5C42A

Crystal structure of hiv-1 reverse transcriptase (k101p) variant in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
547
structure length
544
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent Inhibitors Active against HIV Reverse Transcriptase with K101P, a Mutation Conferring Rilpivirine Resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 131
structure length 544
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c42A05
4DG1B 4O3NA 2KTQA 3VQBA 4LY7A 4CJWA 4FJMA 1U45A 1N56A 4NLVA 4FJLA 3LP0A 4N56A 5F8HA 4CK1A 2WCXA 1RTHB 4MK9A 3O3FA 2V4QA 4AHTA 2VA3A 1S5JA 2DFEA 4KHWA 1TVRA 1T03B 1C1CA 3MF5A 3MR2A 1S97A 2ASLA 3K59A 3MTKA 1SKSA 4K8ZA 2C28A 3PV8A 3PVXA 1ZETA 1ASVA 2IA6A 2XCPA 4J9MA 4LSLA 2W8KA 1NK5A 1NKBA 3NKYA 4CJ5A 3IN5A 1SKWA 1XR7A 1QE1A 1VSEA 1DTQA 1QAIA 4BDZA 3T5JA 4F3OA 1WSHA 4ECYA 5FRNA 1DTQB 1TGOA 1TK0A 2D7SA 4OPKA 4B9VA 3C6TA 4FJ8A 5KGXA 1S1XA 3QO9A 1I6JA 2HHSA 4NRUA 4NLXA 3OL7A 4CFBA 3SCXA 4DU1A 3PW4A 4FM0A 3DLBA 1SV5B 3MXIA 3MXJA 1RBTA 5KT2A 2Y1JA 1ZBIA 4YR2A 1NHVA 3SV3A 1LV5A 4ZTFA 4Z4IA 1J54A 5KI6A 1HMVA 2UVWA 4LSNA 4RW6A 3M8SA 4EYIB 3CJ3A 4OGEA 4PUOA 3OYJA 1HMVB 4FBTA 4LSNB 3T3FA 4URQU 1JLEA 1S6QB 3K57A 2W42A 3RB0A 3SNNA 4DQQA 3VQ4A 1S1VB 2R8KA 5C25A 2V0NA 1T3NA 2C2EA 2FVPA 1LW0A 3N6NA 4MFBB 1RT1B 1LWEB 1L3UA 1N48A 1TL1A 1RT1A 3SQ1A 2IS3A 4L8RB 4CFDA 2R8GA 4FCYA 2XI2A 4F4KA 1WSGA 3GYNA 3DOKA 5KRSA 3LALA 3UDLA 2F8SA 1VSMA 3SUQA 3DOKB 3S3MA 2OZMA 2HNYB 5KFNA 4ZPDA 4HKQA 4ZVFA 1G15A 3DOLB 1QUVA 4I2PB 4CEQA 4YMEA 2FBYA 4AHCA 3CWJA 2XO7A 4OJRA 3HT3A 2PY5A 1B9DA 2EC0A 1C0TB 3KK3A 3RR7A 2FVRA 4J2EA 1C0TA 3KK3B 5DQHA 1LW2A 1S6PA 4EP5A 4F3TA 3K5NA 3WNGA 2PYLA 4EP4A 3FFIB 2RDIA 1RYRA 3NBPA 4E1NA 4K4UA 3N6MA 4IR1A 3FFIA 3BGRA 4KHSA 3NBPB 3KK1A 2O4IA 4C8MA 3SFUA 5HRSA 4FZXC 4JS4A 4XPEA 4I9LA 1KSPA 1NK6A 3LP2A 2Z1JA 1WN7A 4CHNA 2XHBA 3I5AA 4TN2A 4EBCA 3L8BA 2WOMA 5DGAA 3VQ5A 1DTTA 2Z1IA 1RBRA 2QV6A 3HPOA 2YNGB 1HYSB 1DTTB 3HO1A 3OHBA 4QAGA 2R7YA 3QIOA 5J1EA 1IO2A 3QERA 1J5OA 2DPIA 2I1RA 5C24A 1LWCA 2ASDA 4I7FB 3U3GA 4KFBB 1WNEA 4URGA 2BE2B 3OS0A 1RNHA 1FKPA 2IBKA 4H54A 5CYQB 2GBZA 1VRTB 3MFHA 1YTAA 3V4IB 3I5CA 1HPZA 3RBDA 1CXUA 3P5JA 3QESA 4DSIA 3SPZA 1HNVB 4FXDA 4DTMA 1L3SA 3PW2A 4ZVHA 4IH5A 1HNVA 4MH8A 2R2RA 1RDRA 4RNNA 2YNIB 4KHUA 3V9ZA 2X6SA 3V6DA 2JC0A 1BQMA 4TXSA 4CJRA 2YNIA 2WRMA 4Q43A 1BQMB 2OPSA 5SZTA 5EWGA 4FM2A 4KTQA 2IAJB 4F4WA 3EPIA 2OPSB 4TYBA 3AA5X 4O55A 4DTXA 4C8OA 3VQCA 1IM4A 4IR9A 1NOZA 4CGJA 1WSJA 4O0IA 2YNFA 3OYAA 3AA4A 2WTFA 3KHGA 2AJQA 3DRSA 1Z26A 1N6QB 1JXEA 1C1CB 4KSEB 4U7CA 4AH9A 3EZUA 3DRSB 3LP1A 2RF2A 2X74A 2FBVA 4IFYB 1XR5A 3KD5E 3LP1B 4CGFA 4OGCA 1U49A 4LSLB 4KB1A 4DL5A 2Y1IA 3QNNA 1OS5A 2F96A 3OYBA 4DQRA 2G8WA 5DQGA 2HWIA 5FDLB 1EX4A 4FJGA 2FVCA 1W0HA 3GIKA 4IDKB 2DFHA 4FW2A 1C0MA 4W5OA 2ZE2B 3AVMA 4B8AB 3ITHB 5HRRA 1HNIA 4J2AA 2HNZB 4B9SA 2ZE2A 3PW7A 4W5QA 2JGUA 2XI3A 4ELUA 2HNDB 1K1QA 4OKKA 5L9XA 4Q44A 3HL8A 3LAMA 1SV5A 2W9AA 3UIQA 3NH2A 2HHVA 3KLFA 4NYZA 2YKNB 2JEFA 1EKEA 2YKNA 3M9NB 2HHTA 2Z1GA 4RW6B 3VQAA 1BQNA 1JL1A 4ZTJA 3DRRA 4K4YA 3I5BA 2IGIA 1JLEB 4KI6A 1TQLA 3DRRB 2KQ2A 4KPYA 4B3OB 4RW7B 5F9NA 3L2WA 2GIRA 4DL2A 5C25B 1S10A 4RW7A 2VG7A 5KFAA 4JRPA 3I8DA 4Z4GA 5J2PB 1LW0B 1S1TB 5D3GB 2VG7B 1QSLA 3MAQA 3RTVA 3ZSVA 2G8FA 3Q8QB 4O3PA 3S3NA 3GV7B 5L1JA 3VA3A 1O1WA 5KFSA 3PW5A 5EWFA 3KMQA 1N5YB 3EZ5A 1IKYA 4RNHA 4ZP8A 1QS4A 4IKFA 4ID5A 2BRKA 4TSXA 3RMBA 3KNAA 1IKWB 2ATQA 5J2NA 4H8KA 3KLIA 4K50A 5E41A 2FLPA 3KLIB 3MR5A 4EYHB 2P5GA 2R8JA 1NJZA 4CEEA 4B9UA 4KE5A 2XY7A 4OVLA 3AO5A 3KK2A 4DQIA 3CJ4A 1I39A 3AO2A 4FLTA 4GMJB 2B6AB 4FK4A 2WONB 4DL7A 1RT2B 3OLBA 4CEBA 3PJXA 5EDWA 4YQWA 1IKVB 1J53A 5EU7A 4RW4A 3SI8A 4O3OA 3EY1A 2YHAA 4J9SA 3G0ZA 5J2QB 4CGHA 4HHTA 4F8RA 2UUTA 5J2QA 3ZT0A 4OKEA 3TAFA 3TAPA 4CJSA 1T8EA 1JLCA 3NAHA 5I42B 2WOMB 4DFKA 3KLVA 2HVIA 3N6LA 3TAMA 4IG0B 2BQUA 5KFPA 3KHLA 1RT5A 5KFKA 1BCOA 4QCLA 3NF8A 1HYZA 4HCCA 1XWLA 4RUAA 4FZZA 2EX3A 4FVMA 3GQCA 1LWCB 4CEAA 2HW3A 5KFMA 3ZSXA 3LWMA 4M3YA 3DLGB 3V1OA 4LQ3A 3TABA 3SUOA 3V9WA 3QINA 2BE2A 2OPRA 1RT7A 1S1WB 3QETA 1FKPB 4HUEA 5DK5A 1VSIA 3KLGB 2W7OA 3O4QA 2IOCA 1TV6B 2XC9A 4TYAA 3CJ2A 2X78A 4E7HA 5KFHA 4DFPA 4E7JA 4MIAA 3BSAA 3KJVA 3OS1A 1JIHA 3T1AA 3HVTB 1RT4A 4ELTA 3M9OB 1BI4A 3ZCMA 3NAIA 4R0EA 3V6DB 1RT4B 2BANB 1BI4B 2G8HA 4QW8A 1R0AA 3CIZA 3V1RA 5J2MB 2BANA 3BDPA 