5C3NA

Crystal structure of mers coronavirus main protease in spacegroup c2221
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
301
structure length
301
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a protein
publication title Critical Assessment of the Important Residues Involved in the Dimerization and Catalysis of MERS Coronavirus Main Protease.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 69
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5c3nA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c3nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c3nA02
4FUEA 2ZWLH 3STJA 4O3TA 1HJ8A 3LGYA 1P02A 1LKBA 1EATA 3KQDA 2GT7A 3RXUA 4CBOA 3SOSA 1ZJKA 1QJ6B 2HVXA 1V2UT 3E6PH 3M3VA 2B7DH 3SUGA 2RA0A 2PSYA 4J2YB 3RXKA 1GI4A 2PGQB 4R0IA 3TNSA 3U8TH 1HB0B 1AY6H 1L4ZA 2DE8A 3A88A 2G5NA 1NFUA 1SGRE 2BTCE 3PLPA 1TQ7B 2G55A 1C2LA 1SHHB 1TNLA 4ZH8A 2ULLA 1AMHA 2JH5D 1QL8A 1G3CA 5DP8A 2A7CA 1DOJA 3DHKH 1LPKB 3SNAA 4Y8ZA 3V0XA 2O9QA 4FUFA 1OXGA 4INKA 2NU1E 2J2UA 3H7OA 5A8YA 1H4WA 1LHDH 4JMYA 1L4DA 1QRXA 3URCA 1O33A 2KAIB 1DSUA 2ALPA 3EBNA 4RSPA 3HK6B 1TFXA 2BOKA 1O2YA 1Y3UA 3BIUH 1DY9A 1ZGVA 4CRBA 3M5MA 5FHTA 1WQVH 3S9BA 3SU6A 4B71A 4WH6A 2EI6A 4J1YA 1C9TA 1GI1A 1Q31A 2WV4A 4A1VA 1Y5UT 3TU7H 1NFYA 1CSOE 2BD4A 1VGCC 2ZFRH 5GCHG 1QQUA 2FOGA 3RXAA 1QB1A 4O03A 1LTOA 1TX8A 1Y59T 1AN1E 1KY9A 3E1XB 2PKSC 4BOHA 1SGTA 3UNQA 4RN6A 5JBBS 1DITH 1V2NT 1TNJA 3FVFB 1EAXA 3IITA 2Y5FA 5LGOA 4LOYH 2F9BH 2SGQE 2RCEA 4Y0ZE 1AI8H 4MNWA 3RLWH 5C67A 1HAIH 2C4FH 1L1GA 1VJAU 3AAUA 4NWKA 1UK3A 2BY9X 1F5KU 2QN5T 2UUYA 1WOFA 1PPFE 2HALA 4ABFA 3BG8A 2P3TB 1GBDA 2H5CA 2G5VA 1ID5H 1QTFA 1M9UA 5HM2A 1HAZB 2PFEA 1NFWA 4MVNA 1UHBB 4ASHA 2W7SA 3RXCA 2BDGA 1EQ9A 2NWNA 4ZKNU 4WXIA 3Q3XA 3M3SA 1CGHA 5C3NA 3SO3A 1GDNA 1P2NA 2QXHA 1J8AA 2AEIH 2A32A 4ZUHA 8ESTE 1OOKB 5E2PA 4CR5A 2ZPRA 1DXWA 4B73A 4BAKB 1GJ6A 6CHAB 1GMHF 1FLEE 2FOFA 2O8LA 3ZZCA 1Y5BT 1SHYA 1LVBA 1FPCH 3M61U 3RXIA 1O3KA 2OUAA 4ABGA 1SMFE 7GCHF 2ZC9H 1BMNH 1OWDA 1XUIA 2TGAA 1O2NA 3BTQE 3LH3A 4XDEA 3BSQA 4YOIA 4U30A 1P2JA 3NXPA 2P3FH 1RD3B 4O9VA 1RXPA 2LIZA 3GY2A 1MBQA 4Y0YE 1NT1A 1V2VT 1BBRE 2QV1A 3MYWA 5EXNA 3HGNA 1P11E 1PPGE 1ESTA 1GJ4H 3RXPA 5A0BA 1BTYA 2GP9B 3UPEA 1XVOA 4ZXXH 5EU8A 1BQYA 5FPYA 1AKSA 3H5CB 3BG4B 1GVKB 1UK4A 2ZFPH 5E8EH 1DWBH 4UEHH 3G01A 3PMAB 2NU4E 2D2DA 2FI4E 5JB9S 3A7ZA 3D65E 1JIMA 1E34B 1VCWA 1UK2A 4XOJA 1ZLRA 1BTHH 1RTKA 4I7YH 2BD2A 4AFQA 1TRMA 3FANA 4FUJA 1PPEE 1O2UA 2VNTA 4OGXA 3SUEA 2SNWA 5EG4A 3SU5A 4ISIH 3KQBA 3QTVH 1TNKA 2CJIA 4A92A 1Z6JH 3O8BA 2BXTH 1SQTA 1Z7KA 2EEKA 4KTUA 1GMHG 3LJOA 1P03A 2P59A 2TBSA 1K2I1 1A0HB 3U1JB 4MPVA 1SLWB 1IQMA 3PLBA 4JYVH 1MAXA 2VJ1A 1HYLA 7GCHG 1S82A 1ZYOA 2ZO3H 5K7RA 2BVXH 3O8DA 3DD2H 1G9IE 4AGJA 3QWCH 2FO9A 3VB6A 1S0RA 4INHA 1C1UH 1E35B 2ZGJA 3ZVDA 1EP6A 2QCYA 1DLKB 3QTOH 1MTSA 3SU4A 1ESBA 1BDAA 3LKWA 3ZVCA 4UD9H 2ZCLP 2ZTXA 5EXMA 2PWXA 3SBKA 4NSVA 1F0SA 3A7XA 2BY7X 5FX6A 8GCHF 1T4UH 4JZIA 4PROA 3RMMH 2ZGCA 4LZ4B 1T32A 3S9AA 1AQ7A 1MZAA 2FX6A 2G00A 1ZOMA 3K9XB 2P93A 2ZU3A 3TJUA 3V3MA 4FVDA 3MO9A 3R0FA 1C1QA 3RXQA 2WYJA 3LGIA 2ZHWH 1W0ZU 1TGTA 2AMDA 4BTIB 1S85A 3A87A 4ESTE 1KDQA 2PSXA 1AVGH 1AWFH 2D26C 1EXFA 2QXGA 3LH1A 2XTTB 1OP0A 1K28D 1HAVA 1GL0E 4E7NA 2SGAA 2W3IA 1SB1H 4KTSA 3DT0H 1E38B 1GMDF 1V2QT 8KME2 4UDWH 1AFQC 2I6QA 2GCTB 2Z3CA 1DWEH 1MU8B 1E37B 2VH6A 4ZHMU 1GHVH 4FUBA 1Z1JA 1C2DA 3UIRA 3LIWA 1UCYH 2BXUH 2ZZUH 2G4UA 4IC5A 2TPIZ 2G52A 1J17T 1SGCA 2FM2A 2XCNA 5GCHF 4BANB 1C5UA 3TGIE 4Q80A 5T3HA 5FCKA 2TGPZ 4Y10E 5F6MA 5G4BA 2ZGHA 3BV9B 3PO1C 5ABWA 2QYIA 4FUHA 1AKSB 1K1NA 1WQSA 5EODA 3OTJE 1NN6A 4THNH 3RP2A 3T27A 3T62A 1IQIA 1SVPA 3SHAH 5E0GA 8GCHG 1H9HE 1THPB 2AERH 1PJPA 1O3LA 2VWLA 1D3TB 5EGMA 3SJOA 1UCYK 2ZU4A 1QRWA 3RXTA 2WUBA 3ZZ6A 2ZF0H 4LXBH 1A0LA 1GBEA 2AIPA 2H5DA 1EZQA 1W8BH 2ZDAH 2VIPA 1PQ5A 4CRGA 5GWZA 1FN8A 2BY6X 3Q00A 2Y5HA 2ZDNA 3SNDA 5HM9A 2D1JA 3PM3A 5F8XA 5FBIA 4ZROA 3GY7A 1NRSH 4CRCA 5C1XA 1XUKA 2K1QA 1EPTC 2G51A 2A2XH 3RC5A 1PYTD 2FOAA 2SFAA 3T25A 1GMDG 2TGDA 5I46H 2FP7B 3QGNB 4QT8C 1ELGA 3ZZ3A 3M5LA 2VGCB 1A61H 1C5VA 4MPWA 2ZQ1A 2GMTB 1KSNA 3M7TA 1SQAA 2FLBH 5GXPA 1ETSH 1MZDA 1LPGB 2B5TB 3HGPA 1ZHPA 1SFIA 5IYTA 1EAIA 2ZA5A 1TALA 1Y3VA 3BN9A 3RXRA 2AMPA 3MH4A 3LDXH 2ZGBH 1DANH 3ODFA 2FLRH 2HPQH 1O3EA 3BTEE 3C1KA 1LMWB 4MLFB 2FS8A 2VWMA 1O3GA 3GCHB 3RMOH 1ANEA 1KLJH 2OBOA 2VWOA 3ZVAA 1O34A 1P2KA 1O31A 4O3UA 3MH7A 2ZHDA 2ZDVH 3SI4H 2ZCHP 1QJ1B 3MO3A 1TLDA 1FN6A 1ZHRA 1AGJA 5T6GA 3SUDA 2AGEX 1ELAA 1QL7A 4ZHLU 2GT8A 1KDQB 4Y8XA 4D9QA 1P04A 3A8AA 1UTQA 1O37A 4YTAA 3GDSA 2PR3A 1HAVB 3UY9A 5K0HA 1O5EH 1XXDA 5FBEA 3HATH 2AIQA 1N8OB 4JZEH 1K1LA 2OP9A 9ESTA 4ABDA 4ZXYH 1YPHE 3RM2H 1RIWB 1OWKA 1CGIE 1ZRBA 2FOEA 1E36B 1FAXA 1ARCA 1QHRB 1SGFA 1ZPBA 4CREA 2J94A 1GHZA 1SLVB 3BTTE 4A5TS 1IQLA 2TGTA 4E06H 5C2ZA 4A1XA 3EA8A 1YF4A 1F0TA 1TGSZ 5F8ZA 2J9NA 1JBUH 1MKWH 2BDHA 1O5AB 1HPGA 1O3NA 1YBWA 1NRNH 2IPHA 4X0WU 3NK8A 4A1TA 1FAKH 1XX9A 5C20A 3GCTF 2ZDMA 2WV5A 1ZSLA 4GHQA 1SGEE 3HPTB 1DX5M 1V3XA 3E16B 4TPYA 3TITA 1P10A 1KXCA 4LZ1H 4AB8A 