5C3NA

Crystal structure of mers coronavirus main protease in spacegroup c2221
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
301
structure length
301
Chain Sequence
b'SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a protein
publication title Critical Assessment of the Important Residues Involved in the Dimerization and Catalysis of MERS Coronavirus Main Protease.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 69
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5c3nA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c3nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c3nA02
2AH4X 4Y7BA 3TK5A 3MMGA 1QBVH 1IQFA 2PKSB 4KKDA 1BZXE 2RA3A 2P8OB 4CHAB 4K3JA 3RP2A 4ZHLU 1F5RA 1RRKA 1RTKA 3EA7A 3SUDA 4OS5A 1ACBE 4JK5A 1OKXA 1OWJA 1TPSA 2RDLA 4XDEA 3BG4B 1GBDA 1O2IA 1GBKA 1C1OA 1GCTB 4JZIA 1TGSZ 3ZZ7A 5E0JA 1EX3A 1Y59T 4X1QU 3S9AA 2V3HH 2A4GA 1HLTH 1GVZA 2CGAA 3VXEH 5JBTA 3GCHC 1JRTA 1B0EA 3CP7A 5BRRE 3L33A 3PO1B 1D3TB 1O38A 1T8NA 1UTNA 1C4Y2 2PTCE 1C5WB 2SFAA 1F5KU 1O2YA 4X0WU 1DY9A 5LH8A 1FAKH 2GCHF 2EI6A 1QURH 1QGFA 3EA9A 1NO9H 1KXDA 2TIOA 1KIGH 1C5YB 1UVOA 3A84A 3CENA 1P09A 2C8ZB 1GBHA 3M7QA 1ZTKA 4Q7ZA 3W94A 1S85A 4DVAU 3F1SB 2WPKS 3LJJA 1BBRE 2V3OH 4FUFA 1DLKB 2FESH 1GBLA 7GCHF 4Y8ZA 2WPLS 2AMPA 2V6NA 5GJ4B 4RKOB 1Z1JA 3LU9B 1V2JT 2BY8X 1FN8A 2ZIQH 3FP7E 5EGMA 1YKTA 3QWCH 1MKXH 2P94A 2VIQA 4BXSA 3HATH 1EATA 1G2MA 1A3EH 1LVBA 1MU8B 3QZRA 1ELEE 4FUBA 3GYMA 1YCPM 1BITA 1O3PB 2R3UA 5DJ7A 2CF9H 1QL8A 5DP9A 1XKAC 1IQHA 1P12E 5LPFA 1VITG 1ETRH 2FOFA 4NSYA 1HAGE 1XUIA 1WOFA 1DXPA 1C1UH 2HGTH 5DP7A 4CRCA 1GI3A 6ESTA 5PTPA 3A85A 1P2OA 3SQEE 3EA8A 1Y5BT 2F3CE 1T4UH 2DUCA 1UK4A 2ANMH 1SGDE 2EI8A 1YPHE 1SLWB 3Q3XA 4BAHB 1K9OE 2ZFSA 2SGFE 1C5NH 1AVXA 1UHBB 2R2MB 1L4ZA 5C5NA 3HKIB 4GCHF 1FJSA 1H9IE 1OXGA 4JZ1A 5AVDA 2ANWA 4FUHA 3TH4H 2TGPZ 5L30H 1JOUB 2J38A 1GI9B 4B71A 3TITA 1GGDC 4BXWA 2O8WA 1ABJH 1O2VA 3RXRA 1O3MA 1SGEE 4X2WA 5EXMA 3PMBB 4YT6H 5C67A 1YPGH 5JBAS 1K1PA 3SGAE 2ZU1A 1UTQA 1DS2E 3DA9B 1GMHF 1LVYA 2PUQH 3EGKH 2VIPA 3HK3B 3S69A 1NRRH 3OSYA 2ZFTA 2GX4A 2CN0H 1AY6H 4R8TB 3QTVH 1C5MD 1BRUP 1GG6B 2CV3A 4KELA 3G01A 4AG1A 2Q6GA 1ZMJA 2A1DB 3D65E 3EQ0H 3M3TA 3PM3A 3ZVFA 2FEQH 4KTCA 4B74A 4UEHH 1NU7B 1TBRH 4GHTA 5ABWA 2Y5FA 2Z9KA 4WMFA 4IMQA 4LOYH 1Y8TA 2C4FH 2BDHA 4D76A 3TH2H 3RXGA 1O36A 4H4FA 2PHBA 4ZMAH 1HJAC 4INHA 3P8FA 1WTHD 1D6WA 2O8TA 1S0QA 2HNTF 3GICB 3MNSA 4M7GA 1O2OA 4K2YA 4I8KA 1BIOA 2ZFQH 1RTFB 4Q7XA 3SO3A 3FAOA 4MTBA 3K6ZA 1V2ST 1O3EA 4A7IB 4NZQA 1HYLA 5K7RA 1ETTH 3I29A 4HFPB 1DITH 1C2MA 1LKBA 5A8XA 3ZZBA 2J92A 5EQSA 1RIWB 1QB6A 1EKBB 2G81E 1DWDH 2OTVA 2XBWA 1UHBA 3SU5A 3IWMA 1L4DA 2GCTC 4HTCH 2NU0E 4MPVA 5T3HA 1QBNA 4MNYA 2P8OC 3M36A 4CHAC 3VXFH 4HZHA 3A8DA 5CMXH 1ESAA 3T5FH 4O97A 1A5GH 1TQ0B 3KGPA 4WH6A 4YT7H 5DGJA 4A1XA 1TNGA 1GDQA 2GVFA 4CRDA 2H6MA 1C2EA 4UFFH 4Y8YA 4E06H 3K6YA 1C1WH 3BG4C 3KL6A 1DFPA 1GCTC 1TPOA 4NWKA 3SUEA 1LKAA 1DVAH 2UUKB 5EOKA 1QQ4A 2ANYA 3MH6A 4GPGA 4NFEA 1FIZA 5HMAA 1KXAA 3Q77A 2JKHA 3MO9A 1GHZA 2Q1JA 3KQEA 4J2YB 1J8AA 1ZRBA 4INKA 1ZJDA 2A2XH 5A0AE 1C5TA 1ELGA 3TK6A 5C1YA 5DPAA 3SHAH 1XVOA 3SGBE 2BLQA 1GJ6A 1C5SA 3PO1C 2AGGX 2FX6A 1ELTA 5FPSA 1TNLA 4ZHAA 4D7FA 2BLVA 4ZKNU 1THSH 1JMOH 5A0CA 1MKWH 1YPMH 4D9RA 1RGQA 3LIWA 1PPEE 1FY8E 1GDUA 3LGIA 3QN7A 3QUMP 2JETB 1GBJA 4Q80A 4A1TA 1LPGB 1TGNA 1MTSA 1SLUB 5DP8A 2YNAA 1NY22 3D62A 2BOHB 3O8DA 2BVXH 3SUFA 2ANKH 1FNIA 2P95A 4CH2B 1GJBB 5HXFA 1IQNA 1TFXA 1W12U 4K69A 5EXNA 2NU4E 2F9PA 4U30A 3KCGH 1OWIA 1KYNA 5T6FA 3N7OA 1LMWB 1SQOA 2ZKSA 3SJKA 1L0ZA 1UO6A 4CR5A 2TPIZ 2FOCA 4Y0YE 5DP5A 1NRPH 2BVRH 3DD2H 5JBCS 1NTPA 2ZDNA 3F68H 3E91A 2W3IA 5GCHG 1W2KH 3T62A 2VGCB 2BY6X 2OUAA 3LC5A 4I8LA 5K0HA 1QB9A 3MYWA 4YOGA 1P2QA 1PPBH 1ESTA 1HJ9A 2GT8A 1UTKA 3LGTA 4ZKSU 3O8CA 3F9HA 2WUBA 4CRBA 5F6MA 3S0NA 2Z94A 1EJAA 2GV6A 1SG8B 4Y76A 2BQ7B 2QXIA 1HGTH 4IN1A 1O2KA 2TRMA 1C9PA 1SI5H 4OS6A 1SHHB 1AVWA 1LHCH 5TCCA 4MVNA 3NPSA 5F8TA 1ZOMA 3GDVA 1ELCA 2Y6TA 3ODDA 2F9BH 1O2XA 3F6UH 5FXLA 4JYUH 2A45B 3GY6A 3SNCA 2WYJA 3H5CB 2B0FA 4I32A 2BD3A 1T4VH 2XRCA 1O2UA 1CHGA 4WMDA 2BDCA 1V2LT 1AE8H 1HCGA 4ZUHA 1LVMA 1TX6A 1V2TT 1AU8A 1K1LA 1NM6A 3A86A 1F2SE 4ABFA 2AERH 4AGJA 1IOEA 4UFDH 2WPHS 3V3MA 1TE0A 1SGPE 1IQLA 6LPRA 1EASA 1QA7A 1KXCA 3SBKA 4Y10E 3UFAA 3TGKE 4MG3A 1GL0E 2GCHG 1EP6A 3UWIA 3SZNA 1HUTH 2ZFPH 2C90B 1HBTH 2ZGXH 3QTOH 1AFQB 3T26A 1FONA 4Q2KA 1MKXK 3ZVBA 2ASUB 4LZ1H 3QK1A 3BEUA 1GG6C 1W0YH 4GHQA 3ZVDA 1ANCA 1SQTA 4Y6DA 4OGXA 1G37A 4GVUA 1EZXC 1HAZB 4FUDA 5DO4H 3GY4A 1A61H 1ZGVA 1AIXH 3UQOA 1NPMA 2BXTH 2FS8A 1NFXA 3ODFA 2BDGA 1HFDA 2ZCHP 1GJAB 3ZV8A 3SNBA 4MNVA 1RXPA 1A7SA 5A8ZA 3JZ2B 1BOQA 2RA0A 5F8ZA 2O8UA 1PJPA 2FM2A 3NK8A 3TVJB 2XXLA 1Z8IB 4NIWA 1K2I1 1TQ7B 2LNCA 1TMBH 5HM9A 4JZFH 5EW1H 2G5VA 4MLFB 3MH7A 3SUGA 4TYDA 2TGAA 3NCLA 2GGVB 2NWNA 1QIXB 1MH0A 1C5RA 1RIWC 2VINA 3PMJA 5DP4A 3TJOA 3RUOA 4IBLH 2VH0A 2G4TA 3RXIA 3O8RA 1E0FD 1C2LA 1QB1A 1K21H 1OWKA 4QT8C 4IGDA 4UFGH 1V2RT 1YF4A 4K1EA 1P10A 1O5AB 3LGUA 4IC6A 1MMJN 4JMYA 1LTOA 3Q00A 4BOHA 1TOMH 4NG9H 1IHSH 