2IC3A 3KLEB 4DS4A 4J2DA 4O44B 4Y3CA 5J2MA 3AV9A 4CESA 1NKCA 4EO8A 3NDKA 3E51A 4JRQA 4O44A 3OJSA 3QGIA 3E01A 3NGIA 4EBDA 4WFYA 3Q8SB 2W8LA 1D1UA 2IDOA 4C8NA 1UWBA 4RNOA 3OSPA 2G8IA 4M95A 3OYDA 3SPYA 4NZ0A 3C94A 3UQSA 3PX0A 2RDJA 2RF2B 4MKAA 1EP4A 4Z4CA 3D28A 4FJHA 3SV4A 4RG8A 2E9TA 4H4MA 4LH4A 2FLNA 5FRMA 3ISNC 4LH5A 2YV0X 4CFAA 5HROB 1RT6A 2VG6B 3H2LA 1SH3A 3QLHA 4HUGA 3KTQA 1CZ9A 4O4RA 4R8UB 4CGDA 3H5SA 1MU2B 1HNIB 4Y1DA 3AVFA 3PY8A 3M8PB 1S48A 3THVA 4DEZA 4FLZA 3FDSA 2X6NA 4FLXA 2ZD1B 4NLTA 5HBMB 4IOBA 2DY4A 1IKXB 5CYMB 1EETB 4K4SA 4GC6A 2WK4A 3QZ8A 3L3UA 4FK0A 4EZ6A 2HMIA 1S0NA 3MEEB 2DPJA 2B5JA 3HHKA 4ECTA 5KFCA 1JLFB 5SWMA 3V9XA 3NF6A 1KLMA 4N47A 3M8QB 4QWAA 4KHMA 4DL6A 1S9GB 2W9BA 4CEFA 3QEVA 4ICLA 1HJRA 3LWLA 4QW9A 4DSJA 3OYHA 1X9SA 1ITGA 2R2UA 4FS2A 4ED3A 2UUWA 3AVAA 1RTIA 4I2QB 1S0MA 3ZT2A 2VG5A 4TLRA 5J2PA 3H59A 4H4OA 4KHQA 1NNDA 3DLRA 3RRGA 1L5UA 3K5MA 3TWHA 4NCGA 1IH7A 4G3IA 4HCBA 2RKIA 3I0RB 3T5KA 4CJFA 3HSTB 2C2DA 2HHUA 4M3XA 1N5YA 1TP7A 2HHQA 2RKIB 3I0RA 3QIPB 1NK0A 1SKRA 5J2NB 3RMDA 3MEDA 4DL4A 4CEDA 1U48A 1S1UA 4FLYA 1VRUA 1WLJA 3DI6A 2BQ3A 3S9HA 1VRUB 2KW4A 2UVRA 2XY8A 4DF4A 1RA6A 3H40A 3MR3A 4DSFA 2WHOA 5L1IA 3OL8A 1TVRB 4Q8FA 2PZSA 3KKSA 4F4XA 4NLDA 1KHVA 4O5BA 3ALYA 4OL8A 3ASMA 3L3VA 3OL6A 2YNHA 3IGVA 4Z4EA 3TVKA 3HM9A 2AWZA 1JX4A 1D8YA 3GIMA 3NL0A 2WB4A 3IRXB 3BSNA 5KFVA 3CFRA 4CF8A 4QPXA 4PWDA 5DG7A 5KFJA 3C6TB 1Q9YA 1JLGB 4O4GB 1BIUA 1K1SA 4ECZA 4CJVA 4DTUA 4J9LA 3OJUA 1K6YA 3AVNA 1S9EA 2D0BA 4E0DA 4FJIA 3RR8A 4WYWA 1JLQB 4NLOA 1S9EB 4E7KA 3PX6A 4FJ7A 4DFMA 3C6UB 3TANA 4PA1A 4FW1A 2OPPB 4CEOA 5DLFA 3IAYA 1U47A 2JC1A 4FJXA 3ULDA 3U3YA 5KFRA 4CHPA 2J6TA 1RTDA 3H08A 2KZMA 4NYNA 2E4LA 1S1VA 4J9OA 4NLGA 3G86A 3H98A 3OYEA 4BE2A 3UPFA 3AVCA 3B6OA 1U4BA 3JYTA 4NLPA 5KG1A 4TY8B 2BDPA 3ISND 3BJYA 3RB3A 2OYQA 4JV2A 1S9FA 4NLYA 4KTWA 1RTJA 2FC0A 2BGGA 2LSNA 4AILC 4K4TA 2AQ4A 1IG9A 1RTJB 1JXBA 4B9LA 4CIFA 3SUPA 4FLUA 1SL2A 1VSKA 1KFSA 1D0EA 2F8EX 3OYFA 2UVUA 1T03A 1RDBA 4CF1A 4J9NA 1ZBUA 3HVWA 3L2UA 2PYJA 4Q45A 3K5LA 1JLAB 3TQ1A 1WAJA 3RWUA 1JLAA 2DTUA 2KFZA 2IM1A 3AVHA 4J2BA 3E01B 4O3SA 3PW0A 3SQ4A 4IBNA 3ZT1A 3AO3A 2R8HA 3PR4A 3RAQA 1RCHA 4JV0A 2W9CB 4FJNA 1LW2B 1S6PB 4NCAA 4RNMA 3QGGA 4NYFA 1VSFA 4ZP9A 2W9CA 4DTJA 2O4GA 1KRPA 4YP3A 4CK3A 5F8GA 4E7IA 3MEGA 5F8LA 5F8NA 2GV9A 3KMSA 5HROA 2ZKUA 2XRIA 1RT6B 3SQ2A 1BCMA 3HP9A 2C22A 2RN2A 4KO0B 4CGIA 1NJXA 2HB5A 4K4VA 3VQ6A 4KO0A 3D0PA 4UQGA 4KKOB 1W9HA 1MU2A 5KT7A 4IQXA 3H5YA 1HYSA 1HQUA 1YT3A 3VQ7A 4CHOA 4FM1A 5J1EB 3P83D 4URSA 5KG4A 3DM2B 3DLEA 5C24B 4X2BA 3AA2A 3DLEB 3DM2A 3SI6A 4KB0A 3CQ8A 1KLMB 3M8QA 4MFBA 4KFBA 4ZVEA 1QHTA 4EEYA 1B92A 4NLSA 3TAGA 4ZPAA 4F4YA 2R2SA 3LANA 2G8UA 1SL0A 1W25A 3NE6A 1VRTA 4KAIA 1BGXT 4CJKA 3RMAA 4AHUA 1YVFA 4IFVB 4N76A 3NMAA 4HUFA 2CJQA 3DMJB 2VG5B 1BISA 1HPZB 4YR3A 5KFEA 4DWIA 4CJQA 4IFVA 4KHNA 4DLGA 1TL3A 4NLRA 3FQKA 3V9SA 1NHUA 3BR9A 2VWKA 3EYZA 4WFXA 3H5UA 4M3RA 5L1KA 3O3GA 1ZTWA 2GUIA 3V9UA 3FRZA 3DOLA 5KT3A 2IMWP 5DG8A 3RAXA 4MQ3A 1D9DA 3FSIA 3MECB 5KG0A 5F8IA 2Q3SA 3V1QA 4WZQA 5HRPA 4LD0A 4ZVGA 3MECA 2IM3A 3GILA 4IG3A 3AVKA 1JLBA 2QK9A 4NLQA 3LP0B 1RT3B 2OA8A 4M3WA 1JLBB 1A5WA 5KFFA 1TK5A 1BL3A 5KT5A 4M41A 4XO0A 4ID1A 2ILYA 3NAEA 1N6QA 4O0JA 2BQRA 1XR6A 2D3UA 3LP3A 3AO4A 4K4ZA 3BQ1A 2I5JB 1KLNA 4IFYA 2V4RA 1QQCA 3F9KA 4OPJA 2I5JA 1JL2A 2XY6A 1CLQA 5JUMA 3AVJA 4PQUB 1TKXB 1S49A 3LZIA 2JEGA 4DQPA 1A5XA 5FDLA 4RW9A 3NGZA 4QWCA 2UVVA 3U6FA 4Z4FA 1KFDA 1TKDA 4XIUA 3BSCA 3H4DA 4E19A 3QZ7A 4W5NA 2BRLA 3BQ0A 5KFTA 1SUQA 3G6XA 3CM6A 4OLAA 3OYMA 5KFLA 4R5PB 1J9AA 1HQEB 3D45A 5CYQA 2HHWA 5KFDA 3CFPA 3IS9B 3KLHB 2C2RA 5CZ1A 3IS9A 4CJPA 3VN5A 5F8MA 4ECWA 2ZQBA 4Z4HA 1BQNB 1KVCA 4KAZA 3AA3A 3O3HA 1U04A 2NUBA 3SJJA 5T7BA 1UA1A 1SL1A 1X1PA 2QKKA 4CEZA 3CM5A 3D5MA 1NK8A 2OZSA 1LWEA 1FK9B 1JKHA 1NKEA 3OY9A 1FK9A 1JKHB 4I9QA 3ZSQA 3V81A 1RAJA 4DG1A 3WNFA 2J6UA 2IAJA 3VQ8A 4Z0UA 1NJYA 3IGNA 1RTHA 3SUNA 4DTPA 2XY5A 3TAEA 1BHLA 1VSHA 4RU9A 1T94A 3I0SB 4GVMA 4KHRA 2YHBA 4M3TA 1HYVA 2EHGA 3DRPA 1C1BB 3TARA 1QTMA 5DG9A 1QE1B 2WONA 3MFIA 5L1LA 2J6SA 3HP6A 2QKBA 4CHZA 1RT2A 3AVBA 4ED8A 1HRHA 1DLOA 3DLKB 2ALZA 5DLGA 4FJKA 2CKWA 1IKVA 4IDKA 4WXWA 1L3VA 3QEXA 5EWEA 4BE0A 4TQRA 5KFXA 4DQSA 3BGRB 3ITHA 4FYDA 1Z25A 3B6PA 5KFWA 4ED0A 1XHZA 2F8TA 4CFCA 3EPGA 3NH1A 2HNDA 4RNFA 5HLFB 4ELVA 4IH7A 3KHRA 3KLFB 4G1QA 4KKOA 4DTRA 4PUOB 4E3SA 4ECUA 4WZMA 4CF0A 1S6QA 3TAMB 1RDAA 5JS2A 4IG0A 5KFOA 1HQUB 3OSNA 4Y2AA 2FBXA 3CO9A 4ED6A 3V6JA 5KFBA 5F8JA 1CZBA 2ILZA 1CSJA 1ASUA 3K5OA 3CJ5A 3HK2A 3PX4A 4I7FA 3HVAA 1VSDA 1GOBA 3NF7A 2A1RA 3CVKA 1S1TA 5D3GA 3T19A 3SQ0A 3QYYA 4B9NA 3M9MB 1S1WA 4ECSA 3L2RA 4CECA 4CJ4A 3OS2A 3PJWA 4W5RA 4J9PA 3DYAB 5C42A 3KLGA 3K58A 3V6HA 3BREA 3DYAA 5C42B 5T14A 2E9RX 4BACA 1KVBA 3DMJA 3LZJA 1WSFA 1IKWA 4CF9A 2HNYA 4EBEA 3AVLA 2HHXA 1RBUA 3PUFA 4FBUA 2BR0A 3NH0A 4QOZB 3KK2B 2RPIA 4RUCA 1T05B 2XGPA 1Z4UA 4K8XA 1ZBFA 1FXXA 3OYKA 4OKJA 2O5DA 3RRHA 3T5HA 4Q5VA 1RT3A 4YFUA 4MK7A 4RZRA 1T7PA 4B9MA 1VSJA 1GX5A 3CJ0A 3HYFA 3CFOA 2D5RA 1NK4A 4O3RA 3LPTA 3OL9A 3LP2B 4ECRA 1XC9A 1N4LA 4BE1A 5JXSA 1QSSA 4FJJA 1UOCA 3ZSYA 3M8RA 5DMRA 1TKTB 4KHYA 2E9ZA 2E6MA 4AHRA 2FJWA 5KFQA 5I42A 1ZYQA 3C95A 4PQUA 1I3AA 2YNGA 3F73A 4MIBA 3GIJA 1VSLA 5C5JA 1UAXA 3S3OA 5KTQA 3KKRA 2HNZA 1XHXA 4F50A 3SZ2A 3CDUA 4MK8A 1WAFA 5KRTA 3QEIA 5KG3A 4CJEA 4HYKA 1TK8A 3GV8B 3DLGA 4BDYA 1GOCA 2ZD1A 5HBMA 1SUQB 4B08A 3VA0A 1XI1A 2V9WA 1A5VA 4KV8A 4E7LA 2P1JA 4DLEA 5CYMA 3ZT4A 4R5PA 1HQEA 4ZHRA 1NOYA 4JV1A 5F9LA 2HMIB 2B4JA 3V4IA 3OVNA 3KLHA 3AVGA 4FLWA 3GV5B 1RILA 2FJVA 4ZHRB 3WNEA 4DTNA 1KHWA 3OYGA 2KZZA 3G6YA 3KD1E 2AGQA 2IM0A 4ZPCA 4DS5A 4B3OA 3OHAA 3JSMA 3WNHA 4B9TA 3LDSA 3L2VA 3IG1B 4ECQA 5KGWA 5KG6A 3JSMB 3HVTA 3IG1A 4NLUA 1SH2A 1YVUA 3LAKA 3ZSRA 2HWHA 1JXLA 2OH2A 2XCAA 1NK7A 1C1AA 3KLEA 4QWEA 4NCGB 4J9RA 3CG7A 3NGYA 1IKYB 2G8VA 3AVIA 2IJNA 2YNFB 4C8KA 2YKMA 4K4XA 3I0SA 4WXOA 4DFJA 2YKMB 4CJ3A 3VQSA 2AU0A 1B9FA 4NCBA 3PO4A 3O4NA 5KFGA 3PZPA 4RW8A 4DSKA 4FJ9A 1GX6A 3DRPB 1C1BA 4LQ9A 4AHVA 3VQEA 2D0AA 4Q8EA 4RW8B 5KFZA 4KREA 3OYLA 2AX0A 2GC8A 4AHSA 3G10A 3HPHA 4KTZA 4CHQA 3PO5A 3G6VA 1QSYA 1DLOB 3DLKA 4GC7A 2VG6A 3QLHB 5I3UA 5KFIA 4ZP6A 4KB7A 4TQSA 2W7PA 1REVB 4CJUA 5I3UB 2R8IA 4XPCA 3VQQA 2JLEA 4TY9A 2ATLA 1REVA 3M8PA 1LAWA 4DF8A 2A1SA 3IRXA 1D9FA 3SYZA 4J9QA 1JLCB 2AX1A 3BQ2A 4CK2A 4Q0BA 5HLFA 1JLGA 4O4GA 2HAIA 1MMLA 5JS1A 2VA2A 4DU3A 4FLVA 4G1QB 3RB6A 2ETJA 3L2QA 1JLFA 1RT5B 1TAQA 4Y34A 4WYLA 1NJWA 4HVJA 2XWYA 3QIDA 4DL3A 4JLHA 5KFYA 1RBVA 3FQLA 1RTIB 1C0UB 3BSOA 4ECVA 4CF2A 1FKOB 4DU4A 4QWDA 1ASWA 1C0UA 4CCHA 1RBSA 2D41A 1HARA 5KG7A 4M3ZA 1TV6A 2ITGA 1RA7A 1Q9XA 4C8LA 3JYTB 4ID5B 5KFUA 2AGPA 3KIOA 3HJFA 3V6KA 1F21A 3HVRA 5KT6A 4CIGA 3NCIA 4ZPBA 2G8KA 2R2TA 3OYNA 1U09A 3OYIA 4FZYA 1KCFA 1UA0A 4FJ5A 4OLBA 2P5OA 4FS1A 2B6AA 1X9MA 1KVAA 2IC3B 1ZTTA 1T05A 1LWFA 4U6PA 4BDPA 4M3UA 3P1GA 4RW4B 3TR8A 4DSLA 5KT4A 3RBEA 1LWFB 4JUZA 4M94A 4M42A 3MXMA 3OYCA 1SH0A 1EXQA 1TKZB 2IJFA 5K14A 1TKZA 4O3QA 3QEWA 4PWDB 4H4MB 3VQPA 1S1XB 5CY4A 3QO9B 3MR6A 1TKTA 1D5AA 2D0CA 3Q8RB 1QAJA 4KBIA 5K14B 5DGBA 4F2RA 1C6VA 4Y1CA 5KG2A 3ICLA 3AO1A 2DFFA 4NRTA 4R8UA 3QGHA 2AGOA 1JLQA 1KTQA 2FJXA 3OLAA 2XGQA 4EZ9A 1X9WA 3C6UA 3QEPA 1LAVA 2FVQA 2OPPA 2OPRB 5DQIA 2FVSA 1RT7B 1EETA 1TAUA 4KV8B 4E89A 1Q8IA 2D3ZA 2B5JB 5CZ2A 4CERA 4JS5A 4W5TA 4F4ZA 4ICLB 1TL1B 4YNQA 3ZT3A 1ZBLA 3H5XA 1WSEA 2ASJA 3LPUA 3KJVB 3DDKA 1RDCA 4I2QA 4ZMMA 3RMCA 2Z1HA 1RDDA 1GOAA 4FK2A 4CHYA 3UR0A 1ZBHA 4ED1A 3CYMA 3TI0A 4M45A 2B43A 3PR5B 1R0AB 1S4FA 1YTUA 4IKAA 1RYSA 4IH6A 4DSEA 4I2PA 3KHHA 3KOAA 5KG5A 4IRDA 3HPGA 2QXFA 4IRCA 3MEDB 3RB4A 4DMNA 1UWBB 2JEIA 4IG3B 3DI6B 1Y97A 4J9KA 3NF9A 1EP4B 2QE5A 1NK9A 4KRFA 3CDWA 1S0OA 3DLHA 3SFGA 3KK1B 3NHGA 5EUHA 3MEGB 4QWBA 2HVHA 2GIQA 4WE1B 4GW6A 4F2SA 2KFNA 4WE1A 2YNHB 4B8CA 4CJTA 3GIIA 4DTSA 3VQDA 2E6LA 3HXMA 1WSIA 1TKXA 3HKWA 4BWMA 4RW9B 1IKXA 4K4WA 1J5OB 4KI4A 5HP1B 2P51A 4Q0BB 3MEEA 5HP1A 1WNSA 1C2PA 4E1MA 5FROA 3T5LA 2FLLA 2JEJA 1S9GA 2W9BB 4Y2CA 4NLWA 4YR0A 4MKBA 3NFAA 4CE9A 1VK0A 3PHEA 3ZSZA 4BWJA 4DTOA 3NGDA 4H4OB 4EO6A 1FKOA 2VWJA 4CGGA 1BIZA 4IRKA 3VQ9A 1RTDB 4WFZA 4N41A 4CJLA 1TL3B 3A2FA 4ED2A 4ZP7A 3ZSWA 3Q8PB 1L3TA 5HRNA 3K2PA 3CDEA 2FBTA 3H4BA 3QNOA 4TY8A 4CIEA 4ECXA 2OPQA 4ED7A 3QIPA 2IM2A 4N5SA 4PY5A 4HTUA 3ZSOA 3TAQA 2OPQB 1CXQA 3V81B 1S1UB
chains in the Genus database with same CATH superfamily