2ESTE 8LPRA 1BRUP 1A1RA 4GHTA 1T31A 1PYTC 4BAHB 1HFDA 2JH6D 4YZUA 1XMNB 4FUCA 3U8RH 1A4WH 1W7XH 5TCAA 3TPIZ 1LVYA 1W7GH 2B0FA 1MKWK 2A4QA 1P3EA 3TK9A 3A85A 3TJVA 1ZMJA 1WSSH 1NRRH 1D6RA 2ZHQH 4IC6A 3UNRA 2PKAA 2BB4A 1DXPA 2Z6BD 5FAHA 4O97A 2W26A 3KEEA 3EGKH 3GCNA 4BTTB 1ZGIA 1GVZA 1K22H 2ZP0H 2TRMA 3ATKA 1GG6B 4AG1A 2Z7FE 2BLOA 2QAAA 1ETTH 1RTFB 2CXVA 1S5SA 1G2LA 1C5MD 1QBVH 1TOMH 2FODA 4MQAA 1V2RT 2F83A 4UFEH 1HXFH 2ZFSA 1BT7A 4NGAH 4TY6A 1H9LB 1O38A 1ZPCA 1N6XA 3RMLH 1MQ5A 2FMJA 1HJ9A 5B6OA 1ZZZA 1HIAA 1GBJA 4INLA 4HI3A 2SGFE 3TNTA 2GTBA 4I8JA 1O2MA 4DG4A 3UWIA 3UQVA 3GCTG 4CR9A 1PFXC 4AORA 4Z0KA 3BG4C 3V7TA 1GI6A 3DUXH 3A86A 5H4IB 3T26A 4K1TA 1OWEA 1W12U 3DFJA 4AX9H 4WMEA 1BIOA 1HJAB 3SGAE 2ZGXH 1ZPZA 2Y80A 1YPJH 2ODQA 4K1SA 3UOPA 4SGAE 4DVAU 5A8XA 3LONA 3AVZA 1TYNA 3A81A 3K6YA 4ABAA 1FJSA 1O2JA 4RKJB 3UFAA 2QIQA 3EAJA 1AVXA 1GBAA 2R3YA 2ANKH 1TBQH 1Z6EA 2CF9H 5CE1A 3KF2A 2ALVA 4AOQA 4B1TA 1MBMA 1YLDA 2ZDLA 1G3EA 1AE8H 3SI3H 3TH3H 1XUFA 2XRCA 2FIRH 3OU0A 1BTWA 5A0CA 3SJKA 1DY8A 3AAVA 4GAWA 4ABHA 2JKHA 3PYHA 1FDPA 2BLWA 2FOBA 2C8WB 4TWYA 2VVVA 1SGDE 5DKMA 1K1IA 5CMXH 3Q76A 3SGQE 5TCCA 1TPOA 3BTGE 5DP9A 2BY8X 2ZU2A 4DIHH 1C5ZB 1LQDB 3Q77A 5HMAA 3SNBA 1FUJA 3MHWU 2Z9LA 1Z8IB 1O2OA 2CN0H 2Q6FA 5HGGA 1LPZB 1AFEH 3TGKE 3HKJB 4Y8YA 5DP5A 3MO6A 5AHGH 2DUCA 4X8SH 3ZZ7A 1JIRA 5I25A 1DUAA 1WAYB 2ZPSA 3BEIB 2H6MA 3BEFB 2CHAB 2ILNA 2O8MA 3MU1A 5C1UA 2HGTH 4Y7BA 6ESTA 1ZRKA 3P92A 1O2KA 1IHSH 1FY8E 2H1UA 1O3PB 3M5OA 5DP3A 1QY6A 3LPRA 4NA9H 1O2HA 1HAHH 1ZSKA 3M35A 2SGEE 3ZVEA 1SR5C 2OXSA 1P12E 2PKAB 2ZG0H 2GZ7A 1XUGA 1GBBA 2P95A 3VB4A 1TMTH 3M37A 2ANMH 2FX4A 1EJAA 1FONA 1O0DH 1X7AC 2C3SA 1F0RA 2FYRA 3LGVA 1SGIB 1IHTH 5DP7A 1C1RA 4ZHAA 1QIXB 1TBRH 2EC9H 4ISOA 1EB2A 3E8LA 4FU9A 2GCTC 5L2ZH 3ODDA 1H1BA 4MNVA 2EI8A 3VPKA 1UMAH 1HUTH 3RXEA 1V2LT 2BZ6H 2STAE 1GI9B 4JCNA 2A7HA 1EZXC 2SGPE 1BCUH 1ELCA 3ATMA 2FPZA 5A2MH 3P70B 1HAGE 1HIAB 3LT3A 2Q6DA 5JBTA 1AHTH 2FESH 3MOCA 1SGNE 4YT6H 1TGBA 3SORA 3GY8A 5GPIB 1IQFA 2WPMS 3IG6B 4NA8A 3RM0H 1IQGA 5T6FA 1MTVA 1O2LA 2C8ZB 1Y3XA 3GDUA 1AWHB 1Y5AT 2H9TH 2XBXA 2GDDA 3S69A 1EB1H 3FP7E 3D62A 1MQ6A 4X1NU 3DFLA 1ZJDA 3S7HB 1C5RA 1C4V2 1BBRH 1C5WB 1Q2WA 2XWBI 3A7YA 1S84A 1V2PT 1JRSA 3LOXA 2LPRA 3SU1A 2BDYA 1LCYA 4MPUA 4ZMAH 4MTBA 1ANDA 1EOJA 1CGJE 1O2RA 1TQ0B 2THFB 4NG9H 4MG3A 1N6YA 1HGTH 1OPHB 5DJ7A 1ZMNA 3QLPH 1O2ZA 1LHEH 1KXAA 2WPJS 3FAOA 4ABBA 1MD7A 3T5FH 1Z71A 4KELA 1NM6A 5A0AE 1DE7H 3I77A 3PB1E 1BBRK 1DWCH 1OWHA 4B2CA 4B2AA 2A5IA 1G36A 3C27B 4WJG2 4AYYB 2UUFB 3KNXA 3V12A 3ZZDA 5JYIA 1AUJA 1D3QB 1L0ZA 3L3TA 1AB9B 2GMTC 1GPZA 3I78A 1VZQH 2AMQA 2VIDA 3ZYEA 2OTVA 4BXSA 1P57B 3U9AH 3SNEA 1ORFA 3BEUA 3MU5A 2CF8H 4X6MA 4ABEA 2F91A 1C1NA 1MAYA 4FXGH 1ZTJA 1DDJA 3OSYA 4AZ2B 1NPMA 2J38A 1GJ9B 1V2OT 1O32A 1TPAE 1BJVA 1G37A 1CHGA 1AD8H 3GCHC 4I8HA 4Q7ZA 1ELDE 5ETXA 1ZSJA 2C93B 3E0PB 5FXLA 5GIBA 2JETB 2UWOA 3A8CA 1O36A 1AIXH 3FZZA 4BXWA 4ZKOU 2G4TA 4DCDA 2GCHF 1GHWH 4XSKU 1YPKH 1A5IA 2XCFA 2SGDE 3RXMA 1BZXE 3NWUA 1PPCE 1C2MA 3GDVA 1N8OC 5LH8A 1FZZA 2PGBB 2Q6GA 1HXEH 2ZFTA 1MMJN 1ZMLA 4M7GA 2FXRA 1TOCB 1LVMA 1SL3A 1AVWA 3SU0A 1CVWH 1BRCE 1B0FA 1SBWA 1RIWC 4GPGA 3P8NA 1F92A 2I6SA 3UR6A 4ZKSU 3VXEH 1T4VH 2BD5A 4DJZB 2A45B 4Y6DA 1OWIA 1V2TT 2UWPA 4K3JA 4KGAA 1INCA 4X6PA 2CV3A 3BF6H 2ZI2H 4UE7H 3UOUA 3ZZ5A 1BTPA 1EASA 3KN2A 2WPKS 4YLUA 3MU4A 1N1LA 2ZFQH 1YCPM 1ZHMA 3MNSA 4TY7A 2XC0A 4JYTA 7KMEH 3KL6A 4K69A 3BTHE 1L1NA 1YPGH 4BAMB 1YPLH 3SV8A 3MTYA 3TGJE 2NU2E 2ZEBA 4XBBA 3QZRA 1IQKA 4Q7XA 1O3AA 1C1OA 1ELEE 2BOHB 3FZDA 3VEQB 5DO4H 1W10U 4YT7H 2A5KA 1HAYB 3TH4H 2GCHG 1KLIH 1P9SA 1C1PA 2QC2A 4GVUA 5DGJA 1OSSA 1SC8U 3RMNH 1WBGB 1C2FA 1F2SE 1V2ST 1T7CA 4GUXA 1IQJA 3P6ZB 1AUTC 2FOMB 3CS0A 3KGPA 4Y11E 1O2VA 1F0UA 1TNHA 3CS7A 2VVUA 1EZUC 1K1OA 1C1TA 1C2GA 1GG6C 2P8OB 1GGDB 1NS3A 1P01A 1EP5A 3A84A 1SSXA 3RXHA 1ARBA 1AZZA 1O2WA 5C1YA 1CT0E 3AASA 1UVSH 1KXEA 2V3HH 2BVSH 1W13U 3U1IB 3MMGA 2BDCA 3SNCA 1CU1A 1HV7A 1P05A 1S6HA 2GD4B 2QF3A 3MH6A 3ZVBA 2DE9A 2H9EH 1A7SA 2Z94A 3F9FA 1DWDH 3K2UA 1BTZA 2NU0E 4AB9A 3M7QA 3MWIU 5L6NH 1GHYH 4YOGA 2FI3E 2ZKSA 2OC0A 4DURA 1J15A 4LK4A 1ZTKA 5AFYH 3SUFA 1GJBB 4X8UH 5F03A 1YPEH 2F9VA 1HJAC 1G3BA 1S83A 1FMGA 1F5LA 3JZ2B 2BQ6B 1V6DA 1W14U 2PTCE 1GI3A 2G8TA 4IS5A 1KXFA 1LHCH 3ZVGA 4FVBA 1BHXF 1GCTB 3PTBA 1B0EA 1H8DH 1CBWB 1ESAA 4X1PU 3RU4D 1MTNB 1G30B 1KXBA 4OS2A 1C1SA 1YC0A 1DT2A 2VINA 4KTCA 1KLTA 3VB7A 5JDUB 1EPTA 3F9GA 4JK5A 2BD9A 4A7IB 4JZFH 4WMDA 2W7UA 1HAOH 2ZECA 2RG3A 3ZZ9A 2V35A 2ANWA 3VGCB 1MCTA 3T28A 1GJDB 3B9FH 1TMBH 1WYKA 1PQ7A 1BITA 1EJNA 2ZFFH 4ZAEA 2IN2A 5FX5A 3ZV8A 1CA8B 1XKAC 2XXLA 1UTNA 4ZKRU 2ODPA 4NIYA 4DOQA 1A5GH 2FDAA 4D8NA 3RU4E 3RXBA 3OY5U 1C1MA 1K1MA 1TONA 4TYDA 1RRKA 3FP8E 3E91A 1CT2E 1Q3XA 4GCHF 2CHAC 2WINI 1UTJA 1ABJH 4ISHH 4TWWA 1C5TA 4Y7AA 1C5NH 3P17H 2YOLA 2FS9A 4XBDA 3RXGA 2XBVA 4H6TA 4OS4A 3BTDE 1H8IH 1FIWA 1A0JA 3S0NA 2ZHEH 1LVOA 3TH2H 4BNRA 2HRVA 1NU7B 1IQHA 2FTLE 4DGJA 3GY6A 1O3JA 1BRBE 1GI8B 4UFDH 2Z9JA 2C90B 2Y7XA 4D9RA 2FEQH 4CRFA 1T8NA 4Y71A 1O3FA 1QNJA 2CGAA 1HLTH 1TAWA 