4KTSA 1GBMA 1TYNA 2P59A 1ZMLA 4MPWA 1BTPA 3D23A 4FUEA 3UOUA 5JYIA 1O2QA 2FS9A 1BHXB 3SJOA 2TBSA 1H1BA 1DOJA 1GHAG 4WVPE 2GD4B 1CQQA 1QRZA 3AW1A 4DGJA 1GMHG 1BTZA 1MAXA 3GDSA 1G2LA 1VR1H 5EPNA 1VZQH 1EJNA 3B8JA 4X8UH 2FYQA 2O9QA 2YOLA 2C8WB 3SU1A 2VVCA 3RXDA 5JB9S 2FLBH 1QL7A 2HRVA 2BZAA 3UPEA 2OBQA 3E0NB 3F9GA 1O0DH 1T31A 1FAXA 2OQ5A 3OY6U 2J94A 1GBFA 3T27A 1S6FA 3M3SA 5E8EH 2PTNA 3ENSB 3MNBA 1RS0A 4X1PU 3E90B 2JETC 4B75A 2FI5E 2FIRH 3PMAB 2ZDVH 1PPFE 3RXCA 1IQJA 5JB8S 4DJZB 5LPEA 1GDNA 1BRCE 1C5QA 2FX4A 3SN8A 2BMGB 3EYDA 2VB0A 3R0FA 1BA8B 2WPIS 1TRNA 2PKAB 1IAUA 2QN5T 2GZ9A 2B8OH 4NCYA 3BTTE 1A1RA 5T6DA 4NWLA 2THFB 3NUMA 3A8AA 1IQIA 4AB9A 5T6GA 1G3DA 1TBZH 5EPYA 1HIAB 1O3OA 2VGCC 1TRMA 1OWDA 4BAMB 2FPZA 4WWYA 2PWXA 4WXIA 4B2CA 4ABDA 5FAHA 2GCTB 3AVZA 1FZZA 5JDUB 1XXFA 1CO7E 1D9IA 1UTJA 4ISOA 1DLEA 2H9HA 2ZU4A 1WQVH 3LJOA 1BTWA 4TWYA 2ZU3A 1K1MA 2VIDA 4AFQA 1TOCB 2ESTE 2Y5HA 1V3XA 1KXFA 3E3TA 1UCYK 3ZZ6A 1MKWK 1WTGH 1YYY1 2PSXA 2ZHQH 4ABBA 4AYYB 4BAQB 3NXPA 1ZYOA 1O3LA 1OX1A 2UWLA 2XC5A 3SNDA 1K28D 1TLDA 3SNAA 2STBE 4J1YA 2H5CA 4FVDA 4O3TA 2VIVA 1ELBA 1VCQA 1HPGA 1GI5A 5AFYH 3AASA 2XCNA 4Y79A 4DG4A 2Y80A 2D2DA 4Y8XA 1GJ5H 4K8YA 2DE8A 3ITIA 1JXPA 3M5LA 1AHTH 1WUNH 1TIOA 4IW4E 1BTXA 3BIUH 2O8MA 2H2ZA 4X6PA 1ELAA 2AMQA 1O2JA 1AUTC 4X2XA 3E0PB 4TY7A 1OWHA 1J14A 3U9AH 4ESTE 1Z8GA 1ZPBA 2FOMB 3D49H 1LPZB 1O2NA 1AFQC 1OS8A 5E0HA 1E38B 3MOCA 8LPRA 2G8TA 1FN6A 2QA9E 1NROH 5DP3A 1D3DB 1VGCB 1P06A 2A4QA 2BY5X 3VGCB 1QR3E 1EQ9A 1SSXA 1GHBF 1KDQA 2UWPA 1FMGA 2FWWA 3IITA 3V0XA 2UWOA 2BYAX 4CBNA 5HYOA 2G00A 1O3CA 1V2KT 3K9XB 4CRFA 1NS3A 4O3UA 4YO9A 3RMLH 3BTGE 3W95A 5CHAB 1Q2WA 3SORA 3ATWA 1NC6A 2PGBB 3SGQE 1P0SH 1TALA 3Q3YA 2GDEH 1W0ZU 1AO5A 3ATLA 3KQBA 2P93A 1AZ8A 3A88A 1PQAA 4CRGA 3OU0A 1GCDA 1S83A 3LC3A 2LPRA 5EQRA 1ZR0A 1O2ZA 3A81A 2VNTA 4YM9A 2AMDA 3TGIE 4INLA 4K1TA 1UVTH 4WY3A 5BPEA 1B7XB 5FBIA 4YTAA 4MPXA 1ZTJA 3TJUA 3OX7U 5GXPA 1WSSH 1P57B 4ISLA 1Q31A 5C20A 3DFLA 1EB1H 1ORFA 1O5EH 2PGQB 3MHWU 1P11E 2ZP0H 6GCHG 2A5AA 2Y82A 2GKVE 1CA0B 1W8BH 4ZROA 4NA7A 7LPRA 1GVKB 1HXEH 3SU3A 1BB0B 3GCTF 2NU1E 3BTQE 3H7TA 3VEQB 2VJ1A 2VWNA 3T28A 3SQHE 3BEIB 1GJ7B 3NWUA 1AVGH 5A2MH 1ARCA 3U8RH 2EA3A 1SGFG 1O2HA 1GHAF 1ZLRA 4ISIH 1MCTA 1BCUH 3P8NA 3VB3A 2I6QA 2QCYA 2GTBA 3RU4E 1GPZA 1YPHC 5C3NA 3E8LA 7KMEH 2BX3A 1GI0A 1TPAE 4X2VA 1GMCF 1O2RA 7ESTE 1W11U 2XNIA 3P92A 2CHAC 3M35A 4JYTA 1U6QA 1XVMA 3FP6E 4AGKA 1QRWA 3ESTA 2Z9GA 1FIWA 4XFQA 8ESTE 1EAIA 4U01A 3UR6A 2AS9A 3RXJA 2BOKA 1FUJA 3JZ1B 2VIOA 2ZC9H 3K2UA 3M5MA 1S82A 4DOQA 4E7NA 1PYTD 3VB4A 1O3HA 3UREA 1O30A 5C1UA 1O2WA 3I77A 4ISNA 3U1IB 1TPPA 3SHCH 1H9LB 2R9PA 5EXLA 1G36A 1O3IA 4I8JA 1HXFH 4DT7B 1DY8A 2SGQE 2J4IA 3M37A 3SU2A 1FV9A 1VJ9U 1KTSB 2W5EA 5H4IB 3GYLB 1SQAA 1D3QB 3MU0A 4XE4A 4JZDH 3Q3KA 3HGNA 5FCRA 2AGIX 1RFNA 3LH1A 1NRSH 1HJ8A 1ANBA 3RLYH 1ZRKA 1CU1A 2BD2A 2BDBA 1V2NT 1MBMA 4GLYA 3UNQA 1PQ8A 1S5SA 1SGYE 2ODQA 1Z6JH 3LH3A 3F9EA 1EZQA 1TNHA 1YCPH 2FODA 2Z3CA 2GP9B 1C9TA 3QX5H 4AG2A 4KP0A 5JPMH 1GBTA 1W14U 3HGPA 3ZVEA 4RN6A 1TX8A 1C2IA 4NIYA 3BN9A 3GCOA 1FLEE 3TGJE 4FU9A 4BTTB 3UUZA 2GMTB 2ZFFH 3EE0B 1FPHH 1NU9A 4AYVB 3M3VA 2A4RA 2J95A 2ZF0H 4DCDA 3SV2H 5GDSH 4A92A 4GAWA 4BTIB 1AQ7A 1GI8B 4NZLA 3SV9A 1L1JA 2ILNA 2ZFRH 3PWBA 2BDAA 3E1XB 4YOJA 3MO3A 3TNTA 5SGAE 1PQ5A 1GJCB 3UIRA 3VFEA 5ETXA 3S9CA 1BRAA 3BF6H 2FOAA 1P2JA 5LGOA 1VGCC 3RC5A 2ZPQA 3VGCC 1IQMA 1C4U2 4BAOB 4UD9H 3KHVA 1XXDA 3NKKA 5E2PA 1A0LA 2FI3E 1C5OH 1YPLH 1UCYE 1CBWB 3LDXH 1DUAA 2W3KA 3IG6B 1AGJA 1SLVB 1A2CH 2PUXB 1C2FA 5CHAC 1F7ZA 2FMJA 3TH3H 1TWXB 4Z6AH 3BTFE 3PV4A 1ZGIA 1EAXA 3S7KB 1TMUH 4OGYA 3A7WA 1SGIB 4I8HA 1EAWA 3ZVAA 2BQWB 2BDIA 1M9UA 2ZTXA 1Z6EA 1EAUA 1FY4A 2EEKA 1THPB 1V2PT 4NIVA 4HGCA 1BQYA 4X6MA 1HDTH 1T8LA 1NFWA 2GV7A 1SMFE 2ZHEH 1QL9A 5DK1A 3P17H 3WY8A 1ZHRA 1GHWH 1MQ5A 6GCHF 2IPHA 8GCHF 1XUHA 2SGAA 1CA0C 2XC0A 2TGTA 4Y0ZE 2WV5A 2ZPRA 1O37A 4B2BA 1YPJH 2HNTE 1UJ1A 4BNRA 5L6NH 2WYGA 4X8TH 4CBOA 4I7YH 1O3FA 1F0SA 4DURA 1DWCH 2OP9A 2OD3B 1LHFH 2BLWA 3HK6B 2XC4A 2PLXA 2FOGA 2R0KA 3RXVA 3NZIA 1CE5A 4ABJA 2FDAA 1W3CA 1HAIH 1SGQE 2XWAA 3P8OA 2Y81A 4PROA 3RXTA 5L2ZH 1MTNC 1NFYA 2SNVA 2FYRA 4MNWA 4X2YA 3SI4H 1MTUA 1C1VH 2BXUH 3ZVCA 1GMDF 1S81A 2IJOB 1GBEA 2OQUA 1LCYA 1GI4A 2WV4A 4I31A 3V7TA 3MU8A 1NZQH 2AYWA 1GHBG 4H42U 1QRXA 2CJIA 5I25A 1SLXB 1TRYA 1GJ9B 1DSTA 2J9NA 4X8VH 1G3EA 3ZZ4A 1FDPA 1QQUA 2OINA 3OY5U 4GUXA 1F0TA 1FY1A 3TU7H 2ZWLH 3MNCA 2OC7A 1ANDA 4UE7H 1OOKB 2WINI 2ZHDA 4K8BA 1UK3A 1L1GA 1D6RA 1OPHB 2FLRH 1AWHB 1C5UA 4IMZA 4IN2A 4Z0KA 3SJ9A 1HAOH 2PW8H 3C1KA 1O5FH 1TNIA 1XUFA 1QCPA 1AZZA 1BMMH 1O3JA 1MTVA 1CGHA 1O5CB 4YZUA 5FBEA 4IC5A 4DY7B 1YP9A 2SGPE 3SW2B 1E34B 1Y3VA 1P9SA 3F9FA 3QZQA 4A6LA 2ZCLP 1MBQA 2A2QH 4AZ2B 3RXOA 2R2WU 2BY7X 3MNXA 5C5OA 1S6HA 2J34A 5ESBA 2ZU2A 1ZSJA 3UOPA 3GDUA 1DSUA 2G4UA 2ALVA 1GBCA 1K22H 2BTCE 2ZG0H 1P3EA 2RG3A 2OBOA 1O33A 4XBBA 1SOZA 2DE9A 2F9OA 1GI1A 2FZZA 2BQ6B 1WQSA 3UQVA 2ZGCA 2XTTB 2EC9H 2Z3DA 3GCTG 3RXSA 3A83A 1O31A 1Y3UA 9ESTA 2PV9B 4CREA 3GISB 1O2LA 1UTPA 3P6ZB 1UK2A 2HPQH 1V6DA 2FXRA 1VCWA 