The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
sequence length |
301
|
structure length |
301
|
Chain Sequence |
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
ORF1a protein
|
publication title |
Critical Assessment of the Important Residues Involved in the Dimerization and Catalysis of MERS Coronavirus Main Protease.
pubmed doi rcsb |
source organism |
Middle east respiratory syndrome coronavirus
|
molecule tags |
Hydrolase
|
total genus |
69
|
structure length |
301
|
sequence length |
301
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2015-06-17 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | main proteinase (3clpro) structure, domain 3 | main proteinase (3clpro) structure, domain 3 | ||
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases | ||
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases |