5C3TA

Pd-1 binding domain from human pd-l1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKELDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
publication title Structure of the Complex of Human Programmed Death 1, PD-1, and Its Ligand PD-L1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c3tA00
2PYEA 1ONQB 4I5BA 5T3ZE 3PL6C 4PJDA 5F96H 3S3PA 1BF2A 4KQ4H 1LGVA 4PGCA 3LN5A 2MNUA 3OKNB 3VFSB 3TZVC 5T33L 3CAFA 5CEYB 2DM7A 4RCAA 5T1LA 4MNQD 5IVXF 1M6OA 4PJGB 1TZIB 1ZVYA 1K4CA 1F58H 4G6MH 4XXCC 5C6PB 1QR1B 1OSZB 5DJXB 3L5WA 5D7JD 4ZAKD 3BJ91 2YPKA 2W0KA 1KB9K 4YUEL 4MWFB 1T1XA 4NNYB 5ETUB 3BUTA 3NPSB 4YJZL 4JFDD 3WE6B 4WUKH 3ZL4L 1WZMA 3P4MA 1FAIH 5DQDH 1T03H 1EEUA 5ISZD 3P0GB 3QNZA 4CRPA 5ESVA 1BEYH 3V7MA 4CVZB 4HPYL 2IJ0C 4F7TA 1AJ7H 4I18A 4WHYH 3BZEB 3QI9D 4P46B 3ARDD 2Q86B 2LVEA 2EDXA 2VR4A 3BQUC 4PUBL 2R0WH 1GGBL 4LOUD 1WWBX 3FMGH 4RWHA 4GRWH 2C3VA 1E4XI 2APVA 3SDXF 4FG6D 4C4KT 3L95B 1BIIB 1BZ7A 3WNLA 1S7VB 1EVTC 2WANA 3SKMA 2PW2A 4WWKC 4LCYA 2XN9A 2VXUL 5FKPB 4UT7H 5GGVL 1HQ4B 1QBLL 4FOMA 4J3UA 3CVHA 4J3OC 2W38A 4FS0A 5F89B 2GHWB 1ZT4A 1KTDB 3M17B 4PRIB 2BVQA 2J88H 4NQCE 2BOBB 2NY1B 4G8EB 2PYEB 4Y4FD 3UTSB 2V9RA 3AAZB 1WQVT 1U93A 3PWUA 4PGCB 4DQOH 1PZUB 1RMFH 1TVHB 5GZNC 4I4WA 1QRND 1XCTA 1YJDC 4KTEH 3S36L 4C56A 1I8IA 1BPVA 4Q58C 3GSRA 3BGMA 2VLKD 1NGPH 5ICYA 3GJEA 1CLOH 2AJXL 1YECL 3BIBX 3HRZA 2YPKB 3OPZH 4GRWB 1EDQA 4G9FA 4X8JA 5D5MF 2APBA 2I25N 1T1XB 3MRRB 4ZYKB 1IZKA 4NHUB 4YXLL 4R2GD 4KRPB 3RVWC 3RNQA 3BPNC 4X7DC 5LQBL 1A6VL 1N59B 3KGRA 2DTML 1KEGL 5CGTA 4HC1L 3H6JA 4EI5D 4RGMB 4O9HH 3MOAH 4NP4L 1C5DB 1LO4L 3QHZL 5HHOB 5L2KD 1RIUL 4MXQD 2CKBA 4LCCC 4YK4C 1D6EA 3MLVL 4JVWA 2W9EL 1R3LA 4XNZC 3SDCC 1JWUA 3QFJD 2OI9B 3UXFA 2RHEA 4FQIL 5FA4B 2XN9B 2IEPA 3TO4A 4PRHA 4D9RE 5JA9A 3VWJC 1KNOA 1HN1A 3A6CL 5B8CC 1IT9L 4K3JL 5EUOB 1QFPA 4M9OA 1AD0B 1MLBB 4BUHA 4NQDD 1S7QA 3F58H 3N85H 1F42A 2GJ6B 2JJTA 4JN2A 3B2VH 1ZT4B 2HFTA 2QR0A 3T0XA 1E28B 4GMSL 5GSVB 2BVQB 3VXSB 5GS0H 3PWPA 2ICWB 2CKBH 4X6BB 5EU4A 1U8LB 1BWMA 1WSST 5EBMA 4HFWA 1FJ1A 4APQB 4AT6A 3PDDA 2E27L 4OIAA 1UFUA 1XH3A 1K8IA 1MCEA 1HH6B 1F8TL 1U93B 1CL7H 5ACZA 4XBGA 2VN7A 1G7IA 2CRMA 2X9YA 3MPCA 5HY9B 1H15A 4C56B 1I8IB 3GSXA 3CXHK 2UUDH 4KUZL 1RZKH 5KSVA 1CICD 2VABA 2XICA 4H1LH 4QY8B 4NQXA 5ICYB 4NKOA 2K9UA 5EULV 3ZKND 5IFAH 2GQHA 1J8HE 3VXMD 4JFZH 1RULL 3ZYZA 1QYGH 2R0KH 5B38A 1UKTA 4X5LA 3MRGA 1CE6B 2FJFA 3CFEA 3MRDB 4RGOH 2BY1A 1I7UA 3SQOL 1FDLL 3RNQB 4EUPA 4N1HB 4M8QA 1RHHB 4XCFL 2PO6C 5GRXG 4PJ7B 1BVKB 3KJ6L 2KUTA 5E8OB 3QIBD 1KIQA 4HW6A 3QUXC 4A6YA 4Z7VF 2CKBB 4KHTH 1KENH 4KQ3L 1CTOA 1F45A 4JVPA 2HT3D 5KW9H 1KBGL 1WK0A 4TSBH 4M8VA 4GXUN 1YEHL 3FZUD 3GK8H 2FYYA 3TWCH 3VW3H 2W0LA 3IAPA 4XNMA 5I0ZA 2Z31D 4JM2A 1RUAH 2N56A 1EX0A 4ENED 4KKLC 4WNQA 4OLWL 5B3JF 1HKFA 4ZFGL 2DBLL 4H1LB 3NCCB 1K2DB 5K33A 5E1AA 2W0FA 5C0AD 2FHCA 1ROWA 1IAIH 1I3UA 3MZTA 1MVUB 4J2XA 1EH9A 1HXMA 1U3ZA 2Y23A 3RWIA 2EICA 3L5XL 1Q0YH 5EU4B 3RQ3A 1UQSA 2IALA 4S11A 1LK2B 5DD5H 4AT6B 2FWOB 1A2YA 3DJ9A 4X5WB 5GSRB 2COQA 4U1KA 5CGMA 4KVNH 2X4SB 4LSUL 4PTTA 1G0YR 4WFHD 1MIML 4PJFB 5HBBA 3PWNB 3OR6A 1A6TA 5FO7A 1GC1L 4OCXL 1G7JB 2LV4A 2CK0H 1R5VA 4N68A 5D6DA 2CSPA 2N4IA 1VPOL 4QOKD 3FOMB 2R2BA 3N9GL 3L3OA 4QYOB 3WBDA 5K9OB 1GXEA 2BRRL 3QQ3B 3QCUH 4P5KA 3MRGB 4FFWC 5D7LA 3ZKXB 1J12A 4JG0L 1NGQH 4NJ9H 3GBLA 3QDMA 5BRZA 5CLWA 2AK1L 4PRDB 2VXSH 1OF2A 1IAMA 3FB5A 2VLJA 2DJUA 1DQLL 5I18L 3BKJL 1CD0A 1V3KA 2BC4B 2BOCA 4MNGB 5LXGH 5IV2A 3DX7A 2HG5B 3REWA 5F1NA 3SE4A 4NJAL 5HD8C 5EIQA 3MV9B 2FYYB 4QF1A 3HR5A 1LHZA 5D9SB 4XNMB 2EKSA 1PG7W 5DA0B 5FA3A 4EQ2A 3BKYH 4ONGL 1OCWH 2A1WH 1D6VH 4WNQB 1DP0A 3EYFA 2EH7L 3REVA 5IT2H 4RGNC 4NM4H 4P46D 2H1PH 5I1GH 3ULVD 5E1AB 3DURB 3UROR 3MOQA 2F5BL 4FQHA 4YHIB 4UT9H 5DEFB 2XI9A 2HJKA 2CD0A 1UQSB 1Z3GH 2IALB 5DVMA 5IG7B 3GMLA 2OBGA 3WLWD 2OJEA 5EZIH 2WUBH 1SY6L 4HV8A 2YSSA 1KSRA 2CMRH 3GSVB 1TMCB 1D9KA 1FV1B 1VGKB 1ZXQA 3OTTA 1A6UH 1G6RB 5B39B 1UB6A 2NYYD 2LQRA 1EEZA 4PRID 2VITB 4XNXH 4PJBE 3DRTB 4P5TB 2NY1D 4UUJB 2VUOA 1F3JB 2NX5E 2OR8A 2PYED 2SEBB 3UTSD 4PGBA 1KLUB 2BNUA 3DLQR 4BSJA 1U0QA 3VCLA 1Z6JT 4P5KB 1YDPB 5DD1H 1B4RA 1A7OH 3G6AA 5T1DL 4QRPB 3HG1B 1NUGA 1XAUA 3QDMB 5L88L 1PX4A 2NY3B 4E5XB 5BRZB 2FB4L 2BFVL 2DM4A 1FIEA 2CDFA 4IIQB 2LFGA 5I17B 1CE1H 2B1AL 4K71C 3OJ2C 5IFHH 4LDLB 2DI9A 3ZHKA 2G60H 4JO3H 5ITBL 3TN0B 3DX7B 4FP8L 5CILH 1EO8H 1KEML 1P2CB 3Q6GL 4KRPD 4MYWB 3ZHLA 4OIIL 3JV4B 4QF1B 3QDGA 1EXUA 2EKSB 3SE9L 5D93B 4WV1B 1ITCA 1MFAL 4OFKA 1JGVH 1NLBL 1WICA 4DGIL 1B4JL 3SE8H 1L0YA 2X7LA 2AK4E 1EJOH 5HHOD 5FECA 1MUJA 3QRGH 5C0RL 5MENA 5HI5D 5CEZH 4M02A 1BAFH 3FFCA 5F9WB 3VI3E 3P0YH 4FQHB 3SJVB 5C3TA 3RUGF 3LKSB 4KVCH 3W82A 3GSUB 1IKFH 4K9EH 2BNQA 5C86A 4UTAL 2GFBA 2HJKB 3CLFH 5HYSG 3NFNB 5DO2C 2XN9D 1HYSD 5I71B 3QB7C 1E4XL 1N4XH 2HRPH 3GMPA 5IOPA 1MCFA 5DJCB 2XZQL 4YX2H 4BQCA 1IGIL 2OR9H 4LQ1A 4XNQA 1VADA 4IRZH 4ETQB 2GJ6D 1CG9B 1XF4B 5IQ7H 4K3EH 4O4YL 1UB6B 4DN4L 5TDPB 3L7EB 1MHHB 1ACYH 1B88A 2QQLH 4AG4L 3VXSD 3S35L 4F33A 4L3CA 