5C3TA

Pd-1 binding domain from human pd-l1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
b'AFTVTVPKDLYVVEYGSNMTIECKFPVEKELDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
molecule tags Immune system
source organism Homo sapiens
publication title Structure of the Complex of Human Programmed Death 1, PD-1, and Its Ligand PD-L1.
pubmed doi rcsb
total genus 32
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c3tA00
1KT2B 2XPGA 1DANT 2NR6D 4WFFD 1JZ8A 1CL7I 4PJ9D 3NABH 5E8NA 3ZKQD 5D7JA 5IFJA 4Y4FC 1GGIL 5DJ0B 3PV7A 1P4LB 4L3ED 4NRYB 3KLAA 3L3KA 5ESQA 5JIHA 4M5ZL 4JPWL 2A1WL 3VGHA 1LWRA 3VXUA 5I8OH 3HC4L 2GJ6D 2ZNXA 1MFAL 4V2BA 4W6WB 4KQ4H 3GUTA 3CX5K 1T22B 4AENB 5T1KD 4KVCL 5T3XH 4FABL 5DZNA 4JZOA 4WENB 1IKFL 4X6CF 2YD3A 2BNUA 3GSUB 4KJYA 2Y36L 1J0IA 1D6EB 1KCLA 4XAKE 2Y72A 4PJAF 3WFBL 1P4BH 5J3HC 3BGFB 5TDOB 4R7NA 4DW2H 1WZKA 3G04A 5KSAB 4BFIA 3QPXH 2XG4A 4LLWA 4HD9A 3QUMA 4OT1L 3HCVB 2FO1A 3QISA 2C4XA 2ZUVA 5DQJB 4O2FB 1EEZA 1QQDB 2AJVH 4G8FB 3W0WB 2EEBA 2CPCA 2FLRT 4PGBA 2X4UA 4QRRE 4OFDA 4OZGE 4Z0XB 1EBPA 4XVUD 5B38G 5IVZB 5JQ6H 1I8LC 1MCCA 2EXYD 4QCIA 3FQWB 3SCMA 2H26A 4AQ1B 4Z7OE 4L4VB 2WBJA 3IJSA 4PJCE 2C4FT 3I75A 2E27L 2Q76A 4RIRA 2FCBA 4MDIB 1I1YB 3RUGA 1BQSA 5LGHH 4RNRB 4OV5B 4FXKA 1OSPH 4PY8I 4JDTL 2HTLD 1HEZB 5E99H 2VN7A 2YR3A 2A6IB 2VB5A 1LO0H 2R1YB 4RMRA 3FONA 4S10A 4KY1L 2W9EH 4PJ5B 4FZEH 1AJ7H 1YMME 3S7GA 3VH8A 3S34H 1IC5H 2VDQL 1QTYT 1NDMB 1LEIA 4RQQB 1NLBL 1EAPB 4FS0A 3D0VB 5ILTL 1Z9LA 5I66A 3BKMH 1X7QA 1N6UA 2DIAA 2NNAA 1K4DB 3CVHB 4FQ1H 4ZOAA 3ARBC 4BSJA 1T22A 1EH9A 4KAQH 4TPRH 4NUJB 3MR9A 3ARBA 4YDKL 4CN1A 2HT4C 3BEWA 4OV6F 3IVKB 5FYJD 1EK3A 3MRKB 4U49A 3RWEB 1CIDA 3EO0B 4JFOA 2OL3A 5JDSB 3ZTJH 2X89A 1G9NH 3SKNA 4GKZA 4NRZB 3KPSE 4BQ9A 3MV8E 4GRLC 1OB1A 1MUJB 5IMMB 1GHFL 2CGRL 5HHMB 5LXGH 2DQIL 2D31A 4GKNA 4JGMA 1L6XA 2AEIT 3C5ZC 3HB3C 3PHOB 4LQFH 4I48B 4CMHC 3GB7A 1Q1JL 3D18A 1GIGL 3HUJB 1D6VH 3MBED 2AQ3A 4EN3C 5DTFB 1X5ZA 2FD6H 3D2UD 5I1LB 4O58L 4N9OB 2MCPH 4PV9A 3AROA 5FO8A 4YWGH 5I6XC 4S1RH 5GSVB 5J1AA 1IQWL 2ICWJ 1IAIM 1Q94A 2PTUA 4WVRA 3X11A 5TFSL 4RFEB 4ZD3L 3EJJX 1J88A 1RK0A 3VGBA 1MVFA 5DEGA 3NCJH 2QSCH 3OAYK 4TRPL 2H3NB 3FT3B 1AD9A 3SKOA 5IJKC 3D85B 4AEHH 5FUZL 3GSWA 4WU5A 1QLRB 4XBEH 3PP3K 3RY6A 4K94L 3V6OA 5KSVB 4QGTA 1N59B 1T03L 1C5CL 4N5UA 3CZFA 4FZ8H 2YRZA 4H0HB 4F57L 3E8UH 2ZCKL 1UXWB 4P57B 1YDPB 5DVOA 4KJWD 5ICYA 4U6VH 1NEZA 4XRCA 3MBEB 2VXQH 4MDJA 3ARRA 4JQIL 5KS9A 4OM0H 5GRJH 1S7XB 3V7AE 2WINB 4YHLL 1UWEL 5F6HI 5I8OL 4FQHB 3O2VL 1G7MB 4Y19A 4L8SC 1ZE3C 2P49B 3IJYA 1MFAH 3JWDH 4XCNA 1F11A 5TDPA 3RNKA 1Z6JT 2JELH 3HC0A 5T3XL 5L9DH 3CXHJ 4AEFA 1IEAA 3QJFA 5DT1H 5A16B 2UUDH 3WO4C 1JZ6A 3DETC 5FB8B 2NY3C 1BFOA 5E4IA 4ZODA 3FFDA 1RZFH 1P4BL 2QQLH 1IBGL 2F8OA 3BIKB 4U6XB 4CU6A 3QDGE 5ESAB 1X9QA 1GCFA 1T21A 5D93B 3J8F7 5EBMB 5BRZA 4IRJA 3GMRA 4ORGA 4HKJA 2XWJB 2OTWB 5BZWA 2GITB 4QRQB 3FTGB 3SO5A 3MRHB 1I4FB 3S9DB 1A64A 4NO2A 3RQ3A 1KJMA 5FYKU 1T6VN 1JPTL 3DHMA 2AXFB 1IQDB 1B2WH 5SWSE 1VFAA 4KRPD 3FQRA 5K59E 1O0VA 4G6AC 4OCXL 5TJWK 1A5FL 4TSAL 2ESVA 4NHUB 4OZHE 4B7IA 1S78C 5F9OH 1JTTA 1IQDA 4P3CH 4PIRF 4H25B 1IM9D 3ULSB 2N7BA 2Z35A 4CVWA 2R4SL 1T7VA 2E27H 4NGHL 3QFDB 4FTVB 3PV6A 4L9LB 3REWB 2LFGA 1OSPL 1N6QH 1CDBA 4G8GA 5EOQH 4JDTH 2D7QA 4K9EH 1M4KA 3UEZA 4NO0B 1DANU 3QI9B 1NGWB 5DMJB 4DK6A 2OYPA 5D7JC 3RX5A 4G9FB 4XPFL 4JDZA 1UACH 2DOCA 2AJUH 3EHBC 4O2CB 1MCBA 3O0RL 1NLBH 3P77A 4GAGL 4I0PD 5E24E 5C1MB 2LE9A 3BH9A 3C9NB 3L6FB 3C6SB 1L0QA 4LASL 1ES0B 4J2XA 5E8DL 4PGJA 3GFUA 4OZGB 4IOIB 4KAQL 4TPRL 4BH8A 2GW5A 3WXVL 4NKIH 4YDKH 1FNEA 5EU5A 3S6CA 2MSPA 1XF2A 5JHLL 4NN5B 1X5LA 2P47B 4DVBB 2P8PB 3BDYL 1Z9SA 1XMWA 3CDCA 1P7QD 3ARSA 4MSWA 4ZXBB 1A1NB 4NFDA 3VGDA 5C0EA 1Q1JH 3KPOB 3W2DL 1QR4A 2HJFB 1YMMB 4P2QE 2W0FA 4O58H 3VA6A 2MPAL 3PWNA 3TVMA 3CSYA 4RAUA 2PYFA 1P7QB 1ZT4A 2CH8A 3PIQB 5E2VL 2HFTA 3EO9L 5DJYB 4DN4L 2NXZB 4RDQG 3D3VD 3S36H 5HHQB 4Y88A 3C8HA 5CD3A 3FFCB 3ARGB 3SCMC 5E00B 1WBXA 1ZVYA 2GQHA 2EYSA 2D0HA 3QNZA 3HE7C 4BQBA 3TESA 4ZUWA 2DQGH 5DO2D 5FUZH 2Z93B 1AQDA 3S88H 1ITBB 4FRWA 1QSEE 1HSBB 1QG3A 1RU9L 4B7LA 4FZ8L 1JWMA 2FSEA 3FOLB 5A2KH 5HY9B 4F57H 1INEL 1KB9J 5FAAA 4YQXH 4EOWH 2YD8A 2AEQH 3WDJA 3GMNB 4LCCA 4OAWB 4S1QL 5KVFH 3IF1B 3Q5OA 5FIEA 1ZLSL 4JQIH 3UBXI 4OM0L 5GRJL 3KYOB 2ICEB 4CDGC 3JTTA 4YXLH 4UDTA 3HNVH 5IMMA 1NBQA 2XKUA 3LEYH 4ZQKA 5KVGH 2DQHL 3VDAA 3H9HA 1QO3A 2JIXD 1HDMB 1NCNA 5MENB 3T0ED 1K3IA 5D2NA 3GK8H 3F8UB 5C0FB 3OKOA 1YQVL 1VFAB 5IFAH 5C0GA 1QFWL 5ADPL 1GC1H 2HFFA 2NY3D 2Q8BL 3BGAA 5L9DL 1YN7B 3PWLB 5IOPB 5CLTA 3DHJA 2GITA 5T1LD 3RX8A 5DT1L 5BW7A 1KLGA 5GZOD 1A1MA 1NDMA 3KAAA 2Y7QA 1W0VB 3K7UA 3DXAB 3IGAA 3B5HA 1S5IH 4OM1H 3S5LA 1F97A 2VZSA 1WK0A 4RCAA 1RI8A 2Q3ZA 3N1MC 4JHAH 1J1OL 3P9MA 4OKVA 3F7QA 1IGMH 5CJXA 2KL6A 3LRHA 4M9OA 2HMID 1QBAA 2YEZB 1PJ9A 4POZD 3BQUA 1G7HA 3H8NA 3RVUC 1MCNA 3SE3A 4TNWK 5HI3C 4FQLL 3QEQA 1I8MA 4MNHA 4MD5A 1WJ3A 1JPTH 2VLJE 4ODVH 4YEFA 4OCXH 3KXFA 5ABDE 3SGKC 3V4UH 3V6BR 2AGJH 1KLFA 2UUDK 4QOKE 5C08A 4U1HB 4X6EB 