4O3NA 3MMCB 1UW9A 3TQEA 3SQGA 3CJKA 1Y5NB 3SMZA 3BF4A 1RTHB 4MK9A 2V4QA 1X4HA 4B3RF 4KHWA 1TVRA 4FWNA 1C1CA 2GGPA 1S97A 1AXQA 3K59A 4B9QA 3O4WA 3PV8A 2C28A 1ZETA 3EL2A 3US5A 1D9AA 4J9MA 3EKSA 2B7BB 1NUEA 3IN5A 4IO1A 4DV4J 1YJWS 1P9YA 1KP6A 4F3OA 3JSRA 1TGOA 1FJCA 2YHWA 1TK0A 1B7YB 4PG5A 2L9DA 4WF9Q 2WVDA 3MM9A 3O8WA 1JQGA 3OL7A 2FJBB 3SCXA 4DU1A 2HBQB 2HQDA 4FM0A 1VBYA 4R0JA 1SV5B 1RGVA 4DX6A 2ITMA 2IIRA 3P39A 2X3GA 4MT1A 4OZ2A 4Z4IA 4LSNA 3DKDA 3M8SA 5M1KA 3CJ3A 3OYJA 1HMVB 4OHYA 1BUPA 3K57A 4Y65A 4TU9A 3IR5B 4BREA 1GAOA 4WP9A 3SNNA 2CPHA 3OXFA 3FFKB 5GAEP 1WSRA 2QWRA 1HQ2A 4DU8A 5AQTA 2FVPA 4MFBB 5BYRA 2HKEA 2J0WA 4K25A 1TUWA 1F6TA 3H6EA 1RAFB 5IM0B 1YI2S 4HL9A 4CFDA 2E2NA 4NPOA 3VPZA 3NG8A 3OA9A 2LP4A 2XI2A 3T6BA 3GYNA 4CZMA 5FPNA 3HHLD 2F8SA 5AXKA 1B7FA 3AY0A 2Q1NA 2OZMA 2YI1A 3H45C 1G15A 4FPIA 4JI3J 4WFNL 3OTOJ 4FPBA 3CCLS 2EBEA 2D9OA 3M6GA 1B9DA 1F5CA 2P9SB 1C0TB 2J8SA 3DFEA 2JLGA 1ZXOA 1LW2A 3C2PA 2XG8A 2VQEF 3LO3A 4F3TA 1ICEB 2PYLA 3FFIB 2RDIA 1RYRA 3NBPA 2H5JB 3BGRA 3KVGA 3SFUA 5HRSA 1FKAF 3MXHP 4DV3F 1NEEA 4TN2A 4EBCA 3L8BA 2NS1B 1WOSA 2N4DA 5GIPA 4CI6A 3HLUA 3HPOA 4DR6J 4QAGA 1WSVA 1NH7A 2CADA 3DHWC 2RVJA 3NCPA 2KDOA 3F44A 4KFBB 1WNEA 3BGLA 2QFIA 4BRHA 4FWQA 3PYFA 3V4IB 3AOAA 4DI6A 3UD5A 5DETA 5LMNK 1HPZA 1CXUA 3GFXA 1UCNA 4FWSA 4DSIA 5AZJA 3IUCA 3AY9A 1RISA 1SJ3P 2LCWA 3OW2R 1L3SA 5D0EA 5B0BA 3DGPB 3C15B 4ZVHA 3TW0A 1HNVA 4BLGA 5IOLA 4RNNA 5HL7Q 2G2YA 3QT8A 3V9ZA 2X6SA 2VPZB 2GWKA 2JC0A 1BQMA 4TXSA 4CJRA 2WRMA 1B3TA 1LFPA 3PIOL 2KVQE 4FM2A 2ZOGA 4MDBA 4F4WA 2FC9A 4OYWA 4BCAA 4P72A 4DTXA 2Z58B 4DR1K 2FDNA 1B99A 3DAWA 4E8UA 3D6HB 4X66J 3KHGA 3KWGA 1WI6A 2AJQA 6AT1B 3DRSA 3JSBA 2HHHK 4U7CA 4AH9A 3EZUA 3O9QA 2RE2A 3MUMP 3FEYB 1GLFO 4IFYB 3W3SA 2MLYA 1H98A 2F1FA 1R8PA 3I96A 3QNNA 3CSKA 2QXLA 2QSWA 4JKGA 1SQKA 2IVOA 1UPPA 3GIKA 4IDKB 1PYOB 4W5OA 2ZE2B 3SDEB 1HNIA 4LT6A 4B9SA 2M0GB 2ZVIA 4OX9F 3AJ2A 1MWMA 3B4DA 1NSQA 2W9AA 1SV5A 2JEFA 1EKEA 3GSIA 4CLTA 3D2FB 3Q7CA 4OQJA 2MHNA 2NUUG 2HHTA 2Z1GA 2F63A 3VQAA 4JI5F 2I7PA 3W9IA 1BQNA 1NGGA 2GFFA 4JI8F 1BC6A 1VHFA 3I5BA 1JLEB 4KI6A 3R6GB 3AXKA 1PYTA 3VVUA 2ZGYA 2GIRA 3EZWA 1MG7A 4Y2IA 4RW7A 4P75A 5KFAA 4JRPA 3O5TB 3CMES 4Z4GA 5J2PB 1N33J 1LW0B 2VG7B 3AAPA 3ZSVA 1IBLJ 2G8FA 2J9DA 3GV7B 2CPYA 2DIUA 3VA3A 3KFWX 1O1WA 3D3CJ 4X62K 3PW5A 2KL8A 2V8PA 5EWFA 4YEAA 1IKYA 2FGOA 1YJ7A 2ZUAA 3OUYB 4ID5A 4TSXA 1IKWB 3DWLA 1NGBA 1YHQS 3TA0A 4NE9C 3WQUA 4D3GA 3KLIB 5IS2A 2P5GA 1NJZA 4B9UA 4I64A 4MLEA 2XY7A 1RABB 2FHOB 1K47A 1RBLA 3CETA 4F36A 1RT2B 3SK3A 4YQWA 5BR8F 1FXRA 5EU7A 2CJXB 3M2RB 3NGUA 2VC0A 3KUHA 3L9ZA 3EY1A 4YS2A 1O5JA 4J9SA 4CGHA 5EX0A 3W2WA 2MY8A 4HHTA 4GVBB 4F8RA 1NJIO 4DR6F 1MA9B 5AQUA 1P1LA 3TAFA 6FD1A 3TAPA 2R4FA 5BR8K 4BR0A 2MQPA 2AF6A 1M1HA 4DFKA 1R6VA 2HVDA 1YHQN 1JCFA 4JD2B 4KH4A 3N6LA 4IG0B 2BQUA 2A6MA 2DHAA 3I87A 2M4MA 2HS4A 1HBUB 4A8YA 2EX3A 1FA0A 1VQ7N 5FLXU 3OTEA 3ZSXA 5BR9A 2MZJA 4G1IA 4X4TA 2WBMA 3T1YK 4PHTX 5IC4B 3JTPA 4NXNK 4NI2A 4NMLA 3DN9A 4M5HA 4HUEA 5CAAA 3KLGB 3E3XA 3O4QA 5C0YA 2IOCA 2XC9A 1BUXA 3ISZA 3CJ2A 2O8CA 3ZEUA 5KFHA 2R7QA 4FWLA 1OJ4A 1J5EJ 1KC8O 1JIHA 3M9OB 2ZJPQ 4YHHK 1RHKB 4R0EA 2NQPA 3O9TA 3J7AP 3K5PA 3K2YA 1I3OB 1A6LA 4F0KA 1HKAA 3MM5A 5G0RA 4B3SJ 3G71N 4EO8A 3UI3A 4WCEL 1TMJA 3AOBA 3OJSA 4CO2A 3NGIA 4PPZA 4ZIVA 1FRJA 4WIIA 1MWYA 4C8NA 4FYVB 1UWBA 2AT1B 2ZWOA 2RDDA 3DDIA 4H5RA 4NYPA 3UQSA 2RDJA 1TFYA 2H51B 3OR2B 3SCIE 3NGSA 3RU0A 3PACA 4LH5A 2EG1A 3CCUN 2BKNA 4P10A 3MWBA 3H2LA 3QLHA 4JYAF 4P2MA 1CZ9A 2VL1A 2DNNA 1XERA 2KT5A 2W6LA 1HNIB 2BKOA 4JI2F 4IDHA 1S48A 3THVA 4DEZA 4FLZA 2X6NA 2CJYB 3TSQA 4FLXA 1NGHA 5HBMB 1Y64A 4KHPK 4CBXA 2ASOA 1VQ5S 4X65J 4IOBA 2XS5A 3A8JA 1CLFA 4LF6K 2E1MC 3MMJA 4H0OA 4MO4A 4WFBL 1ZM2A 2P6TA 2QMXA 2B5JA 3V9XA 4N47A 1LOTB 4DL6A 3I4HX 4OYMA 4DV7J 3B8HA 3IAS9 2GUPA 4ICLA 2NPFA 1VQ6S 2C3PA 3LWLA 4OO1J 2IDEA 1WC6A 4QW9A 3HSGA 2KM8B 2ALYB 3N4WA 2MZ1A 1TL7A 4QQBA 1RTIA 4I2QB 5HVHA 3ZT2A 1P8ZA 2CPIA 2BA9A 1VQ8N 5J2PA 2CAJA 4ZK7M 4NEYA 2ROEA 3FSXA 2CPJA 3LM2A 2BJDA 4OHXA 4AT1B 4G3IA 2IYIA 4CJFA 4I6YA 3JQKA 2C2DA 1OQ6A 4M3XA 1FWKA 2V51B 4X4PA 2RQMA 3I0RA 3QIPB 2BXJA 2Y0BB 3RMDA 4DL4A 3ZNJ1 4OI1A 2I8EA 1U48A 1S1UA 4FLYA 1TYQB 1YJNN 2ZH7A 4I4BA 3M8YA 2Q43A 3EVOA 2HBMA 4JI4K 3QSYB 4DF4A 1CG2A 4DSFA 5D4OA 3SMPA 1G7CB 2V8HA 2BABA 4HTLA 4NA3A 4F4XA 4XH1A 1RAEB 4KT0C 1KHVA 1S79A 3ALYA 4O5BA 3ASMA 3OTOF 5ETLA 3OL6A 3IGVA 1JNRB 3K9JA 4Z4EA 5IT9Y 3HM9A 2AWZA 3GIMA 3NL0A 3NS5A 3BSNA 3UFCX 3CFRA 3J7ZT 4CF8A 4GV9A 3TEHB 5DG7A 1Q9YA 1JLGB 4FO0A 2B4PA 4C48A 4B17A 1M0SA 1PBAA 1EB0A 3I8BA 1Q95G 1W2BR 3UB5A 1QQMA 1T0TV 3AQPA 2MDAA 3D1HA 1VQLS 4E7KA 4DFMA 3WZ0A 3LPYA 3O9SA 4JI5K 1TFWA 2DNRA 5IQQA 3IAYA 3WIVA 3U3YA 2F4FA 