1O5DH 1V2MT 2BDIA 2Z9IA 1AU8A 1VITF 2TIOA 1A3BH 4MDSA 1IAUA 3JZ1B 5EW1H 1O3DA 3NZIA 4D76A 5E2OA 1OYQA 2PHBA 5CHAB 4D7GA 6CHAC 3LU9B 5A09A 1ZTLA 1IQNA 2OQUA 3KCGH 1GBCA 4YM9A 1GL1A 4X8VH 1P8VC 3EE0B 5AFZH 2FWWA 1YPHC 3QGJA 4NFEA 2Z9KA 3L33A 4Y79A 3LGWA 4JZ1A 3VB5A 4GCHG 1W0YH 2ZNKH 1J9CH 2BX4A 1A46H 2F9PA 3RU4T 2CMYA 1SG8B 2Z3EA 5DK1A 4CHAB 1P2IA 3SV2H 2BD7A 4K1EA 1UTPA 1GBKA 1T8MA 1C2IA 1EKBB 1IQEA 1O2SA 1UTKA 1OWJA 5AF9H 3EA7A 1SGPE 1O5FH 3TVJB 5GDSH 2BZAA 3U69H 2XNIA 1NU9A 2J92A 3CP7A 2BDBA 2ASUB 3F6UH 1WU1A 1UJ1A 7ESTE 1BMMH 3RXVA 1FIZA 3ZV9A 1JWTA 4CH8B 5EXLA 1DSTA 5EQSA 1OS8A 2WYGA 2VIWA 4Q2KA 2FOHA 3QK1A 1FPHH 1O3IA 1D3PB 1FY3A 3U8OH 1TIOA 1UVUH 1VITG 2Y6TA 1O2TA 4IN2A 1YLCA 4WVPE 1AB9C 1MKXH 4X1RU 4FUIA 5J4QA 5JB8S 1XM1A 2V3OH 3GYLB 1BA8B 1Y3YA 1OP8A 2OCVB 1KTSB 3SN8A 1JXPA 1BMLA 2R2MB 5LPRA 1TWXB 5IDKA 2ANYA 1K9OE 3A7WA 1NO9H 3H7TA 3ZYDA 3P95A 2GX4A 1JMOH 1MKXK 1Z1IA 1A5HA 4IBLH 1LKAA 1O2QA 1QL9A 3OX7U 1TA6A 1DLEA 2JETC 2AGIX 4X2XA 1O3CA 2ZIQH 2BX3A 1MUEB 3MU0A 3AW1A 1HNEE 4X2YA 4DIIH 1C4Y2 5EQRA 1FY5A 2BMGB 9LPRA 4MNYA 1YP9A 1CA0B 3D49H 2D8WA 2VIQA 2VH0A 3MFJA 2EI7A 3FP6E 2ZPQA 5EW2H 4Q7YA 2HLCA 4VGCB 5BRRE 5J4SA 2QXIA 1PQAA 4UFGH 3KHVA 5DP6A 3MU8A 2Y81A 2M5TA 3OYPA 4FU8A 4CRDA 4YOJA 3UREA 3E0NB 1YKTA 1P2OA 1W11U 4X1SU 1C9PA 2OQ5A 2A2QH 3F9EA 2R3UA 1XVMA 4NA7A 1GBLA 1YYY1 2R0LA 2Y82A 3MNXA 2AFQB 5EQQA 3RDZA 1DPOA 1F5RA 1T8OA 2XC5A 4IW4E 2B9LA 1JRTA 1QA7A 4Z6AH 2EA3A 3NPSA 3A7VA 3UWJH 7LPRA 2HPPH 1XXFA 2Y7ZA 1CE5A 4R8TB 1NY22 2A1DB 3GY4A 1O5BB 2A5AA 4DY7B 3B8JA 1UO6A 2FYQA 2QXJA 1KIGH 3RC4A 3M5NA 1DICA 1BTXA 4TPIZ 2OD3B 2B8OH 4DT7B 5ESBA 4HTCH 2ZTYA 1IOEA 1WCZA 3RXLA 3RLYH 1PPBH 5DPAA 1EX3A 1TB6H 3HKIB 4H4FA 4HFPB 2PUQH 1S81A 3W95A 1NROH 1S0QA 1HCGA 1VITH 2PTNA 1EAWA 1TRNA 5L30H 1BTUA 4YLQH 1KXDA 4ABIA 4X6NA 3SQHE 4B2BA 3SJ8A 3UQOA 3ESTA 1C5PA 4D7FA 1O3HA 1TBZH 1C5LH 2SNVA 2A7JA 1ANCA 4X2WA 1OYTH 1QR3E 1LQEA 1MU6B 2P8OC 1GGDC 1TNIA 1C5OH 1C2HA 5T6DA 2ZU1A 4UFFH 4MPXA 1D4PB 1VR1H 2H2ZA 4WMFA 4UONA 3W94A 5HXFA 3RXJA 4B74A 3P8GA 2HNTE 5JPMH 1THRH 2XWAA 2P94A 1UTOA 4OS1A 3LC3A 2VU8E 3RXSA 1GJAB 1P2QA 3FFGA 1C5QA 2FZZA 3MI4A 1DM4B 2OC1A 4NCYA 2ZU5A 3GOVB 1QB6A 3M7UA 3UR9A 1KYNA 3MH5A 1BOQA 1PQ8A 2VGCC 1W3CA 1G2MA 3K65B 3SJIA 2ZCKP 2RDLA 1ELVA 1VCPA 5L2YH 1J16A 5C5NA 1ANBA 1P2MA 4I33A 4I8GA 1GJCB 1QURH 2BD3A 2XC4A 1T8LA 1L2EA 3NCLA 1GBFA 3A82A 1SI5H 2GV7A 3LGUA 4OS6A 1O3OA 3T29A 1GMCF 1SGFG 2W3KA 3D23A 5DG6A 3STIA 1GCTC 1UVPA 3N7OA 1ABIH 3SV9A 2GKVE 3BIVH 1CBWC 3TK6A 4H6SB 3EQ0H 1MTNC 5F8TA 1ELFA 3PLKA 1O5GH 1H9IE 1SOZA 1TA2A 3SV6A 2J34A 4GLYA 1YPMH 4AN7A 3TLOA 3BTWE 3P8FA 1NTPA 2NU3E 3PMJA 4X6OA 5LPFA 1NC6A 1EZSC 1QQ4A 3VFEA 1C5SA 1YGCH 1DS2E 1Z8RA 3PMBB 3VGCC 4BTUB 5EOKA 2HNTC 4GSOA 1D9IA 1F7ZA 2F9UA 1C1VH 1C2KA 3RXFA 1LHFH 2O8TA 1QFKH 1EAUA 2GGVB 3SHCH 1CQQA 1O5CB 1ELTA 2A4RA 4NZQA 2WPIS 2WUCA 4K8BA 3B23B 1BJUA 2BYAX 1TABE 2ZDKA 2YNAA 1P06A 3O8CA 3SGBE 1ELBA 2V0BA 4OS5A 1GJ5H 2A31A 1VGCB 6LPRA 2BVRH 1OKXA 1D6WA 2VIVA 1OP2A 3QO6A 3HK3B 1FXYA 3ZVFA 1VCQA 1XUJA 4IMZA 2IOTA 4B75A 3QX5H 1GMCG 2PKSB 5FPSA 2F9NA 3ATWA 1P09A 3Q3YA 2PW8H 3ZZ4A 4AGKA 2PLXA 1TMUH 1SGQE 3ATIA 1S6FA 1P9UA 1LO6A 2A0QB 2BQWB 2GDEH 2BY5X 1WTGH 4HZHA 3ZZBA 1B7XB 1C2JA 2OINA 2Z9GA 3K6ZA 3S7KB 4OGYA 1QJ7B 2FTMA 3A80A 4BAQB 1WUNH 1ZR0A 4FUGA 1XKBC 4U32A 1L1JA 1QB9A 3A7TA 1BB0B 1HBTH 1TGNA 4ISNA 1CO7E 1O35A 3VXFH 3MNBA 1GHBF 3SW2B 1MTUA 2RA3A 2W5EA 1CHOF 4FUDA 4KKDA 2C8YB 4AFUA 2STBE 4DW2U 1GJ8B 1JOUB 1O30A 1BHXB 4H42U 3KQEA 3OY6U 1OX1A 1GJ7B 1DFPA 2QF0A 4A6LA 5SGAE 2UUKB 5CHAC 3A8BA 1UCYE 4X2VA 1C4U2 1O2PA 4ABJA 2O8UA 6GCHF 4E7RG 3EDXB 3QZQA 1K1PA 4I8LA 1RS0A 4I31A 4WXVA 3GISB 2ZQ2A 2VB0A 1GI5A 1QBNA 3ZZ8A 1Z8GA 3PWCA 2G81E 3TIUA 1SOTA 2YNBA 1LHGH 1O39A 2Z3DA 4CBNA 5JBAS 1HAXB 1RTLA 5ESTE 4CHAC 3DA9B 2GV6A 4AFZA 2Q1JA 1NESE 3MNCA 1Y3WA 2R2WU 1TRYA 4NFFA 1MTWA 3ATLA 1D3DB 1U6QA 3SU3A 3ITIA 1Y8TA 3EA9A 2AS9A 3PWBA 4OS7A 1AO5A 1RFNA 3SZNA 3M36A 5DP4A 5PTPA 3T2NA 1GDQA 4SGBE 1SGYE 4Y76A 3LGTA 2VWNA 1MCVA 1P0SH 2BLVA 4XBCA 2OLGA 3LC5A 4K2YA 2AH4X 2HWLB 3GY3A 1P3CA 3WY8A 1GHAF 1FQ3A 4WY3A 3V13A 1YCPH 2P16A 1NRPH 1GHBG 3ELAH 3RC6A 1HAPH 1B5GH 1CHOG 1FY1A 1G32B 1EJMA 1WV7H 3UUZA 1GBIA 4IN1A 1TPSA 3KQCA 1MD8A 4NIVA 1GBHA 2GZ9A 4AG2A 1GBMA 4JYUH 2UWLA 3U98H 1QBOA 2Y5GA 3GYMA 3P8OA 3R3GB 4XFQA 6GCHG 4YO9A 4RKOB 4IMQA 4NIWA 1GVLA 2XBYA 1PPHE 2H9HA 2FI5E 2ODYB 1RGQA 4HGCA 1YCPK 1GI2A 2BDAA 1QGFA 1HDTH 1BMAA 2A4OA 4JK6A 1E0FD 2R9PA 1Z8JB 4X1QU 1O3MA 4BAOB 5A8ZA 1GCDA 1DVAH 3L6PA 2WPHS 2XYAA 3PMHB 4MNXA 1BRAA 1G3DA 3M3TA 2OC7A 5AVDA 4CH2B 2ZHFH 3E90B 1LDTT 1CA0C 4XE4A 4YESB 4F4OC 4AFSA 4U01A 2R0KA 1GDUA 1HRTH 4VGCC 1NRQH 3BTME 1C2EA 3LJJA 2FOCA 4NIXA 4I32A 1C5XB 2GZ8A 1FY4A 4FU7A 4NSYA 3F9HA 3ENSB 1J14A 3URDA 1SQOA 4NZLA 2BQ7B 1TE0A 2F3CE 3TJOA 4E05H 1KTTB 1TX6A 1GHAG 1TGCA 3IWMA 1PPZA 3GICB 5LPEA 2XW9A 4F49A 1C1WH 2F9OA 1UVTH 5E0JA 1O2XA 3RXOA 2A4GA 3SV7A 3BTKE 4CRAA 1SLXB 1V2WT 1CT4E 1QCPA 2AYWA 2IJOB 3F1SB 1MH0A 3RUOA 3SU2A 1BUIA 1TNGA 3S9CA 3Q3KA 1AZ8A 4WH8A 1QRZA 2PUXB 2KAIA 3SQEE 