4GQAA 2EW8A 4TZKA 4CM9D 2Z1MA 2JD1A 2QW8A 3STHA 3PQEA 3COSA 5HTOA 1PL8A 3K92A 4MKXA 5A02A 1GQQA 1HL3A 2QZ9A 2VRBA 3TOXA 1M66A 5L7TA 3PZBA 4XQ9A 2ZTMA 1SO8A 2R00A 2AE2A 2VHZA 4CV0A 4PZCA 4B3IA 1Y8RA 1EQUA 4DC0A 2BH9A 4MP6A 1VM6A 3TZQA 3RC2A 2YZ7A 4FPXA 3JCZA 1N5DA 4XDYA 2NADA 3W8DA 3ROPA 3ZN2A 4CLOA 5CDGA 5HS4A 3OQ1A 4BV9A 3PIIA 1LDMA 4UUNA 2E4AA 1BXGA 3OA2A 5BR7A 3L4BC 3I52A 1A71A 3KRTA 4IUYA 5JAZA 3VH1A 4Z3DA 5CG2A 4N5LA 5ADHA 2I6TA 2I9PA 2Y1FA 3UH1A 1E7MA 1P0FA 4AJ4A 2B4TO 1C0KA 3GPIA 3NDIA 4II2A 1M6WA 4BNHA 3ZV3A 4ZQEA 3ZH2A 4IQ0A 4WJZA 3ZWNA 5ICMA 1Z7EA 5LDHA 4N5MA 2GSDA 3ZWXA 4G5HA 3AI2A 1WDLA 4P4GA 3GAZA 4XDZA 2UYYA 1A72A 2ZJ0A 1EDZA 4BHTA 3LT2A 1GYQA 1SCUA 3KZVA 4NG5A 5L45A 3HQ4O 4QSMA 1A27A 2QX7A 2EWMA 3U09A 2XXJA 1I2CA 5JAIA 4OSPA 3RFTA 4UULA 4C7JA 4GLLA 1A9YA 2Q4EA 1A4UA 1CETA 3B1JA 5HS6A 3UOGA 1LQUA 4A73A 4RV9A 1M2WA 3RIHA 3SX2A 2VCYA 4JX8A 4ONEA 4MIEA 4O6VA 2G0TA 1I0ZA 3H6KA 4RDIA 1P45A 4DL9A 4YRDA 3TZHA 2Q3EA 2X6TA 3FNHA 3K5PA 3TNLA 2X22A 5AYVA 3VPGA 3DAGA 1T25A 4A27A 1Y9AA 1R66A 4OKIA 2X9VA 3V2GA 4LSMA 5ITVA 2ZCUA 3W8EA 1ZBQA 1YJQA 1UP6A 4QFCA 3EVTA 4XEHA 2Y99A 4WCFA 3WWYA 2J3IA 3DMTC 3WS7A 2J5RA 3GR6A 5I7VA 2D5AA 2TMGA 3LF1A 1H2BA 5TT0A 1TXGA 3L6OO 2W8ZA 1MP0A 1V3VA 1JWBB 2EKPA 1B7GO 1HF3A 4MVJH 1X7DA 5FFFA 3W6UA 1Y6JA 2CDAA 1PX0A 5EL0A 4RZHA 2PFGA 1MUUA 2Q1UA 2ET6A 1P3DA 2A35A 3OA0A 1T2DA 3ZV4A 3TDKA 4FW8A 2V65A 3AJRA 2GN8A 4HP8A 3LZ6A 1GAEO 2B36A 4ZA2A 1O95A 1QMGA 3IKTA 4NBRA 3OH8A 1CWUA 1LXCA 1S7CA 3L07A 3GQVA 4FFOA 2O50A 2RCYA 2GUGA 2JD2A 4WLOA 3V8BA 1P1KA 1TEHA 3D5QA 1Y9EA 1K3TA 4E32A 1YQGA 4WCDA 2AEJA 3GZ4A 3GVHA 4M1QA 2X9GA 3SEFA 4GWGA 3E1KA 3NUGA 1BDBA 3S2GA 1I24A 1ZSNA 4RLSA 1T2AA 2GR9A 4KUHA 3JD0A 1IE3A 1LC0A 4XQEA 3S2FA 3DZBA 2V6BA 1O6ZA 2ZIZA 4R51A 4PIVA 5COAA 4CL3A 4JJFA 1UP4A 4GBJA 2DFDA 4ZHSA 4EUFA 1JVSA 5CEFA 1KVUA 1WP4A 4UVHA 3JQBC 3Q9UA 3E18A 3CPSA 4Z6KA 3AWDA 5AQ1A 1QYDA 5KJCA 3OQ6A 3SVTA 4Z9XA 3QLJA 5F5LA 2NVBA 1G1AA 2E37A 3NGLA 4CM8B 1I30A 1E6EA 2BGLA 3VH4A 3VPSA 5BSFA 4YDRA 3ONDA 1GR0A 1NHGA 3F1LA 1EBUA 2IYPA 2PLAA 1V0JA 4Q3BA 4NFYA 3TL3A 1C1DA 3QWAA 3ABIA 1N9GB 1V3TA 1P77A 3A4VA 3JQGB 3UCEA 5BNTA 2D5CA 1R4NA 5JYDA 4PLCA 4I5EA 2XF8A 3PEFA 2PZKA 1ZEJA 4YAIA 2W2LA 1E7YA 1XR3A 1ZMTA 2QYSA 3ANNA 3FBTA 3IAHA 5GY7A 3UUWA 3ROKA 3ZWCA 1H9AA 2BI8A 3ZU3A 3OICA 1U3TA 5JMWA 3DBLA 4BKOA 1IZ0A 3VVCA 3ZHYA 4IDDA 4LRTB 2X0NA 4CL8A 3DFUA 4PLVA 3LLSA 4MVJE 1NPTO 1AXGA 2CF5A 3PWSA 3DAPA 3RD5A 1EUZA 2NU9A 5B1YA 3BMNA 2G1UA 1T24A 2X0IA 3D4OA 4RF4A 5DNAA 2JCXA 2X5OA 3DWFA 5TJ9A 1P0CA 1V9LA 5I8WA 4CM7A 2JHFA 5L7WA 4OMUA 2FZWA 2PTGA 1VSUA 2DAPA 3G3EA 3PI7A 3QVWA 4ZN6A 3PLRA 4MIYA 1RKXA 3WQSB 1H93A 2B35A 4IZIA 4GSKA 1EK6A 2GCGA 4HUJA 2EGHA 1X15A 1PZGA 2P9EA 1ZKMA 4RLHA 2VHXA 3Q0EA 1BVRA 4A5OA 3O8QB 1JDJA 3JQ8A 4ZQGA 2EXXA 2GRAA 5L4NA 3B1KA 1F12A 3WGZA 3DO5A 4XJTA 4Q3DA 2EP5A 1U3VA 1XGKA 4FD3A 3QRWA 1PJQA 3IUPA 3JYLA 1DIAA 3BIOA 3K8ZA 4URFA 4DLLA 2PY6A 2OZPA 1LRLA 1NWCA 3RVDA 1V35A 1P1JA 3ON5A 3KM0A 4E12A 5THKA 5HM8A 3DBRA 5B4TA 2IE0A 5JW6A 5K0ZA 2HDHA 1ISGA 3Q9NA 4W9NA 2FSVA 4Z3KA 2GNAA 2P2SA 3D3WB 2EJVA 4PN3A 2WJPA 3CSDA 4IQ8A 3GN2A 2YHIB 2OXIA 4ND5A 5CEEA 5DZSA 1EFLA 2OOSA 2Q1TA 3NT2A 3K30A 3PYLA 5JDCA 1B2LA 1I3LA 3ZU5A 1EBFA 3BXXA 1I3KA 3HDQA 5DOVA 4BNUA 1ULSA 5GZ1A 2E82A 4MINA 5JMPA 1IL0A 1FJHA 5DBIA 4F6CA 1E92A 1VL8A 3R3JA 4IDBA 4KUGA 2I5PO 2ZTUA 4XKJA 4KTVE 5IDWA 2PV7A 3RCBA 2CF6A 1ISMA 3PPIA 5JXWA 1ARZA 1DRWA 3RUCA 3PGXA 4BL5A 4I5FA 3ZW9A 1U9JA 2RHRA 4PRLA 3LT4A 4FSHA 4PG4A 