3VB6A 5C2ZA 1E36B 1UVUH 1MTWA 1C1NA 2CXVA 3RXUA 1AKSB 2QYIA 3PYHA 5A09A 1EPTB 1UTOA 2A7CA 4AFZA 1Y3YA 1CA8B 1TAWA 1MCVA 3FVFB 4YLQH 4B2AA 2GMTC 1OSSA 3EAJA 1IHTH 5IDKA 2BVSH 4AORA 4MPUA 1QJ6B 1J16A 4UONA 4TPIZ 1P2MA 5DG6A 4U32A 2R3YA 4WXVA 1P04A 1EP5A 1GMCG 1C5LH 5EG4A 3RC6A 5GIBA 3M5NA 2CHAB 3FANA 1P9UA 1BMAA 3QGJA 1BRBE 1GI2A 2QF0A 5GWZA 2QIQA 1P2KA 1W7GH 2P3FH 5AF9H 1P05A 1BHXF 1TBQH 2QGRA 5LPRA 1GL1A 2B7DH 1C1PA 2ZGHA 1T7CA 2OXSA 2P3UB 4OS1A 1P02A 3LONA 1O3DA 2J2UA 1ELFA 1OYQA 1IQKA 1CGJE 1C5PA 4ABAA 4OS2A 3KEEA 1CBWC 3ZZAA 1PFXC 1EOLA 8KME2 1AI8H 1LQDB 2VIWA 1QJ1B 1AFEH 1YCPK 2G52A 1ZPZA 2H9TH 2VVUA 3BTWE 6CHAB 3AAUA 1SGRE 1G9IE 4ZHMU 3V13A 1FPCH 4XBDA 1DANH 4TWWA 1MZAA 1ZSLA 3ZZ9A 1LVOA 2BB4A 4AX9H 3UTUH 5TJXA 2BZ6H 2XW9A 4H6SB 3P70B 3M7TA 5G4BA 1F5LA 1LQEA 3ZYEA 1GHXH 4X6NA 1OWEA 1GI6A 1EXFA 1TABE 4XOJA 1SGNE 2R0LA 2BD9A 1LPKB 3FZDA 1PPHE 2NU2E 3H7OA 4KTUA 1AKSA 1EPTA 2FOBA 1K1OA 3EDXB 1FI8A 1DICA 2K1QA 2KAIB 4Y7AA 1CHOG 1TNKA 3OTJE 4FXGH 3STIA 3MTYA 4E05H 2V0BA 2FO9A 1EUFA 4JYVH 4YLUA 2ZHFH 2A5KA 1GHVH 1C2DA 1C5ZB 2OC0A 4AB8A 2ZDAH 2BD7A 1HAXB 3LT3A 2JH6D 2C8YB 1A0HB 3RDZA 1F0RA 4SGAE 1QY6A 1HAPH 2D1JA 1C2GA 4A1VA 1AMHA 2GDDA 5CE1A 3KIDU 3BEFB 1TGBA 1JIRA 2HPPH 2P3TB 1BMNH 1KSNA 5A0BA 1BBRH 1J17T 1O5DH 2OLGA 1NFUA 2BY9X 4FUJA 2ZU5A 2AFQB 1O34A 1Y5UT 3S7HB 1K1NA 2FP7B 3URCA 4K60A 2SGDE 2XWBI 3PWCA 2GZ7A 2BDYA 2ZHWH 2PKAA 4LK4A 3A8CA 3BTME 2UUJB 4F49A 1BT7A 4BANB 3LPRA 1XM1A 4I33A 1WU1A 2ODYB 4NGAH 1UVPA 3ATMA 4ZKOU 3SU0A 3RXAA 3UNRA 4K1SA 3FFGA 2H9EH 3FP8E 2G51A 1DE7H 3A7XA 4ISHH 1HIAA 1X7AC 3KN2A 1ARBA 3PTNA 3L3TA 4ZKRU 1QFKH 2SNWA 1C5XB 5J4SA 1SPJA 5L2YH 3TPIZ 1JBUH 1MZDA 1N8OB 2ZDMA 5IYTA 4E7RG 1DXWA 3B23B 1BJUA 5GPIB 1GJ4H 1E37B 1HV7A 3HPTB 1K1JA 2QXHA 3KNXA 1KXEA 1ZTLA 3ZZ5A 2VWMA 2JH0D 1CSOE 4B76A 3BTKE 4WH8A 2YNBA 3L6PA 2FI4E 2UUFB 1C2HA 2GZ8A 3BG8A 1OP0A 1BTHH 1FXYA 1DWEH 2ZCKP 1Z8JB 3A87A 1RD3B 4THNH 1NN6A 3SOSA 1UMAH 1ZMNA 1SL3A 1TONA 1HAHH 2KAIA 1OP2A 1HRTH 3A7VA 5EQQA 1A5HA 1GBIA 1EOJA 1JIMA 4AFUA 2C8XB 2H1UA 8GCHG 3M7UA 3RMMH 2A7JA 1KLTA 4ABHA 1XMNB 2ZPSA 3ATIA 5I46H 3ZV9A 1GJ8B 3GY5A 3P95A 3PLKA 1EJMA 1NRNH 2G5NA 1V2VT 3M61U 1MD7A 1OP8A 3ZZCA 4NFFA 1O2GH 1Y5AT 3PB1E 3MH4A 1HNEE 1C4V2 1EPTC 3RLWH 2Q6DA 2UUYA 1TA6A 1ID5H 2ZTZA 3RMNH 1MTNB 1G3BA 2H5DA 3CS0A 1KLIH 1Z8RA 1UTLM 1VJAU 2WPMS 2AEIH 1TMTH 1GMDG 5FHTA 2XBYA 2Q6FA 2ZQ1A 3TJVA 3ELAH 3ATKA 4B1TA 1G32B 2P16A 1O3NA 2IN2A 1P01A 5E2OA 1G30B 1XKBC 4MNXA 4MQAA 5FX5A 2FOEA 3AW0A 2OC8A 1TGTA 1ELDE 1YLDA 1YPEH 1V2WT 3UY9A 1XUKA 2PR3A 3P8GA 1DX5M 3ZZ3A 2Y7XA 2BD5A 1JWTA 1WAYB 3QDZB 2HVXA 1W10U 3MU1A 1O3GA 2HLCA 2A32A 2NU3E 1N6YA 2ZEBA 2W7SA 1O5BB 1MUEB 1P2IA 2XBXA 2ALPA 2Y5GA 1O5GH 3RMOH 1SVPA 5C1XA 2Z9JA 1F92A 2ZGBH 5F8XA 3FZZA 3PROA 1AB9B 3GOVB 3U8TH 3MH5A 3MWIU 1DPOA 1BDAA 1YLCA 4X1RU 5FX6A 1C1MA 2FTLE 4FUGA 4FU7A 3UWJH 1O3BA 3BTHE 6CHAC 1V2MT 3QO6A 2VU8E 1C1QA 1CT2E 5ESTE 4WF8A 4AFSA 2F9UA 2D26C 1EZSC 2JH5D 4VGCC 1W7XH 2QF3A 2Z7FE 1DUEA 3RXHA 1GHYH 1QTFA 2ZECA 1G3CA 1L2EA 1GBBA 5JBBS 4TY6A 1ETSH 3O8BA 4FU8A 4XSKU 4DW2U 1CVWH 1ELVA 2EI7A 3BV9B 2PKSC 1ABIH 1AD8H 4D8NA 1H9HE 1PPZA 1KY9A 2VH6A 4ZAEA 5EW2H 4JCNA 2ZGJA 3RU4T 1SGTA 1CHOF 4YESB 1NT1A 1O32A 1MQ6A 4NIXA 2B9LA 2XCFA 3ZZ8A 2WUCA 1DDJA 1ZPCA 1O2MA 2AIPA 3T2NA 1PQ7A 3MFJA 2QXGA 3UNSA 4RKJB 1GVLA 4ZXYH 1WYKA 4NA9H 4ABGA 3VPKA 2FOHA 1HB0B 4I8GA 4K5ZA 2Z9IA 4Y11E 2K7XA 1GJDB 4IS5A 1YC0A 1SR5C 1C1RA 1T8OA 1UCYH 4MDSA 9LPRA 1DWBH 3LGVA 1BTUA 3BTDE 1Z1IA 1GBAA 4CR9A 3MU5A 1DM4B 4X6OA 1WV7H 2XBVA 4YOIA 1TA2A 1Q3XA 2Z6BD 2QAAA 1SOTA 1EB2A 5TCAA 1FY5A 3SV6A 1N8OC 1INCA 1D3PB 4D9QA 3U1JB 2C3SA 3VB7A 2QV1A 1BTYA 1VCPA 2A7HA 4R0IA 1ZSKA 1O3AA 3A80A 5FPYA 1HAVB 1PPGE 5E0GA 4U2WA 1LHDH 1CGIE 4RSPA 4XBCA 5HM2A 1SFQB 4BAKB 1SBWA 2CMYA 3GY7A 4X1SU 3A7YA 1ZZZA 3RM0H 2HALA 1P8VC 2F91A 2D8WA 2W26A 4A5TS 2G55A 2SGEE 3DFJA 3RC4A 4KGAA 1CT0E 3K65B 2F9NA 3TNSA 1PPCE 1VITF 2Z9LA 1ANEA 1BBRK 3GCNA 4O03A 2ZDLA 3Q76A 1FQ3A 4Q7YA 1TX7A 4UFEH 1Z7KA 2F83A 1H8DH 1XUJA 1AN1E 1O2SA 1CT4E 3SJIA 1FY3A 4AN7A 5EU8A 2Y7ZA 1QA0A 4FUIA 4GSOA 3TIUA 4JZEH 1KXBA 4ASHA 3RXKA 2TGDA 1QBOA 3MU4A 1P3CA 3SV8A 1HAYB 1V2UT 2HWLB 1C2JA 4Y71A 4O9VA 3T25A 2I6SA 1P03A 2QXJA 5AFZH 1N6XA 3GCHB 1J9CH 3E6PH 4CRAA 2LIZA 1GWAA 1Y3WA 3RXPA 3STJA 4UDWH 1H4WA 2XYAA 1YM0A 5AHGH 1N1LA 3OYPA 2BHGA 3B9FH 3T29A 2WPJS 2QC2A 3DT0H 4WMEA 1NESE 2M5TA 2ZO3H 3GY8A 2ULLA 1C1SA 5B6OA 1TB6H 1ZJKA 2BM2A 3LOXA 2HNTC 3M5OA 3LGWA 1A3BH 2ODPA 3I78A 2V35A 4X8SH 2QY0B 3RXBA 1DT2A 4H6TA 3V12A 1D4PB 1B5GH 3U69H 2BX4A 1Y3XA 1T32A 1QJ7B 3MI4A 4AOQA 2A31A 4D7GA 3TLOA 4B73A 1IQEA 7GCHG 1BMLA 5DKMA 1HAVA 1LHEH 4FVBA 5F03A 2GT7A 4ABEA 1V2QT 4FUCA 1V2OT 1L1NA 2PSYA 1AB9C 1AE5A 3A7TA 1K1IA 1BJVA 1WCZA 3SV7A 1ZHMA 1J15A 2HOBA 4JK6A 3BIVH 1C2KA 4HI3A 3A89A 3LGYA 2C93B 1KTTB 1TNJA 2W7UA 3VB5A 2PFEA 1UTMA 3BTEE 1UVSH 3SNEA 1THRH 3AAVA 3E16B 1O39A 1SGFA 2A0QB 3QGNB 4X1NU 1XX9A 1IQGA 4LZ4B 4BTUB 3DHKH 2ZA5A 1PYTC 2RCEA 1BUIA 1YPKH 3HKJB 4OS4A 1O2PA 3UR9A 3RXEA 3A8BA 1S0RA 5J4QA 2VVVA 4NA8A 3KF2A 3QLPH 1JRSA 3SJ8A 1LDTT 