1NSNH 4U0RB 3HG1E 4P3CL 4XP6L 3KWWA 3PJSA 4ETQB 3RZCD 3U1SL 2OR9H 4XCCL 4NGHH 4F8QA 2M26A 4ODHL 7CGTA 2WWMD 5EBWB 4Y5XC 2X4SA 3OGCA 2ICWB 2V2WB 4WI8A 2DBLL 1N6QL 1MHPH 5EOQL 2YD4A 3AMLA 4FFVC 3S5LG 4PBXA 1I1AC 1Q0YH 4TUJB 2DMKA 4XPFH 1NFIA 1AGFB 4NCDA 4M8VA 5HGAA 4GSDL 1FORL 1ZHLB 1A14H 4JVUA 4LHUG 3QNYB 5H2BB 4DGIH 1JZ7A 4P4KA 5J8OA 2LABA 4GAGH 1TZGH 2IAMC 4K7PL 2BNUB 3GSUA 3V7AG 1TITA 1H15A 1FG2B 1G7PA 2PO6B 4AYFA 4JZOB 1U3HC 1UKQA 4LASH 1JV5B 3NVQA 1ZS8B 3S37L 5E8DH 3C6LC 4R4FL 4MD0A 3BPNC 3H42L 1JHKL 2ZCLH 3DMMA 1BVKA 4KXZI 4FQXB 5K59F 2K3TA 3VWJB 4XH2A 4OUUA 3UTTA 2YKLL 1G7LB 5T1DL 2XWTA 1SVCP 3RHWK 3VWKD 4R4BB 3TJEL 2W60A 3FQXB 1LE5A 1QEWB 3B2UD 5E1AB 4IHOA 5DD1L 4XZUB 3W2DH 1RJZB 5HJ3B 5HHNA 2CRIA 3B43A 2GKIA 1CE1L 2FIKA 3O3AA 1OSZA 2MPAH 2B20A 5I75C 2X4OA 4X6DB 4YHIB 5I76B 3ZDYE 3CJJA 4HH9A 3I84A 3QA3A 1P2CA 4KHXL 3EO9H 3BIAX 1EO7A 4DN4H 3ARBB 1QYGL 4JFFA 2FHFA 5ECJE 3MFFA 4HKZA 4JFEB 1JPST 1AO7E 2V7NB 3K1DA 3FAXA 2DQGL 3ARZA 4PRHB 5I1EH 5DD5L 3QP3A 4LBEB 5B39A 1NGZB 1W8NA 4LSUL 3U79A 2V9RA 1DJSA 1TQBC 3O6MH 3QDAA 1INEH 1WZ1H 2CSPA 4R97C 5D7KE 1S7RB 4HGWA 1NANI 3BESR 1SYSA 4NQEE 1ADQA 4QHNA 5KVFL 2NTFA 1ZLSH 3QEHA 3QB7C 1QPPA 4L3EA 3MJ9H 4O02H 1W72B 5D8JL 5L2KB 3ZO0A 3QNXB 5EZJB 1U9KA 43C9B 4XMKL 1FRGL 4MNQE 5DHXB 4D0DB 3OKDA 2Z8RA 3P9WB 2Z92B 1K6QL 3J7HA 2P8LB 3QFJA 5IVZA 3VXMA 1UXSA 3ALWA 4GAYA 3NFSL 4WW1B 1AGDB 4YR6A 5L2KD 1BQHG 1IFHH 3U46B 3O9WB 5IFAL 3FB6A 4PRIB 5DS8B 5EPMA 5FDWB 3G6JE 3S97C 1QSEB 3QUKB 1VADA 1OARL 1KCUL 4YPGB 3OB0K 4U6TA 2JB6B 1NC2B 2XIDA 3TN0C 1NBVH 3T4AA 3WFHB 3I6GB 3O2WH 4NKQB 5CEZL 5DRZA 2NY7H 2QR0B 1J1OH 2GJ6A 4AEIL 3P4OB 2XACC 1QRNB 2MCG1 4BQ8A 4H26B 2P5EE 3O6FA 5F1NA 1OWRM 2ATPB 4FQLH 1NCUA 2ZUYA 1H15B 2XA3A 2O26U 2J5LC 3P4NA 1BQHA 4F37F 4DZ8A 3ULVF 4YHZH 1OTSC 2FHBA 2AGJL 1JFQL 3VFMB 2YRLA 4TUJA 1JMXA 2X09A 3PWPB 4XP6H 5ESQB 3BH8A 3UTQA 4XCCH 4RMTA 3JWDC 4WU7B 2CJUL 1DBKL 3LN5A 35C8H 3FQTB 4WRLA 4L4VD 5FHAL 2ICWA 2V2WA 1XR8A 1RIHL 3CPLB 3RU8H 2W91A 1N5YL 1DLHB 5C0AE 2VH5L 2CLVB 3D6GA 3PJSB 4LMQE 4G8EA 4U1GC 1JZ4A 3FN9A 2NX5E 1MJJA 4GSDH 4U3CA 4XNMA 3WLWC 2EZ0D 1YEGL 4P49A 3FB7B 3PP4H 2GT9A 1KB5H 4XBGB 1SEBA 4BSVB 4NQSB 1QBML 4LLVA 3L3IA 1PLGL 3D85D 3MLZH 1N7ML 4OIBA 4KK5C 5HHOE 2CRZA 2EDLA 2X1WL 4NNXB 3S37H 3IT8D 1RK1A 3TBYA 2YEZA 4H1LH 2ZCLL 2A0LC 1C7TA 3IFOB 2LV4A 1VESA 4P3DA 1P1ZB 1XCQA 3OXSB 3V8OA 4K23L 3V5HB 3ZKMC 5T1DH 3K0WA 2VXVH 4PY8J 1NFDA 3TJEH 3PDOB 2WBKA 5GJSH 3UYRH 2W65A 3QUMH 2ZUUA 2HFGH 3HKFA 2H6PA 4P4RB 1SY6L 2V2XB 1T7WA 4NWTL 5FGSA 2HFFB 3L3JB 2B39A 4JY4B 1U8JB 1C16A 1U6AH 1A47A 5ISZA 4XP4L 2C26A 3WJJC 5JTWA 4ZTOH 1VACA 1JK8A 5FA4B 2AXGB 3B9KC 4ZDHA 4NHCH 3TA3A 3DMMC 2P7TB 5EC1B 1CL7H 3O2DA 1D9KA 1WFUA 4DOHB 3LS4L 1GXEA 1QYGH 3T0BA 3HPJB 4GW5A 3SJVD 4PJXE 3CFJB 1FN4A 2OJZH 4ZFZA 2DQDH 3UZVB 1CGSL 3VU2A 4WW2B 2Z31B 2Q8AH 3T2NH 1MIML 3ULUE 3CFJA 4RAVA 3C60A 4R7DA 1ZLWK 4XNYL 2G9HA 3BWAA 1ZHNB 5I1KH 2R56L 5D70L 2M1KA 5ERWA 4LSUH 2NY3B 3C8KB 4FQPA 5EU6B 3O6ML 1LK3L 5EC1A 2Z4QA 3DROA 1PG7H 2ORBL 3BSZH 2W9DH 3VJ6A 2WIMA 2CRMA 4NO0D 1EJOL 1F2QA 2X41A 2Q7NA 3MJ9L 4O02L 5D8JH 5E2WL 4HUUB 4FQQA 3HI6L 3VFNA 3VFSA 2VLLA 2UYLA 5I15L 4G6FD 3BP5A 3FB8B 1KJ2A 4F7EA 1FDLH 4M6MH 3VFRA 1UJTA 4NQDB 4IM8A 3QZWG 1VFUA 2Z91B 1K6QH 2G2RB 2SEBB 3CU1A 3SDXA 2BVOB 5I16B 1I1AB 3NFSH 3RGVD 4Z7QF 5E5MB 4WTWA 2LAGB 5BRZE 1ZA6A 3CSGA 4HS6A 1ZA3A 4HMEA 4NQDD 1GH7A 3O3EA 1GGIH 3MCLH 5F9WC 5JW4N 3VCLB 5FUCC 2Y4SA 5J9PB 1KCUH 2OM5A 4P2RB 5DHVB 4M4RA 4WHYH 2HRPH 1YYML 5IW3A 3N1GC 2FL5B 2V7HA 4D0BA 3NFNB 2NY7L 3DUUB 4OQ1A 3GIZH 1CFTB 4OGXL 4KI1A 3A6CL 3T8XA 4X7TB 3PHQB 4KQ4L 4IOIA 2NYYC 4YDVA 2CLVA 3FO0L 5HDBE 4KVCH 4M02A 1ES0A 1BIHA 3QIUA 1IKFH 4JFPB 3FO9A 4QXGL 2A2QT 3ESVF 3FQTA 3HE7A 5MHSE 3MRBB 3RZCC 5EO1B 5AAMA 3B8SA 3NCMA 2XICA 3L3DB 3OXRB 1NJ9A 4YBLC 4YHZL 1OT2A 2MMXA 1JFQH 3Q0HA 3C5ZA 3K2UL 3MV9D 2P48B 3QPXL 2Z31C 1FC1A 4CVZB 2EIDA 3QHTC 3SDAA 1OAZL 5F72S 35C8L 1PSKH 5MERB 1CFQA 1GC1C 3STBA 5J3HD 1YYLL 2VQTA 4OLWH 1MI5E 1RIHH 5IMKA 4FTVD 3N1FC 1HHJA 5DJ2B 4KKAC 2W07A 3NZ8A 5DA0B 5K9KA 3F7YB 4GS7C 2VERN 1J05A 3TZVB 1YEGH 3CDGB 3I9GL 1DEDA 3PP4L 3PWUA 1KB5L 1G7JB 5C0BA 1BZ7B 4PJEB 1FJ1A 1KJMB 1PLGH 1T2JA 2YHGA 1WBYA 5LGHL 3C2AH 4CMMB 5BW7C 4GUPA 4PV8A 4HDIA 2DM3A 5LG1A 3U4EB 4X7SL 4Q9CA 1RUPH 4EQ2A 3ES6B 3VXTA 1HSAA 4M7JL 1LO0L 3T0EC 3PWPE 2W9EL 3SN6N 3NCBB 1AJ7L 5IB4B 4LSDA 1UQSB 4M5YL 3GDBA 3O4LE 2Z92A 2VLKA 4WEBL 5GIRA 4F2MA 3Q5TA 1D5XB 2JJTC 3B9AA 3GSXB 3QH3B 3FHAA 4E9LA 3UYRL 5EZJA 4Q6YA 4JM2C 4PGEB 2X4NB 3BKML 3DMMD 4FQ1L 1U6AL 3ES6A 1EDQA 1QSFB 2GCYA 3KYKL 1A3QA 3GSRA 1DUYA 2KZ1B 5GS2H 3WUWB 3PGDB 1IL1B 4KJQC 1K5NA 2EIEA 1G9NL 2R9HD 3GMLB 2A74A 3IJHA 4AL8H 3PWUB 5LQBH 4YLQT 5HVFB 2OJZL 1TENA 5GGRB 1CU4L 3G5ZB 1GIGH 3SKMB 3BWUC 5DRXB 1T4KB 3WJLA 3FFCD 4YO0B 4PRID 1KFAH 2FD6L 1S7SA 5CMAB 2R56H 2ATKB 5FGBA 1JRHH 2MCPL 1KTDB 5D70H 3CFDA 1MWAA 2CDGA 4NKOB 3WNMA 4PRPA 4JGJA 4S1RL 5GPRA 1IEHA 1PG7L 1IQWH 5CJXC 2AV1A 5GGTH 3TA3C 3UO1H 3EOAB 2XN9E 2W9DL 3VA2C 4JG0L 3DVGA 1EJOH 5TE4H 4KKLD 