4EJ0A 4J0FA 3TL2A 4TZTA 3A14A 1RPNA 3ANLA 3UF0A 1Y1PA 4RPLA 5F1PA 4OXNA 2TMDA 2NLOA 3TFQA 3VZPA 1SBYA 3RFVA 1ADBA 3WFIA 4D3FA 1GL3A 1P1RA 2NU8A 1PJ4A 3C24A 4CMAA 3JQAD 4ZICA 5JDIA 1O8CA 2HO5A 2X5JO 3UGKA 3AOEC 4GMFA 3JQ7A 3WICA 3U0BA 3MEQA 2P4HX 3GFBA 1ML3A 4D3DA 2QRJA 1I32A 1HDXA 1V8BA 4MVJM 2VYVA 3EY4A 2VTEA 3IC5A 1U8XX 2FWMX 4RL6A 1U7TA 2X23A 4CV1A 4Q3EA 3KSUA 1EUDA 3HE3A 4KZPA 4P38A 1SMKA 2HMUA 3RASA 4RPGA 2Q2VA 3D0OA 2VYNA 1D3AA 4YT2A 3R1IA 2NUAA 3CMMA 3IP1A 3NTRA 3H3FA 1PJTA 3WB9A 4D46A 1X13A 4LMRA 4D41A 3QIVA 2HMWA 1FXSA 3U4CA 2GN6A 1K2WA 4MKRA 3T7EA 3DBHA 2Z1NA 3V5NA 3GUYA 3FTNA 1NHWA 2C5AA 3RBVA 1P31A 4QEDA 5U9CA 1SOWA 5DP2A 4OM8A 4OQZA 2EEZA 3DFZA 1T4DA 4AL4A 3LT0A 1PU2A 3OIFA 1UXIA 5KIAA 2RBEA 4NR0A 1F8GA 4OKNA 3S8MA 4PG7A 4BNIA 1C3VA 3D7LA 1I10A 2AE1A 3QA9A 2B0JA 3L9WA 1YOVB 1T2CA 4WCFC 4P4LA 5KKCA 3U4HA 4MVJG 1MG5A 4WLEA 4WOKA 4NU5A 1UDCA 3ZWVA 3I6QA 3C3XA 3WXBA 4MVJA 4UEKA 2HAEA 4R54A 4YBZA 5DN9A 3GDOA 5KVQA 2EKLA 3U5TA 5G0UA 1K6XA 2J3JA 2Y67A 1P9LA 2FP4A 2WYUA 4ZQBA 1D8AA 3I9JA 4UVGA 3UAGA 4BO1A 3UN1A 2Y0EA 1B0AA 3AM3A 4ZVVA 3D4NA 2VWQA 1YB5A 3W1VA 1XG5A 3JV7A 5L51A 1Q7BA 4CJXA 4W6ZA 1QXSA 5EQFA 1NQTA 4L0QA 4TQGA 5JS6A 2X1HA 4PG5A 1E3SA 4R41A 1NFRA 3TFOA 5TSDA 5JY6A 4Y67A 3WIDA 1VKOA 3ICCA 4PVDA 4Y6SA 4R9SA 1Q0LA 3GEGA 4CV3A 4CM8A 2GO1A 4Y8VA 3K73O 4Y9DA 2VRCD 5F5NA 1XHLA 3TSCA 1RM0A 4CMIB 3PVZA 1ADCA 1UH5A 4E0BA 3P7MA 3N58A 5JYEA 4BNMA 5L9AA 2EERA 5DBGA 4K9DA 3ITDA 4DWVA 2O4CA 1GUZA 1PL7A 4FOOA 2DM6A 3WGHA 3GHHA 4NNJA 5KNLA 1LU9A 4R69A 3OQBA 1ZK4A 1JU9A 1HYGA 4J1SA 5KOIA 1RYDA 1YQXA 2PWZA 3GG2A 2IZ1A 1LLCA 1PGPA 1K6JA 3DBHB 3P2YA 3M6IA 4GH5A 3WGIA 4KQXA 3FR7A 3GGGA 3JYOA 1WLYA 4LMPA 3JQ6A 2FPGA 2IEDA 4TVOA 3UW3A 4YAEA 3GHYA 3SLKA 3VDQA 4MOWA 4YACA 3VPXA 3P2OA 4XJSA 3ZCXA 3OSUA 3WDSA 2BELA 2POQX 3IIEA 2NSDA 1Q7CA 4JJIA 1DJQA 1J49A 4FCCA 1HDCA 1VC2A 1LSSA 4E31A 1UZNA 1F14A 4KOAA 3ETEA 1C14A 5I9LA 1Z74A 3I9MA 2ZB3A 1HE4A 5AXCA 2AW5A 2DTXA 2WTBA 2HMTA 3GG9A 2O3QA 1DSSG 4OAQA 2PH5A 2QQ5A 3W4KA 5A5FA 2G82A 1CRWG 3NYWA 1HZZA 3PHIA 1QORA 1WZEA 5TJHA 3L77A 4CLDA 5KCZA 2Y1DA 3H8VA 3JQ9A 4FJ0A 3R3SA 3PHLA 4PLTA 2HRBA 2BFOA 4O59O 5FI3A 1YO6A 3Q2KA 1HEUA 1U2DA 3IDSA 1XQ6A 1A7AA 1VE9A 4WLNA 1RWBA 1EQ2A 2PNFA 5TC4A 4BKUA 2EKQA 3M2PA 3Q3CA 4NHEA 4GKBA 5C37A 4B8ZA 2XOXA 1Y81A 2VTDA 4I8XA 2W2KB 3WSWA 4JN6B 5EESA 3D64A 3PJGA 1G6KA 3QE3A 4U5QA 1C1XB 3RWBA 2VZ9A 1UZLA 2RIRA 4S1VA 3L6DA 1QG6A 5L7YA 4BNTA 4AJHA 2DFVA 4Q3NA 2CZCA 1DJNA 2VT2A 3EC7A 3KYDA 3OECA 3QSGA 1R37A 5AXDA 2HK9A 2Y68A 4Q39A 5BQFA 1GV1A 3HSKA 3C1OA 5FYDA 3ZHXA 4B7XA 3DZFA 3WBBA 4D45A 3ZV5A 4ALNA 2OUIA 3VOSA 3D3EA 4FR5A 1ZFNA 4WPGA 1GFSA 3DQPA 4A03A 1YL5A 5K6AC 1CF2O 4MVJF 1DFHA 5ITWA 1W6UA 4IDAA 1R0SA 4TVBA 3ST7A 5C5IA 4LSWA 1I01A 1UAYA 2VHWA 1GPJA 2X7HA 3NTOA 5G0VA 4C4OA 4RVHA 2VHYA 1GQ2A 2V6FA 1ZO8A 4ALIA 1N7HA 2Q50A 3DZKA 1EE2A 3WX0A 5DCUA 1E77A 4FFLA 4O1MA 4ZQHA 3UHAA 4BKRA 2DTDA 3U9LA 4AJLA 4KQWA 1PGOA 5JC8A 4ND2A 1HDYA 3BMCB 2HK8A 1TT7A 4ZRNA 5IFLA 2ILTA 5GMOA 3GEDA 5LC1A 3ADOA 4M8SA 2AQHA 4NJOA 3KYCB 6ADHA 2F1KA 1QP8A 2GD1O 3FTPA 4CQLB 4IPTA 4M87A 4W9NC 1YXMA 3DZHA 3ZWOA 3AUTA 2X9NA 8ADHA 1P1IA 1XDWA 1QYCA 2GASA 3INRA 5JCJD 1DFIA 1B3RA 3PP8A 4L9RA 4RF3A 5CEJA 3CUKA 5TNXA 1HKUA 4MIOA 4W7HA 1XEAA 3SC6A 1BXKA 3BYZA 3NX4A 4J7XA 5A03A 4YCAA 1J6UA 4PLGA 5T57A 3GZNA 1NQOA 1AGNA 2E49A 3OHSX 1EVJA 1SEVA 4IJKA 4H3VA 1YGYA 3CIFA 2C59A 1BXGB 2UAGA 2YQ4A 3NT5A 4K26A 1KY4A 4CR6A 2HSDA 2O3TA 3T7CA 4CQMD 1KETA 1PWZA 3IOYA 5CHEA 2I3GA 1NNUA 4J2HA 