3ZYDA 1O3KA 3PLPA 2A4OA 1P2NA 2OCVB 4DIHH 1ZHPA 3SU6A 1W13U 1MU6B 2VWOA 3GY2A 1LO6A 3SU4A 4LXBH 1O2TA 4GCHG 2OC1A 2A5IA 1A46H 3SI3H 2BD8A 3A82A 1MD8A 3C27B 4ABIA 4ZH8A 2ZNKH 2CF8H 3ZVGA 1QHRB 2B5TB 1GGDB 5EODA 2ZQ2A 1KLJH 1VITH 1AUJA 2O8LA 2AGEX 1C1TA 5DP6A 2ZI2H 2Z3EA 3TJNA 1QNJA 3S9BA 3U98H 1O35A 1F0UA 2FTMA 3KQDA 3RXQA 1NRQH 3RM2H 3RXMA 2BLOA 5FCKA 4CH8B 1RJXB 1SC8U 3GY3A 1RTLA 3BSQA 5FPTA 1A4WH 1SHYA 3KQCA 3RU4D 1H8IH 4F4OC 1MAYA 1ESBA 2ZZUH 1T8MA 1S84A 2VWLA 1SFIA 3URDA 3PMHB 1SGCA 1C5VA 2BD4A 2IOTA 3RXLA 3LKWA 1B0FA 1EZUC 4SGBE 5A8YA 4OS7A 3MO6A 1WBGB 1LHGH 3EBNA 3ZZDA 2F9VA 5HGGA 2ZTYA 4NSVA 4WJG2 3DUXH 3PTBA 1HJAB 2ZDKA 3R3GB 1AWFH 1A0JA 3A7ZA 1YGCH 1A5IA 2AIQA 1XUGA 4VGCB 3RXFA 1KDQB 4ZXXH 3CS7A 3U8OH 3TK9A 1TGCA 1Z71A 1OYTH 3PLBA 4TPYA 4DIIH 1YBWA 1E35B 5GCHF 1GI7B 1SB1H 2STAE
chains in the Genus database with same CATH superfamily
2AH4X 4Y7BA 3TK5A 3MMGA 1QBVH 1IQFA 2PKSB 4KKDA 1BZXE 2RA3A 2P8OB 2W6JD 4CHAB 4K3JA 3RP2A 4ZHLU 1F5RA 1RRKA 1RTKA 3EA7A 3SUDA 4OS5A 1ACBE 4JK5A 1OKXA 1OWJA 1TPSA 4I86A 2RDLA 4XDEA 5DSFA 3BG4B 1GBDA 1O2IA 1GBKA 1C1OA 1YY3A 1GCTB 4JZIA 1TGSZ 3ZZ7A 1W0KD 5E0JA 1EX3A 1Y59T 3OTPA 4X1QU 3S9AA 2V3HH 2A4GA 1HLTH 1GVZA 2CGAA 3VXEH 5JBTA 3GCHC 1JRTA 1B0EA 3CP7A 5BRRE 3N99A 3L33A 3PO1B 1D3TB 1O38A 1T8NA 1UTNA 1C4Y2 2PTCE 1C5WB 2SFAA 1F5KU 2V3MA 1O2YA 4X0WU 1DY9A 5LH8A 1FAKH 2GCHF 2EI6A 1QURH 2L74A 1QGFA 3EA9A 1NO9H 1KXDA 2TIOA 1KIGH 1C5YB 1UVOA 3A84A 3CENA 1P09A 2C8ZB 1GBHA 3M7QA 1ZTKA 4Q7ZA 3W94A 1S85A 4DVAU 5C0UA 3F1SB 4ACBA 2WPKS 3LJJA 1BBRE 1BMFD 2V3OH 4FUFA 4P00A 1DLKB 2FESH 1GBLA 4RT0A 7GCHF 4Y8ZA 2WPLS 2AMPA 2V6NA 5GJ4B 4RKOB 1Z1JA 3LU9B 1V2JT 2BY8X 1FN8A 2ZIQH 3FP7E 2KCPA 5EGMA 2KZ4A 1YKTA 2WV9A 2GJGA 3QWCH 1MKXH 2P94A 2VIQA 4BXSA 3HATH 1EATA 1G2MA 1A3EH 1LVBA 1MU8B 3QZRA 1ELEE 4FUBA 3GYMA 1YCPM 4F55A 1BITA 1O3PB 2R3UA 5DJ7A 2CF9H 4M9FA 1QL8A 5DP9A 1XKAC 1IQHA 1P12E 5LPFA 1VITG 1ETRH 2FOFA 2KCAA 4NSYA 1HAGE 1XUIA 1WOFA 1DXPA 1C1UH 2HGTH 5DP7A 4CRCA 1GI3A 6ESTA 5PTPA 3A85A 1P2OA 3SQEE 3EA8A 1Y5BT 4ZCNA 2F3CE 1T4UH 2DUCA 1UK4A 2ANMH 1SGDE 2EI8A 1YPHE 1SLWB 3Q3XA 4BAHB 1K9OE 2ZFSA 2SGFE 1C5NH 1AVXA 1UHBB 2R2MB 1L4ZA 5C5NA 3HKIB 4GCHF 4P02A 1FJSA 1H9IE 1OXGA 4JZ1A 5AVDA 2ANWA 4FUHA 2V7QD 3TH4H 2TGPZ 3DCLA 5L30H 1JOUB 2J38A 1GI9B 4B71A 3TITA 1GGDC 4BXWA 2O8WA 1ABJH 1O2VA 3OEED 3RXRA 1O3MA 1SGEE 4X2WA 5EXMA 3PMBB 4YT6H 5C67A 1YPGH 5C94A 5JBAS 1K1PA 3SGAE 2ZU1A 1UTQA 1DS2E 3DA9B 1GMHF 1LVYA 1UW7A 2PUQH 3EGKH 2VIPA 3HK3B 3S69A 1NRRH 3OSYA 2ZFTA 2GX4A 2CN0H 1AY6H 4R8TB 3QTVH 1C5MD 1BRUP 1GG6B 2CV3A 4KELA 3G01A 4AG1A 2L6OA 2Q6GA 1ZMJA 2A1DB 3D65E 3F0PA 2XNDD 3EQ0H 3M3TA 3PM3A 3ZVFA 2FEQH 4KTCA 4DT4A 2JJ1D 4B74A 4UEHH 1NU7B 1TBRH 4GHTA 3PV5A 5ABWA 2Y5FA 2Z9KA 4WMFA 4IMQA 4LOYH 1Y8TA 2C4FH 2BDHA 4D76A 3TH2H 3RXGA 1O36A 4H4FA 2PHBA 5HKKD 4ZMAH 1HJAC 4INHA 3P8FA 1WTHD 1D6WA 2O8TA 1S0QA 2HNTF 3GICB 3MNSA 4M7GA 1O2OA 4K2YA 4I8KA 1BIOA 2ZFQH 1RTFB 4Q7XA 3SO3A 3FAOA 4MTBA 3K6ZA 1V2ST 1O3EA 4A7IB 4NZQA 1HYLA 2YMSC 5K7RA 1ETTH 3I29A 4HFPB 1DITH 1C2MA 1LKBA 5A8XA 3ZZBA 2J92A 5EQSA 1RIWB 1QB6A 1EKBB 2G81E 3FOAA 1DWDH 2OTVA 2XBWA 1NBMD 2HLDD 1UHBA 3SU5A 3IWMA 1L4DA 2GCTC 4HTCH 2NU0E 4MPVA 5T3HA 1QBNA 4MNYA 2P8OC 3M36A 4CHAC 3VXFH 4HZHA 3A8DA 5CMXH 1ESAA 3T5FH 4O97A 1A5GH 1TQ0B 3KGPA 4WH6A 4YT7H 5DGJA 4A1XA 1TNGA 1GDQA 2GVFA 4CRDA 2H6MA 1C2EA 4UFFH 4Y8YA 4E06H 3K6YA 1C1WH 3BG4C 3KL6A 1DFPA 1GCTC 1TPOA 4NWKA 3SUEA 1LKAA 1DVAH 2UUKB 5EOKA 1QQ4A 2ANYA 3MH6A 4GPGA 4NFEA 1FIZA 5HMAA 1KXAA 3Q77A 2JKHA 3MO9A 1GHZA 2Q1JA 3N7DA 3KQEA 4J2YB 1J8AA 1ZRBA 4INKA 1ZJDA 2A2XH 5A0AE 1C5TA 1ELGA 3TK6A 5C1YA 5DPAA 3SHAH 1XVOA 3SGBE 2BLQA 1GJ6A 1C5SA 3PO1C 2AGGX 2FX6A 1ELTA 5FPSA 1TNLA 4ZHAA 4D7FA 2BLVA 4ZKNU 1THSH 1JMOH 5A0CA 1MKWH 1YPMH 4D9RA 1RGQA 3LIWA 1PPEE 1FY8E 1GDUA 3LGIA 3QN7A 3QUMP 2JETB 4FOUC 1GBJA 4Q80A 4A1TA 1LPGB 1TGNA 1MTSA 1SLUB 5DP8A 2YNAA 1NY22 3D62A 2BOHB 3O8DA 2BVXH 3SUFA 2ANKH 2EQNA 1FNIA 2P95A 4CH2B 1GJBB 5HXFA 1IQNA 1TFXA 1W12U 4K69A 5EXNA 2NU4E 2F9PA 2IPQX 4U30A 3F0OA 1OWIA 3KCGH 1KYNA 5T6FA 3N7OA 1LMWB 1SQOA 2ZKSA 3SJKA 1L0ZA 1UO6A 4CR5A 2TPIZ 2FOCA 4Y0YE 5DP5A 1NRPH 2BVRH 3DD2H 5JBCS 1NTPA 2ZDNA 3F68H 3ZIAD 3E91A 2W3IA 5GCHG 1W2KH 3T62A 2VGCB 2BY6X 2OUAA 3LC5A 4I8LA 5K0HA 1QB9A 3MYWA 4YOGA 1P2QA 1PPBH 1ESTA 3AK5A 1HJ9A 2GT8A 1UTKA 3LGTA 4ZKSU 3O8CA 3F9HA 2WUBA 4CRBA 5F6MA 3S0NA 2Z94A 1EJAA 2GV6A 1SG8B 4Y76A 2BQ7B 5KECA 2QXIA 1HGTH 4IN1A 1O2KA 2TRMA 1C9PA 1SI5H 4OS6A 1SHHB 1AVWA 1LHCH 5TCCA 4MVNA 3NPSA 5F8TA 3VG8A 1ZOMA 3GDVA 1ELCA 2Y6TA 3ODDA 2F9BH 4TSFD 1O2XA 3F6UH 5FXLA 4JYUH 2A45B 3GY6A 3SNCA 2WYJA 3H5CB 2B0FA 4I32A 2BD3A 1T4VH 2XRCA 1O2UA 1CHGA 4WMDA 2BDCA 1V2LT 1AE8H 1HCGA 4ZUHA 1LVMA 1TX6A 1V2TT 1AU8A 1K1LA 1NM6A 3A86A 1F2SE 4ABFA 2EY4C 2AERH 4AGJA 1IOEA 4UFDH 2WPHS 3V3MA 1TE0A 3U28C 1SGPE 1IQLA 6LPRA 1EASA 1QA7A 2KCYA 1KXCA 3SBKA 4Y10E 3NRLA 3UFAA 3TGKE 4MG3A 1GL0E 2GCHG 1EP6A 3UWIA 3SZNA 1HUTH 2ZFPH 2C90B 1HBTH 2ZGXH 3QTOH 1AFQB 3T26A 1FONA 4Q2KA 1MKXK 3ZVBA 2ASUB 4LZ1H 3QK1A 3BEUA 1GG6C 1W0YH 4GHQA 3UAIC 3ZVDA 1ANCA 