5IB2A 4R2GB 2PXYC 2QSCL 3WLWD 2GTWA 4TRPH 2ZSWB 3X12B 3ARPA 4LNRA 1NCTA 4WHTB 2UV3A 4JM4H 1EFXA 1NMAL 3KS0J 4XPGL 2UVEA 4KI5D 3KPRD 1OF2A 2ZSVB 1AY1H 4K94H 1KYOJ 3QIUB 5FM8A 5DI8B 1DBMH 4YDVB 2ZCKH 2YPKB 4AIZA 1OW0A 2X1PA 1WCQA 5AD0B 4N1EA 4O9HH 4UTAH 2DQCL 2VXQL 1A9EB 4Z7WB 1PQZB 1EEYA 1JN6A 4BUGA 3MJ7B 1A6TB 4JFED 3OAZK 4IIQC 2X1OA 4UQ2B 3BEVA 4XBPA 1AXIB 1R3IL 1JRHI 1UWEH 1YYMH 4I2XB 3FMGH 3QNYA 2M2DA 5H2BA 3GIZL 1FFNA 3O2VH 4OGXH 1Q9OA 3L9RB 2BJML 4NUJA 3B9KA 5FXCH 1KULA 4M7LL 1IGIL 4PJDB 2APBA 3RAJH 3FO0H 2NY6B 2JELL 5JO5B 1FV1A 3EFFB 4QXGH 5E56A 1R3KB 4M6OH 4LPYA 3BKCH 5C6TH 1EEQA 2PETA 3VXUD 2YOCA 1HCFX 3P2TA 3O3UN 3VFSB 3KWWB 3MV01 1IBGH 4S2SB 1CLCA 4Q2ZA 1RZGA 3F58L 3K2UH 5DSCB 1B0WA 3R0MA 5DMGC 3REVA 2C1OB 5DMKA 1ZMYA 5IHUH 4Z78A 2ZUXA 1PSKL 4JFFE 5HYQA 1OCWL 4PJ5D 4YC2C 1YYLH 3F7VA 4PJCB 3VXSD 3WXWH 1M05A 3CFBB 1GSMA 1KIRB 3H6JA 5CEZD 5DHYB 4RAVB 1EFQA 1PD6A 3VXSE 2YD5A 1R5IA 5GIRB 5FO9A 3HRZB 4Z0XA 1MQ8A 1KTKE 1TVHA 3I9GH 4Q2ZB 4QXUL 4Z77B 5J6GB 4HIHB 3MREB 3DXAA 3G6AA 2R4SH 5M95B 1R3LB 3JXAA 4ZMAT 2BSRB 3C2AL 32C2B 5T1LB 5L2KE 5FYLE 3NTCL 4K9EL 4KKLC 4KJPC 4WV1A 4PJEA 4M7JH 4OD1L 2C4FU 1VPOL 1G7JA 4Z7QE 4HK0B 3T04D 1UACL 2V2TA 2EH8L 2AJUL 1FO0A 3O0RH 4I5BA 4BYHA 4HHAA 1BWMA 2GK2A 4CW1A 1D3CA 5C3LD 4Y8DC 1MI5B 2BVEA 1XIWC 5GHWH 3QYCA 2HWZH 4MJ2A 5LJYH 3QULA 3DARA 3D9AL 4X5WA 2PYEA 1FVDB 5DJZB 4OFIA 3HTLX 4I18B 1J0ZA 3HZKA 1EFXD 3WXVH 4NKIL 5DUBA 3KYKH 4BSWA 1MCRA 2A77H 3BP6B 4Q6IA 3HUJE 1CFNA 1ORQA 1U8IA 1Q0XL 5TGBA 4Q9RH 2ZG2A 4G6FB 3E3QE 2NW2A 5A1AA 4M6NL 5I1HH 3VFPB 4NQEA 4AL8L 2NY5C 2Z93A 1NGQL 1PX4A 3RY4A 5KSBA 1S8DA 2BHZA 4WHTA 4YFDB 5HGBA 4GW1A 1CU4H 3BMWA 3U83A 3E6FA 4JFXB 3TV3H 3JVGA 4K8RD 2P5WB 4LARH 2AV7A 2XN9A 1AGEB 1LMKA 5E2VH 1I1FA 3MRRB 5CJOL 4JJ5B 2NW2B 1S9YA 4XWOC 5I73C 2XKSA 4JG0H 3IS0X 2XFXB 3ARFA 5F96H 2EIZB 4KDWA 3TIEA 3GRWA 3ZYIA 5CEXB 1KUMA 1A7RH 4HS6B 1J87A 3CMOL 2MNUA 4IS6A 4JM4L 3VWKA 1NMAH 5A3ID 3CC5B 1N0XL 5E5MA 2RAMA 1ZVSB 4FXLA 1RU9H 1DBML 2YZ1A 1RZ7L 1K5NB 2IADA 3PL6D 1A6ZB 4EOWL 4YQXL 3MC0A 4S1QH 2HVKB 3U82B 4O9HL 4UTAL 2DQCH 2HVJA 4F58H 4R3SB 3FQNB 4NN7C 4HAGA 2GJZA 4YXLL 5BXFB 3NIDF 5DJCA 2Q3AA 2BCKA 2ENSA 4G80B 3HZMB 4N0FA 4RFNB 5DFVD 1G7QA 1OGTA 5HHXH 4KKCC 1CI5A 2E6JA 2ID5A 3RWFA 4JKKA 3LKSB 2OJEB 5TF1L 4MB3A 5IROA 1YQVH 3PDDA 1AD0A 1KG0A 1QSVA 1AGDA 1IGIH 5CD5C 1QFWH 5ADPH 1CT8A 3QDGB 1UG9A 1YECL 4NO0A 12E8H 2DMCA 3C5SB 3V9FA 3BD5A 1R5IB 4D0DA 1MJ7L 2VLMD 5IG7A 2F53E 3I85A 4CMMA 1T66C 1DCLA 4CRPA 5IWLA 4OTXH 5BV7L 1UWXH 1S5IL 3IDJA 3KPLA 3F58H 2Y5TB 3TFKD 4LVNC 4JHAL 4KWUA 2IPUK 1IGML 4YDJB 2XTJE 5TQ0L 5IHUL 3IDIB 4YDLC 5DJAA 5D9SA 1OCWH 2HN7B 1CTNA 4WI6A 1I4FA 1RUMH 2O5ZH 4MJ6B 3SDDB 2B5IC 2YC1B 4I0PB 5IK3B 4ODVL 3VDCA 4IMLB 4MQXC 3ZE1E 3V4UL 5CAYB 4QXUH 4ZS6C 1NSNL 4XCYA 3HRPA 5FV2A 3CX2A 1BGXH 5FDYA 2OR9L 4ODHH 5F8QC 1KGCD 3NCCB 4L4TA 1HNGA 3HAEH 2DBLH 1A6PA 1MHPL 3NTCH 4O51B 3W9EB 1NC2D 2FIKB 4XNUH 2BNRD 2X2YA 2Y1VA 3MOBL 4KTYA 5BO1H 1KTRL 4OD1H 5EU4A 1Q0YL 3R06A 5EC2A 1T5WA 4GW1B 3F5WA 2XZQH 2EH8H 1V3JA 1F5WA 1FORH 1A14L 2FEDC 5T5FL 2CUIA 3FRPA 1S3KL 4K7PH 1FO0H 5GHWL 3KYNB 2NZ9D 3RWHB 4QHKI 2HWZL 1QFUH 4G80A 3AREB 4PB9H 4QXTA 5FYKD 1ZGLM 1BVKB 4R4FH 5JIPA 1S5HB 2V5MA 3KPMB 1JHKH 4ZG1A 5DF0A 4OZHF 2ZSWA 3BHBA 5GS0C 5I9QC 2A77L 4LCCC 1TQBB 5IB2B 2EH7H 1EV2E 3BE1H 2PXYB 3QCVL 2BVOA 3IU3B 2FRGP 5B38B 4NFCA 4XGZB 3SO3B 3EOAA 3NH7H 2FJFB 2V5SA 5KVEH 4HCRA 3UAJD 4WUUA 1NGQH 3CC5A 3LB6D 3CFDB 1VDGA 1W0WB 3NMEA 5DD1H 1G7IB 5FA3B 1JUFA 4NQED 2ITCA 4PJ7A 4PJBB 3OF6D 1CE1H 3TV3L 5E6IB 1VFMA 3PE9A 3EGSA 5GGRA 4LARL 5I1IH 5DRZB 4Y5VA 3BGMA 4ALAL 2H2SC 4KHXH 4ZNCD 5FO8B 5CJOH 3VGEA 5ERWB 1DSFL 4DGVH 1HZHL 5GISH 1IL1A 4Z5RB 4U1HA 4X6EA 2DLIA 3LPWA 1FLTX 1YEIL 1A7RL 1M71B 1Q9WA 5D7JD 1L6ZA 2F74B 3QDGA 4ZAKA 5C8JB 5I1EL 2D31B 5DD5H 5IMOA 1KIRA 1N0XH 3V5KB 2Q20A 1JPSL 2X44D 1IAOA 4K71B 3QSKB 3ZDXF 1D5BA 1RZ7H 3LKSA 2IC2A 4DWHA 5I74B 5E03A 2IAMD 4JFOB 2ICES 1G7QB 5FUOL 5JW3L 3OHXB 2AXGA 4ZDHB 3THMH 2E7LA 3AXLA 3O45A 4M48L 1PKQA 3C6LB 3KJ6H 2NTSP 1WTGT 2YD6A 3NCYS 2YXFA 1GJIA 3I3EA 2EKSB 4U1KA 1NANH 2BVTA 4JRWA 3MRNA 3DO7A 2PW1A 4EUPB 2IAMB 2HVKA 4JRYE 3H9SA 1U92B 5HHXL 5SWZD 1CIUA 5EWIL 5I8KL 5FYLD 2V2TB 1U3JA 3SBWC 1IFHL 3CFIC 3SBWA 3T2OA 1NGXA 12E8L 1IM3A 3WJLC 1RK1B 4Y5XB 1CGTA 1MJ7H 4Y4HA 1XIWD 3BEVB 4QHKJ 1OARH 3UYOD 5CHNB 5I75B 2A9ML 3T0EA 4NO5A 4OTXL 3MJ7A 2CKNA 4ZUUA 4HH9B 4TNVK 5CEZH 4XI5C 3VFUA 1YNLL 1A7QH 4E5XB 4RISL 3OKEB 4S1SL 2CD0A 1TQCC 5ETUB 1RJZA 3PWJB 4PJIF 1S7QB 5HJ3A 1N3NA 1NGPH 5KSBB 3LQAL 4KQ3H 3V6FB 4X6FB 4GKSA 4KHTH 2OK0L 4MXWH 5HYQB 4LNRB 1M71A 1OM3L 1TZIB 4W68A 3B5GA 3WE6B 3PWPA 3AY4A 4JZNB 3FFCA 3BP4B 4FFWD 2MQ3A 4UQ3B 5DUMH 5F9JA 2VLKE 5EH1A 1IGYA 1QFWI 4I18A 1JPFA 3EOBA 1L7IH 4P2QA 1CBVL 1WITA 1YMMD 4RDQF 5E7BA 1U8QB 1AXSB 4OGYL 5FHAH 1EZVX 5GRYA 5IB5B 1QBBA 4XNUL 4CN6A 5CHNA 3OG6B 1NCAL 5BO1L 4Y4HB 3SGEH 3RIFK 2AK1L 3B9KB 4N5ED 3RNQA 3VG0H 2IBZX 1JZ2A 2XZQL 4FG6C 3MGTA 2BNRA 4WTZG 5T5FH 4MAYA 1A1OA 1S3KH 1QBMH 4LPUA 2VISB 4CKVX 3QHFL 5B38A 3VFGH 