2B69A 5IZ4A 2VUUA 4O63O 3O26A 4NJMA 1NPDA 1LA2A 2NACA 2OP1A 4IGFA 4BUCA 3PJDA 1TT5B 2DU8A 4LVUA 4PZDA 5ENVA 4YXFA 4FC6A 1B15A 4BOYA 4JK3A 1SEPA 4QQRA 3WWZA 4BMSA 1UZMA 2W4QA 4YJHB 3NDRA 3VZRA 1NQ5A 1WVGA 2YW9A 4WEOA 2YFQA 4R1TA 4YJFB 1B26A 4Q9NA 3AI1A 2I65A 1GADO 3DL2A 4LK3A 3G79A 3GY0A 2P4QA 1YH3A 2VYVD 3U4IA 4OO3A 1PZHA 3W4JA 4E30A 3BMOA 2WD7A 3FHLA 4CV2A 3GDFA 3QVXA 1WPQA 3R6DA 4B4UA 3KETA 3ONEA 1SOVA 1NQAO 3E48A 1NFQA 1VSVA 2VYND 3HHPA 1GV0A 3MJEA 1ADFA 1UAGA 5T8KA 5AXAA 4AJ2A 4BO2A 2FOIA 2XXBA 5T67A 4MJLA 1P1HA 4JBGA 2Y0CA 4CLOB 1PGQA 1DB3A 1VI2A 4GPD1 1U2GA 4XYEA 4EEXA 1JTVA 1X7GA 2Y05A 3G49A 1PS0A 2DC1A 1RJWA 3JTMA 4B4WA 2Y1OA 1AXEA 4RVUA 1W0CA 4B7UA 1T4BA 3AU8A 3OEYA 1FMCA 3KV3O 5THQA 5ES3A 3GUCA 3RQSA 4QXMA 4L75A 7ADHA 5ER6A 1SC6A 5B4VA 1W8DA 3E8XA 4AJNA 4ND4A 3VC7A 3I83A 3TPCA 1KEWA 1VKNA 3GMSA 3GVPA 1ISJA 5C3MA 1MG0A 2DT5A 2PGDA 1ZNQO 3SXPA 1K0UA 1XYGA 4J9UE 1DAPA 2D59A 3PDJA 2GPTA 1CJCA 3AUAA 1PIWA 4WNIA 2JCYA 1ZXLA 5C7LO 2ZYGA 4TWRA 3RROA 4E6PA 4TRNA 2Y0DA 6LDHA 5DT9A 3VPHA 4XRRA 1R4MB 2QHXA 3PK0A 1WMAA 3H65A 2A92A 1IHXA 4W4TA 3QHAA 1ADGA 1U5AA 1VPDA 4S3MA 4BQPA 1P33A 4BNGA 3VPFA 2OFPA 2VNSA 3S2EA 1Y5RA 2CNBA 2IXBA 5JCXA 2O3UA 2UUPA 2HRZA 4L4SA 2DLDA 4D43A 1C1DB 1NR1A 1QV7A 4J49A 4Q3CA 1KEUA 4R3NA 4YJHA 3G17A 1E1KA 2OGUA 3QWFA 1BMDA 3HADA 3DTTA 2W90A 1MC5A 3AY3A 2PA3A 3OFSA 3AK4A 4U6QA 4JP2A 4W7IA 4DIBA 4IJWA 4EZBA 3Q1LA 1FK8A 2Q49A 1GY8A 3RJ5A 3F4LA 5H81A 1MXHA 2BI7A 1M76A 1LI4A 1H6CA 5FWNA 1LLUA 3K96A 3LC1O 3KBOA 3WGYA 2FPPA 2IRWA 4PGFA 3KTDA 3AFNA 5DULA 4A26A 1X14A 1UXHA 2J5QA 3E5RA 4WLUA 4BO0A 4GMGA 4M89A 4BV8A 1Z75A 5CG1A 4CLRB 4YVFA 3ZWPA 4YR9A 3BHIA 4NBUA 1L7DA 1EEHA 3MOGA 4AJEA 4R5HA 3H7AA 4AICA 1NVTA 4PFJA 3WGQA 4CODB 3ETGA 3F9IA 3M1AA 3EZYA 4NK4A 3UKOA 1HDGO 3IL2A 3WNVA 3EAGA 4N18A 1NPYA 2AQKA 2UV8A 3WMWA 3DB2A 1SB9A 2Y66A 3E9NA 2IODA 2B37A 3OJ0A 3RUEA 1KY5A 2HJRA 3T4XA 1UXGA 1GU7A 3HUDA 1J5PA 1XWFA 2XAAA 4AFNA 4XR9A 2ZK7A 3G1TA
chains in the Genus database with same CATH superfamily
1ONOA 4I4LA 5JJBA 3LSTA 3U4DA 2AFIE 1WRBA 3NS7A 5A3QA 5KJ6A 3PA8A 4YEDA 5DNWA 5E6UA 1JR6A 1Z26A 4QL3A 1NA5A 2YXBA 4AZ3B 5NLLA 3N5CA 5KX5B 3PNYA 5JD4A 4H3HB 4EY3A 4AUKA 3AEXA 5ICSA 5H4HA 1XVLA 1UDBA 3QQPA 3R3UA 3W6ZA 4LCJA 3FNGA 4GWLA 1NUTA 2X2PA 4QOSA 4Z4QA 5H8WA 2G71A 1H6BA 1N5KA 4G2NA 4ISBA 4UNPA 2BTQA 3T3DA 4B40A 4YIKA 2QUIA 2XDAA 4YIHA 5HWSA 4ZU6X 3L4BA 1TLFA 4YJDA 3OJXA 4AQYB 3DLBA 5J2UB 3J80A 3PFNA 3PPVA 5I5GA 2HJHA 5CX4A 1B41A 3TWOA 4L7VA 1DLJA 4AQ7A 3OT1A 3TBKA 2JLWA 4ZI5A 5JH7F 4RZ3A 2VPXA 1TVEA 3D2LA 4FDAA 5AVXA 2Q29A 4GXTA 3N75A 2WF6A 2Z4SA 3F5SA 3L3BA 5TQJA 1PEDA 2EDCA 2WWFA 1XZNA 4QGSA 2TECE 2XDWA 4ZV9A 1M2HA 1B3BA 3ASZA 2WMNB 1EXVA 1YUNA 1K68A 4PG6A 3FGNA 3RK4A 2W98A 2Q4RA 3FWNA 1X86B 3F6YA 1RACA 3F47A 1ZK2A 1TC1A 2CYAA 1G59A 2PVSA 1SQ0A 3G0OA 5D8DA 1ZD5A 4E14A 4CEHA 1X1TA 3DONA 4DADA 5BWCA 4IGIA 4JX9A 4Q9AA 3A9WA 4Y2YA 1XU7A 2HSEA 5ESXA 3TKAA 4F8YA 3GJ6A 1YDGA 2AOUB 3NOVA 3L1KA 4JH0A 1KQ3A 2H5IA 1WW8A 1M6HA 3UPTA 3EPJA 2NUPA 4DLAA 2PBRA 3TQQA 5DCYA 2WHEA 1MA0A 1UDAA 3GBSA 2HQRA 4JUBA 3LT1A 1EJBA 3Q3EA 3D6TB 4IEIA 1X38A 4LC9A 4EF4A 3GK3A 3WRVA 4XGKA 2AKEA 4TL6A 3SXUB 1T9DA 1RBYA 3AR5A 1E9RA 4H77A 3WA7A 3ZKAA 2WD7B 3M70A 5DH9A 4N5IX 2ALJA 5T6BA 2XSZD 2PD4A 3WBFA 3GLKA 3I4CA 4JEIA 4N47A 4X00A 4EPRA 3MYYA 8GPBA 5EMJA 2Q1WA 3RAPR 3CNEA 4BDSA 3X1YA 5BWBA 1UC8A 4QFDA 5HCNA 4BKPA 4ALMA 1PR3A 1ZIYA 2BOVA 1UP7A 2PTHA 3CURA 3EXFA 3I2JA 4RHUA 1AB6A 1PQPA 3QVMA 4HFRA 1JIVA 1IBCA 1MPXA 4URWR 