1SQTA 4Y6DA 4OGXA 1G37A 4GVUA 1EZXC 1HAZB 4FUDA 5DO4H 3GY4A 1A61H 1ZGVA 1AIXH 3UQOA 5EJ1A 1NPMA 2BXTH 2FS8A 1NFXA 3ODFA 2BDGA 1HFDA 2ZCHP 1GJAB 3ZV8A 3SNBA 4MNVA 1RXPA 1A7SA 5A8ZA 3JZ2B 1BOQA 2RA0A 5F8ZA 2O8UA 1PJPA 2FM2A 3NK8A 3TVJB 2XXLA 1Z8IB 4NIWA 1K2I1 1TQ7B 2LNCA 1TMBH 5HM9A 4JZFH 5EW1H 2G5VA 3W1EA 4MLFB 3MH7A 3SUGA 4TYDA 2TGAA 3NCLA 2GGVB 1YLNA 2NWNA 1NBME 1MH0A 1C5RA 1QIXB 1RIWC 2VINA 3PMJA 5DP4A 3TJOA 3RUOA 4IBLH 2VH0A 2G4TA 3RXIA 3O8RA 1E0FD 1C2LA 1QB1A 1K21H 1OWKA 4QT8C 4IGDA 4UFGH 1V2RT 1SKYE 1YF4A 4K1EA 1P10A 1O5AB 3LGUA 4IC6A 1MMJN 4JMYA 1LTOA 3Q00A 4BOHA 1TOMH 4NG9H 2HVYB 1IHSH 4KTSA 1GBMA 1TYNA 2P59A 3WWBA 1ZMLA 4MPWA 1W0JD 1BTPA 3D23A 4FUEA 3UOUA 1E1QD 5JYIA 1O2QA 2FS9A 1BHXB 3SJOA 4Z1MD 3EE7A 2TBSA 1H1BA 1DOJA 1EFRD 1GHAG 4WVPE 2GD4B 1CQQA 2J98B 1QRZA 3AW1A 4DGJA 1GMHG 1BTZA 1MAXA 3GDSA 1G2LA 1VR1H 5EPNA 1VZQH 1EJNA 3B8JA 4X8UH 2FYQA 2O9QA 2YOLA 2C8WB 3SU1A 2VVCA 3RXDA 5JB9S 2FLBH 1QL7A 2HRVA 2BZAA 2KCOA 3UPEA 2OBQA 3E0NB 3F9GA 1O0DH 2WZQA 1T31A 1FAXA 2OQ5A 3OY6U 2QF5A 2J94A 1GBFA 3KYGA 3T27A 1S6FA 3M3SA 5E8EH 2PTNA 3ENSB 3MNBA 2F4LA 1RS0A 4X1PU 3E90B 2JETC 4B75A 2FI5E 2FIRH 3PMAB 2ZDVH 1PPFE 3RXCA 1IQJA 5JB8S 4DJZB 5LPEA 1GDNA 1BRCE 1C5QA 2FX4A 3SN8A 2BMGB 3EYDA 2VB0A 3R0FA 1BA8B 2WPIS 1TRNA 2PKAB 1IAUA 2QN5T 2GZ9A 2B8OH 4NCYA 3BTTE 1A1RA 5T6DA 4NWLA 2THFB 3NUMA 3A8AA 1IQIA 4AB9A 5T6GA 1G3DA 1TBZH 5EPYA 1HIAB 1O3OA 2VGCC 1TRMA 1OWDA 4BAMB 2FPZA 3FO8D 4WWYA 2PWXA 4WXIA 4B2CA 4ABDA 5FAHA 2JIZD 1YWUA 2GCTB 3AVZA 1FZZA 5JDUB 1XXFA 1CO7E 1D9IA 1UTJA 4ISOA 1DLEA 2H9HA 2ZU4A 1WQVH 3LJOA 1BTWA 4TWYA 2ZU3A 1K1MA 2VIDA 4AFQA 3CNRA 1TOCB 2ESTE 2Y5HA 1V3XA 2QF4A 1KXFA 3E3TA 2J98A 1UCYK 3ZZ6A 1MKWK 1WTGH 1YYY1 2PSXA 2ZHQH 4ABBA 4AYYB 4BAQB 3NXPA 1ZYOA 1O3LA 1OX1A 2UWLA 2XC5A 3SNDA 3F2GA 1K28D 1TLDA 3SNAA 2STBE 4J1YA 2H5CA 4FVDA 4O3TA 2VIVA 1ELBA 1VCQA 1HPGA 1GI5A 5AFYH 4ACAA 3AASA 2XCNA 4Y79A 4DG4A 2Y80A 2D2DA 4Y8XA 1GJ5H 4K8YA 2DE8A 3ITIA 1JXPA 3M5LA 1AHTH 1WUNH 1TIOA 4IW4E 1BTXA 3BIUH 2O8MA 2H2ZA 4X6PA 1ELAA 2AMQA 1O2JA 1AUTC 4X2XA 3E0PB 4TY7A 1OWHA 1J14A 3U9AH 4ESTE 1Z8GA 1ZPBA 2FOMB 3D49H 1LPZB 1O2NA 1AFQC 1OS8A 4FETA 5E0HA 3FN8A 1E38B 3MOCA 8LPRA 2G8TA 1FN6A 2QA9E 1NROH 5DP3A 4YXWD 1D3DB 1VGCB 1P06A 2A4QA 2BY5X 3VGCB 1QR3E 1EQ9A 1SSXA 1GHBF 1KDQA 2UWPA 1FMGA 5CDFE 2FWWA 1H8ED 3IITA 3V0XA 2UWOA 2BYAX 4CBNA 5HYOA 2G00A 1O3CA 1V2KT 3K9XB 4CRFA 1NS3A 4O3UA 4YO9A 3RMLH 3BTGE 3WWFA 3W95A 5CHAB 1Q2WA 3SORA 3ATWA 1NC6A 2PGBB 3SGQE 1P0SH 1TALA 3Q3YA 2GDEH 1W0ZU 1AO5A 3ATLA 3KQBA 2P93A 1AZ8A 3A88A 3SYJA 1PQAA 4CRGA 3OU0A 1GCDA 1S83A 3LC3A 2LPRA 5EQRA 1ZR0A 1O2ZA 3A81A 2VNTA 4YM9A 2AMDA 3TGIE 4INLA 3N7EA 2OK5A 4K1TA 1UVTH 4WY3A 5BPEA 1B7XB 5FBIA 4YTAA 4MPXA 1ZTJA 3TJUA 3OX7U 5GXPA 1WSSH 1P57B 4ISLA 1Q31A 5C20A 3DFLA 1EB1H 1ORFA 5KGOA 5HIYA 1O5EH 2PGQB 3MHWU 1P11E 2ZP0H 6GCHG 2A5AA 2Y82A 2GKVE 1CA0B 1W8BH 4ZROA 4NA7A 7LPRA 1GVKB 1E79D 1HXEH 1BB0B 3SU3A 3GCTF 2NU1E 3BTQE 3H7TA 3VEQB 2PP6A 2VJ1A 2VWNA 3T28A 3SQHE 3BEIB 1GJ7B 3NWUA 1AVGH 5A2MH 1ARCA 3U8RH 2EA3A 1SGFG 1O2HA 1GHAF 1ZLRA 4ISIH 1MCTA 3PV2A 1BCUH 3P8NA 3VB3A 2I6QA 2QCYA 2GTBA 3RU4E 1GPZA 1YPHC 5C3NA 3E8LA 7KMEH 2BX3A 1GI0A 1TPAE 4X2VA 1GMCF 1O2RA 7ESTE 1W11U 2XNIA 3P92A 2CHAC 3M35A 1KMHB 4JYTA 1U6QA 1XVMA 2K0QA 3OEHD 3FP6E 4AGKA 1QRWA 3ESTA 2Z9GA 1FIWA 4XFQA 8ESTE 1EAIA 4U01A 3UR6A 2AS9A 3RXJA 2BOKA 4XD7D 1FUJA 3JZ1B 2VIOA 5GNDA 2ZC9H 3K2UA 3M5MA 1S82A 4DOQA 4E7NA 1PYTD 3VB4A 1O3HA 3UREA 1O30A 5C1UA 1O2WA 3I77A 4ISNA 3U1IB 1TPPA 3SHCH 1H9LB 2R9PA 5EXLA 1G36A 1O3IA 4I8JA 1HXFH 4DT7B 1DY8A 2SGQE 2J4IA 4Q4LA 3M37A 1MABB 3SU2A 1FV9A 1VJ9U 1KTSB 2W5EA 4HG6A 5H4IB 3GYLB 1SQAA 1D3QB 3MU0A 4XE4A 1VKYA 4JZDH 3Q3KA 3HGNA 5FCRA 2AGIX 1RFNA 3LH1A 1NRSH 1HJ8A 1ANBA 3RLYH 1ZRKA 1CU1A 2BD2A 2BDBA 1V2NT 1MBMA 4GLYA 3UNQA 1PQ8A 1S5SA 1SGYE 2ODQA 1Z6JH 3LH3A 3F9EA 1EZQA 1TNHA 1YCPH 2FODA 5CHBA 2Z3CA 2GP9B 1C9TA 3QX5H 4AG2A 4KP0A 5JPMH 1E1RD 1GBTA 1W14U 3HGPA 3ZVEA 4RN6A 1TX8A 1C2IA 4NIYA 3BN9A 3GCOA 1FLEE 3TGJE 4FU9A 4BTTB 4RT1A 3UUZA 2GMTB 2ZFFH 3EE0B 1FPHH 1NU9A 4AYVB 3M3VA 2A4RA 2J95A 2ZF0H 4DCDA 3SV2H 5GDSH 4A92A 4GAWA 4BTIB 1AQ7A 1GI8B 4NZLA 3SV9A 1L1JA 4OM9A 2ILNA 2ZFRH 3PWBA 2BDAA 3E1XB 3OAAD 4YOJA 3MO3A 3TNTA 5SGAE 1PQ5A 1GJCB 3UIRA 3VFEA 5ETXA 3S9CA 1BRAA 3BF6H 2FOAA 1P2JA 5LGOA 1VGCC 3RC5A 2ZPQA 3VGCC 1IQMA 1C4U2 4BAOB 4UD9H 3KHVA 1XXDA 3KQ5A 3NKKA 5E2PA 1A0LA 2FI3E 1C5OH 1YPLH 1UCYE 1CBWB 3LDXH 1DUAA 2W3KA 3IG6B 1AGJA 1SLVB 3UB0A 1A2CH 2PUXB 1C2FA 5FL7D 5CHAC 1F7ZA 2FMJA 3TH3H 1TWXB 2F43B 3BTFE 4Z6AH 3PV4A 1ZGIA 1EAXA 2RFKC 3S7KB 1TMUH 4OGYA 3A7WA 1SGIB 4I8HA 1EAWA 3ZVAA 2BQWB 2BDIA 1M9UA 2K8IA 2ZTXA 1Z6EA 1EAUA 1FY4A 3MQKC 2EEKA 1THPB 1V2PT 4NIVA 4HGCA 1BQYA 4X6MA 1HDTH 1T8LA 1NFWA 2GV7A 1SMFE 2ZHEH 1QL9A 5DK1A 3P17H 3WY8A 1ZHRA 1GHWH 1MQ5A 6GCHF 2IPHA 8GCHF 1XUHA 2SGAA 1CA0C 2XC0A 2KX4A 2TGTA 4Y0ZE 2WV5A 2ZPRA 1O37A 4B2BA 1YPJH 2HNTE 1UJ1A 4BNRA 5L6NH 2WYGA 4X8TH 4CBOA 4I7YH 1O3FA 1F0SA 4DURA 1DWCH 2OP9A 2OD3B 1LHFH 2BLWA 3HK6B 2XC4A 2PLXA 2FOGA 2R0KA 3RXVA 3NZIA 1CE5A 4ABJA 2FDAA 1W3CA 