3MLZL 1N7MH 2VOTA 1VADB 5I0DA 1QSEA 3QUKA 5IVXF 2X5PA 4NM8L 2OSLB 1DUYB 2BSRA 1AR2A 1PBYA 4QRRA 1QPXA 1S5HA 1R3LA 1ZANH 2UYLB 1HILB 3T1FA 3GNMH 4OZGA 4Y0GA 1QLFA 3LKQB 2K7PA 4L9DA 5IKCB 4P5MA 4E0RB 5F9DC 3BE1L 3QCVH 2BVQB 5INCA 4FP8H 3RL1A 4ISVA 1DL7H 1NCDL 4TULL 5KVEL 4N68A 1KJVA 3MLTA 4FQCH 2ARJA 1T3FA 4X7FC 3QUML 1S9XB 3KPPA 2QQKL 4NWTH 3NPSC 5GGUB 5JQHC 5IMOB 1AHWB 3IDUA 1F4AA 4WWKA 2G5BB 4XP4H 2HG5B 1Q9WB 2N4IA 4KK9D 3O11B 4ZTOL 2UWEE 3W9EA 4PLNC 4B41A 1Q9KA 3IYLW 4NHCL 4ALAH 5HI4C 5F89B 4PJFB 1HZHH 5GISL 3F6LA 4K3EH 3LIZH 4HJGB 1S7WA 2JJWA 3WYRA 4HLZG 5JO5A 3MA9H 3MRLA 4PJGE 5FGRA 5I1AA 3T2NL 1MIMH 5IGXL 4PJBA 5E6IC 1CF8H 4OFPA 3BYTA 5AAWA 3GIVA 1J11A 5I1KL 1U2CA 4Q9BA 2C3XA 4M93B 4KUCF 4QWWC 4QRQA 1LK3H 1WAAE 4EXPX 3IDIA 1GZQB 3K4DA 2ORBH 3BSZL 3THML 3DV4B 3KJ6L 5FM4A 3KS0H 4UIMB 3CFCL 1FZJB 3HLAB 3NPSB 3MRPB 3LEXA 4XVUC 5E2WH 3KXFE 1MFBH 1CS6A 5D5ME 4J3XA 5I9QB 5EO1A 4MB4A 1FDLL 1ZHBB 4M6ML 4PJ9A 4LSRL 1D5XA 5IG7B 4HUVB 4UBDC 4NCC2 1RFDH 1BFSA 1EGJL 4QF1B 4NBZB 1UQSA 2IPKB 4LLVB 4WNQB 1PZUB 5D1XD 2AJ3A 2IPTL 1FZKA 3LKQA 2VQ1A 1EFXB 4YDIL 1TVDA 5KBNC 5E6ZA 4LLUA 4ZUSA 3MCLL 5E00A 5F7LB 4L4VE 3U9PL 2A9MH 4UI2A 4F9LC 3CZJA 4O51A 5J6HA 2HRPL 1PVHA 5E9DD 2AEPH 3ULVE 1U8NA 3FQNA 2VNCA 4GBXD 4P4KB 4MDJB 4YGVB 1YNLH 1G6VK 4RISH 3VRIA 2BNQD 4S1SH 2H32A 3A6CH 4XCYB 4F7CB 2AJSH 1UADC 1X44A 1MIEH 3VW3H 2FHCA 1T4KA 4QHLB 1ZLUH 4UV7H 4E41E 1NGPL 3LQAH 4KQ3L 4KHTL 1FNFA 4MXWL 3MV8A 2P8PA 5ICXA 5HHVL 4N0UE 1OM3H 2VZ1A 1T89A 3QWQB 4N9GA 4NZJA 1XF4B 4Y19E 2DWDA 2J12B 4OLZH 1MHEB 2FO4B 1MAMH 3OJDB 1E4XL 4PYHA 1Q94B 1OAZH 3DROB 5HI5C 1E6JH 5DURD 3EYFB 2FX9H 4OLWL 4JFPA 4LCUA 2B8OT 4G43B 3AS2A 1GGUA 3V7MA 1BOGB 3FO2B 4TVPD 5JIKA 4LLUB 4ZUSB 2AK1H 3PHQA 1G0XA 3VG0L 5D1XC 3T65A 1EIBA 4PTUB 5E70A 4YGAB 5DURB 3WNPA 1OP3H 1G9NC 3QDMB 1T1ZA 2VLME 4GAYB 1A0QL 3QHFH 2YK1H 4V2CB 3VFGL 4KJPD 3VCLA 5J9PA 3M8OH 3RWEA 1EX0A 3O3EB 3DSNA 3LQMA 4C58B 5CWSA 3SJVE 5F7EH 1QR1A 4PJAE 4X7SH 1RUPL 4C59B 1ZANL 4D0CA 5BS0E 3IETA 2DQFA 3LY6A 2EDYA 1FVDA 1WWCA 4KDVA 3HLAA 1FZJA 1PEWA 3TPKA 4K3JL 3AM8A 3W5NA 2ZKHL 1YN6B 4PJIA 4L3EE 1LVEA 4FP8L 4N1HB 4M5YH 4N90D 3ZYOA 1SYSB 1TJHH 4WEBH 1NCDH 4OZ4A 1DQQA 4NC1E 1HHJB 3EYOB 1BLNA 3M45A 3VH8B 4PJIB 2IAMA 5JW4Q 1ACZA 1PKOA 5D6DC 2QQKH 1P6AB 1BHGA 2W9LA 3GSQA 5DJAB 4K8RC 1J0KA 4QRPA 5A2FA 5KN5B 3BVNB 3DVNB 4U05A 3BUTA 3VXQB 2CUHA 3BW9B 1MCQA 1C08B 1KGCE 2J8UF 3TIEB 1I1YA 4MA1C 1TCMA 2QSVA 5J13B 3QA3B 3LIZL 1GOHA 2H26B 4NN6B 1IEAB 1WFTA 3FO9B 2BERA 5LQBL 4L8DA 3AAZB 3MA9L 4RSVA 2IH1A 4XCEB 2I9LA 4PJDF 5T5NF 1KFAL 4I13B 1A6WL 3JV5A 1JRHL 1RZ8A 3TO4C 1FL6B 4IIQA 4WI5A 3UTSE 3EYFA 1AKJA 4RAUB 3BXNB 1RZKC 3WS3A 5GGTL 3PWNB 3HZMA 3UO1L 2XWTB 4Z9KB 1QKZL 4UIKL 4U1MA 4XB8A 5JXAL 2EDFA 5TE4L 3T0XA 3L3JA 5FF6B 1MFBL 3WV0A 4QRRB 1MCOL 4XPGH 4JFDB 2VLKD 4LSRH 3BPNB 1AY1L 4P57A 2VZVA 1RFDL 1EGJH 4CBPA 4QHLA 2PNDA 4KRPB 4ESKA 4H8WH 2IPTH 3V5DB 2YPLA 4YDIH 2BNRB 2JE8A 3G5XA 5DEFB 4B50A 1AD9B 3L5XL 4F15B 3RX7A 4NNXA 1J9CT 2DB8A 5JUEL 3U9PH 1U3HD 2LU3A 5DC0A 1VSCA 2V5YA 4PJ5E 1B0RA 1BD2D 1R3IH 2AEPL 1EJ6A 2E7HA 2CIIA 1AKJB 3FMGL 3ARED 4IIQB 4O2CA 3SE8H 2VLRD 3MCG1 5JOPE 2A0LD 3G6AB 1NUDA 2BJMH 3RVXC 5CUSL 4M7LH 3R06B 1TJIL 1Y18B 3RAJL 3VXPB 4WJ5A 1F2XK 3LKOA 4UV7L 3SDAD 4K9EC 5BCAA 1CXLA 5MEOA 4M6OL 3MMEB 3BKCL 4LHQB 2BK8A 2RB8A 5C6TL 2I24N 1M05B 3TF7C 4K3GA 5HHVH 4FQ2H 3S35X 4XHJC 3ZE2F 1O7VA 4Z78B 3GBML 4OLZL 3DVFA 1F3RB 4NDMB 1BQHB 1E4XH 2HH0H 3RRQA 2CO7B 1NBYA 1CWVA 4YK4B 4XXCA 2X89D 4CADA 1G6RB 3KJ4B 2J1KA 3WXWL 5I66B 3QDJB 4JM2D 1MELA 1BLNB 1Y6MR 1AKJD 4H26A 4HAFA 1SYVB 2MQ0A 3GMRB 4ORGB 1ZLUK 3ZHLA 1KIQB 4AZ8A 4YDJA 4YNYA 3MCKA 2Q7YB 2V7NA 1T21B 3NN8B 5KVMC 4FFYH 4NYLA 3QXDB 3ARDD 1A0QH 1UA6L 4Y4FB 4X4ZA 1HDMA 5A16A 1A7OH 1T0MA 1B0GA 2FGWH 4AY0A 2OBGA 4P23D 5F7EL 3X17A 1LEKA 2HT2D 5DXWA 1VPOH 1IGTB 3FFCE 3VI4F 1JMZA 5IV2A 1BJMA 1C5BL 1U3ZA 3IF1A 4ZUVA 5IFHL 2HLAB 3OKMB 3OKLB 1R3HA 3H9SD 4F2MB 1SQ2N 2NW3B 4NKMB 43C9A 5INCB 4G43A 4X4MA 2IFFL 3RHWF 4X6BB 1GRWA 4PLKD 3D9AH 1CR9H 4GG6F 3DIFB 3SGJA 4QTIH 3P0GB 1R5VA 1UKTA 2X4RB 4HIJB 1CG9B 5AYUL 3S35H 3GHEL 4Y4HD 1Q0XH 5C07D 3UX9B 1PAMA 1MREL 4Q9RL 3ARGC 4J1UA 3OJMB 3EDDA 3QXAA 4PUBL 3TYGH 4M6NH 1P4IH 4O00A 5I1HL 3GEWB 2R9HC 5A2IH 3CDGA 1MWAB 2CDGB 4UOJA 1K4CB 3JBG7 4Y19D 3D87B 1DE4A 5HVHC 3FT3A 1JI2A 4UNTA 1FL5B 3OR6A 4ZPTA 3UXFA 5DRXA 5DVLA 1JUFB 3UP1A 2NYYD 3ARFB 1Q9OB 2NXZD 3L9RA 5C0EB 5CJ5A 3MRRA 3VXUB 2VZTA 5TH2A 2J3SA 4WUUB 1T80A 2CXGA 5DK2B 5I76A 2B2XH 2XNAB 4GRWH 5MP6L 1QKZH 4UIKH 1ROWA 4Y2DA 5F96L 2PXYA 5JXAH 1OAXL 2OS7A 4NO3A 4TVSa 4NFBA 3GSNB 5HGHB 5C92A 5L8KB 3CMOH 1MCOH 4Z7WE 4X6FA 3WKNA 5SX5H 3I50H 4U7SA 1QP1A 4G3YL 1R3JB 4BM7A 3FHQA 4NCC1 1QSFD 4OUUB 3UTTB 1P84K 2VAJA 4H8WL 5HI4D 4DKEL 5AEAA 5D7KD 3VI3F 4ODTL 4F58L 1J0HA 2FB4H 3L5XH 4UT9H 5E5RB 1FNLA 3FB5B 1X7QB 1GGCL 5IEHA 4MLIA 4HWNA 1OGAD 2WWKT 5JUEH 2BY0A 3T0EB 3NGBC 3DVGB 5TQ2L 1FVEA 4GQPH 3BKYL 1JWUB 2NY6D 3QUXD 1CGUA 5HGAB 3ECBB 5TF1H 1BZ7A 4L3CA 5ACZB 1FCGA 4JZJC 3ULUH 5CUSH 2ERJB 4O4YL 1TJIH 1YECH 