1XUHA 3E3TA 1EOLA 2J4IA 1QA0A 3GY5A 4K60A 2LNCA 4JZDH 1RJXB 2HOBA 1O3BA 1SLUB 2OBQA 3F68H 3NKKA 3TJNA 2VIOA 5E0HA 2PV9B 3QDZB 5HYOA 1GWAA 1GHXH 1AFQB 5EPYA 1FV9A 1FNIA 2V6NA 1WTHD 5FPTA 4NWLA 1NZQH 3O8RA 1K21H 1V2KT 5EPNA 1ETRH 2QA9E 2BM2A 3RXDA 3CENA 4IGDA 2XBWA 1SFQB 4B76A 3KIDU 4U2WA 1GI7B 1GI0A 1UTMA 2QY0B 3ZZAA 2JH0D 2BLQA 4AYVB 2O8WA 3PO1B 1YM0A 2J95A 2BHGA 3VB3A 4WF8A 1AE5A 1C5YB 1W2KH 5GJ4B 2HNTF 3EYDA 1VJ9U 1A2CH 5FCRA 4X8TH 3SJ9A 2QGRA 1O2GH 3PTNA 1NFXA 4WWYA 4K8YA 3UTUH 4K5ZA 2ZTZA 3BTFE 3QN7A 1V2JT 1UHBA 2GVFA 1ACBE 3PROA 3A83A 5BPEA 3NUMA 5TJXA 2OC8A 2K7XA 1O2IA 2C8XB 1UVOA 3A89A 3AW0A 1THSH 1GBTA 1TX7A 3A8DA 1K1JA 1EPTB 2WPLS 5JBCS 5C5OA 2P3UB 3GCOA 1UTLM 4ISLA 2BD8A 1TPPA 2UUJB 3PV4A 4KP0A 1SPJA 1DUEA 1EUFA 3I29A 2AGGX 1A3EH 1FI8A 4I8KA 2VVCA 3UNSA 3TK5A 3QUMP
chains in the Genus database with same CATH superfamily
2WV9A 4FUEA 2ZWLH 3STJA 4O3TA 1HJ8A 3LGYA 1P02A 1LKBA 1EATA 3KQDA 2GT7A 3RXUA 4CBOA 3SOSA 1ZJKA 1QJ6B 2HVXA 1V2UT 3E6PH 3M3VA 2B7DH 4YXWD 3SUGA 2RA0A 2PSYA 4J2YB 3RXKA 1GI4A 2PGQB 4R0IA 3TNSA 3U8TH 1HB0B 1AY6H 1L4ZA 2DE8A 3A88A 2G5NA 1NFUA 1SGRE 2BTCE 3PLPA 1TQ7B 2G55A 1C2LA 1SHHB 1TNLA 4ZH8A 2ULLA 1AMHA 2JH5D 1QL8A 1G3CA 5DP8A 2A7CA 1DOJA 3DHKH 1LPKB 3SNAA 4Y8ZA 3V0XA 2O9QA 4FUFA 1MABB 5HIZA 1COWD 1OXGA 4INKA 2NU1E 2J2UA 3H7OA 5A8YA 1H4WA 1LHDH 4JMYA 1L4DA 1QRXA 3URCA 1O33A 2KAIB 1DSUA 2ALPA 3EBNA 4RSPA 3HK6B 1TFXA 2BOKA 1O2YA 1Y3UA 3BIUH 1DY9A 2JJ2D 1ZGVA 4CRBA 3M5MA 5FHTA 1WQVH 3S9BA 3SU6A 4B71A 4WH6A 5T1VA 2EI6A 4J1YA 1C9TA 1GI1A 1Q31A 2WV4A 4A1VA 1Y5UT 3TU7H 1NFYA 1CSOE 2BD4A 1VGCC 2ZFRH 5GCHG 1QQUA 2FOGA 3RXAA 1QB1A 4O03A 1LTOA 1TX8A 1Y59T 1AN1E 1KY9A 3E1XB 2PKSC 4BOHA 1SGTA 3UNQA 4RN6A 5JBBS 1DITH 3FOAA 1V2NT 1TNJA 3FVFB 1EAXA 3IITA 2Y5FA 5C17A 1FX0B 5LGOA 4LOYH 2F9BH 2SGQE 2RCEA 4Y0ZE 1AI8H 4MNWA 3RLWH 5C67A 1HAIH 2C4FH 1L1GA 1VJAU 3AAUA 4NWKA 1UK3A 2BY9X 1F5KU 2QN5T 2UUYA 3FKSD 1WOFA 1PPFE 2HALA 4ABFA 3BG8A 2P3TB 1GBDA 2H5CA 2G5VA 1ID5H 1QTFA 1M9UA 5HM2A 1HAZB 2PFEA 1NFWA 4MVNA 1UHBB 4ASHA 2W7SA 3RXCA 2BDGA 1EQ9A 2NWNA 4ZKNU 4WXIA 3Q3XA 3M3SA 1CGHA 5C3NA 3SO3A 5KEDA 1GDNA 1P2NA 2QXHA 1J8AA 2AEIH 2A32A 4ZUHA 8ESTE 1OOKB 5E2PA 4CR5A 2ZPRA 1DXWA 4B73A 4BAKB 1GJ6A 6CHAB 1GMHF 1FLEE 2FOFA 2O8LA 3ZZCA 1Y5BT 1SHYA 1LVBA 1FPCH 2IJD1 3M61U 3RXIA 1O3KA 2OUAA 4ABGA 1SMFE 7GCHF 2ZC9H 2WPDD 1BMNH 3OFND 1OWDA 1XUIA 2TGAA 1O2NA 3BTQE 3LH3A 4XDEA 1NBMD 3BSQA 4YOIA 4U30A 1P2JA 3NXPA 2P3FH 1RD3B 4O9VA 1RXPA 2LIZA 3GY2A 1MBQA 4Y0YE 1NT1A 1V2VT 1BBRE 2QV1A 5CDFE 3MYWA 5EXNA 3HGNA 1P11E 1PPGE 3UAIC 1ESTA 1GJ4H 3RXPA 5A0BA 1BTYA 2GP9B 4TSFD 3UPEA 1XVOA 1YLNA 4ZXXH 5EU8A 1BQYA 5FPYA 1AKSA 3H5CB 3BG4B 1GVKB 1UK4A 2ZFPH 5E8EH 1DWBH 4UEHH 3G01A 3PMAB 2NU4E 2D2DA 2FI4E 4FOUC 5JB9S 3A7ZA 3D65E 1JIMA 1E34B 1VCWA 1UK2A 4XOJA 1ZLRA 1BTHH 1RTKA 4I7YH 2BD2A 4AFQA 1TRMA 3FANA 4FUJA 1PPEE 1O2UA 2VNTA 4OGXA 3SUEA 2SNWA 5EG4A 1NBME 3SU5A 4ISIH 3KQBA 3QTVH 1TNKA 2CJIA 4A92A 1Z6JH 3O8BA 2BXTH 1SQTA 1Z7KA 2EEKA 4KTUA 1E1RD 1GMHG 3LJOA 1P03A 2P59A 2TBSA 1K2I1 2LP6A 1A0HB 3U1JB 4MPVA 1SLWB 1IQMA 3PLBA 4JYVH 1MAXA 2VJ1A 1HYLA 7GCHG 1S82A 1ZYOA 2QF4A 2ZO3H 1WDIA 5K7RA 2BVXH 3O8DA 1KMHB 3DD2H 1G9IE 4AGJA 2XOKD 1WXRA 3QWCH 2FO9A 3VB6A 1S0RA 4INHA 1C1UH 1E35B 2ZGJA 3ZVDA 1EP6A 2QCYA 3VG8A 1DLKB 3QTOH 1MTSA 3SU4A 1ESBA 1BDAA 3LKWA 3ZVCA 4UD9H 2ZCLP 2ZTXA 5EXMA 2PWXA 3SBKA 4NSVA 1F0SA 3A7XA 2BY7X 5FX6A 8GCHF 1T4UH 4JZIA 4PROA 3RMMH 2ZGCA 4LZ4B 1T32A 3S9AA 1AQ7A 1MZAA 2FX6A 2G00A 1ZOMA 3K9XB 2HVYB 2P93A 2ZU3A 3TJUA 3V3MA 4FVDA 3MO9A 3R0FA 1C1QA 3RXQA 2WYJA 3LGIA 3KQ5A 2ZHWH 1W0ZU 1TGTA 2AMDA 4BTIB 3OTPA 1S85A 3A87A 4ESTE 1KDQA 2PSXA 1AVGH 1AWFH 2D26C 1EXFA 2QXGA 3F2HA 5FL7D 3LH1A 2XTTB 1OP0A 1K28D 1HAVA 1GL0E 4E7NA 2SGAA 2W3IA 1SB1H 2QE7D 4KTSA 3DT0H 3WWFA 1E38B 1GMDF 1V2QT 8KME2 4UDWH 1AFQC 2I6QA 2GCTB 2Z3CA 1DWEH 1MU8B 1E37B 2VH6A 4ZHMU 1GHVH 4F48B 4FUBA 1Z1JA 1C2DA 3UIRA 3LIWA 1UCYH 2BXUH 2ZZUH 2G4UA 4IC5A 2TPIZ 3DSOA 2G52A 1J17T 1SGCA 2FM2A 2XCNA 5GCHF 4BANB 1C5UA 3TGIE 4Q80A 3MQKC 5T3HA 5FCKA 2TGPZ 4TT3D 4Y10E 5F6MA 5G4BA 2ZGHA 2AHME 3BV9B 3PO1C 5ABWA 2QYIA 4FUHA 1AKSB 1K1NA 1WQSA 5EODA 2KM0A 3OTJE 1NN6A 4THNH 3RP2A 3T27A 3T62A 1IQIA 1SVPA 3SHAH 5E0GA 8GCHG 1H9HE 1THPB 2AERH 1PJPA 1O3LA 2VWLA 1D3TB 5EGMA 3SJOA 1UCYK 2PP6A 2ZU4A 1QRWA 3RXTA 2WUBA 3ZZ6A 2XNDD 2ZF0H 4LXBH 1A0LA 1GBEA 2L74A 2AIPA 2H5DA 1EZQA 1W8BH 2ZDAH 2VIPA 1PQ5A 4CRGA 5GWZA 1FN8A 2BY6X 3Q00A 2Y5HA 2ZDNA 2KCAA 3DSPA 3SNDA 5HM9A 2D1JA 4ASUD 3PM3A 2W6ID 5F8XA 3F0PA 5FBIA 4ZROA 3GY7A 1NRSH 4CRCA 5C1XA 1XUKA 2K1QA 1EPTC 2G51A 2A2XH 2QF5A 3RC5A 1PYTD 2FOAA 2SFAA 3T25A 1GMDG 2TGDA 5I46H 2FP7B 3QGNB 4QT8C 1ELGA 3ZZ3A 3M5LA 2VGCB 3ZIAD 1A61H 1C5VA 4MPWA 2ZQ1A 2GMTB 1KSNA 3M7TA 1SQAA 2FLBH 5GXPA 1ETSH 1MZDA 1LPGB 2B5TB 3HGPA 1ZHPA 1SFIA 5IYTA 1EAIA 2ZA5A 1TALA 1Y3VA 5EJZA 1E1QD 3BN9A 3RXRA 2AMPA 3MH4A 3LDXH 2ZGBH 1DANH 3ODFA 2FLRH 2VBCA 2HPQH 1O3EA 3BTEE 3C1KA 1LMWB 4MLFB 2FS8A 2VWMA 1O3GA 3GCHB 3RMOH 1ANEA 1KLJH 2OBOA 2VWOA 3ZVAA 1O34A 1P2KA 1O31A 4O3UA 3MH7A 2ZHDA 2ZDVH 3SI4H 2ZCHP 1QJ1B 