1HAIH 1SGQE 2XWAA 3P8OA 2Y81A 4PROA 3RXTA 5L2ZH 1MTNC 1NFYA 2LELA 2SNVA 2FYRA 4MNWA 4X2YA 3SI4H 4B6FA 1MTUA 1C1VH 2BXUH 3ZVCA 1GMDF 1S81A 2IJOB 1GBEA 2OQUA 1LCYA 1GI4A 2WV4A 4I31A 3V7TA 3MU8A 1NZQH 2AYWA 4AC9A 1GHBG 3OFND 4H42U 1QRXA 2CJIA 5I25A 1SLXB 1TRYA 1GJ9B 1DSTA 2RDEA 2J9NA 4X8VH 1G3EA 3ZZ4A 1FDPA 1QQUA 2OINA 3OY5U 4GUXA 1F0TA 1FY1A 3TU7H 2ZWLH 3MNCA 2OC7A 1ANDA 4UE7H 1OOKB 2WINI 2ZHDA 4K8BA 1UK3A 1L1GA 1D6RA 1OPHB 2FLRH 1AWHB 1C5UA 4IMZA 4IN2A 4Z0KA 3SJ9A 1HAOH 2PW8H 3C1KA 1O5FH 1TNIA 1XUFA 1QCPA 1AZZA 1BMMH 4XRNA 2WPDD 1O3JA 1MTVA 1CGHA 1O5CB 4YZUA 5FBEA 4IC5A 4DY7B 1YP9A 2SGPE 3SW2B 1E34B 1Y3VA 1P9SA 3F9FA 3QZQA 4A6LA 2AHME 2ZCLP 1MBQA 2A2QH 4AZ2B 3RXOA 2R2WU 2BY7X 2KR7A 3MNXA 5C5OA 1S6HA 2J34A 5ESBA 2ZU2A 1ZSJA 3UOPA 3GDUA 1DSUA 2G4UA 2ALVA 1GBCA 1K22H 2BTCE 2ZG0H 1P3EA 2RG3A 2OBOA 1O33A 4XBBA 1SOZA 2DE9A 2F9OA 1GI1A 2FZZA 2BQ6B 1WQSA 3UQVA 2ZGCA 2XTTB 2EC9H 2Z3DA 3GCTG 3RXSA 2JJ2D 3A83A 1O31A 1Y3UA 9ESTA 2PV9B 4CREA 3GISB 1O2LA 1UTPA 3P6ZB 1UK2A 2HPQH 1V6DA 2FXRA 1VCWA 3VB6A 5C2ZA 1E36B 1UVUH 1MTWA 5KEDA 1C1NA 2CXVA 3GS9A 3RXUA 1AKSB 2QYIA 3PYHA 5A09A 1EPTB 1UTOA 2A7CA 4AFZA 1Y3YA 1CA8B 1TAWA 1MCVA 3FVFB 4YLQH 4B2AA 2GMTC 1OSSA 3EAJA 1IHTH 5IDKA 2BVSH 4AORA 4MPUA 1QJ6B 1J16A 4UONA 4TPIZ 1P2MA 5DG6A 4U32A 2R3YA 4WXVA 1P04A 1EP5A 1GMCG 1C5LH 1SQRA 5EG4A 3RC6A 3F3BA 5GIBA 3M5NA 2CHAB 4B6EA 3FANA 1P9UA 1BMAA 3QGJA 3DSGA 1BRBE 1GI2A 2QF0A 5IK2D 5GWZA 2QIQA 1P2KA 1W7GH 2P3FH 5AF9H 1P05A 1BHXF 1TBQH 2QGRA 5LPRA 1GL1A 2B7DH 1C1PA 2ZGHA 1T7CA 2OXSA 2P3UB 4OS1A 1P02A 3LONA 1O3DA 2J2UA 1ELFA 1OYQA 1IQKA 1CGJE 1C5PA 2YMSD 4ABAA 4OS2A 3KEEA 1CBWC 3ZZAA 1PFXC 1EOLA 2WHXA 8KME2 1AI8H 1LQDB 2VIWA 1QJ1B 1AFEH 1YCPK 2G52A 1ZPZA 2H9TH 2VVUA 5HIZA 3BTWE 6CHAB 3AAUA 1SGRE 1G9IE 4ZHMU 3V13A 1FPCH 4XBDA 1DANH 4TWWA 1MZAA 1ZSLA 3ZZ9A 1LVOA 2BB4A 4AX9H 3UTUH 5DN6D 5TJXA 2BZ6H 2XW9A 4H6SB 3P70B 3M7TA 5G4BA 1F5LA 1LQEA 3ZYEA 1GHXH 4X6NA 1OWEA 1GI6A 1EXFA 1TABE 4XOJA 1SGNE 2R0LA 2BD9A 1LPKB 3FZDA 1PPHE 2NU2E 2WSSD 3H7OA 4KTUA 1AKSA 1EPTA 1S6LA 2FOBA 1K1OA 3EDXB 1FI8A 1DICA 2QE7D 2K1QA 2KAIB 4Y7AA 1CHOG 1TNKA 3OTJE 4FXGH 3STIA 3MTYA 4E05H 2V0BA 2FO9A 1EUFA 4JYVH 4YLUA 2ZHFH 2A5KA 1GHVH 1C2DA 1C5ZB 2OC0A 4AB8A 2ZDAH 2BD7A 1HAXB 3LT3A 2JH6D 2C8YB 1A0HB 3RDZA 1F0RA 4SGAE 1QY6A 1HAPH 2D1JA 1C2GA 4A1VA 1AMHA 2GDDA 5CE1A 3KIDU 3BEFB 1TGBA 1JIRA 2HPPH 2P3TB 1BMNH 1KSNA 5A0BA 1BBRH 1J17T 1O5DH 2OLGA 1NFUA 2BY9X 4FUJA 2ZU5A 2AFQB 1O34A 1Y5UT 3S7HB 1K1NA 2FP7B 3URCA 4K60A 2SGDE 2XWBI 2JDID 1FX0B 3PWCA 2GZ7A 2BDYA 2ZHWH 2PKAA 4LK4A 3A8CA 3BTME 2UUJB 4F49A 1BT7A 4BANB 3LPRA 1XM1A 4I33A 1WU1A 2ODYB 4NGAH 1UVPA 3ATMA 4ZKOU 3SU0A 3PRBA 3RXAA 3UNRA 3F2FA 4K1SA 3FFGA 2H9EH 3FP8E 2G51A 1DE7H 3A7XA 4ISHH 1HIAA 1X7AC 3KN2A 1ARBA 3PTNA 3L3TA 4ZKRU 1QFKH 2SNWA 1C5XB 5J4SA 1SPJA 5L2YH 3TPIZ 1JBUH 1MZDA 1N8OB 2ZDMA 5IYTA 4E7RG 1DXWA 3B23B 1BJUA 5GPIB 1GJ4H 1E37B 1HV7A 3HPTB 1K1JA 2QXHA 3KNXA 1KXEA 1ZTLA 3ZZ5A 2VWMA 2JH0D 1CSOE 4B76A 3BTKE 4WH8A 2YNBA 3L6PA 2FI4E 2UUFB 1C2HA 2GZ8A 3BG8A 1OP0A 1BTHH 1FXYA 1DWEH 2ZCKP 1Z8JB 3H09A 3A87A 1RD3B 4THNH 1NN6A 3SOSA 1UMAH 1ZMNA 1SL3A 1TONA 1HAHH 2KAIA 2LP6A 1OP2A 1HRTH 3A7VA 5EQQA 1A5HA 1GBIA 1EOJA 1JIMA 4AFUA 2J97A 3SZEA 2C8XB 2H1UA 8GCHG 3M7UA 3RMMH 2A7JA 1KLTA 4ABHA 1XMNB 3WW7A 2ZPSA 3ATIA 5I46H 3ZV9A 1GJ8B 3GY5A 3P95A 3PLKA 1EJMA 1NRNH 2G5NA 1V2VT 3M61U 1MD7A 1OP8A 3ZZCA 4NFFA 1O2GH 1Y5AT 3PB1E 3MH4A 1HNEE 2KM0A 1C4V2 1EPTC 3RLWH 2Q6DA 2UUYA 1TA6A 1ID5H 5EIYA 2ZTZA 3RMNH 1MTNB 1G3BA 2H5DA 3CS0A 1KLIH 1Z8RA 1UTLM 1VJAU 2WPMS 2AEIH 1TMTH 4F48B 1GMDG 5FHTA 2XBYA 2Q6FA 2ZQ1A 3TJVA 3ELAH 3ATKA 4B1TA 1G32B 2P16A 1O3NA 2IN2A 1P01A 5E2OA 1G30B 1XKBC 4MNXA 4MQAA 5FX5A 2FOEA 3AW0A 2OC8A 1TGTA 1ELDE 1YLDA 1YPEH 1V2WT 3UY9A 1XUKA 2PR3A 3P8GA 1DX5M 3ZZ3A 2Y7XA 2BD5A 1JWTA 1WAYB 3QDZB 2HVXA 1W10U 3MU1A 1O3GA 2HLCA 2A32A 2NU3E 1N6YA 2ZEBA 2W7SA 1O5BB 1MUEB 1P2IA 2XBXA 2ALPA 2Y5GA 1O5GH 3RMOH 1SVPA 5C1XA 2Z9JA 1F92A 2ZGBH 5F8XA 3FZZA 3PROA 1WDIA 1AB9B 5F53A 2CK3D 3GOVB 3U8TH 3MH5A 3MWIU 1DPOA 1BDAA 1YLCA 4X1RU 5FX6A 1C1MA 2FTLE 4FUGA 4FU7A 3UWJH 1O3BA 3BTHE 6CHAC 1V2MT 3QO6A 2VU8E 1C1QA 1CT2E 5ESTE 4WF8A 4AFSA 2F9UA 2D26C 1EZSC 2JH5D 4VGCC 1OHHD 3OE7D 1QZ8A 1W7XH 2QF3A 5EJZA 2Z7FE 1DUEA 3KYFA 3RXHA 1GHYH 1QTFA 2ZECA 1G3CA 1L2EA 1GBBA 5JBBS 4TY6A 1ETSH 3O8BA 4FU8A 4XSKU 4DW2U 1CVWH 1ELVA 2EI7A 3BV9B 2PKSC 1ABIH 1AD8H 4D8NA 1H9HE 2IJD1 1PPZA 1KY9A 2VH6A 4ZAEA 5EW2H 4JCNA 2ZGJA 3RU4T 1SGTA 1CHOF 3FKSD 1NT1A 1O32A 4YESB 1MQ6A 4NIXA 2B9LA 2XCFA 3ZZ8A 2WUCA 1DDJA 1ZPCA 1O2MA 2AIPA 3T2NA 1PQ7A 3MFJA 2QXGA 3UNSA 4RKJB 1GVLA 4ZXYH 1WYKA 4NA9H 4ABGA 3VPKA 2FOHA 1HB0B 4I8GA 4K5ZA 2Z9IA 4Y11E 2K7XA 1GJDB 4IS5A 1YC0A 1SR5C 2KFWA 1C1RA 1T8OA 1UCYH 4MDSA 9LPRA 1DWBH 3LGVA 1BTUA 3BTDE 1Z1IA 1GBAA 4CR9A 3MU5A 1DM4B 4X6OA 1WV7H 2XBVA 4YOIA 1TA2A 1Q3XA 2Z6BD 2QAAA 5EJLA 1SOTA 1EB2A 5TCAA 1FY5A 3SV6A 1N8OC 1INCA 1D3PB 4D9QA 3U1JB 2C3SA 3VB7A 2QV1A 1BTYA 1WXRA 2XOKD 1VCPA 2A7HA 2W6ID 4R0IA 1ZSKA 1O3AA 3A80A 5FPYA 1HAVB 1PPGE 5E0GA 4U2WA 1LHDH 1CGIE 4RSPA 4XBCA 5HM2A 1SFQB 