2J6TA 1VQNN 4V19X 2GAHC 4NYNA 2ZH9A 2E4LA 5IWAK 4J9OA 2HFZA 4X4VA 3OYEA 3UPFA 3JYTA 3X1LB 3BM7A 2BDPA 2F65A 4I6WA 3WXMB 1PIEA 2YH0A 3PRDA 2CPDA 1DEJA 1AFJA 1RTJA 1FT8A 2Z56B 3R1HA 4AILC 3VF0B 4K4TA 2HRTA 2NXJA 3ENHA 4PAAA 4MDAA 3VALA 1B4SA 3CW2C 2YCHA 1N0UA 2GVDA 1D0EA 1GLJO 3FZFA 2UVUA 3L2UA 2PYJA 2VYPA 1FDBA 3MCMA 4Q45A 1FEEA 4PABA 5E3CA 2FJEB 3OBWA 3MZIA 2YPYA 3ZZRA 2DH7A 3FVYA 3AVHA 5DM7L 4JKCA 2MSSA 3SQ4A 3OTOK 3AO3A 1NGFA 2R8HA 3X3UA 4CLWA 4JV0A 4NCAA 3GU0A 3NLCA 4GKKJ 2GW8A 1XNRK 2QO3A 1KRPA 5D0RA 4GY2B 4CK3A 3MEGA 5F8LA 1S12A 2ZKUA 1BCMA 3J81j 1APSA 4JI6J 2HBRB 4K4VA 3VQ6A 4KO0A 2GHWA 4UQGA 1X4GA 1IBKF 1NDCA 4KQZA 1RCXB 3EE3A 4U67Q 1HYSA 3SBTA 1SC1B 4XEIA 2PE8A 4GKJF 4FM1A 3T7ZA 2YWGA 5KG4A 2F4VF 2GELA 1T9VA 4X2BA 3G25A 1RLCL 2J9CA 3D4JA 2DXFA 2WBNA 1FCAA 3HD1A 1CZAN 3ADAC 4C2MA 3TAGA 3GG0A 1XC3A 4NXMF 1VRTA 1BGXT 2P9NB 4YN3B 1ZM4A 4PXEA 4AHUA 1YVFA 1D09B 1VCTA 3NMAA 3FCWA 2CJQA 3FJ2A 4JNEA 3CCZA 5HSPA 4IFVA 1TL3A 3FQKA 2H54B 3TZYA 3BR9A 2O1PA 1PBUA 2H4YB 4V19J 4K42A 3ZZZA 3O3GA 2XSJB 5H9FJ 2A1BA 3VR1A 4C23A 3RAXA 3VENA 4F0MA 4JI2K 5KG0A 1PAUB 5F8IA 2GIFA 2P9SA 3MECA 4IG3A 1K8KB 5D8HB 1N0VC 3VZIA 3AVKA 4LR8A 2QK9A 3LP0B 1W7AA 3ENAA 3TUZC 1NXIA 2OA8A 4X66F 1CQMA 1BL3A 5BYSA 4DR5F 4M41A 3NAEA 2R7SA 3LP3A 3POTA 3TPQA 3C0BA 3W5YA 1S4EA 2NPIA 4OPJA 2I5JA 4A46A 5JUMA 3R6MA 4DHYA 2AZ1A 3LL3A 2FY8A 2JEGA 1ZA2B 2GX8A 5FDLA 3MMAB 4XDCA 4QWCA 3TUPA 2PMZD 1SJRA 2RRAA 4XIUA 3H4DA 3WC0A 1S6OA 4OZ3A 3MMVA 1DRZA 3A5LC 5KFTA 1WB9A 1UL3A 1HNXK 3CM6A 3D9BA 4CLKA 5KFDA 3AHPA 3IS9B 5CCMA 4PG8A 2RQ4A 5M1QA 5CZ1A 4PXCA 4JI6F 3VN5A 5F8MA 3FBEA 2P9IA 4KAZA 3F56A 1Q82T 1T9XA 2CDQA 4ID8A 1LWEA 1FK9B 5IXUA 2P9UA 1JKHA 1R6YA 3WXKA 1NKEA 3OY9A 2XO6A 3U9ZA 3ZSQA 1RACB 1RAJA 4DG1A 1Y5LB 3UW1A 1I1GA 1SVDA 3VEYA 4FNHA 2XY5A 2NRXA 2IY5B 2EPIA 4CBUA 1KQFB 4RU9A 1MN9A 2O8EA 3I0SB 2X1GA 2FSNA 5MLCV 4KHRA 2KM8C 4M7XA 3VF6A 1MWZA 3TARA 4B3RK 5AQMA 3PHTA 2AYEA 4A8OA 3FKBA 1QE1B 1HBMB 2WONA 3MFIA 5LT5A 4JKBA 5L1LA 2J6SA 3HP6A 2G4BA 2L9NA 1UEKA 4CHZA 3UKUA 3MM7A 4IDKA 1X4CA 1VK3A 3NRBA 3H1QA 2MGZB 1Z25A 4OZ0A 1VGYA 4ED0A 1XHZA 1HPMA 3HMJG 4CFCA 3ONQA 3HD2A 1IBLF 4K0KF 1DJ0A 1V4SA 4IH7A 3KYLA 2BJ9A 4ZN3A 4DTRA 4B1UB 4E3SA 1U2VB 1VS3A 2A0FB 2MEWA 5JS2A 3TAMB 4OZ1A 4Y2AA 4DN9A 2FBXA 3EUNA 5F8JA 1CZBA 4NLCA 1ASUA 3M30B 1ILYA 2NUHA 3PX4A 4C3LA 4F25A 3CCSS 1VSDA 4NZ6A 4B3SK 2YKOA 2A1RA 5ELZA 4BROA 3OFGA 3U7JA 2QWPA 4X65F 1S1TA 2QA4S 4LFAK 1VQ5N 5F41A 1M5KC 5BPLA 4F7VA 1S1WA 3ZO7A 4DR3K 3C7NA 2ZOMA 5C42A 4J9PA 1LXJA 2RUSA 1ZZNA 3GDQA 4ZS6A 1S57A 4CF9A 1NG9A 2HHXA 4FBUA 2BR0A 4DV1F 2O67A 3RW6A 4ED4A 3M5RA 3CJ7A 1RAAB 2DPNA 2DY9A 1WDDA 4OI3A 4CBWA 5L38A 2Q66A 1T05B 1BY9A 4K8XA 2HIYA 1FXXA 3S1TA 3M8WA 4J8FA 5CYJA 4FF1A 2JVRA 4YFUA 1LWXA 5FLXY 3H3OB 2C2ZB 2F8HA 4L73A 4B9MA 1VSJA 4U8YA 3CJ0A 4BR9A 1QUPA 5AQKA 1XC9A 1N4LA 4LF9K 3L7PA 3M8RA 2HGMA 4AHRA 2FJWA 5KFQA 3EDQB 4C11A 2XNQA 3TRGA 1VSLA 1RFQA 3Q2TC 3THPA 4BR5A 5KG3A 5ETRA 5M1NA 1GOCA 3VA0A 3CCSN 1A5VA 4KV8A 3KG1A 2QW9A 4E7LA 2JWNA 2VPYB 1A0OB 4X65K 2OCEA 3KLHA 1JCEA 4FLWA 3HT0A 1UZDA 1RILA 3WNEA 3R97A 1KHWA 1X5OA 4JYAJ 3OYGA 3KD1E 2P9IB 1YG0A 4V19S 2CWKA 2KKZA 3T9ZA 2Y8YA 1PO6A 3JSMB 3IG1A 2EFVA 4HH0A 1WG1A 2YQ3A 3ZSRA 2ZWHA 3OFHA 5D4LA 1NK7A 2ZH1A 5E3RA 4NCGB 4MYUA 3GCXP 4OMFG 3CG7A 1HBNA 2R7RA 1R31A 2UXDK 1SPBP 4C8KA 1AA1B 4DV2K 4NO7A 2JOQA 4K4XA 1Q8KA 2O8EB 3I0SA 4WXOA 4F0HA 3AAQA 2A6AA 2DHSA 2YKMB 1U1PA 3VQSA 2AU0A 1B9FA 4DR5J 3KJQB 2QFJA 4K43A 1OKJA 2Q36A 1GX6A 4Q8EA 3NNCA 2ERRA 4KREA 1CPZA 2GC8A 3C19A 4ZA1A 4KTZA 4CHQA 1S77D 3PO5A 3CF5L 3BN7A 2H5EA 3MM7B 2VG6A 3FZBA 3QLHB 4DBQA 3AQOA 2UXBJ 2K1RA 2F7TA 2UUCJ 2EBGA 2ATLA 1FW6A 3M8PA 2RE1A 5JVHL 1LKZA 4DF8A 1ZAXA 3IRXA 1X4FA 4DR1J 4J9QA 2UXCF 1JLCB 3JAMU 2EFNA 3BQ2A 4O4GA 4DXLA 5FD1A 2QWNA 2VA2A 2GWJA 4WQ4A 4DU3A 4FLVA 1GXLA 2ETJA 3L2QA 4NXMJ 2P9KB 1GLCG 1SZ2A 1M5SA 1IR2A 3I32A 4HHHA 2EC2A 1NJWA 4HVJA 2V5HG 4X4SA 1OPIA 5AE1A 4DL3A 4LIRA 5KFYA 1WEZA 2YWFA 1C0UB 3CULA 3E66A 2P9LA 1SJ4P 1RBSA 4C0HA 3FCHA 1VQKS 4LVNP 5SUHA 2POKA 2MKJA 2OMOA 1SAZA 1TV6A 1E6VA 1HI1A 1R3NA 4LF2A 1YRXA 1AYEA 2G2OA 2AGPA 3KNGA 2A2CA 2V7YA 2RS8A 5KT6A 2PFDA 4DV5K 4L3KA 4CIGA 2VBZA 4ZPBA 2G8KA 2IA0A 1UA0A 2XYHB 3KXDA 5HANA 1MNEA 3E9PA 2MKHA 1IQZA 2IC3B 2GGPB 2W4CA 2A40A 1ZTTA 1T05A 3N79A 1C4CA 3R8EA 3UVJB 3P1GA 3O1BA 4ZKAA 4JK9A 2CQ3A 1H72C 4JUZA 