4WV1B 3NAAL 5K9KB 3Q6GH 3MRLB 2VDRL 1U92A 3H9SB 3I2CH 5ALBH 4JFFB 1TJGL 3SDDA 3MNVA 3TO4B 1MCSA 2DKSA 4Y5YC 5D7LD 4FQ2L 5BV7H 3FTGA 3DO7B 4U1SA 4ETQA 5BZWB 3LAFA 2HJKA 2BNRE 5GGRY 1OSZB 5EBMA 4EQ3A 1KTLA 5TQ0H 2G5BA 2HH0L 1P84J 5HHNB 2R0WH 5GGUA 3QXWA 1RUML 2O5ZL 4PJ9C 3VD7A 4YUEH 3ILQC 4RMQA 5IP4A 4I1NB 3IFPB 1FN4B 4BUHA 4NNPH 2RCSH 1D5ZA 4PLOB 2JK5B 3OB0H 1QSED 1TFHA 1MCKA 1BGXL 3DUUA 1UA6H 3S37X 1D6EA 3HA0A 4ZS6D 5C07E 1XIWB 4WUUD 2FGWL 4PPTA 1JK8B 3BPOC 5E6IA 4NT6B 3V2AR 2JTDA 1S7VB 1FNAA 3MOBH 4XMPH 4NKDA 1EBAA 3O8XB 4R9HA 4R3SA 5C0FA 1C5BH 4WTXA 1QFWM 4U1NB 3DO3A 5IFHH 5MEQB 2AS5M 4MD4B 4Y5VC 4ORZC 3QXVA 3MX0A 4MCZA 2VXTL 1FO0L 4UQ2A 1QFUL 3QCTH 4PB9L 2OR7A 4BZYA 2IFFH 1OLZA 1IGFL 2ZOKA 3QIWD 4OCWH 3OJVC 1Y6KR 3NIFE 5MERA 3BHBB 4WU5B 4G6JH 4RWYL 4QTIL 1NUFA 4IS6B 4UT7H 5L7XL 2VWEE 4OZGF 4LCCB 3UJIH 1RHFA 3GHEH 2EH7L 4GH7B 1A7PL 3BI9X 3W0WD 3NH7L 2P24B 1KB5B 2P5WE 2VIRA 4LLYB 4PUBH 3TYGL 3FCTA 2ZSVA 5I2IA 5GSVA 1LP9E 1FP5A 2HTKD 3O4LD 1MAKA 2OZ4A 1QZ1A 4E41A 5IT2L 3E6FB 2VLRE 1I7TA 2ZZUT 3EIFA 5CD3B 4JCMA 25C8H 4HUMB 4G5ZH 4QGYA 5I1IL 5IVXA 3S5LB 4LKXB 4YXKH 1W0VA 1RSFA 3GGWB 3GSNH 4JQVA 1DSFH 4DGVL 2VSCA 3MRDA 5EUOF 1BD2A 3QRGL 1S7SB 5JLZA 4MD4A 5KVDH 2OP4H 5IHLB 1L0YA 3UROR 3G5VB 1YEIH 3SKMA 3VXOB 1A1NA 3RTQA 1U8MB 4U1IA 4HKBA 3RPIB 2R0ZL 3CVHA 1JPSH 4EKXA 2ITDB 2P5EB 3CXHK 2BMKB 3QQ4A 4P2QD 3OJ2C 1NFDB 3CGTA 4Z7VF 5FUOH 5JW3H 3H7BA 1U42A 4OIIH 4M48H 4ODTH 4LAJH 3OZ9H 1KJ2B 3EO1B 3V5HA 5GRVL 2PW1B 4YDLB 2FB4L 4UT9L 3FRPG 4WY7L 3T3PF 3MNZA 1XGRB 4WDIB 3CFEB 1EXUB 3K8KA 2GY7B 3RVWC 3QWRD 5EWIH 2F53B 3S36X 5JW4R 5I8KH 4PGZA 5DS8A 4AQOA 1D5BB 3WEXB 1PYWB 1WT5C 1HH9B 1T1ZB 4I0CC 2C5DC 4FA8A 4R4ND 1HSAB 1MJJB 4XNMB 3NAAH 1SJHA 2VDRH 4ZFZB 4ZO6A 2HTLC 4LLQA 5DHYA 1FSKC 2XQYK 5ALBL 1VB9A 2FDBP 3CSPA 4UU9A 4U6HB 3ZDZE 1MF2H 3QFDA 4FTVA 2ADIB 1QQDA 5D6CB 3O3DB 1QACA 3AM8C 5E4EC 3TNMA 1ETZA 1N6VA 1M7DB 5ANME 3BGMB 3IXTB 4I3SL 4JLRB 5HYJB 3QUYC 2YPLE 5IVOA 5FA4A 1A7QL 4ZOEA 2PN5A 4TSCL 5H37H 1NMBH 1ZGLP 2K9UA 4PG2A 3WKMH 3DWTA 4PR5A 2FJHB 1Z3GL 3RWJA 4ZSOA 5TDNB 4P4RA 4YUEL 4P5TA 4Y89A 5J57B 2OK0H 3I6KB 1CQKA 4KUZL 2OTWA 1CXEA 3IDNA 5DEZA 2HYMA 4OQTH 3SDDC 2EDBA 2RCSL 3UTSA 3MRMA 5DUML 1OGAA 4HWZB 5I8EB 1L7IL 3FN3A 4YGVA 1CBVH 3QEGH 4PRNA 5C0CB 4ZPVA 4PJFF 4OGYH 4XBPB 3V0VB 4V1DB 3RWIA 3EDEA 1N64H 4ZAKD 1NCAH 5IW6A 3RWHA 4XMPL 4NBYB 4OF0A 5IF0B 4L29B 3DX7B 3DUHA 1XGYH 3VI3E 2RBLA 2O93L 3GJEB 1KF9B 4ONOA 3ZKXB 4PJ7F 4PRDA 3NFNA 3ZSTA 3O9WA 4NQEB 4OKDA 5K9OA 1FZKB 2Q87A 1F13A 2E6QA 2WINA 4JRXD 4IMKC 4XH2B 4OCWL 1IGFH 4H1LA 3TBSB 4UOW1 4NM8H 4R0LB 5J13C 2J8OA 1J12A 2R2HA 1DZBA 3TZVC 3PL6B 4JPVL 4TUKH 4UT7L 5ICYB 3GNML 5DA4A 3UJIL 3MRPA 4X5WB 4QTHB 1DE4B 4JRXB 2CUMA 1FG2A 3FQRB 2SEBA 1KXVC 4JY6B 1AE6L 1DL7L 4TULH 3D0VA 3LRGA 4FQCL 3IB4A 1FO0B 2VDPH 5BV7B 3BUYB 1VCAA 1LHZA 1WF5A 4LK4A 2R4RH 4LDEB 4YO0A 4LMQI 5IT2H 2XWJA 1LO3H 3LKRA 4YBQC 5I1AB 1K9TA 25C8L 3MROA 1WWAX 4Z7WF 1OLLA 3HS0B 5BRZB 4YFLI 1JYNA 1J8HB 4J3UA 4MXVF 2OLDA 5EU6A 1TVBB 4P2OB 3GSNL 4HFWB 1P53A 5I1LA 3MJ8A 4K3EL 5DTFA 5I8CA 2PW2A 1ZLVK 4S0TD 5HYEA 3JV0A 1BEYL 5CSGA 4MWFA 5IGXH 1CF8L 4GW5B 4WEUD 5LBSH 2PW2B 4KK8C 5C0AD 2OJEA 1S9XA 3KPPB 2P8LA 4I3GA 3ZLQC 4F9LA 1LP9B 4C56A 3ZYJA 2KUTA 3IVKA 1I9EA 4LHUA 4OKVB 4HQQL 2VKXA 2RFXB 4AEEA 5E94B 4HUWA 1CYGA 1QA9A 3OZ9L 5IB4A 1TNMA 1QBLL 3CFCH 4QT5B 5EOCL 4S0SD 4OCRH 3T1FB 5C0AB 1CDIA 3RVVD 3DJ9A 2GY5A 5I17A 4D8PB 4MD0B 4X7EC 5IOPA 1HXYB 1NAMB 1ZXQA 2DN7A 3S3SA 2AVGA 2DI9A 5FCUH 2CRYA 3M17A 4PY7A 3ULVC 3UMTA 5CEXA 1XF5A 4ZOBA 1T04B 1PGRB 1K3ZA 1MF2L 3IDMA 3I75B 2BVPB 4X0KA 1I1FB 3CVHL 1CFQB 3O4OB 3TBSA 2EDDA 3BIBX 4I3SH 3FQWA 4X6DA 1BWWA 2HTKC 5FKPB 15C8H 1X6LA 4TSCH 2WUCH 5C9JB 2AJSL 1U58B 1MIEL 3VW3L 2BY3A 2YWYA 1Z3GH 1RUQL 3B9DA 3KYAA 5IF0A 1OF2B 3WUZA 4NQCD 1R6VA 5DQJA 2VSDA 3LN5B 1VKXA 3UTQB 3VXUE 3K81A 2WZPD 4BFIB 4PY7B 4HGKC 1JGEB 3T8XB 3P9MB 1MAML 4PJ7E 4PJXB 1MLCA 4LIQE 1SJEB 3QEGL 3RJQB 1E6JL 4GKOA 2FX9L 5AWNH 4L8CA 5DHVA 3DURB 4AJ0A 3OAUL 1GPOL 1N64L 2UY7A 5GRZA 2I25N 5TE6L 2A6KB 4GXUM 4Z7VE 3L5JA 4MNQD 1EERB 1NUNB 5JORA 2H9GB 3I3BA 1SEQL 2K1MA 2I26N 3AMKA 3FONB 5HDBF 1E4KA 3QG6B 4Q0XH 2OQJB 5BVJB 5L2JB 2YK1L 3SE4A 5MENA 3MOQA 3M8OL 1OP9A 1M1SA 1V05A 3WUWA 1UCTA 4DGYH 3GSRB 3MV11 3UBXG 2GEEA 5F7DB 2O5XH 2EDJA 4JPVH 2Q76B 4NQDE 4TUKL 3SDCA 3KYMB 1PKQE 4ZFOL 4K3JH 4Z0BH 2ZKHH 1JBJA 3Q2CA 3Q3GA 5ELIA 1RZKL 3AXLB 2C1PB 3O45B 1TJHL 1I85C 3CH1B 1TVBA 1HHGB 2IQAA 4P2OA 4IRJD 4PRBB 4KROB 5D96B 4APQC 4H0IA 4G8FA 2NY1B 3H9SE 2J7LA 4PJCA 3SQOL 2R4RL 3TH3T 1YEKH 2XG5A 5EZIH 5JOFB 4M62L 2VDLH 5CD5D 3C60B 1LO3L 4HS3A 3KXFD 5K9QI 4ZFFB 1NDGA 4UINH 4DUXA 4XP9H 2PYED 3T4YB 4HG4K 2DL9A 3KPRE 2C3WA 5LAXA 2BHYA 3ZSSA 1U2HA 1FFQA 3GMQB 3RGVC 4NC2B 5DFTA 3MV9E 2ZJSL 2L7UA 5DJ8B 5HDLA 4G6KL 3H0TB 2BZDA 4TOYH 3QIWB 1MQKH 4DAGL 4HSQA 1A6WH 4NO2B 5LBSL 1W0WA 4XPHH 3OGOE 5D2NB 4XNQA 1KV3A 4RMVA 3B83A 3HAEB 4OLYH 1DVFB 4M7ZC 1VA9A 4WI9A 1T0NB 2R23A 1S7TA 3KLAB 1GVIA 2FJFA 4W4OC 4TVPE 4HQQH 1I3GH 4P3DB 1OL0A 5IFJB 5GJTL 4Z8FL 4OCRL 