4BAKB 1SBWA 2CMYA 3GY7A 4X1SU 3A7YA 2M2AA 1ZZZA 3RM0H 2HALA 1P8VC 2F91A 3F2HA 2D8WA 2W26A 4A5TS 2G55A 2SGEE 3DFJA 3RC4A 4KGAA 1CT0E 3K65B 2F9NA 3TNSA 1PPCE 1VITF 2Z9LA 1ANEA 1BBRK 3GCNA 4O03A 2ZDLA 3Q76A 1FQ3A 4Q7YA 1TX7A 4UFEH 1Z7KA 2F83A 1H8DH 1XUJA 1AN1E 1O2SA 1CT4E 3SJIA 1FY3A 4AN7A 5EU8A 2Y7ZA 1QA0A 4FUIA 4GSOA 3DSPA 3TIUA 4JZEH 1KXBA 4ASHA 3RXKA 2TGDA 1QBOA 3MU4A 1P3CA 3SV8A 1HAYB 1V2UT 2HWLB 1C2JA 4Y71A 4O9VA 3T25A 2I6SA 1P03A 2QXJA 5AFZH 1N6XA 3GCHB 1J9CH 3E6PH 4CRAA 2LIZA 1GWAA 1Y3WA 3RXPA 3STJA 4ASUD 4UDWH 1H4WA 2XYAA 1YM0A 5AHGH 1N1LA 3OYPA 2BHGA 3B9FH 3T29A 2WPJS 5C17A 2QC2A 3DT0H 4WMEA 1COWD 1NESE 2M5TA 2ZO3H 3GY8A 2ULLA 1C1SA 5B6OA 1TB6H 1ZJKA 2BM2A 3LOXA 2HNTC 3M5OA 3LGWA 1A3BH 2ODPA 3I78A 2V35A 4X8SH 2QY0B 4TT3D 3RXBA 1DT2A 4H6TA 3V12A 1D4PB 1B5GH 3U69H 2VBCA 2BX4A 1Y3XA 1T32A 1QJ7B 3MI4A 4AOQA 2A31A 4D7GA 3TLOA 4B73A 1IQEA 7GCHG 1BMLA 5DKMA 1HAVA 1LHEH 4FVBA 5F03A 2GT7A 4ABEA 1V2QT 4FUCA 1V2OT 1L1NA 2PSYA 1AB9C 1AE5A 3A7TA 1K1IA 1BJVA 1WCZA 3SV7A 1ZHMA 1J15A 2HOBA 4JK6A 3BIVH 1C2KA 4HI3A 3A89A 3LGYA 2C93B 3DSOA 1KTTB 1TNJA 2W7UA 3VB5A 2PFEA 1UTMA 3BTEE 1UVSH 3SNEA 1THRH 3AAVA 3E16B 1O39A 1SGFA 2A0QB 3QGNB 4X1NU 1XX9A 1IQGA 1H8HD 4LZ4B 4BTUB 3DHKH 2ZA5A 1PYTC 2RCEA 1BUIA 1YPKH 3HKJB 4OS4A 1O2PA 3UR9A 3RXEA 3A8BA 1S0RA 5J4QA 2VVVA 4NA8A 3KF2A 3QLPH 1K0HA 1JRSA 3SJ8A 1LDTT 3ZYDA 1O3KA 3PLPA 2A4OA 1P2NA 2OCVB 4DIHH 1ZHPA 3SU6A 1W13U 1MU6B 2VWOA 3GY2A 1LO6A 3SU4A 4LXBH 1O2TA 4GCHG 5T1VA 2OC1A 2A5IA 1A46H 3SI3H 2BD8A 3A82A 1MD8A 3C27B 4ABIA 4ZH8A 2ZNKH 2CF8H 3ZVGA 1QHRB 2B5TB 1GGDB 5EODA 2ZQ2A 1KLJH 1VITH 1AUJA 5C0TA 2O8LA 2AGEX 1C1TA 5DP6A 2ZI2H 2Z3EA 3TJNA 1QNJA 3S9BA 3U98H 1O35A 1F0UA 2FTMA 3KQDA 3RXQA 1NRQH 3RM2H 4Q63A 3RXMA 4RI0A 2BLOA 5FCKA 4CH8B 1RJXB 1SC8U 3GY3A 1RTLA 3BSQA 2J5UA 5FPTA 1A4WH 1SHYA 3KQCA 3RU4D 1H8IH 4F4OC 1MAYA 1ESBA 2ZZUH 1T8MA 1S84A 2VWLA 1SFIA 3URDA 3PMHB 1SGCA 1C5VA 2BD4A 2IOTA 3RXLA 3LKWA 1B0FA 1EZUC 4SGBE 5A8YA 4OS7A 3MO6A 1WBGB 1LHGH 3EBNA 3ZZDA 2F9VA 5HGGA 2ZTYA 4NSVA 4WJG2 3DUXH 3PTBA 1HJAB 2ZDKA 3R3GB 1AWFH 1A0JA 3A7ZA 1YGCH 1A5IA 2AIQA 1XUGA 4VGCB 3RXFA 1KDQB 5B6LA 4ZXXH 3CS7A 3PRDA 3U8OH 3TK9A 1TGCA 1Z71A 2YMSB 1OYTH 3PLBA 4TPYA 4DIIH 1YBWA 1E35B 5GCHF 1GI7B 1SB1H 2STAE
chains in the Genus database with same CATH topology
2AH4X 4Y7BA 3TK5A 3MMGA 1QBVH 1IQFA 2PKSB 4KKDA 1BZXE 2RA3A 2P8OB 4CHAB 4K3JA 3RP2A 4ZHLU 1F5RA 1RRKA 1RTKA 3EA7A 3SUDA 4OS5A 1ACBE 4JK5A 1OKXA 1OWJA 1TPSA 2RDLA 4XDEA 3BG4B 1GBDA 1O2IA 1GBKA 1C1OA 1GCTB 4JZIA 1TGSZ 3ZZ7A 5E0JA 1EX3A 1Y59T 4X1QU 3S9AA 2V3HH 2A4GA 1HLTH 1GVZA 2CGAA 3VXEH 5JBTA 3GCHC 1JRTA 1B0EA 3CP7A 5BRRE 3L33A 3PO1B 1D3TB 1O38A 1T8NA 1UTNA 1C4Y2 2PTCE 1C5WB 2SFAA 1F5KU 1O2YA 4X0WU 1DY9A 5LH8A 1FAKH 2GCHF 2EI6A 1QURH 1QGFA 3EA9A 1NO9H 1KXDA 2TIOA 1KIGH 1C5YB 1UVOA 3A84A 3CENA 1P09A 2C8ZB 1GBHA 3M7QA 1ZTKA 4Q7ZA 3W94A 1S85A 4DVAU 3F1SB 2WPKS 3LJJA 1BBRE 2V3OH 4FUFA 1DLKB 2FESH 1GBLA 7GCHF 4Y8ZA 2WPLS 2AMPA 2V6NA 5GJ4B 4RKOB 1Z1JA 3LU9B 1V2JT 2BY8X 1FN8A 2ZIQH 3FP7E 5EGMA 1YKTA 3QWCH 1MKXH 2P94A 2VIQA 4BXSA 3HATH 1EATA 1G2MA 1A3EH 1LVBA 1MU8B 3QZRA 1ELEE 4FUBA 3GYMA 1YCPM 1BITA 1O3PB 2R3UA 5DJ7A 2CF9H 1QL8A 5DP9A 1XKAC 1IQHA 1P12E 5LPFA 1VITG 1ETRH 2FOFA 4NSYA 1HAGE 1XUIA 1WOFA 1DXPA 1C1UH 2HGTH 5DP7A 4CRCA 1GI3A 6ESTA 5PTPA 3A85A 1P2OA 3SQEE 3EA8A 1Y5BT 2F3CE 1T4UH 2DUCA 1UK4A 2ANMH 1SGDE 2EI8A 1YPHE 1SLWB 3Q3XA 4BAHB 1K9OE 2ZFSA 2SGFE 1C5NH 1AVXA 1UHBB 2R2MB 1L4ZA 5C5NA 3HKIB 4GCHF 1FJSA 1H9IE 1OXGA 4JZ1A 5AVDA 2ANWA 4FUHA 3TH4H 2TGPZ 5L30H 1JOUB 2J38A 1GI9B 4B71A 3TITA 1GGDC 4BXWA 2O8WA 1ABJH 1O2VA 3RXRA 1O3MA 1SGEE 4X2WA 5EXMA 3PMBB 4YT6H 5C67A 1YPGH 5JBAS 1K1PA 3SGAE 2ZU1A 1UTQA 1DS2E 3DA9B 1GMHF 1LVYA 2PUQH 3EGKH 2VIPA 3HK3B 3S69A 1NRRH 3OSYA 2ZFTA 2GX4A 2CN0H 1AY6H 4R8TB 3QTVH 1C5MD 1BRUP 1GG6B 2CV3A 4KELA 3G01A 4AG1A 2Q6GA 1ZMJA 2A1DB 3D65E 3EQ0H 3M3TA 3PM3A 3ZVFA 2FEQH 4KTCA 4B74A 4UEHH 1NU7B 1TBRH 4GHTA 5ABWA 2Y5FA 2Z9KA 4WMFA 4IMQA 4LOYH 1Y8TA 2C4FH 2BDHA 4D76A 3TH2H 3RXGA 1O36A 4H4FA 2PHBA 4ZMAH 1HJAC 4INHA 3P8FA 1WTHD 1D6WA 2O8TA 1S0QA 2HNTF 3GICB 3MNSA 4M7GA 1O2OA 4K2YA 4I8KA 1BIOA 2ZFQH 1RTFB 4Q7XA 3SO3A 3FAOA 4MTBA 3K6ZA 1V2ST 1O3EA 4A7IB 4NZQA 1HYLA 5K7RA 1ETTH 3I29A 4HFPB 1DITH 1C2MA 1LKBA 5A8XA 3ZZBA 2J92A 5EQSA 1RIWB 1QB6A 1EKBB 2G81E 1DWDH 2OTVA 2XBWA 1UHBA 3SU5A 3IWMA 1L4DA 2GCTC 4HTCH 2NU0E 4MPVA 5T3HA 1QBNA 4MNYA 2P8OC 3M36A 4CHAC 3VXFH 4HZHA 3A8DA 5CMXH 1ESAA 3T5FH 4O97A 1A5GH 1TQ0B 3KGPA 4WH6A 4YT7H 5DGJA 4A1XA 1TNGA 1GDQA 2GVFA 4CRDA 2H6MA 1C2EA 4UFFH 4Y8YA 4E06H 3K6YA 1C1WH 3BG4C 3KL6A 1DFPA 1GCTC 1TPOA 4NWKA 3SUEA 1LKAA 1DVAH 2UUKB 5EOKA 1QQ4A 2ANYA 3MH6A 4GPGA 4NFEA 1FIZA 5HMAA 1KXAA 3Q77A 2JKHA 3MO9A 1GHZA 2Q1JA 3KQEA 4J2YB 1J8AA 1ZRBA 4INKA 1ZJDA 2A2XH 5A0AE 1C5TA 1ELGA 3TK6A 5C1YA 5DPAA 3SHAH 1XVOA 3SGBE 2BLQA 1GJ6A 1C5SA 3PO1C 2AGGX 2FX6A 1ELTA 5FPSA 1TNLA 4ZHAA 4D7FA 2BLVA 4ZKNU 1THSH 1JMOH 5A0CA 1MKWH 1YPMH 4D9RA 1RGQA 3LIWA 1PPEE 1FY8E 1GDUA 3LGIA 3QN7A 3QUMP 2JETB 1GBJA 4Q80A 4A1TA 1LPGB 1TGNA 1MTSA 1SLUB 5DP8A 2YNAA 1NY22 