4M94A 2VDHA 3SQOP 2F9TA 3IKMA 4ZVTB 1WF2A 4M5GA 4M5DA 4X62J 2R7UA 3GLJA 1ATNA 2IJFA 2QLXA 4U95A 5C10A 1IBKJ 4BRMA 4PWDB 4H4MB 1TKTA 2D0CA 4BHQA 3C46A 1XIQA 4H5TA 5DGBA 1Q5YA 1C6VA 4Y1CA 1E3MA 3ICLA 3Q83A 4CT8A 1X60A 4WYBA 3RUBL 3QGHA 2EG2A 4DR4K 2FJXA 2XGQA 1PJ5A 3D1OA 3D66A 5BN8A 3C6UA 3AD7C 4J91A 1LAVA 2V52B 4K0KK 4HDGA 2FVSA 5JLHA 4X4UA 1EETA 2MKYA 1HD1A 2D3ZA 1F60B 1O6XA 5CZ2A 1HNZK 4KPCA 4M7YA 3BPSP 4W5TA 5GADU 1XNQJ 3TTDA 1R43A 3R1XA 4YNQA 3ZT3A 3HULA 2HFSA 2IVYA 1MROA 3KJVB 1T9UA 3JTOA 3MTJA 3ZZTA 4F67A 3RMCA 1RDDA 1VOMA 4FK2A 1RU2A 2J9EA 2ZH2A 3R2DJ 2O8BB 2E29A 1R0BG 4ED1A 3CYMA 1FDAA 3TI0A 1PGZA 5FPEA 2DD8S 4A61A 3ZTOA 4USHA 4IKAA 3A3NB 4QIVA 4I2PA 3ZZ0A 3VETA 4IRDA 3OBYA 3HPGA 1M5OC 1HBNB 1VJWA 4IRCA 3F9MA 3EVWA 3RB4A 2YJFA 5LXRA 1KVKA 2CJBA 4DN0A 3TX8A 5H9EK 2CNNB 3VEOA 4BGAA 2K3IA 2XZTB 1EP4B 2QE5A 2OANA 4KRFA 2XB2D 3D54A 2HQCA 4LFBF 3DLHA 2VBXA 5EUHA 1FRLA 1FJEB 4QWBA 2V69A 1N32J 4GW6A 4FYXB 1NSAA 4OX6A 3R7BB 2ZM6F 4WE1A 2YNHB 3K8WA 1HBOA 4CJTA 4E98A 1ZAWA 5ADZA 3VQDA 3G8TA 3PRVA 3O2IA 3HXMA 1RHRB 3HKWA 1JJ2M 2ZJRL 1NCLA 3JB9k 1IKXA 1R89A 1O51A 4H5NA 1FF2A 2HWTA 2PN6A 1VQLN 4ES2A 5AQRA 1C2PA 2Z4PA 3MAAB 3P49B 1S9GA 2W9BB 1GT8A 4CO3A 5IWAF 4ZN1A 4K5SA 1VK8A 1ZBTA 4NLWA 4YR0A 4DR2F 3BGUA 4MKBA 3NFAA 2EVZA 4DPUA 4ILMA 4YDUA 3QMQA 3SCKE 4KRWA 4LUBA 3UE5A 3NGDA 4H4OB 3VQ9A 1T44A 4N41A 4CJLA 1TL3B 2KFYA 2MQLA 1NB7A 1IBMF 3DGPA 1NWKA 4M63A 2M8DB 2DBBA 3CDEA 4USJC 1WHXA 4USVA 3MN5A 4OX8A 2OPQA 3A4TA 3IM8A 4PXDA 4PY5A 3H3NO 2O01C 1CXQA 2FF3B 4RWWA 1HNXJ 2HF3A 3VQBA 3D2EA 4LY7A 1K8KA 3VZHA 1U45A 3LA0A 4N56A 4CK1A 4U7UK 1GTEA 4MMOA 4DJBA 1S5JA 1N36J 3MR2A 2ZM6J 1FFSB 4U7BA 3LUYA 1QAXA 3PVXA 4HHUA 3ZX2A 1MMNA 4LSLA 2YWWA 3KZBA 1NK5A 1SKWA 1XR7A 3W8PA 1DTQA 4YB5A 4CLFA 2DNYA 4BDZA 2P9PA 3M05A 4B9VA 3C6TA 5CD4H 5KGXA 1I6JA 4YOUA 1WBDA 1H2UX 1UKUA 4BC2A 3DLJA 3DNCA 3DXKA 2Y1LB 4GKJK 1HFEL 3IAM9 5HMYA 3WXJA 1DQ9A 2W4DA 1NHVA 1TUUA 4KBOA 3D2FA 2FUG9 2MKCA 4M5LA 1LV5A 1J54A 2Z8QA 1WORA 3BZQA 4OGEA 5THWA 4F4AA 3P96A 3T3FA 1M90O 1JLEA 1S6QB 1CULB 3U1MA 2W42A 1VIOA 1U02A 2WVCA 3VQ4A 4IJNA 1S1VB 2R8KA 4EAHD 1ZM9A 1XNRF 3WQPA 1U1LA 1LW0A 1LWEB 3R5CA 4K0KJ 1TUVA 3MCSA 1FI4A 4I6MB 1RT1A 3WUHA 1GQEA 2IS3A 4L8RB 3LDOA 4FWMA 3KUGA 4B3MF 1KVJA 2E8AA 1WSGA 4WFAL 3DOKA 3I31A 3GE1A 5KRSA 5IT4A 2N3LA 4DOZA 3LALA 3UDLA 5GAEU 3RSEB 1YJ9N 3W63A 3OFEA 3SUQA 3OFFA 3T1HJ 2ASMA 2UUAK 1NPRA 3JTNA 3CPWM 4USIA 2CVEA 4WTOB 1DY3A 1QUVA 4I2PB 4CEQA 2FBYA 5DRKA 2VFRA 3CWJA 2XO7A 3W65A 4WWSA 3HT3A 3MM8A 8AT1B 2ZBPA 4WK3A 2EC0A 2XYPB 1VC5A 1FHTA 2DISA 4BG9A 3B82A 4J2EA 3KK3B 3R5DA 5HVGA 1XQSC 4EP5A 3WNGA 2CXEA 1BMQB 3S01A 1U2FA 4QS7A 4JV5K 4E1NA 4K4UA 4FZVA 4KHSA 4YOVA 2CH6A 2O4IA 1VYAA 3W7BA 2CQBA 1KSPA 4P6QA 2NZTA 3LP2A 3R2CJ 4YB7A 5D0GA 1YJUA 2XLKA 1PJ7A 1ACMB 2U1AA 2LQJA 3VQ5A 1RBRA 4JD2A 2QV6A 2IMOA 1F5AA 2YNGB 4A48A 1DTTB 3WX4A 2HBLA 3OHBA 2R7YA 3QIOA 5J1EA 1IO2A 4EIAA 3RBXA 2HS3A 4DR2J 5C24A 3M30A 2ASDA 5KPRA 1GMWA 4I7FB 2AD9A 1ZZFA 1QD1A 3HHDA 1P27B 4NI2B 5CYQB 4NXNF 2GBZA 3T1YF 2C2OB 1YTAA 2NXNA 2YKPA 1HKCA 3HSJA 1ITPA 1YK9A 2GEMA 3P5JA 1HNVB 2K3KA 4FXDA 4DTMA 2D9PA 4MLHA 4IH5A 2R2RA 1EZZB 3CCMN 2BW2A 2YNIA 4A59A 3L7UA 4Q43A 2B9WA 1XN9A 2IAJB 1VQ9S 3EPIA 2OPSB 2KKHA 2C3OA 4TYBA 4C8OA 3HFKA 5AQHA 3VQCA 4IR9A 1NOZA 4CGJA 1SBRA 1NH8A 2YNFA 3AA4A 1Y7PA 4BR2A 2YBVA 1JXEA 5DZ6A 3K9KA 1UWAA 1J5EF 1YBUA 3QJPA 1YIJS 4QU7A 2RF2A 2FBVA 3CNQP 3KD5E 3EDRB 3LP1B 4OGCA 1U49A 4LSLB 4JI7F 1KAYA 1OS5A 2OTJS 2F96A 3UKRB 5D78A 2HWIA 4W4MA 1EX4A 4FJGA 3EKUA 2HBZB 3EEQA 2J0QD 3AVMA 1QVFM 5HRRA 4FDFA 4J2AA 4DCOB 2VD3A 2OD4A 1AROP 3W0LA 2E5IA 2AEFA 1BU6O 2HNDB 1K1QA 4OKKA 5L9XA 4Q44A 2UUCF 3HL8A 2KJWA 4JKDA 3R6LB 2YKNB 4RUHA 2ZNYA 4DV4F 4BC5A 3A13A 3BGOP 4YY3K 1WDTA 4CTAA 4EWTA 2V2ZA 1A9NB 1CBKA 4GKJJ 3MX2A 1TQLA 3DRRB 4KPYA 2KQ2A 2E1CA 3I56N 2DGTA 5F9NA 1PJ6A 4DL2A 2F9DA 2QN6B 2VG7A 2VGMA 4WFNQ 1DBDA 5D3GB 1KWMA 1M90T 3MAQA 2W2MP 4FWRA 3RTVA 4O3PA 5JVGL 2DHGA 9RUBA 4LR7A 3EZ5A 1QS4A 3TZWA 4IKFA 1ZAVA 3RMBA 4H8KA 3KLIA 5E41A 3UD3P 4B3RJ 3W3DA 3MR5A 2R8JA 4CEEA 1QZ6A 2NZ4A 3NS6A 3KK2A 3AO5A 4DQIA 2MQ8A 4GMJB 3W66A 3CJTA 3W61A 2VQEJ 4DL7A 4CEBA 1HUXA 1IKVB 4RW4A 2CA9A 3NGTA 2G1HA 1RHUB 2E5GA 3A1YG 4UY8T 3CJSA 3HJVA 3ZC4A 5C2DA 5J2QA 3ZT0A 2Q6CA 2ZOFA 4QJVA 4G1PA 4CJSA 1T8EA 1S5ZA 1CS4A 1JLCA 4J90A 3N5FA 2DRAA 4FOIA 1YZ6A 2P9KA 