4HIXL 1HQRA 3TO2B 4NC2B 3DARA 5M7QA 3IDMB 1I4FA 4M1DL 4APQD 4PGBB 4YFLF 1G7LB 1KC5L 2DBJA 2ZUUA 1MHPL 3KJ4C 5DD0H 4Z5RA 3HUJF 3LQAL 2BSTA 4CVWA 4DVRL 2VDML 4RA3A 5JXEC 4YBQC 3CLEL 4KHXH 4Q9QH 4C56D 5IHZA 2DQHL 4HIJA 1RZ8A 1B2WH 1BFOA 4AIOA 3JUZA 3O45A 4POZD 4MJ5B 2HLAA 2FHBA 1FVEB 4GW5A 4LHUA 4G7YH 4KKBC 1P4BH 2R29H 3QDGB 3SPVA 5B4MD 4F3FB 4GKSA 1CZ8L 1KIRA 2X89D 3SGDI 2NZ9C 1UYWH 3TV3L 2WBJA 4UI2A 2X7LB 2FGWL 1BVZA 4WFED 3W2DL 3U4EA 5FECB 1MUJB 4YR6A 4MS8C 5GS0D 1F4WH 5F6IC 4BM7A 4WENB 1JF6A 5E2WH 3GHBH 1MCRA 3FFCB 3V5KA 3UEZA 1XGQB 5GQBA 1S7UA 1T0MA 2JJUA 4OM0H 4M1GL 1VERA 3UTZB 3SDXA 3GMNA 3O4LE 1ZVHA 1VACA 3QWQB 4XRCB 4JPVL 1U95A 4RMTA 1A9BB 4NSKB 4QHMB 3BRDA 3CIQA 4XXDA 1RIVH 5DVNA 2VQUA 1SBSL 5TDOA 3PV6B 3IFPA 4PJAB 1R5WB 4XAWH 4FQCH 4HK0A 4TSAL 5K93A 2IANA 5DGRA 4KKCD 3IJSA 1VADB 5CD5D 1AFVH 2C3WA 2X5PA 1W72H 4FQ1H 3F12A 4X6CE 3PWPD 4F33B 5EWIL 3OHXB 3QUMA 3C6SB 4PJ5B 4PJCB 4ZAKC 3W0WE 4EXKA 4I48A 1HSAA 1CU4L 2EIZB 1DUZA 4ZPTB 3DGGB 3GMQA 4Z5RB 3L7FA 1CR9H 3OZ9H 5MEPB 4G7VL 5TGBB 4S1SH 1BOGB 4LLMB 2LE9A 3FO2A 3TYFA 2OCFD 2ITDB 1BX2A 4HLZH 5JDSB 3QI9C 3VFGL 3ARDC 4FN0A 4JKKA 1SEQL 3S35X 2ESVE 5D5MA 4NQEB 2VDQH 1I7TA 2YA2A 3RIFF 3QUMH 5JIKA 2DQIH 4TNVK 2YD3A 4FG6C 4WHCA 2CLZA 4GAGL 3V6OE 4GW5B 4QHUB 1IKNC 3LD8C 5F7EH 4OFYA 2R69L 32C2A 5IESL 1TTUA 5BZWB 4GKSB 2WP3T 4IDJH 1KIRB 3S8WA 2EYSB 2EDYA 2W9LA 3OJDA 2WLZA 4HH9A 4LGRB 1W72B 4XWOD 1GGTA 3C2SA 2F8VA 2VNCA 4WHYG 4GQ9L 2AEIT 1D5IL 2O5XH 5I8EA 2NY5H 4L29B 1MFCL 4P9MH 5T1KA 3T2NL 4IS6A 1OTSD 1IJ9A 1VACB 5I66A 2VDRH 1GGIH 3WIHH 3MV9D 4JRYB 1U95B 4X8XA 3LQMA 1XF1A 3JV6A 1BOYA 3G6JE 3TVMB 1JMXA 4ELKA 5D70L 4P4RA 4ELMA 2MFNA 3O2DA 3EKCA 3HLAA 3ESVF 2G5BB 3QHTC 1TCMA 1BGXH 1XIWA 3KR3H 5DJAA 5F7KC 5D71L 1JNLL 3LV3A 4LLWA 3QUMB 4JFYA 2CPCA 5HI3D 1OGAA 4I48B 4CN6A 2E7LC 1JBJA 1NGWA 4NZUH 1T89C 3DSNA 1KELL 4UMGA 4ERSH 3D0VA 1FSKC 1C5CL 3SDDA 4KK8D 1RUPH 2ZUTA 3C6LB 3BOVA 1NBYB 3U7YH 35C8L 1C5BL 3G9AB 1ZHNB 4M4PA 3O2DH 1UH4A 3P4OA 3VD5A 2CO7B 5L7XH 5IF0B 5ICXB 1JPSL 3T0DA 4RBPK 1D5XB 3KPRE 2DQUL 3R1GH 4P5TD 4D9QD 1D7FA 1RJYB 1MCBA 4NKMB 3K4DA 2JELH 2ARJA 5A2IH 1KT2B 1MFEH 3DXAA 3MRMA 5E4EC 2CLZB 3SOBL 4GKOA 4QRPD 3HG1D 1BQHB 3QDMD 3P0VL 2NY3D 1TQBB 3RDTB 5BRZD 1J05B 3P77A 2FZ3A 4L8BA 2GCYA 4YHOH 4P9HC 3OJDB 5FGCE 4ZNCD 4PG9A 5C0CB 2VLJD 1FIGL 4NO5A 4NRXB 5GIRA 3MRNB 3KLHD 4NPYA 2V7NB 4PV8B 4JGJA 1CGYA 4Z7VA 4FTVA 4GLRI 3TN0D 5I8EB 3MV7E 3CJJA 3IB4A 3KYNB 1HCVA 4JZOB 2GUOB 5I66B 5IMKB 4XVSL 1AGEA 4FZ8H 3KXFA 4PP2B 4P3WA 1PD6A 1U8KA 1U41A 2H3NB 1ZLWK 3RGVA 4ONHB 4X98B 4P4RB 2OTWA 3V7AE 4F7PB 2NY0B 2VDLL 3JWOC 2P5WE 2BMKA 3IDIA 1UXSB 1CICC 1RIHL 1N0LA 4M7ZB 1RPQA 2PCPA 2I9LB 2OTUA 5FYKH 1OW0C 3BKML 3SJVD 4PGDB 4Y4KA 5BVJB 3O6FA 1I1AB 2B5IB 2YKLH 2BVYA 3HE7A 3SDDB 3FB8B 2Q76A 4QRRB 1BREA 1T21B 4L4TE 1JF5A 1Z0MA 5I8CA 1D9KD 5D7SL 3RIAF 5C0IB 1E4KC 1FL5A 1I8KB 5C0NC 1RZ7L 2VUYA 1OAQH 5ALBH 2DI7A 4JLRB 2A6DA 5L0QC 4HF5L 1F90L 1Q9WB 2HH0L 1TETL 1QSFA 2R0LL 3O11B 1INQA 4H1LG 4KPHH 4PJBF 4BH7B 1LP9A 1HNFA 5L6YH 2VQ1A 2JJSC 1FLRL 3KNBA 3NFPA 3P30H 4XCYA 2CXKA 2HT3C 3FQNA 4YHKL 3DXAB 2CR6A 1YMME 2YWZA 3OXSA 1L7IL 1LDSA 1V7MH 2HTLD 1N6QL 1N7ML 4I77H 2AV1A 2O5YL 4OF0A 3GBNL 4ENEC 4R8WH 3EJZC 5HYQA 1RUMH 5CEZD 1P1ZB 25C8H 4P2QB 4XNUL 3SGKA 5BS0B 4RAUB 5IVNA 1UJTA 4GAJH 4H5SA 3WCYA 4XVTL 4TOYL 2C4FU 1P69B 5E6IA 5DK3A 2YPVH 4OZGE 2VJXA 4MD4B 4JKLA 4J12A 3S88L 3QDGD 5F7YC 5I75B 3B9KA 4LSSH 3QWOB 5J57B 1U8KB 2VXVH 3DOSA 3D48R 2FBJH 2J3SA 1R3HB 4UILL 4X4MA 5F8QC 1F4AA 1T20A 2OTPA 3DWTA 3ILPB 4CMHB 1WFOA 1J88A 5HHXH 1T0NB 1UEYA 1UXWB 2OMBA 1A6WL 2OXGA 3FFCD 4KUCF 3SKJH 3VI4E 1L6ZA 3UJTH 3V5HA 3VI3F 4JO4H 3BDYH 2X40A 5BV7L 4N5ED 1NCWH 1N26A 3BD3A 4Y4KB 4ZUTB 3KYMA 2ZUQB 3BKCL 5H35A 5KSBE 4MVBD 1U3HA 3U2SB 3MUGB 4BZ1L 4NO2B 4PJEE 4MSWA 2O61A 2YK1L 3GSWA 2HKFL 3NCJH 4X7SH 4GSDL 5E94B 5FGSA 3OMZA 5GGQL 3X17A 1KN2H 4GBXA 2EIDA 3MJ9H 4DZ8A 3E6FB 1P6AB 5INCB 4PJ5D 1INQB 2YRPA 1LP9B 3OV6A 5JW4Q 4N0FA 2VQ1B 4UQ2A 4X7TB 5DQJA 3HFML 2Y6SD 4XCYB 5IW6A 3UJIH 1E27B 3FQNB 2ADFL 3NPSC 3VXQB 2F5AL 2ZG3A 3WNMA 4IRSA 1UA6L 3FT2B 1ADQA 3WS6A 1FGNH 1JNHA 1KPVA 4HGKC 2ZWLT 1Z0NA 4MLIA 1KFAH 4P46C 3HE6B 3ULVC 2X6MA 3B5HA 1VEOA 4G3YH 1U9KA 4JFEE 2OQJA 2MPAL 5B39G 5EN2A 4NQED 2CGRH 3ECBA 3U0PA 3OGCB 1O0VA 2HWZH 2XZCH 3FN3A 4JM4L 3ZE1E 2R1WA 2VR9A 4G43B 1IL1A 4AMKH 1EO5A 1FN4B 2D7NA 3FB6B 1N0XH 3ALXA 3QIWB 1T2XA 1J0YA 1QFUL 4TUJA 2Z91B 1L7TL 1FBIL 4OCRH 5HGHA 4ODVH 5DJ8B 1NFIA 1J0HA 3GMOA 4IHOB 1G9NH 3BN9D 4OJFL 3UTTE 1T20B 2AEPL 3BGAA 3FCTB 5HHME 5CJXC 1NGYB 2DLGA 2NYYC 2MHAB 4PLJD 3IS1X 2P44B 3E3QE 4TNWF 1QFOA 1X4XA 5J9PA 5IQ9B 1CIUA 3K2UH 3PWVA 5DUMH 1U3HB 4JRYD 3D2UA 3MROA 5DDHA 4YHPA 3FONA 1UWEL 2V6HA 4R4BB 2VDNL 3TVMD 3NACL 2PW1B 4N0CD 3O2WL 3NZ8A 1JHTB 4MSWB 1SJEB 1IBGL 2DIBA 4XPTH 2BNRB 4ZOAA 1JHKL 5FO9A 5JW3L 3C5SB 2VR5A 4QXGL 4M5YL 3QDJB 2L0DA 4DZ8B 4LBEB 1C12A 4NQCA 1N8ZB 2JF1A 4JN1H 1RV6X 4GKZA 4U6YB 1QA9B 1VEMA 1IC4L 4LASH 2HJLA 4F9LA 3C6LD 4BK5A 4XP1L 3BWAA 2JE8A 4UV7H 1XR8B 5F21B 