3D62A 2BOHB 3O8DA 2BVXH 3SUFA 2ANKH 1FNIA 2P95A 4CH2B 1GJBB 5HXFA 1IQNA 1TFXA 1W12U 4K69A 5EXNA 2NU4E 2F9PA 4U30A 3KCGH 1OWIA 1KYNA 5T6FA 3N7OA 1LMWB 1SQOA 2ZKSA 3SJKA 1L0ZA 1UO6A 4CR5A 2TPIZ 2FOCA 4Y0YE 5DP5A 1NRPH 2BVRH 3DD2H 5JBCS 1NTPA 2ZDNA 3F68H 3E91A 2W3IA 5GCHG 1W2KH 3T62A 2VGCB 2BY6X 2OUAA 3LC5A 4I8LA 5K0HA 1QB9A 3MYWA 4YOGA 1P2QA 1PPBH 1ESTA 1HJ9A 2GT8A 1UTKA 3LGTA 4ZKSU 3O8CA 3F9HA 2WUBA 4CRBA 5F6MA 3S0NA 2Z94A 1EJAA 2GV6A 1SG8B 4Y76A 2BQ7B 2QXIA 1HGTH 4IN1A 1O2KA 2TRMA 1C9PA 1SI5H 4OS6A 1SHHB 1AVWA 1LHCH 5TCCA 4MVNA 3NPSA 5F8TA 1ZOMA 3GDVA 1ELCA 2Y6TA 3ODDA 2F9BH 1O2XA 3F6UH 5FXLA 4JYUH 2A45B 3GY6A 3SNCA 2WYJA 3H5CB 2B0FA 4I32A 2BD3A 1T4VH 2XRCA 1O2UA 1CHGA 4WMDA 2BDCA 1V2LT 1AE8H 1HCGA 4ZUHA 1LVMA 1TX6A 1V2TT 1AU8A 1K1LA 1NM6A 3A86A 1F2SE 4ABFA 2AERH 4AGJA 1IOEA 4UFDH 2WPHS 3V3MA 1TE0A 1SGPE 1IQLA 6LPRA 1EASA 1QA7A 1KXCA 3SBKA 4Y10E 3UFAA 3TGKE 4MG3A 1GL0E 2GCHG 1EP6A 3UWIA 3SZNA 1HUTH 2ZFPH 2C90B 1HBTH 2ZGXH 3QTOH 1AFQB 3T26A 1FONA 4Q2KA 1MKXK 3ZVBA 2ASUB 4LZ1H 3QK1A 3BEUA 1GG6C 1W0YH 4GHQA 3ZVDA 1ANCA 1SQTA 4Y6DA 4OGXA 1G37A 4GVUA 1EZXC 1HAZB 4FUDA 5DO4H 3GY4A 1A61H 1ZGVA 1AIXH 3UQOA 1NPMA 2BXTH 2FS8A 1NFXA 3ODFA 2BDGA 1HFDA 2ZCHP 1GJAB 3ZV8A 3SNBA 4MNVA 1RXPA 1A7SA 5A8ZA 3JZ2B 1BOQA 2RA0A 5F8ZA 2O8UA 1PJPA 2FM2A 3NK8A 3TVJB 2XXLA 1Z8IB 4NIWA 1K2I1 1TQ7B 2LNCA 1TMBH 5HM9A 4JZFH 5EW1H 2G5VA 4MLFB 3MH7A 3SUGA 4TYDA 2TGAA 3NCLA 2GGVB 2NWNA 1QIXB 1MH0A 1C5RA 1RIWC 2VINA 3PMJA 5DP4A 3TJOA 3RUOA 4IBLH 2VH0A 2G4TA 3RXIA 3O8RA 1E0FD 1C2LA 1QB1A 1K21H 1OWKA 4QT8C 4IGDA 4UFGH 1V2RT 1YF4A 4K1EA 1P10A 1O5AB 3LGUA 4IC6A 1MMJN 4JMYA 1LTOA 3Q00A 4BOHA 1TOMH 4NG9H 1IHSH 4KTSA 1GBMA 1TYNA 2P59A 1ZMLA 4MPWA 1BTPA 3D23A 4FUEA 3UOUA 5JYIA 1O2QA 2FS9A 1BHXB 3SJOA 2TBSA 1H1BA 1DOJA 1GHAG 4WVPE 2GD4B 1CQQA 1QRZA 3AW1A 4DGJA 1GMHG 1BTZA 1MAXA 3GDSA 1G2LA 1VR1H 5EPNA 1VZQH 1EJNA 3B8JA 4X8UH 2FYQA 2O9QA 2YOLA 2C8WB 3SU1A 2VVCA 3RXDA 5JB9S 2FLBH 1QL7A 2HRVA 2BZAA 3UPEA 2OBQA 3E0NB 3F9GA 1O0DH 1T31A 1FAXA 2OQ5A 3OY6U 2J94A 1GBFA 3T27A 1S6FA 3M3SA 5E8EH 2PTNA 3ENSB 3MNBA 1RS0A 4X1PU 3E90B 2JETC 4B75A 2FI5E 2FIRH 3PMAB 2ZDVH 1PPFE 3RXCA 1IQJA 5JB8S 4DJZB 5LPEA 1GDNA 1BRCE 1C5QA 2FX4A 3SN8A 2BMGB 3EYDA 2VB0A 3R0FA 1BA8B 2WPIS 1TRNA 2PKAB 1IAUA 2QN5T 2GZ9A 2B8OH 4NCYA 3BTTE 1A1RA 5T6DA 4NWLA 2THFB 3NUMA 3A8AA 1IQIA 4AB9A 5T6GA 1G3DA 1TBZH 5EPYA 1HIAB 1O3OA 2VGCC 1TRMA 1OWDA 4BAMB 2FPZA 4WWYA 2PWXA 4WXIA 4B2CA 4ABDA 5FAHA 2GCTB 3AVZA 1FZZA 5JDUB 1XXFA 1CO7E 1D9IA 1UTJA 4ISOA 1DLEA 2H9HA 2ZU4A 1WQVH 3LJOA 1BTWA 4TWYA 2ZU3A 1K1MA 2VIDA 4AFQA 1TOCB 2ESTE 2Y5HA 1V3XA 1KXFA 3E3TA 1UCYK 3ZZ6A 1MKWK 1WTGH 1YYY1 2PSXA 2ZHQH 4ABBA 4AYYB 4BAQB 3NXPA 1ZYOA 1O3LA 1OX1A 2UWLA 2XC5A 3SNDA 1K28D 1TLDA 3SNAA 2STBE 4J1YA 2H5CA 4FVDA 4O3TA 2VIVA 1ELBA 1VCQA 1HPGA 1GI5A 5AFYH 3AASA 2XCNA 4Y79A 4DG4A 2Y80A 2D2DA 4Y8XA 1GJ5H 4K8YA 2DE8A 3ITIA 1JXPA 3M5LA 1AHTH 1WUNH 1TIOA 4IW4E 1BTXA 3BIUH 2O8MA 2H2ZA 4X6PA 1ELAA 2AMQA 1O2JA 1AUTC 4X2XA 3E0PB 4TY7A 1OWHA 1J14A 3U9AH 4ESTE 1Z8GA 1ZPBA 2FOMB 3D49H 1LPZB 1O2NA 1AFQC 1OS8A 5E0HA 1E38B 3MOCA 8LPRA 2G8TA 1FN6A 2QA9E 1NROH 5DP3A 1D3DB 1VGCB 1P06A 2A4QA 2BY5X 3VGCB 1QR3E 1EQ9A 1SSXA 1GHBF 1KDQA 2UWPA 1FMGA 2FWWA 3IITA 3V0XA 2UWOA 2BYAX 4CBNA 5HYOA 2G00A 1O3CA 1V2KT 3K9XB 4CRFA 1NS3A 4O3UA 4YO9A 3RMLH 3BTGE 3W95A 5CHAB 1Q2WA 3SORA 3ATWA 1NC6A 2PGBB 3SGQE 1P0SH 1TALA 3Q3YA 2GDEH 1W0ZU 1AO5A 3ATLA 3KQBA 2P93A 1AZ8A 3A88A 1PQAA 4CRGA 3OU0A 1GCDA 1S83A 3LC3A 2LPRA 5EQRA 1ZR0A 1O2ZA 3A81A 2VNTA 4YM9A 2AMDA 3TGIE 4INLA 4K1TA 1UVTH 4WY3A 5BPEA 1B7XB 5FBIA 4YTAA 4MPXA 1ZTJA 3TJUA 3OX7U 5GXPA 1WSSH 1P57B 4ISLA 1Q31A 5C20A 3DFLA 1EB1H 1ORFA 1O5EH 2PGQB 3MHWU 1P11E 2ZP0H 6GCHG 2A5AA 2Y82A 2GKVE 1CA0B 1W8BH 4ZROA 4NA7A 7LPRA 1GVKB 1HXEH 3SU3A 1BB0B 3GCTF 2NU1E 3BTQE 3H7TA 3VEQB 2VJ1A 2VWNA 3T28A 3SQHE 3BEIB 1GJ7B 3NWUA 1AVGH 5A2MH 1ARCA 3U8RH 2EA3A 1SGFG 1O2HA 1GHAF 1ZLRA 4ISIH 1MCTA 1BCUH 3P8NA 3VB3A 2I6QA 2QCYA 2GTBA 3RU4E 1GPZA 1YPHC 5C3NA 3E8LA 7KMEH 2BX3A 1GI0A 1TPAE 4X2VA 1GMCF 1O2RA 7ESTE 1W11U 2XNIA 3P92A 2CHAC 3M35A 4JYTA 1U6QA 1XVMA 3FP6E 4AGKA 1QRWA 3ESTA 2Z9GA 1FIWA 4XFQA 8ESTE 1EAIA 4U01A 3UR6A 2AS9A 3RXJA 2BOKA 1FUJA 3JZ1B 2VIOA 2ZC9H 3K2UA 3M5MA 1S82A 4DOQA 4E7NA 1PYTD 3VB4A 1O3HA 3UREA 1O30A 5C1UA 1O2WA 3I77A 4ISNA 3U1IB 1TPPA 3SHCH 1H9LB 2R9PA 5EXLA 1G36A 1O3IA 4I8JA 1HXFH 4DT7B 1DY8A 2SGQE 2J4IA 3M37A 3SU2A 1FV9A 1VJ9U 1KTSB 2W5EA 5H4IB 3GYLB 1SQAA 1D3QB 3MU0A 4XE4A 4JZDH 3Q3KA 3HGNA 5FCRA 2AGIX 1RFNA 3LH1A 1NRSH 1HJ8A 1ANBA 3RLYH 1ZRKA 1CU1A 2BD2A 2BDBA 1V2NT 1MBMA 4GLYA 3UNQA 1PQ8A 1S5SA 1SGYE 2ODQA 1Z6JH 3LH3A 3F9EA 1EZQA 1TNHA 1YCPH 2FODA 2Z3CA 2GP9B 1C9TA 3QX5H 4AG2A 4KP0A 5JPMH 1GBTA 1W14U 3HGPA 3ZVEA 4RN6A 1TX8A 1C2IA 4NIYA 3BN9A 3GCOA 1FLEE 3TGJE 4FU9A 4BTTB 3UUZA 2GMTB 2ZFFH 3EE0B 1FPHH 1NU9A 4AYVB 3M3VA 2A4RA 2J95A 2ZF0H 4DCDA 3SV2H 5GDSH 4A92A 4GAWA 4BTIB 1AQ7A 1GI8B 4NZLA 3SV9A 1L1JA 2ILNA 2ZFRH 3PWBA 2BDAA 3E1XB 4YOJA 3MO3A 3TNTA 5SGAE 1PQ5A 1GJCB 3UIRA 3VFEA 5ETXA 3S9CA 1BRAA 3BF6H 2FOAA 1P2JA 5LGOA 1VGCC 3RC5A 2ZPQA