5KFKA 4QCLA 1RU1A 4CH7A 1HYZA 2VQFK 4RUAA 3A5NC 2BJ8A 1LWCB 5K8MA 4Y2MA 2HW3A 2BJ3A 3V2UC 3ZZOA 3HFZB 1FTCA 4OYZA 4LQ3A 3SUOA 3Q8UA 3NWRA 2OPRA 3GFYA 4ES1A 1RT7A 3QETA 2XMKA 4OYIA 3VWSA 2O8CB 4G65A 3TA2A 1KEKA 1TV6B 1OSCA 5CHIA 4LF8J 1TU0B 2NR0A 4E7JA 4C8YA 4DZDA 2W1BA 4MIAA 1VBXA 5F0XA 1B0VA 3OS1A 5B8HA 1HWIA 5A0YA 4KY3A 5B7WA 3NAIA 1FFGB 3GONA 1N8RT 1RT4B 1NU0A 2CQCA 4Z7CA 2IVFB 1BI4B 2G8HA 2ZBRA 4QW8A 4LF4J 1EQ0A 3L3CA 2AZ3A 2QA4N 2IC3A 3KLEB 2VBYA 1G1XA 4ANCA 2HYIB 5J2MA 5M1PA 4CESA 4A8XA 3P4UB 2IYGA 4IQMA 4DUTA 3E51A 4O44A 2VU5A 1EKRA 3FCVA 4OI4A 1T3VA 1HW8A 3Q8SB 2W8LA 3JXOA 4Y00A 3E8OA 4RNOA 2G8IA 4EI2A 3HZEA 3IBCB 4JHDB 4NZ0A 4JI6K 5GMKa 3C94A 2RF2B 4CT9A 5H9EJ 3SV4A 4QZVB 4H4MA 2E9TA 1NDLA 4LH4A 2FLNA 1Z6RA 2D4WA 3BO4A 4CFAA 2B0GA 4Z2XA 2D1KA 3R5BA 3UKRA 1R7IA 1YAGA 2DR8A 3KKFA 2OMLA 5AQOA 1SH3A 2J7KA 1Q7LB 3Q7BA 4UUWA 1SS6A 1JMTA 4GV3A 4CGDA 3H5SA 2KG0A 1MU2B 5H1SV 1RHQB 3M2UA 3PYGA 1NDPA 3FDSA 3K0JA 2KRBA 2LECA 3QSIA 3AT1B 2DY4A 5CYMB 3A5MC 5HQLA 4X64K 1EETB 3C14B 4JV5F 3CXCM 3L3UA 2WW8A 1IR1A 2DPJA 1Q81O 5K20B 2LEAA 4ECTA 2IRUA 4LREA 2E2PA 3GFHA 3QDKA 4QWAA 3TVZA 4JI8J 3D67A 4CEFA 5AQGA 2DNPA 1HJRA 1M5PC 3TJAA 2E7WA 3MMBB 4DR5K 4BRCA 2CPEA 3SLCA 1IM6A 4AYBD 4O23A 2BW7A 3TR5A 5IQ6A 1S0MA 2D74B 2VG5A 2RILA 2VKZG 3PJ9A 4TLRA 3J8AA 3H59A 1W7WA 1NNDA 1L5UA 4P2SA 3ENQA 5BRHA 4HCBA 3I0RB 3HSTB 2HHQA 2RKIB 5GADP 1NK0A 1DZ5A 4DUYK 1SKRA 4USMA 4ZVSB 5AJ3J 2VUGA 1VRUA 3DI6A 2YHYA 2P2CB 1RZMA 3QFHA 2HZVA 3LQVA 2XY8A 3I4PA 4PWUA 1RA6A 3H40A 3MR3A 5L1IA 1Q79A 4ANDA 1TVRB 4P2FA 1Y00A 3KKSA 2PZSA 1K8AO 2E7VA 4CZGA 4OL8A 2W2PP 3L3VA 4M63C 4L72B 2YNHA 2FQQB 2BH1A 1QQNA 1WEXA 4ANEA 2CG4A 2EFQA 1JX4A 2QM1A 2WB4A 1UEVA 1KNZA 4NWBA 2PO4A 2BJ7A 1DFDA 3UNGC 2BJ1A 3A8EA 4MKVA 1RP5A 4XK8C 3PFEA 5E0OA 2ZITA 3RBZA 1FJ7A 1K6YA 1GMVA 2MHEA 3AVNA 2X1AA 4LVOP 4E0DA 4FJIA 2HQGA 1N36K 2H9ZA 4F3QA 1JLQB 2MYFA 3CI5A 2ZHAA 3IMQJ 4FJ7A 4HTIA 4BRAA 3BYPA 4FW1A 4CEOA 3MDFA 2VPXB 5JJBA 2ZEJA 2BM1A 2JC1A 1Q78A 1BA0A 4YB1P 3ULDA 4CHPA 4ZIWA 3L4IA 4BE2A 1X4DA 5KG1A 1U8WA 4TY8B 3A0IX 2DGVA 3R7SB 2NXEA 4NLYA 3A3OB 3CGIA 2JZ5A 4NL5A 2QLBB 4KTWA 4AL5A 3QFPA 3FMBA 3A8IA 2LSNA 5IZHA 3H1VX 2K8GA 1WC3A 3SQGB 1JXBA 3MWPA 1NM1A 3OTCA 1Q86T 3J81Y 3M6XA 3PM9A 4FLUA 2E44A 1KQKA 5E26A 4NX9A 2F8EX 4CF1A 4J9NA 1ZBUA 3HVWA 3BO3A 3ILLA 1JLAB 1RJJA 1WAJA 1FXDA 3GR0A 3WQTA 4J2BA 2YY3A 4YB6A 5K9FA 3PW0A 4O3SA 1VQ9N 3ZT1A 4I68A 5CABA 3PR4A 2V7ZA 2WSCC 2P6SA 2W9CB 1LW2B 2H4WB 4RNMA 3QGGA 4NYFA 1VSFA 2IDLA 2O4GA 4Y0FA 4RU2A 5F8GA 1Z05A 4E7IA 4DV5J 5F8NA 2XRIA 1GMUA 4IWVA 4KO0B 1NJXA 4CGIA 2HB5A 5HJXA 2YXLA 5E5NA 4KKOB 1RDWX 1MU2A 2V4JB 3FGVA 5KAKA 5AXLA 3TWZA 2LFVA 1YT3A 1FE4A 2QA4G 1Q8BA 1K73O 3O6WA 1RSCA 2AW0A 3VGMA 3DM2A 4DCJB 2EFPA 4BRGA 1QAYA 3M8QA 5T7LA 4MFBA 3SXLA 4FL9A 2HSTA 2A42A 1WC1A 4F4YA 2QX0A 1W25A 3G4SN 3VV2B 4CJKA 4N77A 3QB0A 3RMAA 1YXQA 2G0IA 3I55N 4IFVB 4N76A 2DR7A 2DNLA 2NLWA 2VG5B 3R8YA 5KFEA 1LEOA 2JHEA 2AJ1A 4NLRA 4DLGA 3V9SA 5LMNJ 3EYZA 1JXVA 4WFXA 3GBTA 2YQ0A 3G96A 1ZTWA 1OYEA 3V9UA 2BBEA 3FRZA 2IMWP 2CQ0A 1S7IA 4ES3A 1V4TA 2COLA 2A2DA 1R8AA 1UVNA 2Q3SA 4LD0A 4KH6A 4ZVGA 2IM3A 1IJEB 3MURP 1JLBA 3HHLB 2VPWB 1ESVA 5DDPC 1Z2LA 1NAQA 5KFFA 2OKQA 2VASA 3IBWA 3VVTA 3GIRA 1N6QA 1WWHA 2BQRA 2G0JA 1XR6A 2D3UA 1YJ9S 4IO9L 2I5JB 3KUEA 2V4RA 2B51A 3CD0A 1K9MO 1CLQA 1FDDA 1JL2A 1VISA 3AVJA 1NMNA 1TKXB 3AH6A 4CLPA 4DQPA 3NGZA 3A5OC 5GMDA 3U6FA 1KFDA 2I0XA 2V9KA 4B1VA 3LW5C 1TKDA 2JRSA 4W5NA 4JYAK 4ILLA 4C0BA 4OZNA 4OLAA 2NRTA 5KFLA 1VLYA 3RG6A 1J9AA 1HQEB 3G2XA 1VQOS 1H74A 3KLHB 3BZKA 3M2VB 4ECWA 2ZQBA 1BQNB 4IOAQ 3BF1A 3CQXA 5L39A 4ZCLA 1SL1A 1KKHA 3C8YA 4RBTA 3D5MA 3C16B 2CWXA 4BRNA 2OZSA 5LXYA 3BPDA 3V81A 4JBCA 2OSRA 3WNFA 2FB0A 1F5BA 1NSPA 1WJ9A 1MN7A 3OVSA 1NJYA 3IGNA 3CCES 4KGMA 1U2CA 4DR7J 3EMTA 3TOQA 3L4BC 2JSXA 3O5BA 1FXLA 3CJCA 1YF5L 2EHGA 4DV4K 4L74A 1NHKL 4X4NA 4PKHA 5EGYA 4LF4F 1D8ZA 2UUCK 2GJIA 3NOGA 4BC4A 5DLGA 1NDKA 4FJKA 2DHHA 3IP0A 1VMBA 3M2RA 1Q5VA 2W41A 3GWCA 2CQDA 2MY7A 2WSFC 3QEXA 4BE0A 5KFXA 2KYXA 2CQ2A 4FYDA 3B6PA 2HGNA 4ZPVR 3FEXB 1EHWA 2Z2YB 3H25A 2R7OA 1GXTA 3EPGA 2HNDA 4LF8K 3D6FB 4RNFA 2WBRA 5HLFB 1RXOB 3U4LA 1RWUA 4KKOA 1J5EK 2HFNA 1GH8A 3UNYA 2E1YA 4ECUA 1ZPWX 3R5JB 1RDAA 1HQUB 3V6JA 3CO9A 3R9LA 1GXUA 4ED6A 2B4OA 2ILZA 3K5OA 1PAEX 3HK2A 3CJ5A 4U96A 4CZKA 2YX7A 1GOBA 3NF7A 1Q86O 2QLWA 1AB8A 2OTLS 