4LVNC 3GJFA 3HMXH 4I18C 3HC3L 4LSQL 4WFFD 1E4WH 5D6CA 3ZKMD 2CXGA 1BD2E 1JPFA 3CFBB 3HI6H 4OF3A 1CI5A 4BZYA 1MNUL 3RBSA 3WJJA 1CBVL 3DV4B 4D9LL 5I15L 5DJ6A 1FGVH 2A38A 4G8IA 4OZ4A 1FORH 1HINL 4LQFH 2AGJL 4KROB 4P3CL 1FVCA 5JW4N 1HYSC 1G7QA 1S7XA 3RDTD 3P4LA 1CIDA 5HGHB 3OKOA 4CMMA 5GGTA 3A67L 4RFEA 5C0CD 3B5TA 2YUWA 3QUZB 4S1DC 1U3YA 2I07B 3NOIA 2X4QB 5F71A 1KIUA 1YEJH 4LCWA 3PDOA 5C0BB 2HT2D 1I3RB 2X4RA 4LPCA 4ZTPL 1WT5A 4KU1A 5J9PB 3RU8L 3BPLC 5DD3L 2HLFC 3THML 3U9UA 1E6JH 4APQC 1H3PH 4YHPB 2XQYK 5CZKA 1ED3A 5CHNB 2P5EE 1KGCE 4HUNB 4ODHL 4XP9L 4FZEH 3G6JF 4W4NA 1NCDH 2P7TA 2X09A 3WDJA 5ALCL 2NY0D 3MRPA 5T5NF 1QBMH 3LKOA 3QSKB 4BFEA 1CFVH 3CU7A 4PGEA 4FXGA 3VXNB 3CC5A 3I6GB 1C16B 1XEDA 2EYRA 4POZC 1C12B 4QXUH 4PJHE 4I0PA 1I1AD 3MOBL 3UTQB 4ODUA 2BDNH 1ZHKA 3O4OB 2YZ8A 4XCEA 3WL9A 3SDDD 5J8OA 5IB4A 1FO0A 4MLSA 5HGBB 3V0WL 4IOFD 4UNTA 2J4WH 3ET9F 2GK2A 4JG1L 4MZ3A 4RGNE 4HXBH 5CSGA 4CADA 1YEKH 5EU5B 1KB5L 1HHGB 4M7KL 1MEXL 4P2RA 4Z0XB 4HUXA 3D9AH 4GG8A 5FUOH 6CGTA 5ID0B 2FEDC 1G9EA 1Z5LA 5GS0C 5GJTL 1P7HL 3L9RA 2GAZA 1KACB 5JOEA 3VFNA 3MRBA 3DXAD 3ZE0E 2V5YA 1JFQH 3N50A 4MX7A 4QXTB 4YQXH 3V52L 2JCCB 1G7QB 3TO4C 2MTPA 3AY4A 3WFZA 5KVDH 4YZFE 3OKOB 2OL3A 5DHYB 3OGOE 4LKXB 2ZPKL 4KKCC 3RVUD 4MJIB 4P2QD 5FFLA 3ZHDA 5CEXA 2EDEA 3FJTA 5CD5C 2JJTC 5A2KH 5BS0D 5FYKD 4U7SA 2DJ4A 3L3HA 4LCWB 3MLSL 1CWVA 4X80H 1R24B 4XPAL 2J8UB 5A1AA 1CXKA 3MREA 3BP4A 4NUJA 4ONOA 5CZVL 5TDNA 4ZSOA 2C5DC 5JORB 2NXYB 3OX8B 2ZCLL 4LAQH 4ISVB 4C83A 4HJGA 1KYOK 2VXQL 5CIPH 1X7QA 1AI1H 1G6RL 1ZLSH 2XXMB 2QV2A 1Q1JL 1Z9OA 3CZJA 2DWDA 2Q7YB 4YHMH 4Y5XB 3KWWB 1DBKH 2YEZA 4GAFB 5TQ2L 5J1AB 2DB8A 2ITCA 1PBYA 2XWJB 3NPZB 5IR1A 1FNFA 3CC5B 1H8OA 1K3IA 2YBRA 4Y4KD 1NMBL 1YNTA 1FNSH 4ZPVB 1PG7H 5BOZG 1MJ8L 1SBBA 2JTDA 2FX7H 4WU5A 4XCEB 3HE7D 5IB4B 5IIEA 3PXJA 3ZKXC 1KXTB 2JIXA 3BZFB 4DCQB 5D1XA 4XVUD 4CADB 2ED7A 3EIFA 4FABL 2YC1A 4IJ3C 4G5ZL 4UT6L 5DJZA 5HI4C 4X99A 3CFIC 2ATKA 4YDJA 5EIIA 4XWOC 3HR6A 3UZVB 3WN5A 2YXMA 1D5ZA 4I1NB 1NFDE 3L9RB 1TZHB 3EBAA 4OB5H 1FL3B 1FE8H 3IKKA 5DC4B 1U8MA 1I3GL 1OTSC 4XP4L 5TFSL 1CVRA 4L8CA 5L2JA 1S5HB 2UVFA 3ULUC 3JWNC 1S9VB 1YNKL 4WI8A 5CIPB 4HWEH 1JF1B 2E7MA 4YXKL 3DI3B 4HT1L 4ZTOH 1CDBA 2R0ZH 4CJ1A 4MMZC 1G84A 3RWHA 1EPFA 3ARGA 3HE6D 1NCCH 5CEXB 5I1JL 3NABH 3DVGA 2HP4A 3L3HB 4LCIH 2O5ZH 1S5IH 4P0DA 1CGXA 1RK0A 5HI3C 4NUJB 4Y1AB 5TDNB 4OZGF 2BVPA 4ZSOB 1BJ8A 3QIWD 5IB5A 4UU9A 1FFNB 4NFBA 2D7TL 3RWCB 3PUCA 3QEGH 4KK8C 1FVDB 1NC4B 1X7QB 5EU6E 3BZ4A 3V0VA 1A1OA 3A6OA 3G5XA 4K8RH 2AJVH 5DRXB 1BQHG 3MO1A 2YEZB 1L9MA 3CVIL 4X6EA 3DIFB 4ODBD 5D6DC 4PS4H 1EERB 1HKLH 1P9MC 4R0LB 2YD9A 5IGXL 1JYVA 2EDFA 2YBRB 3HNVL 1CT8B 3MGTA 2OM5A 3CX5J 1T04A 4P5TC 5SWZE 4L1DA 3U46A 5KSBF 3O6MH 3TIDB 1U3HD 5CAYB 1JGLL 3DBXA 1AP2A 3NIGE 5ECJE 3SKUD 5KS9E 3KHQA 5ESAA 2R4RL 2JIXB 3SKOA 1MELA 1CF8H 4JO2H 1N64H 1VGEL 1TXKA 1YQVH 1YYML 2BNRD 2YPLA 2NY6D 2NY3C 4NDMA 5AYUH 4FQXB 4GRMA 4Z6AT 1C1EL 5ADOL 3L1OH 2GY5A 4LNRA 3RA7H 2D2OA 5DJZB 3QDJD 3UX9B 5E08H 5GGSB 1CTNA 2NW2B 3IS0X 3W11C 1KJ3H 5DJ2A 1NH6A 3U7AA 3IGAB 4P4KB 2NX5A 2VLLA 3TN0C 3OR7A 3BGFC 3GI8H 4L8CB 5L2JB 2F54A 4MNQE 4LSTH 3QXUA 5D93C 4QRQA 3MBEA 4M61A 1GOGA 2ADIA 3FQXA 1TCRB 4OV5B 4GRLA 3BW9A 1IC5H 1AD9A 1AGBA 3QEHB 1QVOB 3TC9A 4D0DA 4H25A 1DL7L 5GS3A 3DVGB 5FHAH 1ZT7B 4M03A 2B1HH 3VFMB 2IADA 4JFDE 1RK0B 2GTWA 2Q8BL 3QXTA 1AXIB 4WY7H 1R0AL 3FB7B 3TBVB 4KROD 5D7KD 5JR1H 5I1EL 3WNKA 2EC8A 2P48B 3B2UD 3L3IA 7FABH 5ISZE 1YEDB 3DX6B 1S3KL 4RFOH 4OCLC 3MGAA 3V0VB 1IAIM 5D2NB 3EO1B 2A6KB 5F3HB 3GI9L 3WSQL 4MCYA 2IPUK 1D9KC 3QUZD 1F4XL 3N1FC 5FYJL 1TQCC 4KV5F 5EFIA 1IGTA 1SJHA 2AXJA 5C09A 2AABH 2FNBA 4OD3L 5FDWA 5C0BD 3GIVA 4UOJA 1DE4B 1CK0H 3QA3B 3BEVB 3VMPA 1T04B 4OQTH 4DW2L 3FN0L 4O2EB 5DJ0B 1AQKH 1G7HA 1JCKA 4F57L 3TJEL 2BJML 3FRUB 1RK1A 2D03H 2CLVA 5ESAB 4RRPG 3WO4B 2HTLC 3VFPA 2YRZA 4CBPA 4U05A 3QG7H 3CPLA 1KPRA 2DICA 1A7RL 4HX1B 3HCVB 4GS7C 3RWGA 5FIEA 1PKQE 1JRHH 5C2BH 1M7DB 4JREB 2PYFB 2WNGA 1FFRA 1L4IA 1DBJH 5DJ2B 1NCTA 4JQIH 4K9EC 3QXWA 1F3DH 3OR7B 3QUYA 3MA9L 2PXYB 3GSQA 3SY0B 4DFHA 1QRNE 1HIML 2F54B 4J1UB 4B7IA 2VLKE 4ZOEA 1VFBB 3EOTL 3MBEB 3BMVA 4PJIF 5B3NA 4KDTC 3V5DB 2VDOL 3FO1B 4NBYB 2DD8L 3BXNB 1I7RA 2EC9U 3BPOC 3MX0A 2ZSWA 43CAA 4M6NH 3P3YA 4N5EC 2NNAB 2YUZA 2GTWB 1TJIH 1OGTA 4ODSH 4S1QH 4DGYH 1W0VB 5CJ5A 4O02L 2AXGA 2E8ZA 1F4HA 2HVKA 3MXWH 4XPHH 4HIIB 4NN7B 1M1SA 4RAHA 3TT3H 5L2KE 4ALAL 3QXDB 1I1RA 1IFHH 4H0IA 1V7NH 1YYLH 4MJID 2PTUA 4MCYB 1WISA 4WHTA 5A2LH 3M8OL 4ZFZB 4FQQA 4PLKC 1TIUA 5F9JA 4B7LA 3L3KA 5GRUL 2FJGA 4LCWD 5C09B 1YPZF 2Y5EA 3GIVB 3QFJE 1BBJA 1FNGA 4R7DA 3DRQA 3PHOB 2B2XH 1F11B 3KLAB 1VA9A 2Y6SC 3ESUF 5HHQA 3O3DA 3AB0B 5IHBA 2J1KA 4XBEL 2QHRH 3BDBA 1XR9B 4RAVA 4NQDE 3RHWK 5MERB 4LLQA 2X42A 2JJVA 3K4AA 2BVEA 5EO0B 4P48A 1ZHBA 1KPRB 5A2FA 2YMXH 4OZFA 4PJXF 1B90A 4JFQB 5J12B 5I8KH 4DEPB 4N90D 2C1OB 3O81A 1FFPB 4X6CA 3VE0A 1IQDA 3W0WA 4HUMB 1JGEB 4I0PD 2NY4D 3EO0B 1J5OL 3QQ9D 3UYRL 3Q6FA 3I02B 3I2CH 3MSPA 5D2LE 3D39A 3BEWA 5JQ6H 1LO3L 2EEDA 4FHBD 3U4AA 