3MO3A 1TLDA 1FN6A 1ZHRA 1AGJA 5T6GA 3SUDA 2AGEX 1ELAA 1QL7A 2K8IA 4ZHLU 2GT8A 1KDQB 4Y8XA 4D9QA 1P04A 3A8AA 1UTQA 1SKYE 1O37A 4YTAA 3GDSA 2PR3A 1HAVB 3UY9A 5K0HA 1O5EH 1XXDA 5FBEA 3HATH 2AIQA 1N8OB 4JZEH 3UB0A 3OE7D 1K1LA 2OP9A 2L6OA 9ESTA 3SZEA 4ABDA 4ZXYH 1YPHE 3RM2H 1RIWB 1OWKA 1CGIE 1ZRBA 2FOEA 1E36B 1FAXA 1ARCA 1QHRB 1SGFA 1ZPBA 4CREA 2J94A 1GHZA 1SLVB 3BTTE 4A5TS 1IQLA 2TGTA 4E06H 1YWUA 5C2ZA 4A1XA 3EA8A 1YF4A 1F0TA 1TGSZ 5F8ZA 2J9NA 1JBUH 1MKWH 2BDHA 1O5AB 1HPGA 3EE7A 1O3NA 1YBWA 1NRNH 2IPHA 4X0WU 3NK8A 4A1TA 5C0TA 1FAKH 1XX9A 5C20A 3GCTF 2ZDMA 2WV5A 1ZSLA 4GHQA 1SGEE 3HPTB 1DX5M 1V3XA 3E16B 4TPYA 3TITA 1P10A 1KXCA 4LZ1H 4AB8A 2J97A 2ESTE 8LPRA 1BRUP 1A1RA 4GHTA 1T31A 1PYTC 4BAHB 1HFDA 2JH6D 4YZUA 1XMNB 4FUCA 3U8RH 1A4WH 1W7XH 5TCAA 3TPIZ 1LVYA 1W7GH 2B0FA 1MKWK 2A4QA 1P3EA 3TK9A 3A85A 3TJVA 1ZMJA 1WSSH 1NRRH 1YY3A 1D6RA 2ZHQH 4IC6A 3UNRA 2PKAA 2BB4A 1DXPA 2Z6BD 5FAHA 4O97A 2W26A 3KEEA 3EGKH 3GCNA 3N7DA 4BTTB 1ZGIA 1GVZA 1K22H 2ZP0H 2TRMA 3ATKA 1GG6B 4AG1A 2Z7FE 2BLOA 2QAAA 1ETTH 1RTFB 2CXVA 1S5SA 3DSGA 1G2LA 1C5MD 1QBVH 1TOMH 2F4LA 2FODA 4MQAA 1V2RT 2F83A 4UFEH 1HXFH 2ZFSA 1BT7A 4NGAH 4TY6A 2WHXA 1H9LB 1O38A 1ZPCA 1N6XA 3RMLH 1MQ5A 3U28C 2FMJA 1HJ9A 5B6OA 1ZZZA 1HIAA 1GBJA 4INLA 4HI3A 2SGFE 3TNTA 2GTBA 4I8JA 1O2MA 4DG4A 4RT1A 3UWIA 3UQVA 3GCTG 4CR9A 1PFXC 4AORA 4Z0KA 3BG4C 3V7TA 1GI6A 3DUXH 3A86A 5H4IB 3T26A 4K1TA 1OWEA 1W12U 2KR7A 3DFJA 4AX9H 4WMEA 1BIOA 1HJAB 3SGAE 2ZGXH 1ZPZA 2Y80A 1YPJH 2ODQA 4K1SA 3UOPA 4SGAE 4DVAU 5A8XA 3LONA 3AVZA 1TYNA 3A81A 3K6YA 4ABAA 1FJSA 1O2JA 4RKJB 3UFAA 2QIQA 3EAJA 1AVXA 1GBAA 2R3YA 2ANKH 1TBQH 1Z6EA 2CF9H 5CE1A 3KF2A 2ALVA 4AOQA 2LELA 4B1TA 1MBMA 1YLDA 2ZDLA 1G3EA 1AE8H 3SI3H 3TH3H 1XUFA 2XRCA 2FIRH 3OU0A 1BTWA 5A0CA 3SJKA 1DY8A 3AAVA 4GAWA 4ABHA 2JKHA 3PYHA 1FDPA 2BLWA 2FOBA 2C8WB 4TWYA 2VVVA 1SGDE 5DKMA 1K1IA 5CMXH 3Q76A 3SGQE 5TCCA 1TPOA 3BTGE 5DP9A 2BY8X 2ZU2A 4DIHH 1H8ED 1C5ZB 1LQDB 3Q77A 5HMAA 3SNBA 1FUJA 3MHWU 1S6LA 2Z9LA 1Z8IB 1O2OA 2CN0H 2IPQX 2Q6FA 5HGGA 1LPZB 1AFEH 3TGKE 3HKJB 4Y8YA 5DP5A 3MO6A 5AHGH 2DUCA 4X8SH 3ZZ7A 1JIRA 5I25A 1DUAA 1WAYB 2ZPSA 3BEIB 2H6MA 3BEFB 2CHAB 2ILNA 2O8MA 3MU1A 4B6FA 2HGTH 4Y7BA 5C1UA 6ESTA 1ZRKA 3P92A 1O2KA 2KCYA 1IHSH 3N7EA 1FY8E 2H1UA 1O3PB 3M5OA 5DP3A 5KGOA 1QY6A 3LPRA 4NA9H 1O2HA 1HAHH 1ZSKA 3M35A 2SGEE 3ZVEA 1SR5C 2OXSA 1P12E 2PKAB 2ZG0H 2GZ7A 1XUGA 1GBBA 2P95A 3VB4A 1TMTH 3M37A 2ANMH 2FX4A 2J5UA 1EJAA 1FONA 1O0DH 4P02A 1X7AC 2C3SA 1F0RA 2FYRA 3LGVA 1SGIB 1IHTH 5DP7A 1C1RA 4ZHAA 1QIXB 1TBRH 2EC9H 4ISOA 1EB2A 3E8LA 4FU9A 2GCTC 5L2ZH 3ODDA 1H1BA 4MNVA 2EI8A 3VPKA 1UMAH 1HUTH 3RXEA 1V2LT 2BZ6H 2STAE 1GI9B 4JCNA 4AC9A 2A7HA 1EZXC 2SGPE 1BCUH 1ELCA 3ATMA 2FPZA 5A2MH 3AK5A 3P70B 1HAGE 1HIAB 3LT3A 2Q6DA 5JBTA 1AHTH 2FESH 3MOCA 1SGNE 4YT6H 1TGBA 3SORA 3GY8A 5GPIB 1IQFA 2WPMS 3IG6B 4NA8A 3RM0H 1IQGA 5T6FA 1MTVA 1O2LA 2C8ZB 1Y3XA 3GDUA 1AWHB 1Y5AT 4Q63A 2H9TH 2XBXA 2GDDA 3S69A 1EB1H 3FP7E 3PV5A 3D62A 1MQ6A 4X1NU 3DFLA 1ZJDA 3S7HB 1C5RA 1C4V2 1BBRH 1OHHD 1C5WB 1Q2WA 2XWBI 3A7YA 1S84A 4Q4LA 1V2PT 1JRSA 3LOXA 2LPRA 3SU1A 2BDYA 1LCYA 4MPUA 4ZMAH 4MTBA 1ANDA 1EOJA 1CGJE 1O2RA 1TQ0B 2THFB 4NG9H 4MG3A 5DSFA 1N6YA 1HGTH 1OPHB 5DJ7A 1ZMNA 3QLPH 1O2ZA 1LHEH 1KXAA 2WPJS 3FAOA 4ABBA 1MD7A 3T5FH 1Z71A 4KELA 1NM6A 5A0AE 1DE7H 3I77A 3PB1E 1BBRK 2JJ1D 1DWCH 1OWHA 4B2CA 4B2AA 2A5IA 1G36A 3C27B 4WJG2 4AYYB 2UUFB 3KNXA 3V12A 3ZZDA 5JYIA 1AUJA 1D3QB 1L0ZA 3L3TA 1AB9B 2GMTC 1GPZA 3FO8D 3I78A 1VZQH 2AMQA 2VIDA 3ZYEA 2OTVA 4BXSA 1P57B 3U9AH 3SNEA 1ORFA 3BEUA 3MU5A 2CF8H 4X6MA 4ABEA 2F91A 1C1NA 1MAYA 4FXGH 1ZTJA 1DDJA 3OSYA 4AZ2B 1NPMA 2J38A 1GJ9B 1V2OT 2V7QD 1O32A 1TPAE 1BJVA 1G37A 1CHGA 1AD8H 3GCHC 4I8HA 4Q7ZA 1ELDE 5ETXA 1ZSJA 2C93B 3E0PB 5FXLA 5GIBA 2JETB 2UWOA 3A8CA 1O36A 3SYJA 1AIXH 3FZZA 4BXWA 3OEHD 3PRBA 4ZKOU 2G4TA 4DCDA 2GCHF 1GHWH 4XSKU 1YPKH 1A5IA 2XCFA 2SGDE 3RXMA 1BZXE 5CHBA 3NWUA 1PPCE 1C2MA 3GDVA 1N8OC 5LH8A 1FZZA 3F0OA 2PGBB 2Q6GA 1HXEH 2ZFTA 1MMJN 1ZMLA 4M7GA 2FXRA 1TOCB 1LVMA 1SL3A 1AVWA 3SU0A 1CVWH 1BRCE 1B0FA 1SBWA 1RIWC 4GPGA 3P8NA 1F92A 2I6SA 3UR6A 4ZKSU 3VXEH 1T4VH 2BD5A 4DJZB 2A45B 3KYFA 4Y6DA 3DCLA 1OWIA 1V2TT 2UWPA 4K3JA 4KGAA 1INCA 4X6PA 2CV3A 3BF6H 2ZI2H 4UE7H 3UOUA 3ZZ5A 2W6JD 4Z1MD 1BTPA 1EASA 3KN2A 2WPKS 4DT4A 3WW7A 4YLUA 3MU4A 1N1LA 2ZFQH 1YCPM 1ZHMA 3MNSA 4TY7A 2XC0A 5B6LA 4JYTA 7KMEH 3KL6A 4K69A 4ZCNA 3BTHE 1L1NA 1YPGH 4BAMB 1YPLH 3SV8A 3MTYA 3TGJE 2NU2E 1SQRA 2ZEBA 4XBBA 3QZRA 1IQKA 4Q7XA 1O3AA 1C1OA 1ELEE 2BOHB 3FZDA 3VEQB 5DO4H 1W10U 3F2FA 4YT7H 2A5KA 1HAYB 3TH4H 2GCHG 1KLIH 1P9SA 1C1PA 2QC2A 4GVUA 5DGJA 1OSSA 1SC8U 3RMNH 1WBGB 1C2FA 1F2SE 1V2ST 1E79D 1T7CA 4GUXA 1IQJA 3P6ZB 1AUTC 2FOMB 3CS0A 3KGPA 4Y11E 1O2VA 1F0UA 1TNHA 3CS7A 2VVUA 1EZUC 1K1OA 1C1TA 1C2GA 1GG6C 2P8OB 1GGDB 4XD7D 1NS3A 1P01A 1EP5A 3A84A 1SSXA 3RXHA 1ARBA 1AZZA 1O2WA 5C1YA 1CT0E 3AASA 1UVSH 1KXEA 2V3HH 2YMSB 2BVSH 1W13U 3U1IB 3MMGA 2BDCA 3SNCA 1CU1A 1HV7A 1P05A 1S6HA 2GD4B 2QF3A 3MH6A 3ZVBA 2DE9A 2H9EH 1A7SA 2Z94A 3F9FA 1DWDH 3K2UA 1BTZA 2NU0E 4AB9A 3M7QA 3MWIU 5L6NH 1GHYH 4YOGA 2FI3E 