3TLJA 4BNZA 2BP7B 1URPA 2FWPA 1F0KA 5KNCA 1A69A 5HZGA 4L0MA 1T9BA 5LOVB 4GI1A 2I67A 3JQAB 3E3OA 4BO4A 1NJGA 3Q8LA 3BMQB 1E3DA 1XF1A 3OHPA 3HVIA 4U3JB 1DIRA 5F3RA 5CB4F 4ZCRA 1EESA 1QYXA 5LA6F 2YX1A 4O4HB 5K1ZA 1ZH2A 4KO2S 1USGA 3I8XA 4EF5A 4TKLA 5JWHA 2A58A 4BC1A 4Y6OA 5C35A 1DC7A 2A78A 1O9BA 3A25A 3AR6A 2FQWA 2ZRLA 1I80A 4YXWA 5I7WA 5JALA 1ICEA 1FYDA 4IS2A 4ENPA 1KS9A 5B7NA 2BCEA 3VZQA 3S7ZA 1HMYA 3I28A 4E51A 4FOLA 4ZI7F 5IUNC 2EG9A 2WE8A 4LYAA 1GZ3A 3DMHA 1ND5A 3K1AB 4Y1RA 4Y6RA 3TIVA 1ODKA 2H1WA 2HIAA 4BEWA 2ZYWX 2GJKA 3LIIA 1P60A 2ANCA 2C82A 2GN1A 3ZTTA 4BGUA 1Y37A 4UE2A 2X13A 3OT1B 1IIBA 3ZS8A 2HYIC 2GN9A 4Z86A 5A4DA 2D5IA 3QVSA 4ALLA 4BECA 2JARA 5JO9A 3QX7A 5DYGA 2R8PA 1FDRA 4JSRA 1N34B 3BQNB 2G04A 4UM8B 1KMIY 1V6SA 4MJ7A 4TTVA 1OZHA 3GGJA 4XA8A 4MB0A 2PUCA 2ZUFA 1VKJA 4X6YA 4V03A 5BSRA 1D6NA 1E8DA 4UDYX 4YRSA 3OLWA 4JNKA 5IU6A 5LLDA 1NBEA 1LNQA 4OTZA 3JAMA 2H1SA 3EOZA 4IXTA 3IESA 1XZCA 2EFYA 1QIFA 2VDVE 3OEEA 1RJDA 1YBVA 4HWGA 1EVYA 4RMGA 3C6MA 1Y3IA 5E9QA 2YMPA 1NUHA 1CHNA 1TAGA 2DBRA 1GT6A 1WJGA 4MQLA 3WAGA 4J4TA 1V16B 4UAGA 4JXJA 4FC7A 2A2ZA 2NVWA 2V9PA 4QECA 1XL0A 3OE7A 1Y7LA 1KSFX 1GCOA 1Z6PA 2ZRHA 1P2FA 3C5HA 1BFKA 3P2IA 4GU5A 1NIJA 3I39X 3S2ZA 3U49A 1CQIA 1SBTA 1PK9A 4WASA 3VH3A 1JF8A 5L3VA 3N5KA 4OOEA 3WGLA 2V3CC 1EGQA 1XELA 1YC2A 1DT5A 1GOTA 5FWYB 1FX1A 1OXUA 5C7IO 3NMUF 3EQ8A 2Q3BA 3R7SA 1RI4A 3LX4A 1GPH1 4G0QA 2R2GA 3RSFA 1ZW6A 3QLEA 4HBZA 4GEGA 1ENOA 4Y98A 4P6VF 4RJTA 5FAKA 4A15A 3F0TA 1FIUA 3S55A 3DYIA 1Z83A 1SHTX 4P7FA 1EVZA 1LBEA 2BMDA 2C58A 2JATA 4M1MA 1BNCA 1T9ZA 2FFAA 1QIEA 1Z34A 2BPOA 5BSGA 4KC0A 2FW1A 1T36B 3LMKA 3S2IA 5EQJB 5J63A 3MTIA 3ZU6A 3LVQE 2OZEA 5K6AA 1EMDA 5KBYA 3FJ1A 5K09A 3ZBQA 2D1TA 2W0SA 4BLOA 1E2HA 3HI6A 3QU5A 1SULA 4IR7A 1T9AA 5TEWA 2HXGA 2XRFA 1OGYA 1QHSA 3KOXA 3T8YA 5JVDF 3LY9A 3F1KA 3R7FA 3OCCA 4WXMA 4X8HA 3PR3A 4XWYA 3WB1A 1FTGA 1EWYA 2FUG1 1X74A 5HVNA 1PEAA 1OLOA 2IZOA 1U31A 3O6VA 3D8HA 3CUWA 1K75A 3HU2A 1X80A 3L0DA 3LXRA 3HCWA 4NZNA 1TMOA 2GPBA 3FB4A 4QOHA 4CU5A 1JJIA 3U7FB 4FFBB 1E6UA 4KN6A 1EGAA 4LKRA 4Q02A 1QB8A 3DC2A 1EP2B 3DR3A 4QXAA 2I2BA 1G3IA 2AJTA 3HXTA 3B38A 3L7OA 4KE7A 2NTJA 3F7OA 5BW5A 2PLNA 1MU0A 4TN5A 1M67A 5LDGA 1KSGA 2OILA 2NTNA 1RVDA 2ZSDA 5DE3A 3TCNA 2WAOA 1Z2OX 5DO9A 4KBYA 4OAOA 4GX5A 4IQFA 2I3DA 2J09A 4NP6A 4E5NA 1U2QA 2ZUUA 1JSXA 2C5GA 1PZEA 3QXCA 2B8WA 1O5IA 4BO7A 4ZZ0A 4TRJA 821PA 2JI9A 1TZCA 3UMJA 2XB6A 1YVEI 5CLLA 1G8FA 1JWAB 2OO5C 1QBGA 5DTJA 1HFWA 2O20A 3TLAA 1TUIA 4R5MA 3ROQA 4JI3B 1O95C 2J7KA 4HX2A 4ZVNA 5C1BA 4HS4A 5AW2A 5J2UA 1A97A 4OM7A 4Z7NB 1NT2A 4S35A 2JFFA 1SZJG 2ZIAA 4HXFB 2YYZA 3NYQA 1UPBA 1N8KA 2RGNA 3C3WA 2JVIA 5D1HA 2Z6VA 2G67A 2RK4A 2XHEA 4GAEA 2JIZD 4HSGA 3HDVA 5D86A 1C9EA 1K7FB 1KBOA 2FWNA 4RO0A 4TGLA 4YREA 3L6CA 1O4VA 1BZYA 1LPBB 2QLFA 4KQJA 2CFIA 1I9GA 1K5GA 1LDNA 1VB5A 4NMHA 1V3QE 5FO1A 4FYKA 1XHFA 5C5DA 4DNFA 1KZYC 4LCBA 5DBFA 3MJCA 2QB5A 4O4IA 4EF6A 2CHQA 4IQ4A 4D1YA 1L1FA 4H6WA 4RVCA 4DIKA 3WIVA 4KMRA 3P1JA 1EFVA 2BGTA 4OQLA 1AZTA 3G5LA 4PHCA 2CK3D 5I01A 4O2RA 4ZRDA 3CEAA 1WA5A 3R6LA 2ZT5A 3DVAA 2KYRA 2BGUA 1GRCA 3LDHA 2AMJA 4IDQA 1PYDA 3U3RA 4B4VA 2P9QA 2DWUA 4WOJA 5LKAA 2QLJA 1N2ZA 1ZJ4A 1ZN8A 2G5PA 1GD1O 4NBSA 5FI5A 1RC8A 1MZPA 3EJ6A 3NHMA 4JBHA 2CL5A 2O4UX 1BH2A 2WOJA 3OCZA 4KV7A 4UEWA 4ZYTA 4D7AA 1YZYA 1RWQA 2DQKA 5KOJB 1EGHA 5LWQA 3P9SA 1EYZA 4J7AA 1T5TA 4M8IA 5L53A 4CWAA 4WERA 5FT9A 1A4IA 3JU3A 3VV2A 1GFIA 5TVKA 3ETNA 1DG1G 1KKMA 4G0MA 1TPZA 1HETA 5FQNA 3ADDA 1C4XA 1V1RA 4MCAA 1V25A 4B6SA 