4DVBB 4JY5L 3NTCH 4GT7A 2HT4D 2UZIH 4OF6A 4LPVA 3U6RB 3NAAH 1DZBA 1M71A 3P2TA 3C5ZA 1X5IA 1XGYL 2ID5A 2FEEL 2VH5H 2H9GA 4P2RD 5J6HA 2XRAL 3BN9C 4JFOB 5ITFA 3VXME 2ZCKH 3IXAB 2FD6L 4M48H 1F6AA 5FYLH 3RPIB 4PLJC 2DWEA 3LRGA 1I7RB 3RX8A 2ZSWB 5T3XL 4OZIF 5KN5A 1CFQB 3ZE0F 3V6OA 4ZUUA 3IDUA 1CGSL 2I60L 2WIMA 3MCLL 4R3SB 2C4XA 3TVMC 5KVGL 2FLRT 4N0CC 5EB9A 3ARUA 1AQDA 4OZHB 3LPGA 3DUSB 3JVGA 4ZFOB 4MAUL 1JGUH 2XG4A 2DLFH 3MRQB 3CMOH 3ARBA 3L3JB 3VXUB 5ANME 5F97E 5F9JB 2FJGB 2R56H 4M9PA 1MFDH 3PJSB 2F58L 3DUUB 4NT6B 3TBWA 1NAML 4HCRA 1HZHL 4Y89A 3WFCH 4OI7A 1NEUA 3WNOA 2V5TA 4CU7A 1CDGA 5FCUH 1CDJA 1CXIA 4RAVB 2UWEE 1CXFA 4LLQB 1A6ZA 2A6JA 5C0AE 2IH3A 3TNNA 3D3VA 2O26U 4U6VH 3K7UA 1MQ8A 4TVPL 4U1NB 4BSVA 1IQDB 5HHPA 1Y0LA 2A74A 5C71A 4EN3A 5I1IL 4RSVA 1LNUB 4WFHE 3STLB 1FH5L 3BEWB 5DUBA 5EOCJ 1CDHA 3WD5H 5HHVH 2JIXD 3LPFA 3HC4L 2J8HA 1TLKA 4GAYB 4UIKL 5I8OL 4LVHB 5EBWB 2XFXA 1M71B 3K1DA 4FQXD 4HPOH 4OBRA 5J6HB 3HNSH 1QACA 2B20A 4OLZL 4QOKE 3LEYL 1JI1A 1ZHLA 3DTXA 5C0DB 3KPRA 1NFDF 5CZXC 3MLRL 4P4KD 3OJVC 1MCDA 3QUKB 2HT2C 3KS0H 5LWYL 4JFPB 5KN5B 1G1YA 4ZUUB 1DDHA 1T22A 4K23H 4U4BA 3RVVD 2XV6B 1WBXA 4K8RD 4PJGE 3CMGA 3MLXH 5E8NA 4NZRL 1GGCH 1XGUA 3PHQA 3BIKB 4JZNB 1H5BA 4QWWD 3ARGD 5IVXB 1TJHL 3EDEA 2NY0C 4DWHA 3UMTA 3GRWH 4HWBL 1AH1A 1XIWC 4W68A 3VXOB 2Y5TA 4FXKA 1I9RH 3PL6A 1ZVSB 4DN3L 3MV7A 3WV0A 2YA0A 4HG4J 4LRNL 4CDHA 2AW2A 4YHNB 4AH2A 3V4PH 2X4NA 2B5IC 4Z76A 2HN7A 2VZ1A 3ZMRA 3SDDC 1J87A 5C0FA 5F7FA 4IOFC 2VL5A 3FFDA 4JKPH 5ACMA 4XXCA 5FM8A 3JWDC 3ULVE 2KQNA 3GJFK 4ZNEE 1OOAA 3DNKA 1EO7A 2IH3B 4KZDL 3D3VB 1CGWA 2P5WA 3EOBA 4ONFL 3PF2A 2Z8WC 1K6QH 3VRJA 2W1NA 5FB8A 5H37H 1U8HA 1MIEH 4RISH 4OLXL 4GW1A 4F7EA 5E1HB 3QZWA 3PGDA 3LKNA 1ZS8A 3OF6A 1A3RH 5I1CL 4LVEA 1BQLH 1FFOB 3H3PH 2IFFL 3V2AR 4AEHL 1VSCA 4PB0H 1MRDL 5KS9F 3TIEA 3MBXL 2GIYA 4DAGL 4L4TA 4YDIL 3RWDA 1EEYA 1HHJB 2YPLD 4XB8A 4PRIE 2FIKB 4UB0L 4FMKA 4GW4B 1EGJL 5I9QB 4F7CB 3T4AA 1PJ9A 2AJSL 4K94H 1QFHA 1GRWA 2PYEE 3P9MB 3E6HA 4G6KL 5JIHA 3UTSE 1A3LL 5CJ8A 4BKLB 3MFFB 4HIHA 4WWKA 2EEAA 4WHDA 1YEFH 3W9EA 1HHKA 4F58L 5MEQB 2UVEA 4O58H 1EBAA 2LAGB 2PXYD 5JUEH 4N9OB 1SM3H 1IAII 1T22B 2F54D 3D0LA 5I75C 5EZJA 2BSSA 2A9NH 1QD0A 1WBXB 1T2QH 3HB3D 5GISL 3CGTA 2AJ3B 3MBED 3PHQB 5DRZB 4F7MB 4X6FA 4OD1H 3VFUA 1GAFL 3BD5A 4NGHH 1SVCP 4GRWE 2KDGA 5JHLL 1BJ1H 5FYKU 1UKQA 1B6UA 3B6SA 3C08L 4C59B 2CO6B 4DKEL 2EIEA 4N0RA 2JK5B 4Y4KC 1F6FB 3WFHA 1S7SA 3I84A 1UM4L 5EIVA 1GOHA 4MAYB 3LCYA 4EDWH 3LKQA 4HLJA 3HE7C 1K4DB 3IU4H 1MWAL 5HHOE 1RU9H 4XVUC 4B50A 3AREB 5CP3A 1PYWB 5BOPA 3VWKB 2QADD 3VA6A 3SGEH 5GPRA 3VRJB 3B4NA 5FB8B 5C09D 1FC1A 4R4ND 5EA0H 3V4VH 1IGJA 3RIFK 1U8HB 1F4YH 1F13A 1UGNA 3PXHA 4PR5B 4JQVA 2XN9E 4UTBL 3PGDB 5IMMA 1OLLA 1XF5B 1MCPL 1UCBL 1EA9C 2PNDA 5EUOE 4LHJB 4PJEA 3TIEB 2J7LA 3FTGA 2GJ6E 2ERJB 1MREL 3VXSE 5CP3H 1ZA6B 3FT4A 5SWSB 3MYJB 1E0OB 4Q2ZB 4OCSL 3HE6C 1AY1L 1MI5A 4XVJL 3FQWB 4KJPC 1WCBB 4YUEH 2F53A 4Y2DA 4LVOB 3QUYD 1HILA 5TH2A 2PTTB 1FZKB 4ETYA 1INEL 1TJGL 2RR3A 3ZL4H 5EC2A 1BFSA 3PHSA 3D0LB 5EZJB 3B9KC 3U7WL 4C56E 2HJFB 4XC1L 1A5FL 1RZIB 1N5AA 4L8DB 5HGAA 1YC8A 1MVFA 3VFUB 4HPYH 3HA0A 4OCWL 4KKNA 4WEMB 4JFEA 1U36A 5J1TC 3B6SB 4PUBH 5IW1A 1GGBH 2DYPA 5HYEA 3IAQA 1HHIA 4OFVA 3G5VA 3GGWB 1U3HC 1G7PA 1S7SB 4PPTA 4WGWB 1MHEA 2VXUH 4PJ7E 1ORQA 3OAUL 5GGVH 4PV9A 3WEXA 5JMRA 2N7AA 4WFEE 1QBLH 1AR2A 3UTTA 4LEOB 2AQ2A 2NY6C 3VXUD 4ORZC 3BH8A 3VG9C 1LD9B 3INUL 2DQEL 1IGJB 4KI5D 5DTFA 1JN6A 4X9GA 5ENWA 2ZOLA 3BWUC 1KULA 2PO6A 5IMMB 1G7MA 1W2KT 1P7KA 4H20L 5HDBE 3PWJB 3SO5A 5DJDA 3GEWB 4IRSC 5C9KA 3FTGB 1G9NC 4JY4A 1GSMA 1MH5A 4HC1A 3P40A 1YMHA 4UDUA 3S36H 5AUMA 4U0QB 3T77B 3FT4B 3PWPE 3A6BL 5LAXB 1JZ3A 5FYLD 3ZDYE 4XHJD 2AJXH 3AU1A 1YECH 1UH3A 2GW5A 1MI5B 3GSNL 2Q6WB 2F53B 3MNZA 1I1YA 1WF5A 1OL0A 3D39D 2HKHL 4X4YB 4YXLH 4PJFE 5BMFL 3C5JA 4KROC 1CD1A 1DN0B 5LQBH 1A6VH 5IUSA 2FRGP 3MRCA 4FNLL 2DTMH 1DLHA 5C8JB 1QSZA 4U1HB 5K9QG 1KEGH 3VXPB 4HC1H 3RWEA 4HH8A 5C9JA 4NP4H 1BD2A 1JGDB 1LO4H 3QHZH 1RIUH 3MRLA 4PRPB 1AKJA 3VFOA 4UDTA 5C7XL 5IW1B 4MDIB 2DYPB 1HSBA 3MLVH 2W9EH 1T7ZA 4JO1L 4NO0A 4FQIH 3BSZL 4RA0C 5HYFA 3FRPA 4OSUL 2IGFL 4PB9L 3RIAK 2D31A 3A6CH 1IT9H 3F7VA 4K3JH 1W0WA 3T2PA 3T8XB 2D7PA 4UAOC 3OWEA 4UINL 4DKFL 3RNKB 3C8KB 4MNGE 4XMLL 3TBTB 4Z0BL 1Z9LA 1OAKL 1XGRB 4GMSH 3GMMB 4MQ7B 1DQML 2R2HB 3MV9E 1PLGL 4F15C 1CXLA 3D18B 4LF3A 4Y16B 2IH1B 3X13B 3HAEA 4KJYA 2E27H 5EO9A 3H9YA 4FQPA 3CVHL 1VB9A 1F8TH 1WWCA 4F9LC 4NFCA 4ODWA 4JY4B 2WSKA 1MHCA 1A4JA 1RZFL 1YMHB 3D3VD 5DWUL 4PJ8A 3FQRA 5ESQA 4KUZH 2P4AB 1K8DA 2AJZB 4RNRA 4PYHA 4GG6F 3ZZ1A 5HGDA 5FKAA 5KJRL 2DQDL 1RULH 5CSZA 4PJHA 3WJJC 1B0WA 4JJHA 3HZVA 5CP7A 3IVKB 3RI5F 2QQNL 1VDGA 2AQ3A 5IEHA 4U1GB 5CUSH 3C5JB 4BSWB 3SQOH 1FDLH 3MOAL 4JCLA 2X70B 2FATL 1FG2B 4XCFH 2XA3A 5DYOB 2CIIB 2CIKA 2AKRB 3IDNB 1KJ2A 3KJ6H 1QRKA 2E9WA 1Y18A 4D9QE 4WTWA 4U1IA 5HHNA 5DFVD 5DR5L 4UDTB 4ODXA 5JO5A 4R96A 1HSBB 4KQ3H 5TF0A 1WT5C 3MUZ1 1KBGH 4PBWD 4QRPE 3HG1E 3MCKA 3P9LB 3QDME 1YEHH 3PGFL 1CQKA 4GKNB 5BRZE 3CU1A 