2ZKSA 2OC0A 4DURA 1J15A 4LK4A 1ZTKA 5AFYH 3SUFA 1GJBB 4X8UH 5F03A 1YPEH 2F9VA 3KYGA 3PV2A 1HJAC 1G3BA 1S83A 1FMGA 1F5LA 3JZ2B 2BQ6B 4F55A 1V6DA 1W14U 2PTCE 1GI3A 2G8TA 4IS5A 1KXFA 1LHCH 3ZVGA 4FVBA 1BHXF 1GCTB 3PTBA 1B0EA 1H8DH 1CBWB 1ESAA 4X1PU 3RU4D 1MTNB 1G30B 1KXBA 4OS2A 1C1SA 1YC0A 1DT2A 2VINA 4KTCA 1KLTA 3VB7A 2KCPA 5JDUB 1EPTA 3F9GA 4JK5A 2BD9A 4A7IB 4JZFH 4WMDA 2W7UA 1HAOH 3OEED 4ACBA 2ZECA 2RG3A 3ZZ9A 1H8HD 2V35A 2ANWA 3VGCB 1MCTA 3T28A 1GJDB 3B9FH 1TMBH 1WYKA 1PQ7A 1BITA 1EJNA 2ZFFH 4ZAEA 2IN2A 5FX5A 3ZV8A 1CA8B 1XKAC 2XXLA 1UTNA 4ZKRU 2ODPA 4NIYA 4DOQA 1A5GH 2FDAA 4D8NA 3RU4E 3RXBA 3OY5U 1C1MA 1K1MA 1TONA 4TYDA 1RRKA 3FP8E 3E91A 1CT2E 1Q3XA 4GCHF 2CHAC 2WINI 1UTJA 1ABJH 4ISHH 4TWWA 1C5TA 4Y7AA 1C5NH 3P17H 2YOLA 2FS9A 4XBDA 3RXGA 2XBVA 4H6TA 4OS4A 3BTDE 1H8IH 1FIWA 1A0JA 3S0NA 2ZHEH 1LVOA 3TH2H 4BNRA 2HRVA 1NU7B 1IQHA 2FTLE 4DGJA 3CNRA 3GY6A 1O3JA 1BRBE 1GI8B 4UFDH 2Z9JA 2C90B 2Y7XA 4D9RA 2FEQH 4CRFA 1T8NA 4Y71A 1O3FA 1QNJA 2CGAA 1HLTH 1TAWA 1O5DH 1V2MT 2BDIA 2Z9IA 1AU8A 1VITF 2TIOA 1A3BH 4I86A 4MDSA 1IAUA 3JZ1B 5EW1H 1O3DA 3NZIA 4D76A 5E2OA 1OYQA 2PHBA 5CHAB 4P00A 4D7GA 6CHAC 3LU9B 2EY4C 5A09A 1ZTLA 1IQNA 2OQUA 3KCGH 5IK2D 1GBCA 4YM9A 1GL1A 4X8VH 1P8VC 3EE0B 5AFZH 2FWWA 1YPHC 3QGJA 4B6EA 4NFEA 2Z9KA 3L33A 4Y79A 3LGWA 4JZ1A 3VB5A 4GCHG 1W0YH 2ZNKH 1J9CH 5HKKD 2BX4A 1A46H 2F9PA 3RU4T 2CMYA 1SG8B 2Z3EA 5DK1A 4CHAB 1P2IA 3OAAD 3SV2H 2BD7A 4K1EA 1UTPA 1GBKA 1T8MA 1C2IA 1EKBB 1IQEA 1O2SA 1UTKA 1OWJA 2KZ4A 3EA7A 1SGPE 5AF9H 1O5FH 3TVJB 5GDSH 2BZAA 3U69H 2XNIA 1NU9A 2J92A 3CP7A 2BDBA 2ASUB 3F6UH 1WU1A 1UJ1A 7ESTE 1BMMH 2KCOA 3RXVA 1FIZA 3ZV9A 1JWTA 4CH8B 5EXLA 1DSTA 5EQSA 1OS8A 2WYGA 2VIWA 5GNDA 4Q2KA 2FOHA 3QK1A 1FPHH 1O3IA 1D3PB 1FY3A 3U8OH 1TIOA 1UVUH 1VITG 2KFWA 2Y6TA 1O2TA 4IN2A 1YLCA 4WVPE 1AB9C 1MKXH 4X1RU 4FUIA 5J4QA 5JB8S 5C0UA 1XM1A 2V3OH 3GYLB 1BA8B 1Y3YA 1OP8A 2OCVB 1KTSB 3SN8A 1JXPA 1BMLA 2R2MB 5LPRA 1TWXB 5IDKA 2ANYA 1K9OE 3A7WA 1NO9H 3PRDA 3H7TA 3ZYDA 3P95A 2GX4A 1JMOH 1MKXK 2YMSD 1Z1IA 1A5HA 4IBLH 1LKAA 4RT0A 1O2QA 1QL9A 3OX7U 1TA6A 1DLEA 2JETC 2AGIX 4X2XA 1O3CA 2ZIQH 2BX3A 1MUEB 2WSSD 3MU0A 3AW1A 1HNEE 4X2YA 5EJ1A 4DIIH 1C4Y2 5EQRA 1FY5A 2BMGB 9LPRA 4MNYA 1YP9A 1CA0B 3D49H 2D8WA 2VIQA 2K0QA 2VH0A 3MFJA 2EI7A 3FP6E 2ZPQA 5EW2H 4Q7YA 2HLCA 4VGCB 5BRRE 5J4SA 2QXIA 1PQAA 4UFGH 3KHVA 5DP6A 3MU8A 2Y81A 2M5TA 3OYPA 4FU8A 4CRDA 4YOJA 3UREA 3E0NB 1YKTA 1P2OA 1W11U 4X1SU 1C9PA 2OQ5A 2A2QH 3F9EA 2R3UA 1XVMA 4NA7A 1GBLA 1YYY1 2R0LA 2Y82A 3MNXA 2AFQB 5EQQA 3RDZA 1DPOA 1F5RA 1T8OA 2XC5A 4IW4E 2B9LA 1JRTA 1QA7A 4Z6AH 2EA3A 3NPSA 3A7VA 3UWJH 7LPRA 2HPPH 1XXFA 2Y7ZA 1CE5A 4R8TB 1W0KD 1NY22 2A1DB 2J98A 3GY4A 1O5BB 2A5AA 4DY7B 3B8JA 1UO6A 2GJGA 2FYQA 2QXJA 1KIGH 3RC4A 3M5NA 1DICA 1BTXA 4TPIZ 2OD3B 2B8OH 4DT7B 5ESBA 4HTCH 2ZTYA 1IOEA 1WCZA 2CK3D 3RXLA 3RLYH 5F53A 1PPBH 5DPAA 1EX3A 1TB6H 3HKIB 4H4FA 4HFPB 2PUQH 1S81A 3W95A 1NROH 1S0QA 1HCGA 1VITH 2PTNA 1EAWA 2WZQA 1TRNA 5L30H 1BTUA 4YLQH 1KXDA 4ABIA 4X6NA 3SQHE 4B2BA 3SJ8A 3UQOA 3ESTA 1C5PA 4D7FA 1O3HA 1TBZH 1C5LH 2SNVA 2A7JA 1ANCA 4X2WA 1OYTH 1QR3E 1LQEA 1MU6B 2P8OC 1GGDC 1TNIA 1C5OH 1C2HA 5T6DA 2ZU1A 2RFKC 4UFFH 4MPXA 1D4PB 1VR1H 2H2ZA 4WMFA 4UONA 3W94A 5HXFA 2YMSC 3RXJA 4B74A 3P8GA 2HNTE 3FN8A 5JPMH 1THRH 2XWAA 1UW7A 2P94A 1UTOA 4OS1A 3LC3A 2VU8E 3RXSA 1GJAB 1P2QA 3FFGA 2M2AA 1C5QA 2FZZA 3MI4A 1DM4B 2OC1A 4NCYA 2ZU5A 3GOVB 1QB6A 3M7UA 1QZ8A 3UR9A 1KYNA 3MH5A 1BOQA 1PQ8A 2VGCC 1W3CA 1G2MA 3K65B 3SJIA 2ZCKP 2RDLA 1ELVA 1VCPA 5L2YH 1J16A 5C5NA 1ANBA 1P2MA 4I33A 4I8GA 1GJCB 1QURH 2BD3A 2XC4A 1T8LA 1L2EA 3NCLA 1GBFA 3A82A 1SI5H 2GV7A 3LGUA 4OS6A 1O3OA 3T29A 1GMCF 1SGFG 2W3KA 3D23A 5DG6A 3STIA 1GCTC 1UVPA 3N7OA 1ABIH 3SV9A 2GKVE 3BIVH 1CBWC 3TK6A 4H6SB 3EQ0H 1MTNC 5F8TA 1ELFA 3PLKA 1O5GH 1H9IE 1BMFD 2EQNA 1SOZA 1TA2A 3SV6A 2J34A 4GLYA 3F2GA 1YPMH 4AN7A 3TLOA 3BTWE 3P8FA 1NTPA 2NU3E 3PMJA 4X6OA 5LPFA 1NC6A 1EZSC 1QQ4A 3VFEA 1K0HA 1C5SA 1YGCH 1DS2E 1Z8RA 3PMBB 5EJLA 3VGCC 4BTUB 5EOKA 2HNTC 1VKYA 4GSOA 1D9IA 1F7ZA 2F9UA 1C1VH 1C2KA 3RXFA 1LHFH 2J98B 2JDID 2O8TA 2HLDD 1QFKH 1EAUA 2GGVB 3SHCH 1CQQA 1O5CB 3F3BA 1ELTA 2A4RA 4NZQA 2WPIS 2WUCA 4K8BA 3B23B 1BJUA 2BYAX 1TABE 2ZDKA 2YNAA 1P06A 3O8CA 3SGBE 1ELBA 2V0BA 4OS5A 1GJ5H 2A31A 1VGCB 6LPRA 2BVRH 1OKXA 1D6WA 2VIVA 1OP2A 3QO6A 3HK3B 1FXYA 3ZVFA 1VCQA 1XUJA 4IMZA 2IOTA 4B75A 3QX5H 1GMCG 2PKSB 5FPSA 2F9NA 3ATWA 1P09A 3Q3YA 2PW8H 3ZZ4A 4AGKA 2PLXA 1TMUH 1SGQE 3ATIA 1S6FA 5KECA 1P9UA 1LO6A 2A0QB 2BQWB 2GDEH 2BY5X 1WTGH 4HZHA 5C94A 3ZZBA 1B7XB 1C2JA 2OINA 2Z9GA 3K6ZA 3S7KB 4OGYA 1QJ7B 2FTMA 3A80A 4BAQB 1WUNH 1ZR0A 4FUGA 1XKBC 4U32A 1L1JA 5EIYA 1QB9A 3A7TA 1BB0B 1HBTH 1TGNA 4ISNA 1CO7E 1O35A 3VXFH 3MNBA 1GHBF 3SW2B 1MTUA 2RA3A 2W5EA 1CHOF 1W0JD 4FUDA 2C8YB 4KKDA 2STBE 4AFUA 4DW2U 1GJ8B 1JOUB 1O30A 1BHXB 4H42U 3KQEA 3OY6U 1OX1A 1GJ7B 1DFPA 2QF0A 4A6LA 5SGAE 2UUKB 5CHAC 3A8BA 1UCYE 4X2VA 1C4U2 1O2PA 4ABJA 2O8UA 6GCHF 4E7RG 3EDXB 3QZQA 1K1PA 4I8LA 1RS0A 4I31A 4WXVA 3H09A 3GISB 2ZQ2A 2VB0A 1GI5A 1QBNA 3ZZ8A 4M9FA 1Z8GA 3PWCA 2G81E 3TIUA 1SOTA 2YNBA 1LHGH 