4NCAA 1QVWA 1NVDA 4HLCA 5IYZB 1WDMA 3PC3A 2OTCA 4W82A 4J43A 2PUHA 3UC9A 3U44B 2J3DA 5JHHB 2GTPA 4IAOA 3SMVA 2CZQA 1Y1TA 1VL5A 2WZQA 1RHKA 2YL2A 3EXEB 3IQIX 2PD3A 3VR3A 4EARA 1US8B 5EKUA 2NNLD 1DXQA 3M4NA 5JYBA 3W5DA 3FYHA 2HJSA 3G68A 2RHCA 4JGBA 5KOJA 1U0HC 2P69A 4MUJA 3R5KA 2QTBA 1FFXA 3W5AA 2BI4A 3DZJA 5F9HA 3HBNA 4YUYA 1DG9A 1NUQA 3A1VA 2M6RA 3HY6A 4DMUB 4DIOA 5IRCD 3WLKX 2VBCA 3CEMA 3BJEA 3C2QA 4QHTA 1NKSA 1UR5A 1Z06A 3CYFA 1FNSA 3F2IA 3IP7A 4G8DA 2WDZA 4M1KA 3ZXIA 2MR6A 2OPHA 4YAGA 1OKKD 1Z2NX 2CNOA 3E05A 4OFZA 2IYQA 5D01A 3SF8B 3LTNC 4OB8A 1VLLA 1FUYB 1I2ZA 1LNSA 5C5EA 2C1ZA 4BGEA 5CM9C 4YP5A 2C8KA 4IDOA 2RGAA 5ICEA 4MDEA 2VAVA 2RH8A 4IY1A 5H83A 2PKQP 5K3OA 1P4GA 1Y33E 3CQ9A 4POAA 1GCGA 2BSXA 7REQB 1I4EB 2EBWA 4LNAA 4X8MA 4EM6A 1JA9A 4KG7A 5M3BA 1JAXA 1XZQA 3KEMA 4E2WA 2C96A 2O19A 1KJ8A 4MUHA 2B21A 2A0WA 2IUYA 3T4UA 3CRZA 1I3CA 3MCUA 3HCEA 3QKWA 1KVSA 3SJCA 1GUDA 5F73A 1ZK0A 4MUBA 3EASA 4BPBA 3AHCA 3CR3C 4JC0A 2AV6A 4XM1A 3VO1A 2D0DA 1YHNA 1QLHA 1XCMA 4I2VA 1YB7A 1GEGA 5CM2Z 2OP0A 2ZB8A 1Q0QA 2A94A 2PH3A 2ZBRA 1KK2A 5AICA 1IC6A 1X9HA 3RIXA 2XTMA 2WEKA 1IMOA 4A6PA 2YS6A 2WTXA 4X20B 1W85A 3PC8A 3DEJA 4D0NA 1UK8A 2VPPA 3GJZA 3OM9A 4AVYA 2ZJ6A 1KYQA 1JEEA 2GSWA 3OZXA 1ZGAA 4J9VA 1WMBA 1PL6A 1PQUA 3VBEA 3CT4A 3FWZA 5LA6B 5HA5A 3OMLA 5HHTA 3L0BA 4IIJF 5D5PA 4IEEA 3VU1A 1NG1A 5EUMA 1NW9B 2EP8A 2YZKA 1A3CA 1DHRA 5C18A 3PHHA 4UEJA 2DR3A 3G9QA 3MT0A 1IEWA 2BCJQ 4L5YA 4AMZA 4EKEA 4IXNA 4DXDA 2H8KA 3RBAA 1AU9A 2OLEA 3VZSA 4B82A 4CM6A 2DOKA 3W7BA 2QE7D 1HX7A 1RXYA 3GA5A 1E0DA 1SOUA 3LUAA 5HK8A 1YDFA 3WNQA 5EE5B 2AZ4A 2XUKA 5KYUA 1KIMA 4ERNA 4YRZA 1B43A 2YY5A 3I9V6 1GL6A 1CQZA 1TMKA 3UM9A 4QGAA 3ISJA 4S1WA 2BGKA 1C7FA 2VP4A 5EERA 4A0HA 5CD9A 121PA 1WF6A 2YFHA 3MSXA 2IKQA 1VHTA 4BX9A 3I92A 2AR0A 3FA2A 3GRAA 3M1IA 4U8GA 4E4YA 4LRWA 5ARDA 3E3NA 1PTJC 1KL7A 4JCCA 2I54A 4CN8A 4EMSA 2I87A 4OL9A 2XTAA 3P71T 1AKTA 2IVFA 1SUWA 1JEQB 1MB2A 2PKWA 3WK6A 5LQAA 5JDIC 2AFHE 3IMFA 4EK9A 1FLVA 4UZEA 3NHLA 4DV3B 4X9XA 1ZL0A 1NXQA 3R7WA 4B4DA 4YQFA 4ECAA 4NJEB 1BE1A 1KTVA 3K6JA 3X1JA 2JGDB 4KRXA 2NYRA 3RUPA 4FFNA 1HDEA 1A8QA 3P32A 3IO3A 1GHTA 4JD5A 2L69A 5DYNA 5GGYA 1ZVKA 3SYMA 4BN5A 3U4QB 4E5KA 5LBTA 3NHPA 5E2AA 3N0RA 2VDOB 2XB2A 3W2IA 1G8PA 4R8LA 2F9LA 1NNLA 2IW1A 4JT9A 1R12A 3V00A 4X7PA 4ADSG 1JKIA 2OYSA 1X3LA 4BLQA 4EDFA 2Q3FA 4Q16A 2QRVB 4KR7A 2I6XA 2Y8EA 1VIDA 4OYRA 1Z45A 1GEEA 3AERB 3ZU4A 1G8HA 1OZAA 3EULA 2WSSD 1QOQB 4F45A 4PQGA 3EVDA 1WEHA 2BY4A 5F21A 4PQRA 1U6JA 2VPYA 4AS3A 4NJEA 3A4TA 3QTTA 4ISCA 1R0WA 4RHCA 2IQ5A 1H2HA 4P7KA 1P3JA 1HOXA 4NENB 1UKZA 2HK7A 5LLTA 1PBNA 2I8AA 2RHJA 4X71A 2IHKA 5TF0A 4BQNA 3QF4A 3Q98A 4FHZA 1RJFA 1RLMA 2H2AA 1ZXXA 4L76A 4TRRA 1IZ9A 1U3UA 3TM5A 5AI9A 3IRVA 3CH4B 4EYEA 3IMGA 1WCWA 2QSYA 3LCJA 3U7GA 1PUXA 2PMBA 3LV8A 3WZMA 1IN6A 3CGGA 1FL9A 2IU3A 3T6KA 3BD7A 5L4SA 3K70D 1EVQA 5KPDA 4NXMB 1FC0A 5BWLA 1KPGA 1ENPA 1KBQA 3D5EA 3S6JA 5DISB 5FOXA 3CVXA 5EWMA 1DX6A 3G2LA 2M2IA 3VR6D 1GQSA 4JCOA 5DU2A 2QK4A 4OL0A 1I5RA 3Q85A 2JLZA 3GW8A 2ST1A 3V80A 3HTXA 3NDPA 2YBDA 4C9BA 4M49A 4JMLA 4YRTA 2FX5A 1YE5A 2HMSA 2J5BA 1DAOA 3GEPA 4IINA 4JB2A 3RS7A 5JD5A 1IY8A 1H6DA 1Q3KA 3DBOB 5ALOA 5M2QA 1XRSB 3AFIA 3I9V1 1MRZA 4UPEA 5JS2A 1PSDA 4MLZA 3KQPA 5A1TA 1MO2A 3P9PA 4Y6PA 5EIBC 4PLWA 2P2YA 4UJ5A 5LP6F 1G7RA 3IJPA 3QXXA 3TIIA 4AWXA 5U4QA 1XQYA 2QAGC 1XRRA 3OAAD 5EVJA 4CLRA 2AL7A 1GAWA 3H16A 4M1SA 5G0TA 3D1LA 3FWYA 4FS3A 1N1DA 5IYZA 1ENZA 2R9VA 3IS3A 4G63A 2M6KA 5K0SA 1NUUA 1TTPB 2YIMA 1L5YA 3F90A 4RYLA 3H11A 