5J06A 4EBQH 4IHOB 1ED3B 5DWUL 1T1YA 1FHGA 2CLRB 2ZOLB 1ODAA 5SWSD 3TBYB 3ZDZF 1BFTA 2WBJC 4J12A 1DBJL 5IJVB 5ITFB 1I7RB 4QXTB 2EEDA 4XP1L 1KXQE 2D4DA 4CL7A 1M7XA 4PRNB 1NKOA 2ZP0T 5FO7B 4PJEE 4FQXA 5EN2A 1CICD 5FCUL 1HN1A 2JIXA 4M00A 1XAUA 3QAZB 2VKWA 1JF5A 4D0BB 3BDBA 1FQ9C 3B9KD 3QO1B 4JKMA 3HPLA 1MCEA 2AV1B 4HEME 2PYFB 3O4LB 3QZWA 2VL5B 4V1DD 3SE8L 1A9BB 4CVXA 2LU7A 2WUCL 1I9IH 1EAJA 2XRAL 4PREA 3G5ZA 1A6AB 3C09C 5BOZG 1U8NB 4L4TD 1BIIA 2QKIB 3MUGA 1I7ZA 1T89C 3EYVB 1AXTL 3RWGB 3SKOB 3WIHH 3RVUD 4DVBA 2R69H 2JJVA 4RGOL 2PUQT 4WWKD 2OCFD 3EDFA 2P1YA 3GBMH 4XHJD 4HC1A 1V7ML 5EIIA 5DLML 2R39A 5ESAA 4S11A 1D5ZB 4LSVH 4MMXC 1QVOA 1XGUB 2AABL 4HW6A 3T4AB 5AWNL 3WJJA 4PJHA 3LN4A 5CJBA 5KSUA 4OZIF 3V95A 5J89A 4ZYKA 3LQZA 2WWKO 2Z8WC 2NY2C 4NQTA 1B6DA 1RQ5A 3C5SA 4IRZH 5KW9L 4I48A 4FHBD 1NBZB 5TDPB 5IHBA 4YHNB 4UIMA 1FPTH 3I3DA 5MENE 1KACB 4HPYL 1UH4A 4FFYL 2Y7QB 3DBXB 3G08B 3DV4A 5BRZD 4FQHA 4ZSOE 2X10A 2HJKB 1O5DT 1F00I 1A7OL 3HR5B 3OKDB 3U4EA 5DJDA 4DGYL 3MRGA 1DTUA 3MO1A 4X6DF 4BQCA 1VGKB 3MR9B 1P5UA 1UCBL 2PCPB 1X5IA 1X5HA 3RTQB 1MI5D 1ITCA 4JY4A 2R29L 4ELME 2LTQC 4Z0BL 4HZLB 3O6LL 5A2JH 2NX5D 1RZKH 4HJGA 3UCRA 4ZQKB 3DNKA 1BD2E 4PP1C 1K8IB 4J3TA 4RX4A 3CZFB 3GMPB 3D69A 5F7KC 1NGZA 3SQOH 3T08A 1YEKL 3HN3A 5EZIL 1CR9L 4J3SA 5F7MC 4M62H 5EFIA 2IFGA 1ZSDA 4UINL 4X9GA 5D2LB 5ANMB 5AYUH 4XP9L 3LS5L 3S35L 3TJHD 2EE9A 1IGCL 2JJTA 4LLDA 1MREH 4LIQL 4H8WC 2IBZY 5J56B 3JSSA 4LSPH 2YBRB 4L4VA 4N8PA 1P4IL 3BZ4A 2NY4D 3HE7B 1I85A 1RD6A 1FGVH 3AREC 4OI9A 1AC6A 3ZKND 4G6KH 2P5WD 2DM7A 5ITFA 1FBIH 3O8XD 3WFCL 2AP2A 4LGRB 1MQKL 4PGBB 3RWCA 4DAGH 3MLWH 4PB0H 5DRNA 5HGBB 2ADFL 3CPLA 4XPHL 4F7PB 1CFTA 3BOVA 4UZGA 1CLOH 4GKNB 3TEUA 3K4ZA 1YJDL 1KLUB 4JFDE 1G1YA 4R4BA 2ED7A 2B2XL 2E5EA 3TVMB 5MP6H 2JB5H 4LVOB 3QG6A 2R23B 4BA8A 1CFSA 3G04B 5KSAA 1I3GL 1OAXH 5IEKA 1AIFB 3O6FD 3DX8B 4N0UA 2VL4A 5EO9A 4F33A 5H94B 3STZA 4ZNEA 1SMAA 4X98B 3L5WA 1WGOA 5D4QA 4NJAL 1ZV5A 5E4EB 3I50L 4G6ML 4G3YH 3DURA 2X4PB 1I7UB 4AENA 4I0PC 5T33L 3O6FB 5F1NB 5C0CD 1SJEA 3GMQA 1FZOB 1QRNA 2VZUA 4DKEH 3TT1L 1WV7T 4XXCC 4JFHD 4ODUB 5D7LE 1I1AD 3RGVB 1WBZA 3EHBD 2YPVH 1JGEA 3EKCA 1T5XB 3LMJH 2I07A 1ZWIB 3VFNB 3JV4A 4MA8L 1GGCH 1TZIA 5TE7H 2A6IA 3WLBA 1NGYB 5EBGA 1LGVA 3U4BH 5TQ2H 3BH9B 3BKYH 3STLB 4KJQD 1N3NB 1NFDF 1BZQK 3L3OB 2GIYA 2V9QA 3RY5A 1SVZA 1S78D 2MKLC 3SJVA 3U46A 2NXYB 1I9IL 4NBXB 4NQXB 3ULUL 4O4YH 43CAB 1NGWA 5J12B 5KANI 3TBWB 5IQ9A 3DUSA 3Q6GL 3GB7B 3X14A 4JANA 2YBRA 3HFML 2OL3H 4UNVA 3I2CL 4MQ7B 4GRWF 3SPVA 3UTOA 3PV6B 1TJGH 1BX2B 3ARDB 3C6LD 4P5KB 3WIHL 1B4RA 1H0DA 4H25A 5JDSA 1XH3B 5HGGS 1YY8B 5IIEB 1IM3B 2JJUA 1PZ5A 1WSST 3GJFB 1IGJA 5ID1B 4PS4L 1KJ3H 4P46A 1JF6A 4IOSD 4LSVL 2F54A 1KIPA 5CBEA 2R0WL 2AABH 3EJZD 3IGAB 5JORB 3TFKC 2ICCA 5F3HB 1CXKA 2FLBT 1NMCC 1MOEA 1R3KA 1CICC 4RMSA 1BOYA 3P30L 5F3HA 4OZFG 3MFGB 4IRZL 5KW9H 1ZHKA 4NNPL 4PJDA 4MVBC 1BBJB 3VMPA 5IR1B 3ZT5A 4M3KB 1X4ZA 2NR6C 3WO4B 3CLEH 2EECA 5CSZB 4BZ2L 3QEQE 3B3IA 1KOAA 4NRYA 5FCSH 4ELMA 3L3IB 3M1BA 3QBTB 4FFZH 5D7JB 4CAGA 1MJUH 2R29H 3IJYB 4KH2A 4PTTB 3T0WA 3TBVB 4P5TD 2CQVA 4YHYB 1U8KA 5FOBB 4HH8A 2DYPD 2VLJA 1U58A 2EYRB 1JP5A 2J8HA 3QUZD 1UZ8B 4NC1C 4H5SA 1MAJA 2VXTH 3E3QC 4PBWD 4PJHB 3V0WH 5KSUB 3QCTL 3V6ZB 3HR6A 4ZOCA 1YPZF 1BMGA 4Y5VB 3IDMB 3RIAK 2QSTA 4G6JL 4RWYH 5FYJE 5KS9B 3MROB 4U6YB 5CIPH 3ZE1F 3UDWC 5L7XH 3LS5H 4ZO8A 1L0XA 1IGCH 5IB3B 3D25A 1WICA 4MJ5B 4YE4L 1A7PH 4I18C 1BM3H 1F3JA 1T1XB 3RIAF 2VAAA 1XFPA 3BPOB 4KXZH 1HHHA 4XNZB 4LSPL 1SMOA 3IXAB 1QLRA 3K8MA 1FGVL 5DK3A 3PNWB 4MB5A 5D71H 1AGFA 4QKXB 2ED9A 1FBIL 3WBDA 4UMGA 4APQD 3HNTH 3KPMA 4YBLB 3MLWL 3MUZ1 4PB0L 4QRTB 4X98A 4G5ZL 3QUXC 1CLOL 1QA9B 1HQ4B 4YXKL 4BH7B 1ZT1A 3WDIA 3QRGH 4YPGA 5KVDL 2OP4L 3UTTE 4HULB 1FYTE 4ZUVB 1LD9B 5KG9B 2BP3A 5KOMC 4RAHA 5HHOB 3GJEA 4L8SB 3ILPB 4XAKD 3RVTC 5FO7A 5EC2B 5M7QA 3AB0B 2R0ZH 1H5BC 4LF3B 4NJAH 4MNHB 1TDQA 1OB1B 1H5BB 4G6MH 4QXWA 1ZOXA 1X5YA 2UZIL 5T33H 4OBRA 3VWJD 3U30C 3BZ4B 3ELAT 3WL9A 3QWOA 3TT1H 4OIIL 2P5ED 3TO4D 5ADOH 5HBBA 2F54D 3BVNA 3CVIH 1II4E 4WY7H 3K80A 2X1QA 5INDB 4YEEA 4GAFB 3U4BL 1INDL 3ROLA 4G8GB 5DYOB 1HH6B 5DJXA 2X4TB 1KIPB 5CBEB 5HDOA 5J11C 5LKNA 3OWEA 3RVWD 4NQCA 3OKOB 3T2PA 4NDMA 4DOHE 3TZVA 5DJ8A 4U7KA 1QHOA 4LPCA 2AJYH 3IXTA 5HYJA 5CP3H 1KEGH 1KYOK 3HFMH 2ADGB 1CN4A 3SKJL 1F6FB 4ONHA 1CLYH 5E8OA 1FVCB 3JTTB 4PJEF 3X14B 5JHDD 3RI5F 4KI5F 2EDQA 4IRJB 1LEGA 4JVPA 4LNVA 2JJSA 4UT6H 1MHCB 1NMBL 1DQJB 4NQXA 3OG4B 4PFEA 3WKML 1HH9A 4KMTL 4C83A 1XCTB 5MI0B 3LPGA 3FOLA 5HY9A 5KANG 3R8BB 3CH1A 4XZUA 1HYSD 4PJBE 2PF6A 3STLA 4KTDL 1LILA 5D1XB 2C1PA 1E0OB 4KUZH 4QHUB 1J10A 1X5KA 2CO6B 1I8KB 4WGWB 5J1TC 5DD6B 3P30H 5CKAA 4OQTL 3JV4B 1U93A 3RNKB 3HUJF 4HMCA 4XI5D 4FXGA 3EO1A 3RUGF 2CK0L 1NL0L 4GT7A 4X99A 1S7UB 3W39B 3RGVA 1MHEA 3W0WE 3I02B 3QDMD 5C6WH 2UWEB 2FL5A 2V7HB 4F37K 2VO5A 4EXKA 5BS0A 3BPLC 1P7QA 1I9JH 4JO1L 3ULUD 2CXKA 1MY5A 4XC3L 4N8VG 5H8DA 5JW5B 5HI3D 2JCCF 2CMRH 1FL3A 4QNPF 4Y7MA 1V8HA 5JPMA 2MHAB 2L0DA 5DDHB 1B4JH 3G9AB 3OKYA 1EUTA 1MJUL 3L5WB 4P2RE 1XGYL 1T7ZA 