1O39A 2Z3DA 4CBNA 5JBAS 1HAXB 1RTLA 5ESTE 4CHAC 3DA9B 2GV6A 4AFZA 2Q1JA 1NESE 3MNCA 1Y3WA 2R2WU 1TRYA 4NFFA 1MTWA 3ATLA 1D3DB 1U6QA 3SU3A 3ITIA 1Y8TA 3EA9A 2AS9A 3PWBA 4OS7A 1AO5A 1RFNA 3SZNA 3M36A 5DP4A 5PTPA 3T2NA 1GDQA 4SGBE 1SGYE 4Y76A 3LGTA 2VWNA 1MCVA 1P0SH 2BLVA 4XBCA 2OLGA 3LC5A 4K2YA 2AH4X 2HWLB 3GY3A 5HIYA 1P3CA 3WY8A 1GHAF 1FQ3A 4WY3A 3V13A 1YCPH 2P16A 1NRPH 1GHBG 3ELAH 3RC6A 1HAPH 1B5GH 1CHOG 1FY1A 2RDEA 3WWBA 1G32B 1EJMA 1WV7H 3UUZA 1GBIA 3GS9A 4IN1A 1TPSA 3KQCA 1MD8A 4NIVA 1GBHA 2GZ9A 4AG2A 1GBMA 4JYUH 2UWLA 3U98H 1QBOA 2Y5GA 3GYMA 3P8OA 2KX4A 3R3GB 4XFQA 6GCHG 4YO9A 4RKOB 4IMQA 4NIWA 1GVLA 2XBYA 3NRLA 1PPHE 2H9HA 2FI5E 2ODYB 1RGQA 4HGCA 1YCPK 1GI2A 2BDAA 1QGFA 1HDTH 1BMAA 2A4OA 4JK6A 1E0FD 2R9PA 1Z8JB 4X1QU 2OK5A 1O3MA 4BAOB 5A8ZA 1GCDA 1DVAH 3L6PA 2WPHS 2XYAA 3PMHB 4MNXA 1BRAA 1G3DA 3M3TA 2OC7A 5AVDA 4CH2B 2ZHFH 3E90B 1LDTT 1CA0C 4XE4A 4YESB 4F4OC 4AFSA 4U01A 2R0KA 1GDUA 1HRTH 4VGCC 1NRQH 3BTME 1C2EA 3LJJA 2FOCA 4NIXA 4I32A 1C5XB 2GZ8A 1FY4A 1EFRD 4FU7A 3F9HA 3ENSB 1J14A 4NSYA 3URDA 1SQOA 4NZLA 2BQ7B 4OM9A 4RI0A 1TE0A 2F3CE 3TJOA 4E05H 1KTTB 1TX6A 1GHAG 1TGCA 3IWMA 1PPZA 3GICB 5LPEA 2XW9A 4F49A 1C1WH 2F9OA 1UVTH 5E0JA 1O2XA 3RXOA 2A4GA 3N99A 3SV7A 3BTKE 4CRAA 1SLXB 1V2WT 1CT4E 1QCPA 2V3MA 2AYWA 2IJOB 3F1SB 1MH0A 4ACAA 3RUOA 3SU2A 1BUIA 1TNGA 3S9CA 3Q3KA 1AZ8A 4WH8A 1QRZA 2PUXB 2KAIA 3SQEE 1XUHA 3E3TA 1EOLA 2J4IA 1QA0A 3GY5A 4K60A 2LNCA 4JZDH 1RJXB 2HOBA 1O3BA 1SLUB 2OBQA 3F68H 3NKKA 3TJNA 2VIOA 5E0HA 2PV9B 3QDZB 5HYOA 1GWAA 1GHXH 1AFQB 5EPYA 1FV9A 1FNIA 2V6NA 1WTHD 5FPTA 4NWLA 1NZQH 3O8RA 1K21H 1V2KT 5EPNA 1ETRH 2QA9E 2BM2A 3RXDA 3CENA 4IGDA 2XBWA 1SFQB 4B76A 3KIDU 4HG6A 4U2WA 1GI7B 1GI0A 1UTMA 2QY0B 3ZZAA 2JH0D 2BLQA 4AYVB 2O8WA 3PO1B 1YM0A 2J95A 2BHGA 3VB3A 4WF8A 1AE5A 1C5YB 1W2KH 4XRNA 5GJ4B 2HNTF 3EYDA 1VJ9U 1A2CH 5FCRA 4X8TH 3SJ9A 4FETA 2QGRA 1O2GH 3PTNA 1NFXA 2F43B 4WWYA 5DN6D 4K8YA 3UTUH 4K5ZA 2ZTZA 3BTFE 3QN7A 1V2JT 1UHBA 2GVFA 1ACBE 2JIZD 3PROA 3A83A 5BPEA 3NUMA 5TJXA 2OC8A 2K7XA 1O2IA 2C8XB 1UVOA 3A89A 3AW0A 1THSH 1GBTA 1TX7A 3A8DA 1K1JA 1EPTB 2WPLS 5JBCS 5C5OA 2P3UB 3GCOA 1UTLM 4ISLA 2BD8A 1TPPA 2UUJB 3PV4A 3W1EA 4KP0A 1SPJA 1DUEA 1EUFA 3I29A 2AGGX 1A3EH 1FI8A 4I8KA 2VVCA 3UNSA 3TK5A 3QUMP
chains in the Genus database with same CATH topology
4FUEA 2ZWLH 3STJA 4O3TA 1HJ8A 3LGYA 1P02A 1LKBA 1EATA 3KQDA 2GT7A 3RXUA 4CBOA 3SOSA 1ZJKA 1QJ6B 2HVXA 1V2UT 3E6PH 3M3VA 2B7DH 3SUGA 2RA0A 2PSYA 4J2YB 3RXKA 1GI4A 2PGQB 4R0IA 3TNSA 3U8TH 1HB0B 1AY6H 1L4ZA 2DE8A 3A88A 2G5NA 1NFUA 1SGRE 2BTCE 3PLPA 1TQ7B 2G55A 1C2LA 1SHHB 1TNLA 4ZH8A 2ULLA 1AMHA 2JH5D 1QL8A 1G3CA 5DP8A 2A7CA 1DOJA 3DHKH 1LPKB 3SNAA 4Y8ZA 3V0XA 2O9QA 4FUFA 1OXGA 4INKA 2NU1E 2J2UA 3H7OA 5A8YA 1H4WA 1LHDH 4JMYA 1L4DA 1QRXA 3URCA 1O33A 2KAIB 1DSUA 2ALPA 3EBNA 4RSPA 3HK6B 1TFXA 2BOKA 1O2YA 1Y3UA 3BIUH 1DY9A 1ZGVA 4CRBA 3M5MA 5FHTA 1WQVH 3S9BA 3SU6A 4B71A 4WH6A 2EI6A 4J1YA 1C9TA 1GI1A 1Q31A 2WV4A 4A1VA 1Y5UT 3TU7H 1NFYA 1CSOE 2BD4A 1VGCC 2ZFRH 5GCHG 1QQUA 2FOGA 3RXAA 1QB1A 4O03A 1LTOA 1TX8A 1Y59T 1AN1E 1KY9A 3E1XB 2PKSC 4BOHA 1SGTA 3UNQA 4RN6A 5JBBS 1DITH 1V2NT 1TNJA 3FVFB 1EAXA 3IITA 2Y5FA 5LGOA 4LOYH 2F9BH 2SGQE 2RCEA 4Y0ZE 1AI8H 4MNWA 3RLWH 5C67A 1HAIH 2C4FH 1L1GA 1VJAU 3AAUA 4NWKA 1UK3A 2BY9X 1F5KU 2QN5T 2UUYA 1WOFA 1PPFE 2HALA 4ABFA 3BG8A 2P3TB 1GBDA 2H5CA 2G5VA 1ID5H 1QTFA 1M9UA 5HM2A 1HAZB 2PFEA 1NFWA 4MVNA 1UHBB 4ASHA 2W7SA 3RXCA 2BDGA 1EQ9A 2NWNA 4ZKNU 4WXIA 3Q3XA 3M3SA 1CGHA 5C3NA 3SO3A 1GDNA 1P2NA 2QXHA 1J8AA 2AEIH 2A32A 4ZUHA 8ESTE 1OOKB 5E2PA 4CR5A 2ZPRA 1DXWA 4B73A 4BAKB 1GJ6A 6CHAB 1GMHF 1FLEE 2FOFA 2O8LA 3ZZCA 1Y5BT 1SHYA 1LVBA 1FPCH 3M61U 3RXIA 1O3KA 2OUAA 4ABGA 1SMFE 7GCHF 2ZC9H 1BMNH 1OWDA 1XUIA 2TGAA 1O2NA 3BTQE 3LH3A 4XDEA 3BSQA 4YOIA 4U30A 1P2JA 3NXPA 2P3FH 1RD3B 4O9VA 1RXPA 2LIZA 3GY2A 1MBQA 4Y0YE 1NT1A 1V2VT 1BBRE 2QV1A 3MYWA 5EXNA 3HGNA 1P11E 1PPGE 1ESTA 1GJ4H 3RXPA 5A0BA 1BTYA 2GP9B 3UPEA 1XVOA 4ZXXH 5EU8A 1BQYA 5FPYA 1AKSA 3H5CB 3BG4B 1GVKB 1UK4A 2ZFPH 5E8EH 1DWBH 4UEHH 3G01A 3PMAB 2NU4E 2D2DA 2FI4E 5JB9S 3A7ZA 3D65E 1JIMA 1E34B 1VCWA 1UK2A 4XOJA 1ZLRA 1BTHH 1RTKA 4I7YH 2BD2A 4AFQA 1TRMA 3FANA 4FUJA 1PPEE 1O2UA 2VNTA 4OGXA 3SUEA 2SNWA 5EG4A 3SU5A 4ISIH 3KQBA 3QTVH 1TNKA 2CJIA 4A92A 1Z6JH 3O8BA 2BXTH 1SQTA 1Z7KA 2EEKA 4KTUA 1GMHG 3LJOA 1P03A 2P59A 2TBSA 1K2I1 1A0HB 3U1JB 4MPVA 1SLWB 1IQMA 3PLBA 4JYVH 1MAXA 2VJ1A 1HYLA 7GCHG 1S82A 1ZYOA 2ZO3H 5K7RA 2BVXH 3O8DA 3DD2H 1G9IE 4AGJA 3QWCH 2FO9A 3VB6A 1S0RA 4INHA 1C1UH 1E35B 2ZGJA 3ZVDA 1EP6A 2QCYA 1DLKB 3QTOH 1MTSA 3SU4A 1ESBA 1BDAA 3LKWA 3ZVCA 4UD9H 2ZCLP 2ZTXA 5EXMA 2PWXA 3SBKA 4NSVA 1F0SA 3A7XA 2BY7X 5FX6A 8GCHF 1T4UH 4JZIA 4PROA 3RMMH 2ZGCA 4LZ4B 1T32A 3S9AA 1AQ7A 1MZAA 2FX6A 2G00A 1ZOMA 3K9XB 2P93A 2ZU3A 3TJUA 3V3MA 4FVDA 3MO9A 3R0FA 1C1QA 3RXQA 2WYJA 3LGIA 2ZHWH 1W0ZU 1TGTA 2AMDA 4BTIB 1S85A 3A87A 4ESTE 1KDQA 2PSXA 1AVGH 1AWFH 2D26C 1EXFA 2QXGA 3LH1A 2XTTB 1OP0A 1K28D 1HAVA 1GL0E 4E7NA 2SGAA 2W3IA 1SB1H 4KTSA 3DT0H 1E38B 1GMDF 1V2QT 8KME2 4UDWH 1AFQC 2I6QA 2GCTB 2Z3CA 1DWEH 1MU8B 1E37B 2VH6A 