4G36A 4G01B 4OHCA 3EB9A 5LIRA 3D6JA 1AH2A 1SNYA 5GONA 3OF2A 1I7NA 3OWHA 2CLCX 4HVCA 3MMZA 3C39A 3NIWA 4IIFA 1H5QA 2NXJA 2ZJ5A 3V1TC 5BNWA 5CBKA 1N5RA 4QDOA 1Q12A 3TRIA 1ABBA 3PPYA 4YT5A 1KRHA 4I5DA 3CUUA 3DTVD 1GAJA 2FQQA 2Q4DA 4P08A 2ZBDA 1ZM7A 2QP3A 2WI8A 5BT9A 3ZEIA 1RKQA 3ZU2A 3FIJA 2NSYA 5LQJA 3RUFA 4UAJA 3MLAA 4XB6B 1QK3A 1USWA 2F90A 2MR5A 1H8EA 3ESAA 4M0UA 2GCOB 2OVFA 3PUHA 2FR0A 3FNRA 4RX1A 3RUAA 1TO2E 1N92A 4CQJA 3SFVA 4ARZB 1CDOA 1V41E 2QG9A 4NOLA 3CZMA 3IMEA 4OI2A 1MD9A 2FCRA 3WZLA 4K6GA 4OFXA 5L95A 5BVHA 4ZAWA 5REQB 3PQDA 1CUCA 4OLBA 2Q5OA 3Q2IA 3OEWA 4L5BA 1JALA 1ORDA 4K0RA 5IN4A 4AZTA 3QE4A 1HSZA 1X1BA 3ZHBA 3JVVA 3R7LA 1F3LA 4MGIR 3DE6X 4B31A 4CR7A 2ODBA 1TCAA 3OX4A 4RVOA 1RCTE 2VP0A 2ZBVA 1U9CA 1QHGA 2P8JA 3RWMB 1PJCA 3BXZA 3GDGA 3GNSA 2MDTA 2EL7A 3HNOA 3N2LA 4H59A 4LX0A 4PO9A 3ZBUA 2FN7A 1NF8A 4M0PA 4Y2TA 3NRBA 1BGXT 4UU1A 3RYFB 2JS7A 4QOJA 4ARZA 2ODEA 1RQPA 4YJ3F 5TEVA 1Z0IA 4GD3Q 1H9BA 2LNDA 1H4VB 1XN4A 4RETA 2F3RA 4D4JA 2GM4A 3PVCA 2JLQA 2YR0A 3Q11A 2H5LA 2KB0A 2D3WA 3IAEA 1X0VA 2ZYAA 4BVJA 1AA9A 2RGNC 4B6EA 1BRMA 4C3UA 3K9QO 3W5IA 2PZMA 2JFYA 1QUFA 4HZUB 4IWXA 4BLRA 5IH7A 1XXHE 1MIOB 1NJ2A 4JJ4A 4D9JA 3CEPB 1SCJA 2LDBA 1LLQA 3H1TA 2ISSD 4HATA 4YJKA 1JPUA 2YJ3A 1C4WA 1GGMA 3ZX5A 2ATCA 4TTSA 1Y6FA 4TLCA 4RBNA 2VDWB 5F9FA 4GVLA 1E4VA 1LKZA 3OFND 1QIDA 1LC3A 3DE5X 4NCXA 5BNFA 5I7EA 4W9RA 2FKAA 1A1SA 2RAPA 3MJTA 5HNKA 3S1AB 3CZPA 1MTZA 2O48X 1K97A 3E4DA 4KAFA 2QYTA 1JHPA 2EFJA 3WWOA 1YRQA 4OXRA 3B2NA 3NC4A 3QY9A 2XGMA 1OT3A 1YL6A 1U3CA 1E1MA 3EWNA 5CLHA 1Y8ZA 2C20A 3R7WB 2D7CA 1D7OA 1UKAA 2JFQA 4CMJA 1R8JA 1PTJA 3A6FA 3EXAA 4HPJB 1NVAA 1PK8A 4OXKA 3VDRA 3W4IA 3DXZA 5H80A 3CH7A 4OH1A 1Z12A 1GCUA 1JTFA 3N6RA 2BFPA 4CNBA 4O4LA 3K15A 3ORSA 5A5EA 1EIWA 1JHVA 3TZKA 4DCOA 3V7FA 5EJ6A 4KRFA 1QU3A 2GLUA 3ZW7A 3AV0B 4EH1A 4LOJA 2RDMA 1GJRA 5HDBB 3WAKA 5GTDA 1GQYA 4L3OA 4LBVA 3COYA 1ZRMA 3Q5DA 2D1YA 3NC1C 3UJBA 3W8RA 4DKJA 3CN7A 3AVPA 5DBHX 1VXOA 5DV9A 5FTJA 3GLIB 1WIWA 3W2FA 5F3DA 1KC1A 3WRYC 2GJSA 1K89A 1FQKA 5FCDA 4TKVA 2VRCA 3EMDA 4RGBA 2B4RO 4XUDA 3TTVA 4WZZA 1QDLB 3EOBI 2W6ZA 3GELA 3PJFA 4K3VA 4MQFA 3REQA 3W5BA 4DV1B 4GIBA 5B3AA 4G9EA 4ZYXA 2CVZA 1YB2A 2R62A 3I9KA 4TZ0A 4LA4A 3BE8A 4AECA 4CIBA 3O0DA 4I50F 2BR4A 4PX2A 2JA1A 3WQHA 4PGMA 3V48A 2CDRA 3GVCA 1LTQA 3TZCA 4H15A 5JS1A 2A30A 4IHJB 3DV2A 4DPLA 4J07A 3IT0A 4BFYA 4DN6A 4EO4A 1KAOA 3RS9A 3VHRA 1JJVA 2JJ2A 2ZRGA 1NMSA 1CQJA 4P4SA 2IZ0A 3R5FA 6NULA 2F1IA 4IZHA 1EGMB 1TYAE 4KQEA 3C85A 3G8DA 3JAWA 3LO8A 2OY0A 3LWBA 1TFRA 3WFZA 4EW6A 1VRWA 4NS1A 1S4QA 1TA9A 4DA8A 1WKCA 4EUSA 1RYNA 3PD1A 3RUDA 1M8PA 3Q6IA 4C30A 5EP4A 1RLTA 3SX4A 1IOVA 3FDJA 3LYAA 2R8RA 4Q19A 3H2ZA 1OBFO 2FFRA 2H6EA 4QKQA 4RKYA 5J2TB 1BDMA 2D8AA 2JGDA 3DOOA 1QHHB 2HPHA 3DMRA 1XLTA 4AKSA 1XCJA 2WF8A 5E7MA 1XZLA 2N9UA 1E3TA 3LVFO 2ZITA 4Z4CA 4JQYA 1TAUA 3C14C 3UJPA 2IELA 2CEAA 3QUTA 3KB2A 4RVSA 1U3FA 5K99A 5IX8A 3SBEA 5DM60 2BUBA 2QRZA 1L1EA 1RWPA 1CB7A 4GX0A 4KQGA 4TLAA 4KFCA 1FF9A 2NVUA 2B8TA 2GKGA 2JH8A 1QG2A 2MSLA 1VB3A 1GZDA 2WAAA 3CKMA 2VHJA 3EZGA 3KXDA 4FDMA 4P2BA 3DBRB 4KVGA 1AKNA 1TL7C 4KN8A 4KFUA 3F6SA 3TRKA 3TR5A 1K8XB 1LDEA 2LIVA 3A6EA 2I8CA 4P3PA 1VKRA 3BZUA 1UJ4A 5T4BA 3M82A 2O8DA 4R2JA 3VTZA 2BLNA 3EWSA 3FFTA 1N6IA 3H9UA 4I8DA 3JWGA 5FLYA 5KTYA 1W2WB 4A7PA 2VBGA 4NK5A 3KT0A 3QVVA 1FJ2A 2YKGA 4CMEC 4ZGBA 5IP5A 3D3JA 3ZWYA 1DQSA 3EJWA 4LC1A 3T95A 3THOA 3U62A 1XQVA 4C7KA 1FRZA 2JEZA 4EGSA 2Y1LA 1GU1A 1AE1A 2QXTA 3AY7A 4FNMA 1XWWA 2ZQZA 4JUFA 4Q15A 5BOVA 4H4EA 