4JY6A 3JV0A 4PJGF 2MMXA 4QT5A 2A0LC 2VLJE 4ZO6A 4OLWH 2Y7QA 3F7VB 2CDGA 1W0WB 4DGVL 5BZDB 3F7RA 1MRFL 2IQAA 3U9PL 3VRLE 1RURL 2DBLH 1JP5A 4ZFGH 4YC2C 5KAQG 4I0CC 4P2OA 2A2QT 2J6EL 5BCAA 3HC0A 1S9WA 4KZEL 3B43A 1RZJC 3L5XH 4I0PC 2NY4C 4IRJB 5A43C 3DO7B 2DIAA 4MQTB 1OVZA 4MAYD 2ZG2A 1ND0B 3RVTC 3BE1H 4LSUH 4LLDA 4MB4A 5C0JA 2HT4C 3BIAX 3P9WB 1MIMH 5F1IA 3H7LA 1I9JL 1TPXB 2CRYA 3ULVF 3ARED 1FG9C 4JAMB 4EIZC 5IFAL 4JFFB 1Q38A 1VFMA 3LZFL 3VWKD 3WFEL 1GC1H 2XQYG 4OCXH 3SJVE 1ZV5A 3ROOA 3AS0A 4D94A 3G5ZA 3GSOA 1CN4A 3CXDL 2X1XR 1KTRL 3MJ8A 1VPOH 5IBTL 3TNMB 4CVUA 3N9GH 4XBPA 3RUGB 2JB5L 3DV6B 5CP7B 3OAZK 2BRRH 4KY1L 5E24E 4OF5A 4YAQB 4JG0H 1MCHA 5EORL 1IRAY 1JV5A 1ZWIB 4YIQB 3QQ4A 1CFTA 4GMTL 3AY4C 4JANB 2Y25A 5C08B 2AK1H 2BSRB 5IKCA 4LRIA 5SWSD 4LL9A 4LP5A 2EDLA 1DQLH 5I18H 4TNWK 4U1IB 3WHXA 5JXAL 43C9B 3BKJH 4PJDF 4ODXB 5JO5B 5M95B 1N2RA 3VFRA 2NLJB 1D5MB 1QLFA 3WUWA 3MCKB 4NJAH 3B83A 5I1LA 3WNPA 3HUJB 2KZWA 3WKML 1T2JA 3EYSL 1GJIA 5CEZE 3DMMB 1EJ6A 4ONGH 4PRNB 1DEDA 2EH7H 4A6YL 3CDGB 4KC3B 4NOBA 1DQQB 5IBUB 1KG0B 4LLYA 3CCHB 1R6VA 2BY0A 4O2CB 5J3HD 3LIZL 4MCZB 3IKCB 4NBXB 2F5BH 4NUGL 4JKWA 4JB9L 3ULSA 3ZDXF 3ULUL 4K07A 3QDGE 1Q9OA 4HMEA 2VC2L 5KSAB 1X44A 1LMKA 2DQJL 2P8LA 3HI1B 2YS4A 1YN6B 2R2CA 2WIIA 5D1XC 3H9HA 1SY6H 1P84J 4WI2A 5E5MA 5HGGS 4K2UL 4JFXA 4FQXC 4DZBB 3FFCE 3CZFB 4U3XA 3UTPD 4KK9D 1NGZA 4U6HB 3IDJA 3ARFB 1E4JA 4LK4A 3UDWA 2IG2L 2JKXA 2ATPB 3MJ8B 3WN5C 4ESKA 2D4FA 1K5NA 1Q9LB 2P8MB 4CVXB 4WO4A 1NBVL 1LO5B 4PJAE 3T04D 1WUNT 3OKKA 4RFNB 3WIFA 3KPSB 4P3DA 5KS9A 5EOTA 5T1DH 2H6PB 1AGFA 3RVVC 2IAMB 4K8RC 5L88H 3VGGA 2QKIB 2BFVH 5H2BB 1WBZA 5CGYC 4QWWC 3ARGC 3NA4A 3PABB 4PJCE 4PJ5E 2VYRE 5DMJB 2B1AH 1YN7B 1JZ7A 4LDOB 4XMKL 5DGQA 1N5YL 1MI5D 1S7RB 1T3FA 5E8DL 2Y1VA 5ITBH 1SYVA 1CD8A 2F53D 4Y2DD 4FP8H 4I3GA 1C08B 3VFRB 1KEMH 5JPNA 3WUWB 3Q6GH 4OUUA 5KSUB 4OIIH 5EPMB 3QNYB 3GMRA 3SE9H 5AD0B 3JTSB 1MFAH 1NLBH 2XKNA 4DGIH 1B4JH 1RY7B 2ENYA 4XHQA 5D2NC 3QO0A 2GK0B 4FMFA 5D7JA 1S7TB 3HPLA 4ZAKA 1A21A 4P5MA 4MA8L 4LLYB 4NQEE 3RBGA 3AROA 5C0RH 3PQYA 5CBAA 4PRPD 1ZE3C 2ARWA 3OKMA 5ERWB 2QBWA 2DYPD 1NBQA 1UZ6E 3FKUS 4JFDA 5DXWA 3ULSB 4TQEL 4YDVA 4LLVB 4MB3A 4L4VB 3CFDB 4PJ9A 1Q9OB 1IGFL 5MI0B 4UTAH 4HWNA 2GITB 1A1MA 1G1CA 1BVLA 5ISZA 2FBOJ 4PJ7F 1UEMA 1UKSA 2WINB 1E4XH 1IGCL 2APXA 2P8LB 4ZUSA 4FQLL 3KPMA 2WIIB 3FQUA 2XZQH 4WW2A 1DQJB 1IGIH 3UPCA 4KK6D 3QG6B 4JFXB 3TH2T 1DQDL 4L8SA 2VIRA 3NCBB 4NO3A 3PNWB 4O4YH 4DN4H 4M7LL 5CJQL 3LMJL 4AG4H 4HQQL 3S35H 3HKFA 4HIXH 2LVCA 4V2CB 4JRYE 1Q8MA 5DMKB 1QBAA 4MD0B 5H37G 1I1FB 2BSED 1U91A 2X2YA 4M1DH 4Y16D 5LBSL 1KC5H 2PXYC 4PRBA 3FAWA 4YGVB 1MHPH 3WIFB 3X11A 2AI0L 2OK0L 4HDIA 3ARYA 3LQAH 2EYTA 5HYJB 2NY7L 4HKJA 4DVRH 5KG9A 3HMWL 5DK2A 3CLEH 3HB3C 3EYVB 3MBEC 5E8PA 1WBZB 4AEIL 1SEBA 2F15A 4U1MA 4TTDD 4GRLC 3WFBL 1PFCA 3ZDYF 2J5LB 1U8NB 3J7HA 2FLBT 5IROA 4RMWA 1JWMB 4Y4FA 3T0WA 2VLRB 3M1BB 1X4YA 5E2UL 4HULB 1K3ZA 3WFDL 2GTZA 4LARL 4XWGL 3DUHA 5JPNB 1LE5A 4M1CC 5GRVL 1QRNA 2XNAA 1JPGA 1QSEB 2XWTB 2VLKA 3DSFL 3MRKB 1CZ8H 4NN7C 3F5WB 1H0DB 3Q1SL 4WFFE 1I7ZB 3TV3H 5JLZB 5CKAA 5L8KB 2FGWH 3T3PF 2QADC 1DFBL 3KPOB 5IB1B 1ACZA 4HAGA 5GS1B 1BF8A 3IYLW 2XWBA 4A2MA 4HBCL 4XT1C 4R4NC 4HFUL 3FT3A 2W65B 1HDMA 4S2SA 4M1GH 3QULB 1JZ4A 1CLZL 3MRIB 1IEBB 4KRLB 4PJ9B 1EVUA 2MWCA 4JPVH 1A1MB 1BVLB 1AHWA 1SBSH 4EI5A 5J56B 5E2TL 5C0CE 4H8WC 4TSAH 3FQUB 3UO1L 5L2KA 1TNNA 3AMLA 4FQ2L 5DK0A 4NO3B 4OFPA 1P4IL 4OLVL 1T5WA 2JB6A 5EWIH 3QFJA 3ULUF 1SYSB 2X4TA 4NQVA 3P4NB 1CU4H 4IRJD 1U91B 3H0TB 5F88B 1UJ3B 3T4YB 3QUYC 2EKJA 4ZG1A 4ELME 3KLSA 4PRBB 4G8FB 6FABL 3W9DA 3SO3C 4NQDA 2EYTB 3LN4A 5E8EB 3RGHA 2R9HD 4G7VH 4JFFD 3GZKA 3U30C 1KIPA 3P73A 4PJ8D 1WWWX 2OS7A 4U1MB 3NCYS 4LSPL 3VFGH 5JOFB 1CDUA 5FOBA 4NC1C 1EHLL 3BVNB 1SEQH 1S9YA 5C6TL 1HNGA 1II4E 4NHCL 2V9TA 1A6AA 5D2LA 2GTZB 5SX5H 2OR7A 1Q94B 4I13B 4GAGH 1O7SA 1JUFA 5JNYB 2CDEB 4U31A 2XNAB 1JPGB 2R69H 5IESH 3JBG7 4HXAL 1R3IL 4LLUB 5C08D 1T0PB 3L3DA 1GGYA 4EDXA 4C58B 2MKWA 5KANG 1I8MB 4JDZB 4GQ9H 1S78D 4PJBB 2XWBB 5I1AA 1D5IH 4NN6C 5K9JL 3V4UL 3DXAE 4RQQA 3S9DB 1RAMA 1MFCH 4S2SB 4KI5C 2R23B 1FZJA 3T2NH 4XI5D 2WBWB 5KOVC 1GVIA 2ZUYA 2JJWA 1R3KB 3R8BB 2W9DL 5KTEL 2R8SL 4XP5L 3M07A 4F80A 3QIBA 5D70H 2XKSA 4P2QE 3W39B 1AGDB 5GZOD 3VRLF 5BS0E 5FYKE 4YFDB 4TYUA 5HYSA 1J0ZA 5ANMA 2E5EA 3RWJA 5CBEA 1ES0B 3UYPA 4XHJC 5D71H 1JNLH 2VZUA 2ARJQ 1T5WB 3EJYD 2B4CL 4FFZL 4NQVB 2Z31A 4XCNB 2X41A 1Q72L 1X5LA 3GKWL 2DQTL 3LN9A 4ZDHB 5CKGA 3NIFF 5KSAD 1KELH 3IDGA 4M6OL 1CXEA 3IDYC 3IU3A 2AV7A 2CUHA 1D3CA 1C5CH 4Y19B 1FAKT 5AEAA 1JWSB 1XF3A 2Q20A 4Z7WA 2UWEA 4WJ5A 2P1YA 4LVHC 1SQ2N 4Y7MA 35C8H 5C0AA 1V3JA 1C5BH 2AK4B 3TBYB 1KIPB 3P73B 3VDCA 3ARFD 1OP5H 1LK3L 4JVUA 1IZJA 1JPSH 1JI2A 5JHDA 2EEBA 2DQUH 4HUUB 1F2XK 2X10A 3LSOB 4AEEA 3T1FA 2V2WA 3KPSD 4U1SA 1NDMA 3SOBH 3S3SA 1U8JA 4QHNB 3RX5A 4J7RA 2IAMD 1DUYB 3P0VH 4CNIB 3RY4A 3S37X 3GIZL 1T1YB 4RDQF 4QOKA 3E8UL 3JVGC 3MRFA 1FIGH 1LP9E 4JGMA 5HVHB 3RY5A 1KCVL 1ONQA 3ARBC 1I9IL 1T83A 4WI9A 3OG4B 1C7TA 5L9DH 1WAAA 4RQQB 