4ZHMU 1GHVH 4FUBA 1Z1JA 1C2DA 3UIRA 3LIWA 1UCYH 2BXUH 2ZZUH 2G4UA 4IC5A 2TPIZ 2G52A 1J17T 1SGCA 2FM2A 2XCNA 5GCHF 4BANB 1C5UA 3TGIE 4Q80A 5T3HA 5FCKA 2TGPZ 4Y10E 5F6MA 5G4BA 2ZGHA 3BV9B 3PO1C 5ABWA 2QYIA 4FUHA 1AKSB 1K1NA 1WQSA 5EODA 3OTJE 1NN6A 4THNH 3RP2A 3T27A 3T62A 1IQIA 1SVPA 3SHAH 5E0GA 8GCHG 1H9HE 1THPB 2AERH 1PJPA 1O3LA 2VWLA 1D3TB 5EGMA 3SJOA 1UCYK 2ZU4A 1QRWA 3RXTA 2WUBA 3ZZ6A 2ZF0H 4LXBH 1A0LA 1GBEA 2AIPA 2H5DA 1EZQA 1W8BH 2ZDAH 2VIPA 1PQ5A 4CRGA 5GWZA 1FN8A 2BY6X 3Q00A 2Y5HA 2ZDNA 3SNDA 5HM9A 2D1JA 3PM3A 5F8XA 5FBIA 4ZROA 3GY7A 1NRSH 4CRCA 5C1XA 1XUKA 2K1QA 1EPTC 2G51A 2A2XH 3RC5A 1PYTD 2FOAA 2SFAA 3T25A 1GMDG 2TGDA 5I46H 2FP7B 3QGNB 4QT8C 1ELGA 3ZZ3A 3M5LA 2VGCB 1A61H 1C5VA 4MPWA 2ZQ1A 2GMTB 1KSNA 3M7TA 1SQAA 2FLBH 5GXPA 1ETSH 1MZDA 1LPGB 2B5TB 3HGPA 1ZHPA 1SFIA 5IYTA 1EAIA 2ZA5A 1TALA 1Y3VA 3BN9A 3RXRA 2AMPA 3MH4A 3LDXH 2ZGBH 1DANH 3ODFA 2FLRH 2HPQH 1O3EA 3BTEE 3C1KA 1LMWB 4MLFB 2FS8A 2VWMA 1O3GA 3GCHB 3RMOH 1ANEA 1KLJH 2OBOA 2VWOA 3ZVAA 1O34A 1P2KA 1O31A 4O3UA 3MH7A 2ZHDA 2ZDVH 3SI4H 2ZCHP 1QJ1B 3MO3A 1TLDA 1FN6A 1ZHRA 1AGJA 5T6GA 3SUDA 2AGEX 1ELAA 1QL7A 4ZHLU 2GT8A 1KDQB 4Y8XA 4D9QA 1P04A 3A8AA 1UTQA 1O37A 4YTAA 3GDSA 2PR3A 1HAVB 3UY9A 5K0HA 1O5EH 1XXDA 5FBEA 3HATH 2AIQA 1N8OB 4JZEH 1K1LA 2OP9A 9ESTA 4ABDA 4ZXYH 1YPHE 3RM2H 1RIWB 1OWKA 1CGIE 1ZRBA 2FOEA 1E36B 1FAXA 1ARCA 1QHRB 1SGFA 1ZPBA 4CREA 2J94A 1GHZA 1SLVB 3BTTE 4A5TS 1IQLA 2TGTA 4E06H 5C2ZA 4A1XA 3EA8A 1YF4A 1F0TA 1TGSZ 5F8ZA 2J9NA 1JBUH 1MKWH 2BDHA 1O5AB 1HPGA 1O3NA 1YBWA 1NRNH 2IPHA 4X0WU 3NK8A 4A1TA 1FAKH 1XX9A 5C20A 3GCTF 2ZDMA 2WV5A 1ZSLA 4GHQA 1SGEE 3HPTB 1DX5M 1V3XA 3E16B 4TPYA 3TITA 1P10A 1KXCA 4LZ1H 4AB8A 2ESTE 8LPRA 1BRUP 1A1RA 4GHTA 1T31A 1PYTC 4BAHB 1HFDA 2JH6D 4YZUA 1XMNB 4FUCA 3U8RH 1A4WH 1W7XH 5TCAA 3TPIZ 1LVYA 1W7GH 2B0FA 1MKWK 2A4QA 1P3EA 3TK9A 3A85A 3TJVA 1ZMJA 1WSSH 1NRRH 1D6RA 2ZHQH 4IC6A 3UNRA 2PKAA 2BB4A 1DXPA 2Z6BD 5FAHA 4O97A 2W26A 3KEEA 3EGKH 3GCNA 4BTTB 1ZGIA 1GVZA 1K22H 2ZP0H 2TRMA 3ATKA 1GG6B 4AG1A 2Z7FE 2BLOA 2QAAA 1ETTH 1RTFB 2CXVA 1S5SA 1G2LA 1C5MD 1QBVH 1TOMH 2FODA 4MQAA 1V2RT 2F83A 4UFEH 1HXFH 2ZFSA 1BT7A 4NGAH 4TY6A 1H9LB 1O38A 1ZPCA 1N6XA 3RMLH 1MQ5A 2FMJA 1HJ9A 5B6OA 1ZZZA 1HIAA 1GBJA 4INLA 4HI3A 2SGFE 3TNTA 2GTBA 4I8JA 1O2MA 4DG4A 3UWIA 3UQVA 3GCTG 4CR9A 1PFXC 4AORA 4Z0KA 3BG4C 3V7TA 1GI6A 3DUXH 3A86A 5H4IB 3T26A 4K1TA 1OWEA 1W12U 3DFJA 4AX9H 4WMEA 1BIOA 1HJAB 3SGAE 2ZGXH 1ZPZA 2Y80A 1YPJH 2ODQA 4K1SA 3UOPA 4SGAE 4DVAU 5A8XA 3LONA 3AVZA 1TYNA 3A81A 3K6YA 4ABAA 1FJSA 1O2JA 4RKJB 3UFAA 2QIQA 3EAJA 1AVXA 1GBAA 2R3YA 2ANKH 1TBQH 1Z6EA 2CF9H 5CE1A 3KF2A 2ALVA 4AOQA 4B1TA 1MBMA 1YLDA 2ZDLA 1G3EA 1AE8H 3SI3H 3TH3H 1XUFA 2XRCA 2FIRH 3OU0A 1BTWA 5A0CA 3SJKA 1DY8A 3AAVA 4GAWA 4ABHA 2JKHA 3PYHA 1FDPA 2BLWA 2FOBA 2C8WB 4TWYA 2VVVA 1SGDE 5DKMA 1K1IA 5CMXH 3Q76A 3SGQE 5TCCA 1TPOA 3BTGE 5DP9A 2BY8X 2ZU2A 4DIHH 1C5ZB 1LQDB 3Q77A 5HMAA 3SNBA 1FUJA 3MHWU 2Z9LA 1Z8IB 1O2OA 2CN0H 2Q6FA 5HGGA 1LPZB 1AFEH 3TGKE 3HKJB 4Y8YA 5DP5A 3MO6A 5AHGH 2DUCA 4X8SH 3ZZ7A 1JIRA 5I25A 1DUAA 1WAYB 2ZPSA 3BEIB 2H6MA 3BEFB 2CHAB 2ILNA 2O8MA 3MU1A 5C1UA 2HGTH 4Y7BA 6ESTA 1ZRKA 3P92A 1O2KA 1IHSH 1FY8E 2H1UA 1O3PB 3M5OA 5DP3A 1QY6A 3LPRA 4NA9H 1O2HA 1HAHH 1ZSKA 3M35A 2SGEE 3ZVEA 1SR5C 2OXSA 1P12E 2PKAB 2ZG0H 2GZ7A 1XUGA 1GBBA 2P95A 3VB4A 1TMTH 3M37A 2ANMH 2FX4A 1EJAA 1FONA 1O0DH 1X7AC 2C3SA 1F0RA 2FYRA 3LGVA 1SGIB 1IHTH 5DP7A 1C1RA 4ZHAA 1QIXB 1TBRH 2EC9H 4ISOA 1EB2A 3E8LA 4FU9A 2GCTC 5L2ZH 3ODDA 1H1BA 4MNVA 2EI8A 3VPKA 1UMAH 1HUTH 3RXEA 1V2LT 2BZ6H 2STAE 1GI9B 4JCNA 2A7HA 1EZXC 2SGPE 1BCUH 1ELCA 3ATMA 2FPZA 5A2MH 3P70B 1HAGE 1HIAB 3LT3A 2Q6DA 5JBTA 1AHTH 2FESH 3MOCA 1SGNE 4YT6H 1TGBA 3SORA 3GY8A 5GPIB 1IQFA 2WPMS 3IG6B 4NA8A 3RM0H 1IQGA 5T6FA 1MTVA 1O2LA 2C8ZB 1Y3XA 3GDUA 1AWHB 1Y5AT 2H9TH 2XBXA 2GDDA 3S69A 1EB1H 3FP7E 3D62A 1MQ6A 4X1NU 3DFLA 1ZJDA 3S7HB 1C5RA 1C4V2 1BBRH 1C5WB 1Q2WA 2XWBI 3A7YA 1S84A 1V2PT 1JRSA 3LOXA 2LPRA 3SU1A 2BDYA 1LCYA 4MPUA 4ZMAH 4MTBA 1ANDA 1EOJA 1CGJE 1O2RA 1TQ0B 2THFB 4NG9H 4MG3A 1N6YA 1HGTH 1OPHB 5DJ7A 1ZMNA 3QLPH 1O2ZA 1LHEH 1KXAA 2WPJS 3FAOA 4ABBA 1MD7A 3T5FH 1Z71A 4KELA 1NM6A 5A0AE 1DE7H 3I77A 3PB1E 1BBRK 1DWCH 1OWHA 4B2CA 4B2AA 2A5IA 1G36A 3C27B 4WJG2 4AYYB 2UUFB 3KNXA 3V12A 3ZZDA 5JYIA 1AUJA 1D3QB 1L0ZA 3L3TA 1AB9B 2GMTC 1GPZA 3I78A 1VZQH 2AMQA 2VIDA 3ZYEA 2OTVA 4BXSA 1P57B 3U9AH 3SNEA 1ORFA 3BEUA 3MU5A 2CF8H 4X6MA 4ABEA 2F91A 1C1NA 1MAYA 4FXGH 1ZTJA 1DDJA 3OSYA 4AZ2B 1NPMA 2J38A 1GJ9B 1V2OT 1O32A 1TPAE 1BJVA 1G37A 1CHGA 1AD8H 3GCHC 4I8HA 4Q7ZA 1ELDE 5ETXA 1ZSJA 2C93B 3E0PB 5FXLA 5GIBA 2JETB 2UWOA 3A8CA 1O36A 1AIXH 3FZZA 4BXWA 4ZKOU 2G4TA 4DCDA 2GCHF 1GHWH 4XSKU 1YPKH 1A5IA 2XCFA 2SGDE 3RXMA 1BZXE 3NWUA 1PPCE 1C2MA 3GDVA 1N8OC 5LH8A 1FZZA 2PGBB 2Q6GA 1HXEH 2ZFTA 1MMJN 1ZMLA 4M7GA 2FXRA 1TOCB 1LVMA 1SL3A 1AVWA 3SU0A 1CVWH 1BRCE 1B0FA 1SBWA 1RIWC 4GPGA 3P8NA 1F92A 2I6SA 3UR6A 4ZKSU 3VXEH 1T4VH 2BD5A 4DJZB 2A45B 4Y6DA 1OWIA 1V2TT 2UWPA 4K3JA 4KGAA 1INCA 4X6PA 2CV3A 3BF6H 2ZI2H 4UE7H 3UOUA 3ZZ5A 1BTPA 1EASA 3KN2A 2WPKS 4YLUA 3MU4A 1N1LA 2ZFQH