4RWHA 5FF6A 3STZB 3GMMA 5T3ZE 2Q6WB 3RWJB 4YFLF 3RIFF 1J5OL 4MQSB 4EI5A 5IEKB 4D9QE 1HXMB 4W4OA 4HT1L 2EIZA 4LPWA 3WNNA 2H32B 2GFBA 4CNIB 2LU4A 3RKDD 5I16A 1IC1A 3PNWA 2VL5A 1M6OA 3V0WL 3X3FL 4YIQB 3CXDL 5HYSG 3KPNB 5E0QA 4M03A 5KSVA 1RZ8B 5IBUG 3QUYB 2ADJB 5ESVA 4JFXA 2R8SL 2NX5A 4OZFH 2H3NA 4NQVA 1NH6A 5F88B 3HMXL 4XVTL 4TUOA 3KXFB 4IMKA 1A6VL 2RJMA 4Y4KC 1AE6H 1F3DH 3FCTB 4GBXC 5J12C 2AJ3B 1R24B 3MODL 1KCRH 2NMSA 2VDPL 5CZXD 3UPRA 2VABB 1X5JA 5D2LA 1T2QL 4ZS7L 5HHMD 3HNTL 2BSED 3HZKB 1NC4B 1K85A 1UB6A 2P8MB 3LDBC 1RAMA 5IBTH 4GFTB 2FATL 1HE7A 1H3TA 4UDUA 3U36A 5IJKA 5BVPH 4HIEA 5EUOE 4RGNE 5C71A 1YN6A 3K8LA 4MNGA 4HJ0D 3G6JF 4NRXA 1BEYH 2A73B 1A8JH 2DQFB 3RPIA 1U8MA 1W72H 4U1IB 2X4TA 1PFCA 4QEGA 1T2XA 2P44B 3FAWA 5JA9A 5GGVY 2W65B 3G5VA 4UB0L 5LVEA 3H9HB 2DL2A 1G9MC 3U36B 4QWWD 3RKPA 1FZMB 4Y2DD 2E8YA 2FX7H 4M61B 4UDTB 1QBLH 2IALB 4PJ5A 1G9EA 1OOAA 1OP5H 3HRZA 5EOCH 4PYGA 1IVLA 2DLGA 3CVIL 3IFOA 3SY0B 2DJSA 2NY0C 4BQ6A 2OTUA 4ZFOA 4OLVL 3AFLA 4Y16A 1GAFH 3O3BA 1I7TB 2E3VA 2IJ0C 5L6YH 2VABA 4ZYKB 1H0DB 3D2UA 3VG9B 3RDTA 1JE6A 1HHGA 1RV6X 2ARJB 4PJAA 3UDWA 1SEBB 4BSVA 1HWHB 3A6BH 4RGMB 2GT9B 5HYJE 2EDEA 4OGAC 5I30H 3MRCB 5I8CB 2AJYL 1B3JA 3IDYB 4HV8B 4JQXA 5E9DB 5HYIA 3LSOA 4BH7A 4M3JA 4JQXC 3TLRA 2AQ2A 1CLYL 3TH2T 1OQXA 5D1ZB 2J88L 4OCSL 3CVHH 3DI2B 3TM6A 1EPFA 4K8RL 5JR1H 1NEZB 15C8L 4UT6L 4MCZB 4JDVB 5EDXA 5F9WB 1RPQA 5CBAB 1U36A 3ZZ1A 5D7IB 4KMTH 4XX1E 1RUQH 2C3VB 4XP5L 4RZCB 4FMFA 3JTSB 5GRXG 1IRAY 3NIDE 2IF7A 2FEEI 2QADC 3AVEA 3CLFL 1XZ0B 2X4PA 2VZOA 3SDCD 1U8QA 2R1WA 1NQBA 1UYWH 1QRKA 2KZWA 2CK0H 1NL0H 4GXVH 3DX6A 2NZ9C 2ZG3A 5D2LF 1RJYB 1TZHB 2JK5A 2FX8H 4WNQA 5BJTB 5D93C 1CQYA 4Y4FD 3W82A 4XC3H 1P4LA 4M6AA 3OAUH 4WFEE 1GPOH 1E4XI 2CMRL 4HWBA 3CH8A 1E27B 1KLUA 5L8JB 4QHUA 1B4JL 5TE6H 4UAOB 1T83C 1INQA 4P59L 4UAOC 1BQUA 3Q48A 3QQ9D 4ETYA 4NO3B 1SEQH 4J8RB 3MA7A 3FT4B 5J7CC 4HT1H 1SY6A 3RWIB 1KTLB 2EDNA 4Q0XL 3WDHA 5EZLA 3X3FH 5T5NG 1GZQA 3IAGC 2CIKA 3CXDH 4AIOA 4ZUUB 4B53A 1XGTB 5BMFH 2BVPA 5D5MB 1JZ5A 1DQTA 4POUB 2XWBA 2O5XL 3MXVH 3CUPB 1K4DA 4MXVE 2CKBB 3PL6C 2NTFB 4Z76B 1A6VH 3S96B 3UTSD 3BP7A 5T1KA 3X13B 4BELD 4CJ1A 2YPLD 5HDQH 5ICZB 2FH8A 4KZDH 2AJZB 2AJXL 2FJHA 3QCUH 5HD8C 3BP7B 1UT9A 4NSKA 2VDLL 1UZ6F 1NUGA 3HE6B 4ZS7H 4D8PA 1YY8A 5IIEA 4EI5C 5F7UA 2N56A 2NXYD 1UWXK 2FATH 2PCPA 3D48R 3OKNB 3BIKA 3UJTH 4POYA 3IDYC 3W81A 1Z0MA 3QWOB 3BRDA 1MY7A 5BVPL 3G5YB 3GBLA 2YD9A 1TLKA 3RL1B 3DUSB 2ZJSH 2VDKH 3TBWA 5JHDE 3QEQD 4TOYL 3V5KA 3FJTA 1W72L 4F3FB 5I1GH 4G9DB 4S1DD 4OGZA 1G7MA 4Y19B 5E1AA 1EEZB 5IQ7L 4UB0H 2I27N 4OLYL 1VFOA 1GYAA 3MUHL 1C5DB 1K2DB 5C09B 3TIDA 5BVJA 1WZLA 3H3KA 5HXMA 2N1KA 3OL2A 2R2BA 2WANA 4GOSA 2GJJA 5DK2A 3GI8L 2FX7L 2I07B 4JFDD 4LCYB 3FO1B 4M61A 1CDGA 1J05B 3V4VH 5GJTH 4Z8FH 2HFEA 3SDAC 4DEPC 3DMMB 4EBQL 2F15A 4OLVH 5AG8A 2ESVE 3H7BB 4XRCB 5DWUH 4N0CD 2DYPB 4AH2B 3WUWG 5L6YL 3BGFC 1KCSL 5IMKB 1DBJH 4XP1H 1XZ0A 2J5LB 5EUOB 3ZHKA 2H2SD 3GUTB 3QXAB 2DRUA 3A6BL 4HXAH 4XWOD 3V52L 5F9JB 5H94A 3MGOB 1U8HA 3TPUB 3EAKA 1XT5A 3KNBB 1JHLH 4KVNH 1JNLH 3L3KB 5CEZE 5C0NC 3RWDB 2YXMA 1IKNC 4M1GL 4X4XB 3V6FA 3LN9A 3VXNB 3V6ZA 4KDTA 3PWJA 2KH2B 4KK9C 1G9ML 2WP3T 4H5SB 4KROC 5C9JA 3OKLA 2XRAH 2XV6B 3MRQA 4M43H 1I9RL 2WK2A 3VFUB 4XP5H 2JIXB 4PTTA 4HKXA 4Y4KB 1Y0LA 2UZXB 3N9GL 3ALXA 2NY1D 2WM0A 2IAND 3U7YL 4TUOB 1AXTH 1CTOA 4OCLC 1CGWA 1N2RB 2R69L 4M7LT 3FZUC 3TYFA 4RGOH 1UYWL 2X70B 1BBDL 5DJ6A 3AS0A 4ZFGL 3L3HA 1S9WB 4GXVL 4KC3B 5CEYB 1V7MH 5E9DE 5DLMH 4LAQL 3QI9D 5IR1A 4BFEA 4Z6AT 2JF1A 3KPNA 4H20H 3VXRE 4IMLA 1KELH 4NOBA 4PJ8A 1LE9A 1HKLH 3U6RB 4J23A 5C86A 1CD1A 2YWZA 5I17B 2G5RA 3MPCA 1NBYB 2QL1A 4QT5A 1EHXA 2EKSA 2F54B 1FPTL 4HPYH 1IAKB 1VGKA 1PKQB 3C6LA 4MJIB 3BPLB 5EZOH 5IVNA 3VGFA 3BXNA 5HHPB 4OZIE 5A43C 3OAYH 4FXKB 1FFPB 2DTML 3QO0B 4LEOB 5FK9B 3ARWA 1V7NL 2XXMB 2C7UA 1BVZA 2DQTH 1UCBH 1VEPA 2B0SH 4PG9B 3IAQA 2HT3D 3E0GA 3PP3H 4F7TA 3K2MC 2QSQA 5GS2D 1A2YB 4EUPH 3O6LH 4KROD 4WJ5B 5IQ9B 3NFPA 3UPRB 3KPRB 4APQA 4KGJA 1KPRA 5C07A 3HAEG 4PRBA 3KPSA 5D1QD 2BSTA 3OX8A 3U2SB 1JWMB 4X9BA 1OW0C 1QFOA 4LGPB 3OV6A 3QCUL 1GGBL 4EDXB 3D39E 4GG6E 4JFQB 1F6LL 2O5YH 1N0LA 4HBQA 2R1XA 3MV8D 3G5XB 3UJTL 4LIQH 5C0IA 4LEOA 5K9JL 4JPIA 5D2NE 4WI4A 4XCFH 3WMSA 3PIQA 1ZT4B 1R5WB 4R97B 4JKWA 3RL2B 4EVNA 2VDKL 5SV3A 2L7JA 4NIKB 1KXTB 4N8VB 4X6DE 4EI5B 1ZEAH 3WFCH 5CP7A 5I1GL 4M7KL 4OD2B 2PKDA 3HE6C 3S3PA 2ADFH 1FLRL 3QUZB 5JIIA 1YJDH 4PRHD 3DV6B 4IOFC 3U0TA 1CDYA 2XFXA 4GJTB 2JB5L 1LK2A 5FM5M 5HSFA 1AGEA 1IT9L 1BF2A 1BECA 4PRHE 2MWCA 4JGUA 4K7PX 3QPQD 3U30B 2AXJA 4JO2L 4FXGB 3Q1SL 1YNTA 2I9LB 1EVTC 1YC8A 5ENWB 1YPZA 5L88H 1IMHC 2IMMA 5DVKA 3OJDA 1KB5A 2VIRB 2EDRA 3V52H 1DUZA 3MBEC 2YPVL 3LMJL 4EI5D 3BW9A 1JHLL 4KVNL 5F7NC 2VR9A 1JNLL 1MHCA 4MA8H 5ANMA 5TE7L 4NC0B 2E9JA 3P4MA 4M1GH 1PEZA 3QUZA 5C09E 1MJ8L 1DQLL 1VGEL 2HT4D 1G9MH 2FIRT 4QYOA 4YHKH 2F8VA 3P4OA 3QXTA 5HHOD 2E7MA 4MA3A 3VRIB 4M43L 2ESVB 4GG8B 5E2TL 4K7FB 2FECL 2OL3L 3TNMB 1KNOB 3N9GH 3WHXA 1ONQA 2AKRB 1KSRA 4OJFH 4U6HA 2FECI 3D25B 3DSFL 3T4YA 1KEML 1U91B 