2EDOA 2VRAA 2OZ4A 4PLOB 3OKNA 3JTTB 1JPTL 1QFWH 1W8OA 2APFA 4M3JA 4XVSH 1FNEA 1IGML 3MA7B 4NRZB 5CEYA 1KUMA 4KMLB 4RWYL 3IFLL 1HWGB 3JXAA 2FHFA 1QR1A 1OSZA 4G80A 3AS1A 1PX3A 2VDLH 2JLLA 1RQ5A 4LKCB 5JPMA 4HZAA 3D1MC 1RIHH 5EOQL 1SMAA 4NNYA 5CBEB 2LTQB 5ETUA 2FX8L 3BKMH 3WE6A 1J86A 4L4VD 1L0XA 2IPTL 3LS4L 1EAPB 3IFNL 3IU3B 3BZEA 3O2DL 5D1QA 4KDWA 2Q86A 4ZNEA 4OT1L 5D7SH 3QYCA 1QZ1A 1U42A 4QRTB 1KCLA 1ZKAA 1ZK9A 1RZ7H 1OAUL 3RRQA 4HF5H 1F90H 5GGUA 3D85B 2HH0H 3L95A 5IHUL 1OLZA 2R0LH 1QPXA 1BIIA 1S7VA 4KK5C 4CU6A 3VGAB 3O4LB 1FLRH 1NLDL 1JK8A 4PJAF 3EZJB 1HQ4A 4LEXL 5DC0A 1DBML 4NYLB 5I2IB 3JWDL 5DQ9B 4YHKH 2V2WB 3MFGB 1NDMB 1L7IH 2BNRE 5HYJD 1KXQE 4M62L 1X5XA 3MRJB 5F89A 1N6QH 4HIEB 4BFIB 1N7MH 4NKIL 4AIZB 2O5YH 1P4LB 3GBNH 3M17A 4PRIA 2P24B 1H5BC 3QDJE 4LDEB 1QEWB 3DVIA 4PJCF 3MRFB 3TT1L 3MUY1 3DX9B 4G8EA 2VLRD 3UTSA 3AAZA 1DJSA 3IJYB 4HKXB 1ZANL 1F5WA 2L7UA 1PAMA 3O6KL 4XVTH 4TOYH 1MAJA 2XZZA 1H9VA 5EOCL 1TVHA 3HZMB 1FNEB 4QKXB 3S88H 5E7BA 1QSED 4WEBL 1WFNA 2XT1B 4TTGA 4UILH 1DANT 1MAML 4G80B 3AREC 2AXFA 3RVXC 4HHAB 3QP3A 3N1GC 3PQYD 3QIUB 4H0GA 4K94C 5D1ZB 5DUPH 5JPMB 2VZ3A 1EHXA 4JRXB 5LCVL 3T08A 1A6WH 3I75B 3MRRA 4NNXB 4ZYKA 4NHUA 3QXAB 1MCLA 3LHPL 1RJCA 3VD7A 5D7KE 1PSKL 3BKCH 4PJ9D 1N59A 4GFTB 3MJ6A 3EDDA 3WS3B 1ITBB 5SX4H 4BZ1H 1XF2B 5BO1L 4U1JB 2YK1H 1C5DA 3CUPA 2HKFH 5D1QB 5HHOA 4GSDH 2ERJC 3TFKD 1IILE 2ZSVA 1AC0A 5J11B 5GGQH 5C0BE 2BRQA 4Z7QE 3BI9X 1F3RB 5TQ0L 1WGOA 3PV7A 1QPPA 1MLCB 5GGUB 4M43L 5IBUG 4X4XA 3FOLB 5FA4A 3HFMH 1JK8B 4LVOC 3H9ZA 1DVFB 4LFHG 2E7HA 5CWSA 5EUOA 1AD0A 1MLBA 2F5AH 3SBWA 1FQ9C 1UA6H 4PD4K 2GJ6A 2HA1A 4WW1B 1MF2L 5E0QA 4X9IA 1E28A 5GSVA 3VXSA 4Y0GA 4LSRL 2ICWA 1KCSL 3DX8A 4E41A 3N06B 4X6BA 1U8LA 1KJVB 1NMAL 4MA3B 2EDNA 5BV7B 4APQA 1FCCA 2MPAH 2VLMD 5J3HC 1QKZL 4ZO7A 1HH6A 4JM4H 2FBJL 2R4SL 1BWWA 4PY7B 5I73C 2EDQA 3QBTB 3VJ6B 5DS8B 5HY9A 1QFUH 1L7TH 1FBIH 1U8OB 3G08B 5JTWA 4QY8A 1V3MA 2M1KA 2BHZA 3STBA 4OJFH 3KDMB 4OAWB 2MOVA 3O8XB 2AXFB 3IDXL 2AEPH 1U6AL 2D3VA 4KK9C 5E95B 3SGDH 1VKXB 4OKDA 1CE6A 4YHYC 3MRDA 3H42L 3LDBC 4YO0B 4MJ6B 2R1XB 4JQVC 4YNYB 1J0JA 1RHHA 2X89A 1UWEH 1R5IB 4PJ7A 1BVKA 2VDNH 5E8OA 1KOAA 5FXCH 3O2WH 4MJIE 4KTDL 3WUWG 3CUPB 1IBGH 5SWQA 5LGHL 3N1PC 2ZSVB 1JHKH 4LCWE 5JW3H 4X4ZA 1CFSA 2FX9L 1EUUA 3C60B 4QXGH 5JZ7D 2J2ZA 4M5YH 2DM2A 1KLGA 2RGSA 1ZTXL 4X4XB 1IARB 3RKPA 3EYQC 4OCNC 3TZVB 2I9TA 4Y2DC 3F6LA 4Y19D 2YUXA 4ELMF 5E03A 5CWSB 1IC4H 4H1LA 1K2DA 4XP1H 4QNPE 5DRNB 4NOFA 1MVUA 4N90E 5IMLA 2VDKL 3HC3H 3DX8B 4LSQH 4E41B 3V8CA 1OD9A 1B0GB 1TVDA 4Y5YB 1OP9A 2D7QA 1ETZA 1FNLA 2VB5A 5T3ZL 1LK2A 1N0XL 2FWOA 3KPNB 1CBVH 5GSRA 4X5WA 4D9LH 5I15H 2X4SA 4AZ8A 1QQDB 3IF1B 3VFTB 4PJFA 1G9NL 3QEUA 3PWNA 3MR9B 4Z7UA 1HINH 4WU7B 2AGJH 1ZSDB 1ADQL 4JZJA 2MKLC 4P3CH 4XMPL 3QO1A 4P2RE 1G7JA 5CJOL 4X83A 3K0WA 3BQUB 4FFYL 3MRHB 1G9ML 3A67H 3IAGC 3PDGA 3FOMA 3QJHA 4RX4A 5DMYA 4QYOA 1AO7A 4YEEA 5K9OA 2IFGA 4DUXA 2W92A 3KPLB 3QQ3A 3E3QC 4ZTPH 1J0IA 4V1DB 4Q6IA 5DMGD 3RU8H 4UIMB 5DD3H 1U8PB 4HGWB 3THMH 1JRHI 5TJWK 4PRDA 4ODHH 4XP9H 3VFWA 3S36X 3EGSA 4Z7NF 2N7BA 1A4KB 4ZOBA 5ALCH 5SWQB 1DBAL 2BC4A 1TITA 2NZIA 1XGPB 3ES6B 1CFSB 3EYUL 4MNGA 2QQQA 4YWGL 3QCTL 2GJZB 2HG5A 4TTDC 3MGOB 2DLIA 2E6JA 3VXRA 3MV9A 4EXPX 1KLGB 3AM8A 5JW5B 4ZSOE 1GYAA 3LH2L 5D9SA 1T1WB 1WTLA 3MOBH 1NFKA 2C9AA 2I9TB 3MLWL 1RJLB 5I1DB 3V0WH 3U82B 1PGRB 4JG1H 1KB5H 1HOCB 3DURA 4M7KH 4LGPB 5DVKA 1NBZB 4AENA 4YHIA 5IMLB 4R4FL 2HRLA 4KAQL 5DEFA 1FGVL 3D85D 1JTTA 2K3TA 5JHDD 1ETZB 5GJTH 1BP3B 5IG7A 4QTIL 3DHJA 3QEUB 3GM8A 4Z7UB 4HS8L 1TVBB 3GSVA 4JZJB 1FV1A 1VGKA 3QO1B 5B39A 1G6RA 3V52H 4PD4J 1X6LA 1P9MA 1IAOB 2ZPKH 2VITA 1JZ6A 5KVFL 3F7PC 3WXVL 4LCCB 3JV5A 3QJHB 1CFNB 1OARL 3DRTA 4P5TA 3PIQB 1NCUA 1LP9F 4UUJA 1AO7B 1F3JA 4MB5A 2VZOA 2OP4L 2SEBA 3I50L 3SDCB 1KLUA 2NXZB 2DN7A 1YDPA 3MLSH 4XPAH 2X9WA 1X5AA 4QRPA 4Q6IB 5MHSD 5IBLD 3HG1A 5CZVH 5AWNL 3H3BC 4E5XA 2A73B 2ZCLH 3RHWF 2A83B 5GGTL 4TUKL 3ILQC 1KB5B 2VXQH 3VFWB 3EGSB 4IIQA 5I17A 1G6RH 1Q1JH 4XPGL 4N1EA 3EYOB 3U36A 3QIUD 5TQ2H 5D1ZD 4PJ8C 3BP5A 4JRXD 3TN0A 3V6FB 1NC2A 1P2CA 3VXRB 1NMBH 3JV4A 4QTHB 1MJ8H 1QSVA 1RFDL 3MV8A 4WV1A 1UVQB 4MDJB 5I1KL 1X5YA 5D2NE 3MMEB 2ICEA 4Q0XL 4OGAD 5D1QD 4NZTL 4RIRB 4FABH 5DEZA 1LEKB 3RKDD 4G5ZH 4UT6H 4LPXA 4AENB 3SJVA 3LKSA 1RZJL 3GSUA 4HS3A 2Y36L 4L9DA 3FO0L 1S78C 4ZUVB 3NFNA 4OM1L 3QEQA 2Z35B 1FO0L 2IMNA 4XTRD 3SDAB 1MCOL 1T7YA 1DVFD 3SKNA 1I3GH 2MQCA 5DJCA 5TFSH 4XP4H 5F9AC 4U49A 2V5SA 1QLRB 2CJUL 1UZ8B 2YPLE 1I8LA 4ETQA 1YNKH 1QOKA 4AL8L 1CG9A 4YXKH 1XF4A 4HT1H 3QUXB 2ED8A 3L7EA 1MHHA 1SHMA 5TDPA 1BECA 4EBQL 3P11L 1GC1C 1AE6L 3TO2A 1FLTX 4Q9BA 5GZOC 3IDMA 2FECI 5I1JH 2R1YB 4P2OC 5HSFA 1ZA3B 2EDJA 4JR9L 1G7LA 5JMOC 1YY8B 2EDTA 4YGAB 2IC2A 1FHGA 2X4PB 3EJYC 2F54E 3QISA 1GZQB 1QBBA 5KSAC 2OL3L 2D7TH 4BZ2L 1MJUL 2C1PB 2ZCHL 3LEVL 1QO3B 2FSEB 3O8XD 5TF1L 4M7JL 5I1HL 4PJIB 3U36B 3CVIH 2F19L 4MJ5A 5C0GA 3BP5B 3ARFC 1NC2B 1FVEA 5IGXH 3O2VL 3HNVH 4JFHD 4Z77B 2GSIB 2XIDA 4WUUB 1Y6NR 4PY8J 4F3FA 1JGLH 3MV8B 3LRSB 4MMXC 2V2TB 3MNWB 