5JZSA 3SQOA 5HBGA 3BOSA 3W6PA 1Z8FA 2QUZA 3HYRA 1KBZA 2QXUA 3HKEB 1SHZA 3P0FA 1DO8A 4OGKA 1BN7A 4HQFA 4RZUA 3WK7A 1YVDA 1SK8A 1GKLA 4RHEA 1XP8A 2BHNA 4ETIA 1FLAA 1FSSA 1TEXA 4D8UA 4L50A 4DR5B 5AW8A 3RSLA 1B8NA 1Q91A 4MZDA 1FE8A 1DKLA 2GEDA 3COVA 2Z5GA 5EJ2A 3T7KA 4DPMA 5FOUA 1E2UA 1P4HA 3AH8A 3MINA 4OXQA 5C53B 2OHXA 1RRVA 3OM8A 2FX2A 2R7AA 5TF4A 1DC8A 1AM4D 4G4IA 1FPMA 3IV7A 5I7SA 1LW7A 2ID9A 3GLTA 3IVAA 4ER5A 2R4QA 2Z9DA 4I1PA 1A8UA 2WTNA 4DCMA 3UMYA 3LK7A 1PJSA 1PJRA 3P19A 3SC2A 2ILVA 3CB2A 4BV3A 5ILOA 3M6UA 2C5BA 3ILHA 3NP7A 3WGVA 3GCDA 2FLWA 2OL4A 3RC9A 1V9CA 1YQWA 2R6R1 4R01A 4E33A 1NTOA 3KYIB 4RA6A 1RLUA 4CLEA 3WTCA 4Q4CA 3ZVNA 4I9GA 3KSAC 3IAUA 5DTIA 3AY6A 2BBSA 3AU9A 5A7FA 2FEPA 2QE6A 2QL9A 3E22A 2RARA 4M37A 3WL8A 3LC2O 4MCIA 4O2AB 3F71A 1EINA 3ZY4A 2BFWA 4L27A 1U99A 1WCXA 4JP5A 4KYIB 4LOHA 2OBYA 3A4LA 1N25A 5G53C 1GNPA 3Q9LA 3SC2B 4J6FA 4AIRA 4RM3A 2V55B 3CINA 4CPDA 4GEKA 4B0OA 3KJXA 1M1XB 3M3DA 1GDHA 4RJJA 4DCCA 3KXKA 2H31A 4NMXB 2FEXA 3TQFA 4ENVA 1O4WA 1G5RA 2ECKA 1GG5A 2CBGA 3WMFA 2RHHA 1IY9A 3GPBA 3EQ6A 4HKTA 3ZWMA 4AY5A 3T7TA 1Q3TA 3IUSA 3PUZA 4IUDS 1RKBA 2P4SA 4KYTA 4MPDA 5EY5B 2Z6UA 1CR6A 1LBTA 4LVNA 1CEXA 1FDVA 3EW7A 5CPBA 1Q20A 2YDXA 1FP1D 1K8RA 1KQPA 1ZIXA 3Q7RA 3RS8A 4C0AC 2APJA 4TMFA 4L4RA 1QG4A 4HAUA 4EFLA 1OD6A 3A27A 4KO4S 4AQDA 2H00A 3MTBA 4Z1OA 3C4QA 3DF7A 2QRKA 2O52A 1ONNA 3UEOA 5KTSA 1IEXA 4QO8A 4YT4A 4C6RA 5TS2A 1JXMA 2FB9A 4I3GA 4F5YA 1RYFA 2XOEA 4CUJA 2I99A 1N7JA 2VAMA 1ODIA 1E8NA 2AN3A 2VDQB 3K0KA 4JHXA 1GDDA 3KAQA 4RV5A 4PZEA 4NSNA 4Z0PA 2WTEA 4AW9A 2C0QA 4PLFA 3LSYA 3RANA 4B6FA 4F1JA 1E5XA 4V38A 1AHHA 2ZXEA 1MOQA 1XDUA 3NZEA 1GPNA 2H1CA 3IQFA 2ZSAA 3NBXX 1E9VA 4Z0HO 2H4WA 4IV5A 2Z6QA 4P7GA 3LH5A 1PJBA 3TNFA 2I2WA 1YUMA 2V6IA 3I45A 2H9YA 3N2GA 5TQ2A 1LVHA 2CY0A 1ECLA 1HDRA 3INNA 3DL7A 3UYLA 4HVAA 1X7WA 3RVOA 1XAGA 4DZZA 1SXJB 5FNZA 4C6TA 5JSFA 4LOLA 1SCUB 2O3JA 3E9CA 3UK0A 2XSZA 4HEJA 4IFTA 3W04A 1JV2B 2Z95A 2CSUA 2DEUA 2BFBA 4MW1A 3EA4A 1XDGA 3B1XA 2R2AA 1VMIA 3JATA 1N7IA 2VK2A 3N0TA 4P5PA 4EJMA 3CF0A 1DXYA 4RD4A 4RCVA 4E21A 1CEYA 3CXRA 4POOA 5KVVA 2R6HA 1U0SY 1RLIA 3HJNA 1QQ5A 5KYVA 3KYDB 4YAWA 3E81A 3EK2A 3RI3A 3VO9A 1E1DA 3TLMA 4E5MA 3PXBA 4JBIA 1WQ3A 1ACMA 2DLCX 5DHQA 1QIIA 3IB6A 1T1JA 1YDMA 2VUTA 1XWIA 2FWJA 1J1ZA 1D07A 4MRMB 4N54A 4WH0A 5CP8A 5CFRA 5HQTA 2XA1A 3PPXA 4EP1A 4LXXA 1Q77A 1I7SB 2AVDA 3KOWA 4IJUA 2MT9A 2OC9A 3L79A 1ZIPA 2Y6UA 2IHTA 3NUZA 3G2JA 3ND5A 1RM3A 3R8CA 5JSHA 4HDNB 5B5SA 3LQKA 4FKMA 1QAMA 4M9QA 3F3KA 4H16A 3AJEA 3NHBA 1N0HA 3R9IA 1RIIA 1K2VN 1W73A 3A7EA 4DM7A 4HAXA 3OD5A 1YVPA 1TNDA 1IWOA 4AZ0A 1GTJ1 4CEHB 1Y63A 2ZAMA 4B8YA 4MVJP 5KTNA 1SIOA 3C7DB 4EB6A 3IKMB 2H29A 3GUHA 4HQ0A 2MYUA 3B85A 1L4BA 3C3AA 4XYBA 3THWA 5JAMA 3OZAA 1Q0UA 3OQNA 5JQGF 1EK2A 4B09A 4HNVA 1X70A 3OETA 2GEJA 2HUNA 2VK1A 2D7DA 1IB6A 4X65B 1UPTA 4XUGB 2F8SA 1WMSA 2ZETA 1TJYA 3HDJA 4Q21A 1IONA 1TQDA 3EGOA 3REQB 3R9WA 3MD9A 1R0LA 1DBRA 4GX1A 1N6RA 1JSRA 1LV8A 4Z99A 4YMUA 3U4GA 3U13A 1ESNA 3KAKA 4BFCA 2F4NA 4J0QA 3WB2A 1PYGA 4NDNE 4UZSA 1T1RA 4L73A 4A91A 5DCLA 1JFTA 1K1EA 3PC7A 2V7BA 4XGQA 2NPIA 3OFKA 3MQ2A 1K8YB 1VKZA 5BWNA 1GPKA 4E3ZA 4FX5A 2ZVDA 5IM5A 4BUJA 3ZHUA 4JODA 3L8FA 4IZOA 2J3EA 3FPLA 5JJIA 3GYGA 3OFNA 2XYPA 2QRVA 1BA2A 3SZMA 4ZO4A 5EZYF 1KVQA 1Z08A 1KAEA 1PD1A 3AEKB 3D6MA 1LZLA 2R66A 5ILQA 4JSTA 4WOBA 3F6EX 3UUFA 4LJ6A 2WWVD 1QHEA 3C6BA 1ZN2A 2QMUA 5FTKA 3W9UA 4P3YA 1SPBS 5FEUA 4OOFA 3V7UA 1YACA 3AOEA 5FTMA 2NPOA 3JZDA 3JQFC 4BAGA 1E18A 3S0JA 3R5HA 4YP0A 3R4VA 