5C0RH 1OAYH 1BBDH 4HIJA 4QO1A 4UUJA 4ZFGH 4R0LC 1YNKH 3QQ3A 4WW2C 1ZGLB 2F19H 4XAWL 3DIFA 1C12A 1N5AA 4OFKA 1UB5B 4LPXA 4ZAKC 4PS4H 1KJ3L 1KB9K 5E08L 3LOWA 3MTRA 4Y16C 2XI9A 3MLXL 5LCVH 5E94A 3FFDB 1I1CA 1KELL 3X3GH 4RBPH 3KPRA 5L8LB 1C1EH 4LDLB 3WL9B 3LQZB 2AQ1A 4P46D 1QRND 1YEDB 1U95A 1A4KA 1XGUA 4NOFA 4P46C 4HIXH 1JWSB 4ELMB 4DCQB 1QSFE 3CLEL 5KG9A 4OCYH 3R4DA 1RZGB 4G7YL 4BZ2H 5HHPA 1ZT1B 2DTMH 2YSSA 2QADD 3FT2B 3PWPD 1V7NH 2B0SL 3JWOL 3IDGB 1RUKH 4CJ0A 4OI8A 2BVYA 4FFZL 3VWKB 2HRLA 5CILH 2NY0B 3L5IA 2YN3A 1KIQA 2EICA 3L1OH 4R6UA 3VXRB 1MRDH 3MRJB 1KENL 3BUYA 4X8JA 3H2WA 1TETL 2CLZA 3BZDA 4P4KC 1NFDE 4MAYC 2W92A 3VGAC 3JWNC 2BHUA 5BQ7B 4IJ3B 4PP1D 3FB5A 5IEHB 3Q6FA 1KN2H 1PQZA 5DEGB 2ZUTA 1DEEB 2DIBA 4CU7A 2XTJC 4PD4K 4YE4H 1BM3L 2W60B 3MBXL 3SCMD 1MCWM 4Y1AB 3IFLH 5B8CB 2OI9B 4LHUD 4J3OC 3UC0L 4PJGA 1UH3A 1JL8A 2XQYG 2I60L 5D71L 2UY6A 3MA7B 3GJFH 1T1YB 3C60C 1H8SA 2CIIB 4EUPG 1WQVT 1T83A 2OSLA 1FLRH 3Q5YA 1PY9A 1RVFL 1ERNA 2XN9D 4U2ZA 4G42B 1D5IH 1JV5A 4K07A 5F70A 1JNJA 1AGCB 2B5IB 3PABB 2WAHA 4KMLB 1OHQA 3SKNB 1IILE 3VFOB 2DJ4A 4CW1B 4OF3A 4OZFB 1IT9H 5E8EA 2J8UA 1YY9D 2V9TA 5DEFA 4DKAA 2YPLB 2BY1A 1DDHB 4IJ3C 1UENA 4QRRD 3UYPA 5C9KA 5JW4M 1WC7A 3TN0B 1HXYA 4MX7B 3ZKMD 2UZIH 4G9FE 5GSRB 4TN9A 2WLYA 3I6KA 1HOCB 2AW2A 1CFBA 5F6IC 5IB1B 3GMLA 2HP4A 1MFDH 5C0AA 4HX1A 2BOCA 5ADOL 3TVMC 4OF5A 3MYJB 5ID1A 2R2BB 3AS1A 3BMVA 4NN5C 4P2OD 5C09A 1L9NA 3WS3B 4OB5L 9CGTA 3EFDH 1EGJA 1Q38A 1INDH 4GAJL 3E2HB 2YMXH 1BVLA 3BZFB 1VEOA 1HQRA 2X4NA 5D6CA 3RUGB 1MJ8H 1VGEH 2Q1EA 1P69B 3RWCB 3SPVB 3UTPD 2EKJA 2QV2A 1V3KA 1SJXA 4YPJA 4N0RA 3RZCA 1IEBA 1X5FA 4GBXA 1RJLB 2R2EB 4GRMB 4U1LB 4JREC 3G5YA 4TQEH 1KEGL 4KRPC 3SKJH 3MNVB 5GRVK 4OJFL 3RDTB 3HG1A 1KLGB 3OKNA 3FRUB 3PGCA 1MEXL 3VXQA 3DSFH 1HCVA 5JXEA 5C0RL 4JY5H 4Q58C 1OAYL 3OF6A 1NGYA 2A6JB 2DLFL 1YNKL 3L3GA 3QUMB 4L9LC 2F19L 1A1OB 2FJGA 4WTZA 2YA0A 4OFVA 1ZWIA 3SGJC 5B4MC 5E08H 3RDTD 4WI3A 3MGTB 1JI1A 4YNYB 4JRXE 3X3GL 4Y1AD 4KTDH 1ZVHA 4LVHC 2H45A 4HZLA 5B39G 5ISZE 2V5RA 2W0KA 4R90L 3RGHA 4O2EA 3VH8G 1T0PB 2A6DB 2APVA 4PJXA 5DZLA 5IMLA 3M07A 1R0AL 2JLLA 1XGTA 4OCYL 4NN6C 5DVNA 3T3MF 1I9JL 4JO1H 3ARBD 3MRDB 4RFOL 1R3JA 3EBAA 4XMLH 2F74A 1NBZA 1NFKA 3W11C 3UAJC 1UGNA 5CILL 4MS8D 1J5OH 4JM2A 3IKCA 4X4YB 1JNHB 2APTA 1U8LB 3VFWA 3U0PA 4DN3H 2XA8H 4ERSL 2XQBH 5C0CA 1R24A 3CSYB 4PJXF 4GRLB 1P7KB 1TZHA 2DLEA 2P24A 3BPCB 3SE3C 3MZGB 2FZ3A 2R8SH 4X7CC 4GW4B 1KN2L 1FL5A 3HMXH 1P9MA 5GS1C 4Y5XA 4XXDB 4M8QA 1H3VA 4XVTH 3QDHA 4XPAH 4ZXBA 3IFLL 4M4PA 2AK4D 3LKNB 2DQUH 3GMPA 4YIQA 4J1UB 1KCRL 3MODH 4BK5A 2G2RA 2C3VA 4FQIH 5JA8B 5FYJL 1B6UA 4UOW0 4WFHD 2APXA 3H3PH 1T2QH 4NNYB 5E8PA 3CNKA 4J3WA 1R5VB 4BH8B 2NY4C 3ETBF 1DQML 1ETZB 2EDXA 1PX3A 4Z95H 1VEMA 5IBTL 1LO5B 2IANA 1A21A 3C9NA 4NT6A 3MRGB 4LLMA 4MA7H 4MQXD 1DFBL 4GRLD 2OMBA 5E9DA 5CIPB 4ODWA 1R3HB 1J8KA 5HPMA 4YHMH 3MRCA 4X6CB 4MNQA 3ULVH 4OFYD 4X99B 1HI6A 1LQSR 1RIUL 5DD3L 3ZE2E 4IDLA 4JR9L 2RGSA 4K71C 4PJAB 2IPKA 1FIEA 1YUHA 3EOTH 1JGDB 1G6RH 6CGTA 4S1DC 1ZHBA 4Z5RA 5FYLH 3NCEB 2A38A 1RZJL 3KPTA 1MFDL 3QIUD 4N8CL 1D9KB 4P2RD 5KSAD 3LEXB 1CVSC 3ET9F 1BF8A 1RIVH 2GAZB 1C12B 4V1DE 3GSVB 2WIIA 5BZDB 1GAFL 4OB5H 2X9WA 3EFDL 4XC1H 4WO4D 3SHSA 2ITCB 4PJ7B 3SE9H 2NLJA 4U1SB 3BFOA 1FAIL 2VR5A 4XX1G 1WTLA 1RZIB 2ITDA 2P5EA 5C2UB 4D9RE 2HN7A 1U3HA 3D0LA 2GHWB 4W6XB 3WHXB 5SWSB 4DKFL 2IWGA 4HLJA 4WHCA 4PP2B 4AM0A 5I30L 5EUKB 3IDJB 3KPLB 5E1HB 4BFGA 1RULL 3LCYA 5EU7C 3GGWA 3D39A 5FB8A 3PL6A 5C2BL 3O4LA 3QZWB 4KK6D 2NCMA 4XWGL 5HYFA 2X1XR 3RPKA 2J88H 4OCSH 1A4JA 2W1NA 1Z9MA 3QO1A 1EHLH 1YUHB 3LKOB 4K8RH 5JR1L 5DK0B 2DLFH 2J6EA 4WWKB 4PGDA 2VDML 4D9QD 5CP3A 1AQKL 4PTUA 2D4FA 1T3FB 2EC9T 3F5WB 3RWFB 1AO7B 3MRIB 4OQTA 4ISVB 3CLFH 2HMIC 3IDXH 5F1IB 4LCUB 1I7RA 4HC1H 4L4TB 4LOUC 3WNOA 2CLRA 5I71B 2DM2A 1SJVA 2C3GA 3ILPA 1OGAB 2GYSA 3GMOA 1R0AH 4Z7UF 4YZFE 2WNGA 4C57C 1F4HA 2NXYC 2FX8L 2Y6SC 3SDXB 4MCYB 4ACPA 2HT2C 4RFOH 2FWOA 4MJID 5GRUL 3LKNA 2GFBB 1ZAGA 1ZLWH 4XMLL 1FNSH 4U1NA 2D7OA 4P59H 3GMMB 5CJQH 4CN4A 5ITBH 1EA9C 1X4XA 4KRMB 4MAYD 4RFEA 1KJ2H 5F44A 3D5OF 4DN3L 5B3NA 3AC0A 3WO3B 2XQBL 1OQOA 1XIWA 5FYKL 4PLJD 5C0JA 5CZKA 1CVRA 1IGYB 5BMFL 2ENYA 4GXUN 1HYSC 3W39A 1CLZH 1Q8MA 1WFOA 3MXVL 2R1XB 2M8XA 2ARWA 3BYYA 1D5MA 1U93B 4WW2A 1F58L 3G6JA 1VKXB 4HIIB 4JAMA 1XGPA 1GOFA 4KRLB 4YHOL 3P4LA 2DQUL 5HDQL 3TN0D 3QJHB 3QFJB 3VXMB 4X5XA 4KZDL 3HE7D 4FQIL 2AJXH 2BNQA 3EZ8A 4YAQB 1AR1D 2QLVB 4EI6A 1UZ8A 2Y23A 4D2NA 5BOPA 1XGRA 5KOVC 4WFGD 3FKUS 5IV2B 3F7PC 4OSUH 3DTXA 1M7IB 1C16B 1TCRB 3NIGE 1DQMH 2DMBA 3UJJL 3M1BB 4R2GD 1T7XA 2E7CA 2H6PB 3F12B 1LEKB 1NLDH 4XTRC 3KPQA 2WUBL 1NEUA 1N8ZA 4YHML 1RHHA 1KPUB 4B0MM 5I1DB 2PTTB 1AP2A 1JHTA 3ULVL 2F9BT 3B6SB 1RIUH 2EXWD 3MXWH 4JR9H 3IETB 2YD1A 4P2CG 4I8DA 3EOTL 1JWUA 3VXOA 2CDFB 1G6RL 2FYYA 1SYVA 2FEDD 5IQ7H 3T0VA 2JKXA 4HPOL 5DMGD 4OV5A 2H2PC 1RZJH 1CE6B 3CFKA 4L8BA 1P7HL 2VDNL 4PJ8C 5SX4H 4N8CH 4XBGA 3GI8H 2V5TA 5FM5O 1BZ9B 5KJRH 3V4VL 3ISWA 1WWWX 3TH4T 3O8XC 1CDUA 4I0KA 4XC1L 4Z7VB 3FO2A 3SE9L 2EEAA 1KCSH 1N2RA