3CX2A 5EBLB 2EXWD 2ICEB 4KDTA 2R4RH 2MCG1 5I0DA 1KXVC 1VGEH 5F3BA 2IAMC 1YYMH 3QH3B 4HKBB 4JHBA 1C1EH 5IVOA 5ADOH 5C09E 1XGQA 4Z7QF 4LRIC 3OG6B 3UTZA 3C60D 4XRCA 3BAEL 4HS3B 1BLNB 1YPZB 4JPWL 3QJFB 4NZDA 1A9BA 1GPOL 4HEME 4NSKA 2KBGA 3EJJX 4QHLB 4ZFFB 4QHMA 3QEQB 1IQWL 2XOTA 4Z78B 3NCEB 3PV6A 3TZVD 4PJAA 5E99L 1R5WA 3I6LD 3SKNB 1FYHB 1FL6B 4YPGA 2P5EB 1FZOB 2QSTA 4W4OA 4PYGA 4OGXL 1NCCL 4ORGB 1KCRL 4Y4HB 3OHXA 2F74B 4KI1A 4PJXB 3C6SA 4PJCA 4PJ5A 5H8DA 3G6DL 4E41D 2AJUL 5INDB 2EIZA 4ZPTA 1DL7H 4Q9RL 5DZOA 1TDQA 3DGGA 3ABZA 3QWRD 5I30L 4MXVE 1WZLA 5CS7A 1ZT1A 3EOAB 2Q8BH 5MEPA 5BJTB 3OKDB 4WIQA 4WCYL 1Y6MR 5DEGB 1R0AH 5TGBA 1BOGA 1MCQA 1BBDL 4LLMA 3K46A 5C2UB 4U2ZA 5I1EH 3ARVA 1S3KH 2DQFB 5IFJA 2ITDA 4GXUM 5JDSA 3ZYOA 5TE7L 1HKLL 4BQ6A 5JIPA 3WSQH 4NC1E 3F6IA 3G5YB 1F4XH 4NQEA 4HUWA 4E0RA 5FYJH 3QHFL 3L3GB 5C0GB 5DD6B 3CFCL 1Q9KB 4OCYL 3UDWC 4OD3H 3K1KC 4ZMAT 3RI5K 4QHUA 4V1DD 3PGCB 4DW2H 4OZIB 2Z8VC 3FN0H 1J8KA 5GGRY 1J1XH 4WO4C 5BZWA 3BO8A 3EUUA 4F57H 5ADPL 3TJEH 2BJMH 3EO9L 2EYSA 4YBHA 1UWXK 4OZHE 2BK8A 1NAKL 1W72A 5FM5M 1HI6B 1LDPL 5F3BB 1CCZA 3VXUE 2Q8AL 3BP6B 3KHOA 1OAZL 4MGXA 1A7RH 1UACL 3FO9B 4L1HA 4L29A 4R7NB 4KI5E 2D0GA 2J5LC 3NFSL 4JRYA 4N0YL 4UQ3B 5GZND 5A40E 3TVMA 1WEJL 3I6KA 3T0EA 3MA9H 3O3UN 3G04B 4YPGB 2K7PA 1HIMH 2G5BA 3IJHB 1RZGB 2X4OB 4QNPF 3EOTH 5FYLE 4LSDA 1R3JA 5D7JC 2VDOH 2OJZL 1NSNL 4S0TD 4WY7L 1YEEL 3RVWD 2DD8H 2XPGB 3D39E 4NN5B 5FF6B 4HZLA 1ZT1B 4KXZH 1KPUB 3C6LA 4PJ9C 1NBYA 4LCUB 4OLUL 1VFAB 4P99A 3MYZA 4K3GA 3EOYG 4O02H 1ZHNA 4BUGA 5IFJB 3GDBA 5IF0A 5ICXA 5GJSH 4ALAH 5LVEA 5TPWL 4WW2C 1D5XA 4RX4D 3TFKC 3U79A 3F7YB 3GUTA 1RJYA 4L8SC 4NKMA 1AO7D 4HUWB 3KYKL 3T0AA 3M8OH 2A77L 2APTA 4E0RB 4LOUC 1OM3L 3CFJA 3WIHA 2NXZD 5T5NG 5GRUH 1NFDB 1KT2A 8FABB 5ACLA 1A02N 4I3RL 1BQHA 1NCAL 3I3EA 3BPCB 3MLYL 3RDTA 3BO8B 1J05A 3KYOB 4Z95L 2VZVA 5IVXE 1V5JA 2YD2A 3NN8A 3TJHD 3D25B 4XBEH 5C0CA 2P47B 4NRXA 2XY2A 3MRNA 1VESA 2V7NA 1ERNA 1HHHB 4PV8A 3MACL 2J8OA 1PY4A 1XGTB 5F9OL 2W60A 3VMOA 1JIBA 3KYNA 1UH2A 5DVOA 4G8GB 4JZOA 2GUOA 5IMKA 3VXRD 5EC1B 5IROC 4Q6YA 4Y4FC 3KJ4B 1MPAL 3K80A 4PP2A 4LU5L 1J5OH 3UYRH 4H8WL 2H3NA 3I6KB 1ODAA 3T0EB 4ONHA 4X98A 3TF7C 1LO3H 1VENA 1YZZA 4F7PA 3UPRB 4JY5H 1IM9B 3D3VE 2BVUA 2BY3A 2Y07L 5KOMC 3ZSSA 1UXSA 1XGYH 2XY1A 2XRAH 2A9ML 2I9LA 3S4SG 1R3JB 4NQSA 5BVJA 1RI8A 4PGDA 4U33A 2DJSA 1FC2D 3Q3GA 1I1AA 2FD6H 1DEEB 3R0NA 1UWGL 1SMOA 2XYCA 2OLDA 5SWZB 4HZLB 3FB8A 5T3XH 3SDAD 4R2GC 4QRRA 4BELD 1PW3A 1T21A 2HYMA 4X5XB 1OTTD 1CGSH 2I60H 1T4KB 5C0IA 1I85A 3MCLH 4D0BA 4J3SA 1I8KA 1AHWC 3QUXD 5MP6L 4EI5C 4NKQB 4JLRA 5KVGH 4X6DA 1HEZB 1Q9WA 4XZUB 3O11A 4BH7A 3KPQB 4MAUH 2RCSL 3GUTB 4MXQC 3DECA 1M05A 2QSCL 3CFJB 4XP6L 1KTLB 3PWLB 3GHEL 5JZ7C 2VISB 5CFHA 5IVZB 4OGYL 3RZCA 2F58H 1IGYB 1B0RA 1NAMH 1HZHH 4MNQB 1J18A 3NN8B 4HJJL 3U4BL 4E42B 1P1ZA 4P2QA 2K7QA 5F7UA 1JZ2A 4U1LB 5DLML 4WGVB 5BS0A 4RAUA 4U7MA 5A16B 2UY7A 2VO5A 2ZKHL 3LPWA 5DHVH 3RWFB 2W60B 4TVPH 3HZYA 1NC2D 4G9DA 4RRPA 4MA1C 2H32A 1S8DA 5HTSA 4MXWL 4MD4A 4WUUD 5J6GA 2ILLA 5I1IH 3QWOA 4HWUA 3AXLB 3MV8D 2C7UB 2E9BA 4HBQA 3CSYB 1R3HA 5CD3B 2EDKA 1FH5H 1H3GA 4YDKL 3BRFA 3ILPA 3ARWA 5J13C 3HC4H 1MY5A 1MQKL 1MSPA 4UIKH 5I8OH 1WLHA 1T0NA 3ARDB 3C87A 1UXWA 4U6XB 2FL5B 15C8L 4JHAL 4QCIB 1CDYA 3ZKNC 4NQSB 4B5EA 2X05A 3V95A 4ZUTA 4WI7A 3ZTNL 3LEYH 3Q3GB 5HVHC 5E9DB 1WV7T 2EDWA 3CFKB 5DHXB 3LD8B 3U2SA 3MLRH 3QEQD 4K7PL 2H32H 4K7FB 3MUGA 4N8VG 4NO2A 5LWYH 1NAMB 4GOSA 5DMGC 2EECA 3MZGB 2ZOKB 5E94A 4D0BB 2L4OA 3TEUA 4NIKB 1URLA 4NZRH 5SWSE 1EFXA 3QIBC 4Y4HD 4X6DB 5D8JL 4AM0B 1TJHH 3E6FA 5INCA 1SVZA 4XC3L 1Z9MA 5DHVB 5F7DB 4X7TA 4HWBH 1PKQB 5JQHC 2E6PA 1M05B 1PZ5B 1E27A 4DN3H 1NANH 3VXQA 5C07A 4RZCB 3SCMA 3FZUC 3RZCB 1T5XB 4LRNH 2IQ9L 2Z31C 3ARSA 3OKYA 3FT2A 3PP3K 3JZ7A 1B0RB 1M7IB 2UUDK 4GUPB 2ZG1A 4LPTA 3I85A 2P8PB 1BHGA 4FXLA 3HE6A 4KZDH 1S7WB 3O41B 5E7FA 4ONFH 3ZKQD 4JPKL 3OGCA 3HZYB 4G43A 4G9DB 1DBBL 1FSKB 2H32B 1RVFL 1H3UA 1S8DB 2FCBA 3T1WA 1FN4A 1P5UA 3FB6A 4HCRL 4OLXH 1PEWA 3QIWA 1DTUA 5J6GB 1F02I 2Z91A 2VTFA 4PREB 5DFTA 4ZD3L 5DJ8A 5I1CH 4IHOA 2IFFH 4AEHH 1GGUA 1MRDH 1BFVL 3FCTA 3RPKA 1FZMB 1JTPA 3MBXH 3ARQA 3QDHA 4DAGH 1NGYA 4YDIH 3MJ9A 2X1PA 3EDJA 3UTPE 2MHAA 5GGRB 1MRCL 4UB0H 1A7QL 4MD5A 2PR4L 1DSFL 1EGJH 5IQ9A 2AJSH 3IXTB 3ZTJG 4G6KH 1A3LH 1T83C 4I2XB 1JHLL 4R4BA 1RUQL 4F58H 2PW1A 1JHTA 5LKNA 1SJEA 1N6VA 4O2FA 4D8PA 2BNRA 3DROA 1A0QL 1IC7L 1D5BB 1MWAA 3C5SA 1X5KA 3UJJL 5GISH 1EFXB 4POYA 2HAZA 3QDJA 5IJKA 5FYJD 1GAFH 4YH6A 4LBEA 5EZLB 5F9DC 1N8ZA 1MI5E 3QIUC 5LGKA 4BQBA 3VH8B 2F53E 4CL7A 3D69A 5F7LB 4U6YA 1QA9A 3C08H 5I6XB 4DKEH 1MY7A 5C07B 2VSCA 3SCMB 1WZ1L 4XH2B 4K7PX 1UM4H 4WTZG 2QSQA 3EHBD 1OB1B 1XR8A 4JE4B 2HTKD 1J10A 3ME0A 3LQZA 2UY6A 2CQVA 2Q1EA 1KN4L 3CFBA 5D1QC 1MWAH 2DDQH 2FJHA 4I8DA 4PRPE 1QUNA 5F1OB 1N3NB 3C2AL 2Q87A 3RKDC 3VFSA 3DV4A 1BM3L 3X12B 2XKUA 1ZLVK 3S34L 1A7NL 1T1ZA 4P23A 4UTBH 4URTB 1DVFC 3WLWC 1MCPH 3GBML 1UCBH 2HMID 2GT9B 4OKVB 3H9SA 3QUZA 9CGTA 4OD2B 2I07A 4OLYL 2X4QA 5I16B 2XACC 2E9JA 2ICWJ 