2CB9A 3IAM6 2PR2A 4CEIA 2O1WA 1QIKA 1F0YA 4HGYA 4WINA 2O2ZA 1XKTA 2NX2A 4LWQA 3ZDCA 4H17A 4YTEA 3D4LA 3QMVA 3QLTA 1L4YA 1TO1E 3A32A 5EMLA 3PD7A 4XAQA 2XMGA 2HTEA 3MQFA 2AFIB 2D2FA 2NGRA 5TY0A 2PGLA 1DRVA 1NUAA 1GGNA 3JXEA 3H5VA 5CCBA 4H31A 4U2GA 1EJ6A 4Z4EA 3CR8A 1NKVA 2H1LA 3LUDA 4KAXA 3O9ZA 3H6GA 4IV8A 2D6FA 4GLOA 3EFHA 3V46A 4D8YA 4W8GA 2NP6A 3AGQA 3GPDG 4BNDA 3GRKA 2JRLA 3LFUA 5LZ7A 1H8HD 1Z25A 4M86A 4YJGB 4BB5A 2NN3C 4EI2A 1I7DA 2YS7A 1DO2A 4AX4A 1ONSA 1DTWA 1R0RE 3PGJA 4M8NE 2CXOA 1JZQA 2RB4A 2HA3A 2KM1A 1MRNA 2PX2A 4EMBA 4PBSA 2PLFA 4PPNA 3BD9A 1O8BA 4Q3AA 5EJ9A 5FX2A 2AG5A 4H18A 2VDJA 3L1JA 3OU2A 1TEVA 1V7CA 2HEGA 1DAMA 5ABPA 2MJLA 3D2AA 4GQAA 5K0JA 4HH1A 2W8BB 3AFOA 2D1QA 4BJ6A 1CUGA 3V97A 3SS9X 2Z3WA 4KH0A 4ZVTA 2DH6A 1U7DA 4LNHA 1Q11A 1GQQA 3P20A 3TO5A 5A02A 1SUPA 2VRBA 3MLBA 1HE8B 1FP7A 4H2DA 3KQSA 2H4HA 1R8YA 4KNWA 1K4YA 3MFYA 2JJ2D 3OQPA 5DRTA 4RULA 4R1PA 4HEA1 2R00A 4LQLA 3WLQA 2VHZA 1KGSA 1M74A 1Y3BE 2XHZA 3MGAA 5SYNA 4B3IA 4ETMA 4DC0A 1E1QD 1V8FA 3EA5A 3HCAA 3MUNA 1UMBA 3O93A 3RC2A 4YH1A 1L4MA 1LBIA 1N5DA 3BIXA 3ROPA 3ZWQA 5HS4A 2W58A 3EG9A 3FPGA 1R8XA 3C6QA 3LUPA 4NE7A 5AR1A 5FPQA 3UGQA 1LDMA 2QUBA 2OAEA 3CNOA 2GESA 1W0JA 1WD5A 4WX2B 1K3FA 3SM3A 4NCJA 4DCVA 5BR7A 1UQTA 4RTNA 1A71A 2QRNA 3KRTA 3OY7A 1EK1A 4IUYA 5JAZA 1YF3A 4TYMA 5A5GA 2I9PA 5AI6A 3FFXA 1SQGA 1E7MA 2CL0X 3FTDA 4FMDB 3LPCA 1X19A 4HWSA 4KX3A 4AJ4A 3U3KA 1X1DA 3ETLA 1M6WA 2FN8A 4ZQEA 2OQRA 3ZH2A 4HAWA 1UM9B 3OTGA 1XDZA 4LXIA 3COWA 3WA6A 2QZJA 2E1PA 1GWNA 3LW7A 2I0FA 4N5MA 3ZWXA 1E4OA 4G5HA 3ZZMA 2WDPA 1WDLA 1C7ZA 4JI7B 1KJYA 2I4TA 1A72A 1Q1QA 1EM8B 1LPSA 2WFAA 5JNUA 2NZ8A 1GYQA 2OG2A 5DSXA 2G7MC 3KSBC 2AK2A 5L45A 4BJ5A 3HYLA 4CYMA 2QX7A 4G4GA 4ZYLA 4B87A 3OOYA 3W3ZB 1PK7A 1K06A 1Q83A 3DEZA 3U7QA 5JAIA 1L3IA 3FUWA 4OSPA 5A4KA 5AI0A 3RFTA 5K2OA 5ERXA 4UOQA 2DCUA 1QK5A 3SYLA 1T3HA 2YHSA 3FFBA 2VC2B 4ZOBA 4UOEA 1M6EX 2FG7C 4GLLA 4ZO9A 2Q0XA 5AVQA 1LQUA 1MJGA 1AUXA 3SX2A 1PQ4A 3RIHA 1NU8A 4HAZA 4WBXC 3U80A 4JX8A 4MVYA 2O7NA 4ONEA 1TJPB 3BREA 5JZMA 2C1EA 4H1HA 3G2IA 1CNFA 3MRVA 3TZHA 3DT8A 3K5PA 3EZFA 3DVRX 4V0NA 3PU6A 4XM2A 2B7CA 3VPGA 5JJCA 2H2WA 1TAQA 4D80A 1Y9ZA 1U3GA 2QS9A 2X9VA 4R3UC 3V2GA 4C5BA 2VDKB 2ZCUA 5FPTA 4MITA 1UKEA 2QR2A 3MT7A 2VJLA 1VFNA 2CHUA 1OTYA 1YJQA 2H4YA 3KD3A 3VYUB 5I4CA 4XEHA 1Y4DE 1UEJA 3WWYA 1AQYA 2H92A 2MINB 4JBWA 2ZS8A 2J5RA 3DOUA 1WG8A 2F64A 3MRXA 3WS7A 4EA8A 4FMDF 2TMGA 5HG0A 2AOTA 3VO8A 4KAAA 5D51S 1PI3A 3B6EA 3C15C 4G1VA 4RA9A 1MP0A 4S0XA 4OHXA 1M0EA 5BURA 1KOJA 2XGJA 1S5PA 3O7MA 3VC3A 1C8VB 1Z38A 2OV3A 5SV2A 2TSYB 4MVJH 3V4FA 4CTNA 4RTSA 2PZFA 3DQZA 2FMHA 1FXWF 1Y6JA 3GMIA 3O9MA 4PPFA 3S2SA 3SPXA 3ELBA 1BXRB 3P9YA 3BH6A 4Y2GA 2PFGA 1MUUA 2DY1A 2QI9F 3E1SA 5ALJA 1P3DA 2REXB 3EZ6A 2A35A 2QAIA 1OA0A 2VHTA 4TTIA 4ZK6A 3HB9A 4FW8A 4B7UA 1PHRA 1BDIA 4ZHQB 1QTQA 3VJRA 4TMZA 1BDHA 2NYAA 3HP1A 3LZ6A 1NN1A 4LHYA 2YASA 3OH8A 4D9FA 3JAKA 2ZRNA 1LXCA 2YWCA 3KUUA 3AEQA 1Y80A 1ZGBA 3PXGA 3SIPA 5D5HA 4KVZA 2O50A 5L3SA 2RCYA 3H2KA 3P9RA 3B3GA 2JD2A 2GARA 1GPLA 2J6CA 1Q84A 3HB7A 3T3NA 1Z6GA 3GIWA 3DEKA 4YHHB 3IR5A 5D7NA 2Q6KA 2R1UA 3RYCA 2QD3A 2WB2A 4OX9B 1Y9EA 1K3TA 1DG3A 4WCDA 2AEJA 1QO7A 3GZ4A 2WIJA 3GVHA 3OCVA 1B6RA 2P65A 2X9GA 3QELB 1DCMA 4B3FX 3F5MA 2C4WA 5GOTA 3U60B 3E1KA 3NUGA 1BDBA 3S2GA 1JFSA 1K7EB 1NY5A 4JBLA 1UBFA 2GM9A 3LBNA 2B1RA 4RLSA 5H9VA 4JUCA 3UAOA 4RKQA 4F6RA 2GCOA 4Y2JA 4QELA 3T52A 4U8HA 2JDID 4WVLA 3UAXA 1R4AA 4M1YA 5COAA 4IGKA 1OGIA 3LDAA 3C3DA 3HR7A 4F04A 3G6WA 4LJ5A 3JQBC 2H59A 5JNRA