4ODTL 5C0BA 1BIHA 1I3RA 3MLZL 4MD5B 4KI5F 4G8GD 1YY9D 3S6CA 4OCSH 1O7VA 2NY1C 1AXTL 5CHNA 1AY1H 4XVJH 4L9LB 4PLNC 5GGSY 4YBQD 3V6BR 3T0ED 1P53A 2BCKA 3OSKA 1INEH 1TJGH 1NGXB 4J4PA 1H3WM 2AEWA 3HMXA 4O2FB 4D8PB 3DROB 4NKDB 3CH1B 4I3SL 3HS0B 3QCVL 3U7WH 1MWAB 4XC1H 2P46B 1A5FH 3I9GL 2YD7A 2PN5A 3VXNA 3I6GA 1CDIA 4X6CF 4N9GB 1C16A 3O8XC 2UZXB 4GG6B 4OCWH 1L6XA 3UTQA 1QFWM 3FQTB 4KJQD 4KWUA 4R26L 3FN9A 3D69B 4TULL 1EK3A 5HGBA 3O0RH 4KRPC 5F7HA 4QO1A 2NZ9D 4NM8L 3T0VA 5C0EB 5EU5A 1UADC 3V79C 1A9EB 1RU9L 1HHGA 1V05A 4Z0XA 1ZEAL 2EXWC 3LQZB 3OAUH 4RGMC 5ID0A 1OD7A 2NTFB 3MODL 4N8CL 2FJHB 4J6RL 5HI5C 1MJ7L 4M7LT 3R8QA 2UV3A 2BP3A 4NWUL 4PRAA 3C60C 1I1CA 3INUH 4YLQT 2DQEH 1MJJA 3V6ZB 2VXTL 3U0WL 3MLTB 1YUHA 1RUKL 1U92B 1TZGL 3GSNA 4M6ML 4QRUB 1YJDL 2OI9C 4QXTA 2JCCA 1T1ZB 4P23B 1QLEL 2D7MA 5DHYA 4LKXA 4H20H 4P2YA 3SHSA 1OPGL 1LVEA 1FNHA 1YEIL 1FRGL 4MJIA 3SBWC 2XZAL 3H9SB 4XX1E 3TGXA 1KJMA 1EV2E 2DQGL 5GXBB 2NW3B 3CX5K 4PY8I 1S9XA 1R24A 1X5ZA 3A6BH 3O3EB 4TUOB 3MNVB 2J8UA 3QDAA 5B22A 2LU3A 4Y5YC 2FDBP 3ZSTA 5T3XD 3WYRA 5JORA 3UC0L 1CDCA 3OX8A 4ISVA 2YD4A 4TRPL 5GRVK 4BFBD 2VE6B 3GSNH 3ARTA 2WUCL 2HKHH 2BCKB 5BMFH 2Q7YA 4JFFE 4Y5XA 4CU8A 3KWWA 5J1AA 1IAKB 5EZOL 1WFTA 2UYLB 4FNLH 2XWJA 2EC9T 4NCC1 1KV3A 4BH8B 3RUGE 2H41A 2I5YL 1VHPA 4ZPVA 5E9DD 3WXWL 3VRIB 5C7XH 4R97B 5MEOB 2H2PD 2X4UB 3BZFA 4QRRD 4DCQA 4CKVX 4G6JL 4JO1H 5D7IB 3X14B 5B4MC 1L9NA 5C08E 3BSZH 4OSUH 5IJVB 2IGFH 2Z93B 2VDPL 5DFWH 4PB9H 5HYIA 3MJ7B 2G75B 2XQBL 1TTFA 1C8PA 4HEPG 4TVPD 4DKFH 4JJ5B 4UINH 1TZHA 3LKRB 1FL3A 3AUVA 4XMLH 4RBPH 2C3GA 4I5BB 4Z0BH 4PRAB 1OAKH 3FHQA 4PJDB 1MJJB 2WLYA 1DQMH 1YUHB 3GSNB 1PLGH 1S5HA 4XPFL 3HUJE 3RZCD 2LU7A 1S9VA 5CIPA 5F7NC 1JF1A 3LN5B 4MJ4A 1AXSA 3VGFA 1JNNL 1M7XA 5T1LB 3ARZA 3CVHH 4JDVA 1M6OB 1RZKC 3TLRA 1K4CB 5AZ2H 2KPNA 1RZFH 1KJMB 2WWKO 3L5WB 3VXTA 5DWUH 1S9XB 5JDJA 2MSPA 5KJRH 3DVFA 4Y5VA 2DQDH 5DMIL 4Y1AA 4FA8A 1FFNA 3P4MB 5FDYA 3RWCA 1LWRA 2QQNH 1FVDA 4CDGC 1NC4A 4TSCL 3DYPA 4W6XB 4LVNB 3K74B 3QNZB 5DRXA 5ESVB 4JZJC 2HFGL 4I18B 4S0SD 4F7TB 3O3AA 1ZLWH 1ZGLP 1DLFL 2FATH 1FCGA 3DIFA 4YHLL 2VN4A 4R0LA 5IEKA 2DF3A 3HTLX 1CT8A 2M26A 4ZS7L 2B0SL 2J6EA 2C3VB 4HKZA 4M93B 3TIDA 2AVGA 1DQTA 2D0HA 5DR5H 2NXZC 1BZ7B 2Q3ZA 3SKMB 2PW2B 3KPSE 4LCYB 1OSPL 4Q6IC 4LSVL 2NY2B 3PGFH 4UBDD 3CVHB 4FQXA 3TJHC 1EFXD 3BUYA 4DGVH 2V9QA 5GGSA 1QNZL 1KCKA 1PY9A 1MRFH 1NDGA 2NW2A 1YQ2A 2D7OA 3DVNA 3U9PH 4L5FL 1RURH 2C3HA 4D3CL 3IGAA 4P4KA 2APWA 3BPLB 2J6EH 5C07D 3SCMD 2R2EA 4KZEH 1PVHA 3AM8C 1X5HA 5CINL 3X3FL 3BJLA 3PWUB 2IF7A 1AXSB 4I4WB 1XCTB 4K3DL 4AQOA 4OQ1A 1TCRA 4OV5A 4HSQA 4JDVB 3PP3H 3GSRB 3BGMB 3RAJL 3QEHA 1I9JH 1QVOA 3GJEB 3LZFH 1ZT7A 3VXTB 4LPYA 3WFEH 3HRZB 3VFMA 2P49B 4G9FB 4X8JB 3SGJA 3CXDH 4L4VE 4Y5VB 3FB7A 3KLDA 5CUSL 3TBVA 5IBTH 3H2WA 3V9FA 3W5NA 3O9WA 1YEDA 2JB5H 3DX6A 4KY1H 3SDAC 3LKPA 2MCPL 5FUZL 5D2NA 3EO1A 3TYGL 2A6KA 5F3HA 5C0ND 4AY0A 1OTTC 3O3AB 5EORH 4GMTH 3VI4F 5IEKB 4R6UA 1DE4A 1LO0L 3QA3A 2XTLA 3BEVA 1D6EB 4O2EA 5DJ0A 1KB9J 1R3LB 4HKZB 1KLFA 5JXAH 1U2HA 1JWUB 1IE5A 5BXFA 4LNVA 3FRUA 5FEBA 5TE4L 3ZT7A 4GXVL 4PJEF 3TO4B 4PRHB 5HYJE 2EZ0D 1KNOB 4EUPH 3ZE2E 3EJZD 2NCMA 3WKMH 3Q5YA 1S7QB 2ZUXA 3EYSH 1KJ2L 2DAVA 2QQKL 4HX1A 4JN2B 3HCVA 4IIQC 3BUYB 5FGBC 1M7DA 2QR0B 3KLHC 4A6YH 5JW4M 1NDGB 3DVNB 2PYFA 2VLRE 3PWPB 3KYAA 4JQXA 4KMTL 5F72S 2VWEC 3LIZH 5EBMB 4HFWB 4PP1D 1FJ1B 2PXYA 3SY0A 4NUGH 1UM6L 1K8IB 1XH3B 2R2EB 2EDDA 3BE1L 4JB9H 3ULUH 4J1UA 2DS4A 5ACZB 1QSEE 4XBGB 2VC2H 1G7IB 1VFBA 4WV1C 5E6ZA 4XCCL 2AJYL 2DQJH 1H15B 4A2LA 3GSXB 4HD9A 3V5DA 2VABB 3FO1A 5KSVB 3W5MA 4NQXB 1NCBL 4NKOB 3PQYE 4K2UH 4OLEA 3BXNA 4J3TA 4OQTA 5F9WC 5B38B 1HK6A 1PEZA 2HFEA 2NNAA 2IG2H 3ZE1F 4NBZB 2ZNXA 4I9WD 1W0VA 2FJFB 3CFEB 1HE7A 2HVJA 1ZLVH 1I7UB 3O9WB 4CN4A 1NBVH 4P23D 4EUPB 5I71C 4HIIA 4JDTL 2EDBA 3QR2A 4R90L 4CGTA 4IEFB 4M8QB 3LKPB 5CCKL 4IJ3B 3QXDA 2KZ1B 3VU2A 3BYTA 3H9SD 1I8LC 4ZFZA 1KIQB 3NH7L 4A6YB 1QFWI 3R4DA 2A6IA 4Y4HC 3B9EA 2H8PA 4WEUD 2NQCA 3PHOA 1F11A 5J7CC 4XMKH 3KLAA 1N5YH 5BXFB 2GY7B 5E8DH 4UOW0 4JM2B 5T5FL 1XR9A 1LEGA 2EE6A 1A1NA 1A7PL 4DTGL 5MERA 1A14L 3EZ8A 4J4PD 2PF6A 3BH9A 1LQSR 5EO0A 4JFQA 5F6HJ 2W0FB 2C1OA 1FFPA 4OCMC 1DANU 5J1SC 4P59L 1HXMB 2VLME 1JGEA 2M8XA 4MA8H 4Q7DA 5SV4A 3RWIB 3EO0A 2DLHA 2ORBL 3I02A 4DKDC 5C6WH 5I74B 3SDYL 4DVBA 1A2YB 1GOFA 2XA8L 4U1KB 1P5VA 2DTSA 4TQEH 4PTTB 3UBXA 2DI8A 3U6RA 5E00A 3F7QA 1IGFH 2NTSP 4BK4A 3OR6B 2Y06L 5D96B 4ZS6D 1A6TB 4JFOA 5FO7B 3NCMA 1IGCH 1R5VB 4FQLH 3IXAA 1Z9SA 5AZEL 3RPIA 1DQDH 1BJMA 2EH8L 4U2YA 2R2BB 3L3OB 4HG4K 2HFEB 4M7LH 5CJQH 3LMJH 4HQQH 1CFQA 3JUYA 3LOWA 1H8NA 3FAXA 4MVBC 5DURB 5D7LB 2HVJB 3VH8G 4R3SA 5LBSH 4YXHL 2DQCL 1EZVX 2DOCA 5T1LD 2EDHA 2YN5A 4OZHA 2AI0H 2OK0H 3DUSA 4ZFOA 5L8LB 2NY7H 1OF2B 2V17L 3CXHJ 2VLJB 3FB5B 3MRQA 4HWZA 1UT9A 3GO1L 3HMWH 3L3JA 4W4OC 3VXUA 4ZOCA 4L3EA 5F93C 2A6IB 4AEIH 2IBBA 4JHWL 2BOCB 5E70A 3VGHA 3WFBH 5IV2B 2YHGA 3PJSA 3DUUA 4LIQE 1J1OL 5EDXA 3REWB 5F1NB 2H8PB 3BGFB 4NT6A 3O6LL 2NXYD 5E2UH 3HR5B 4NN5C 4Y19E 5FA3B 3WFDH 1LEGB 4LARH