3KG4A 3T19A 2VCPA 4CRJA 3SQ0A 3QYYA 3M9MB 4ECSA 2CIMA 3L2RA 1AUSL 3CC4S 4AL7A 4W5RA 3PIPQ 2F3JA 5GAGU 3K58A 5AQIA 1H6KX 4IEIA 3V6HA 5T14A 1Z1ZA 3ETOA 1EWQA 3DMJA 3LZJA 1WSFA 1IKWA 3CC2N 3THXA 4AD6A 2EFOA 3NH0A 3WXIA 5DM6L 1RKJA 3J81O 3NXZA 3O9RA 4JI0K 2N7YA 2MKIA 2K06A 1XMQK 2VZ9A 1Z4UA 5AZIA 1ZBFA 2A3JA 4PG7A 3WC2A 2XHWA 3OYKA 3U02A 2O5DA 3T5HA 3K89A 2F9WA 4OPAA 3GR1A 2E20A 4RZRA 3H20A 2OTJN 1J27A 4BRKA 1BWEA 5D4NA 2NYIA 3LM9A 1JNZB 4FJJA 2ACYA 3ZSYA 5DMRA 1TKTB 1WOOA 2EWHA 4CWBA 4LR9A 3HFVA 3Q24A 3C95A 4OJGA 2WC9A 1HWLA 1UVLA 4MIBA 1RWOB 4LF4K 4O8UA 1OWXA 4P73A 2QL5B 5C5JA 2CGKA 2HMPA 5MAOA 3I9ZA 4GVEA 3S3OA 4J7CA 4JKAA 2BKPA 2R42A 4C7QA 4F50A 5KRTA 4CJEA 3FMWA 4HYKA 1TK8A 2DGQA 4ZLNA 4BDYA 1CJUB 2PSZA 1XI1A 4B08A 4ZPTR 3W1YC 1RTZA 5AQLA 2CQ4A 4LF1A 3SJHA 3VEXA 3ZT4A 2L9WA 3PSIA 1HQEA 1WG4A 4OHVA 3MPDA 5F9LA 3MGJA 2HMIB 1P6TA 3Q23A 3V4IA 3GV5B 2FJVA 4ZHRB 4DTNA 3EE9A 4C1NI 2KZZA 1JJ4A 2AGQA 2IM0A 4ZPCA 1U1MA 2HHHF 4IEEA 2J8AA 4B3OA 5DZ7A 3OQ2A 2E5LJ 1TR0A 3JSMA 3FZLA 3IG1B 3L2VA 4LFBK 5KG6A 4YOWA 2FJDB 3QRPA 3O1WA 2O8BA 4DV1K 1SH2A 1IJFB 4HHJA 3CIMA 1YVUA 3CTRA 1RWWB 3LAKA 2ADCA 1U1NA 2ZDPA 2X1FA 1VQPN 2IVNA 3NGYA 2Q79A 4OZJA 2P9EA 4P2XA 5LSLA 4KH5A 3IR7B 3AVIA 3ZLJA 4DR3F 1HA1A 3UN5A 2YKMA 5FJ4A 2CGLA 1KTVA 3PZPA 2CZ4A 4TU8A 4HH1A 4DSKA 4FJ9A 4BS2A 4A8QA 4AHVA 1UJ4A 1XMOK 5AQSA 2FXUA 2JNJA 3G10A 3G82B 1QSYA 4GC7A 2NNWA 4LFCF 1HNZF 5HQ8A 4NASA 3SDEA 4ZITA 1B70B 2W7PA 3FZKA 1TL5A 2XS2A 3L6QA 4CJUA 5I3UB 3DDNA 2V63A 4CP5A 1IBLK 4ZVUB 3OT9A 2GCFA 1REVA 4ILJA 4C9DA 1HL6A 4XH4A 1U26A 3W5ZA 3SSRA 2WZ1A 4YY3J 5HLFA 1UJ5A 3ZZUA 2C2NA 3P4IA 3KK7A 4G1QB 1T9WA 3RB6A 2KXHA 2GS8A 1YWXA 3IWLA 2Q0RA 1T6DA 3I6PA 5IV3A 4UZCA 5LMUF 2A5XA 1RBVA 1Q8LA 3EGVA 1RTIB 2W40A 2VQEK 3BSOA 3H7HB 4CF2A 4DV7F 2XS7A 2VODA 4CCHA 1EAYC 3DXBA 3B4MA 1NNEA 1BD6A 1QLNA 2ITGA 3FK4A 1Q9XA 2CRLA 5A2QU 2YTCA 4NA1A 5KFUA 3D1QA 4DPTA 4CZIA 3SBMA 4L75A 7FD1A 4FNIA 4ZVOB 4CLZA 3RVCA 1VHXA 1PSDA 5E3PA 5BREA 1WHWA 3DLLL 4OYAA 3OYIA 1KCFA 1D3WA 3WBZA 3GFZA 4LF5J 4FS1A 2W7AA 3JAMY 3UVJA 3NNAA 3JSYA 4R79A 2GVZB 2EXUA 1LWFA 2HFUA 3LGMA 1ZOTA 2V94A 4PQAA 3ENOA 2V8VA 4IOCL 1B0PA 3ZYYX 3LH2S 1HNXF 1EXQA 5F2RA 4YORA 2IRYA 1TKZA 4O3QA 1OPZA 2I38A 5CY4A 3QO9B 2NCKL 3CDAA 1YJRA 3KHYA 5K14B 3TUIC 1HWKA 4ZJQA 5LOQA 5KG2A 1XNRJ 3FR0A 3AO1A 4R8UA 4LF9J 1YGYA 3TSUA 5L46A 2BOAA 3T69A 2AGOA 3TA1A 2VIHA 2OLWA 3OLAA 4EZ9A 2VBWA 3AOCA 2Q2RA 4EU0A 3OR1A 5E33A 1CULA 1CJUA 3WIUA 2JWLA 1EARA 4UF4A 4JI7K 5CA5A 4LRDA 1TAUA 3BKTA 4IXCA 3ULEB 2ZHBA 1MWQA 1WG5A 4PG6A 2ZFHA 3PEJA 4F4ZA 1KBRA 1TL1B 2CJKA 3PCOB 1ZBLA 1ROFA 4JI0F 2ASJA 4FYWB 3LPUA 2UUAJ 4IJAA 1W26A 2UU9F 1GOAA 2I6WA 3VEZA 2HRUA 1VI7A 2B43A 3RSEA 4M8LA 2RHKA 1YX2A 1UETA 2FZCB 4A4JA 3MM5B 1REGX 2CPFA 2WFBA 4EFHA 2XMMA 3ENVA 3VGKA 2F9JA 3VAMA 4B1ZA 3LGNA 4RL1A 1NGDA 3MEDB 2J5AA 4LC9B 1D4XA 1UWBB 1AUDA 2JEIA 3ZETB 2ZJQQ 4IG3B 1YSJA 2H48B 2DO4A 5ETNA 3KDNA 3CDWA 4DX8H 2L08A 1FTRA 1P1TA 4DV2J 2BUPA 1NGIA 4N8NA 3CC7N 3G71S 2VGNA 1M5HA 5GAGI 4N7TA 3MEGB 2M8HA 2QA1A 1TMMA 2GIQA 4WE1B 2VFVA 2VB6A 1H73A 4I6AA 4B8CA 1JB0C 3GIIA 4DTSA 1XMOJ 3CT9A 5K8OA 4FOEA 2CZVC 4RW9B 1J5OB 3UE2A 4KI4A 3TJ9A 4KGZB 1V3RA 1VQSA 3KWIA 4Q0BB 4DCHA 4GO7X 5HP1A 2ZNZA 1WNSA 5FROA 3T5LA 2PC6A 2GHVC 2OHDA 4CZJA 4ZCMA 3TO8A 3C3LA 1Q82O 3UDCA 1KS2A 3M32B 2K7JA 1M1KO 3ZSZA 4DTOA 4LF9F 4CGGA 4CZEA 4UOFA 4WIQA 3W9HA 1RTDB 3FEZA 4EGLA 4ZP7A 3ZSWA 3Q8PB 1L3TA 2UUBK 2VOOA 3MX5A 3QAEA 5A6PA 3L95X 1WF0A 1OVQA 3W64A 3R7NB 4CIEA 1KOOA 4ECXA 3CIPA 3QIPA 1CVJA 3QBWA 4HTUA 4X64J 1RE1B 2KLAA 3TAQA 3H46O 4M5IA 3D2EB 1S1UB 4DG1B 1JK9B 2KTQA 1H2VZ 3J7YI 4U7UD 2QLJB 3TNVA 4AQYJ 2OELA 2PMWA 2VFUA 3MMCA 1N56A 4NLVA 3ENBA 3LP0A 4FJLA 1YRUA 5F8HA 2WCXA 4CO4A 3O3FA 4AHTA 3ZX3A 2DFEA 3MF5A 1S7HA 4K8ZA 3PSFA 3BH6B 3O3LA 2XCPA 2MKSA 1HWUA 2W8KA 1PYSB 1NKBA 3DGVA 3J7YU 1VSEA 2QZ8A 5LMUJ 1GTHA 4XAKA 3T5JA 1WSHA 5F0WA 4PKGA 2YX6A 2E1AA 3ZXWA 3QJJA 4FJ8A 4CLSA 3QO9A 3HSZA 2WVFA 3WDOA 2HHSA 3D0IE 3EGWB 3PDNA 4NMXA 1SJFA 4CFBA 3VGTA 3HBTA 2OFHX 3MXJA 2DXDA 3CCQS 4JI5J 3R9PA 2Y1JA 3SV3A 3LTOA 4G9ZA 4A47A 3CMEN 4ZTFA 2DRDA 1HMVA 2UVWA 1U2RA 5CZXA 4BQZA 5LL6d 4PUOA 1VDHA 4FBTA 4LSNB 2PA8D 4URQU 2MQOA 4DV2F 5CCLA 4DQQA 4JI4F 2V0NA 3ULEA 5ETTA 2RQCA 2C2EA 1RT1B 5IM0A 1L3UA 1N48A 1WHYA 1TL1A 1QVGR 3SQ1A 3CC4N 1YJTA 4ETZA 4CZLA 3C7NB 4Q2MA 4IO8A 4F4KA 2LXFA 3CMQA 4GV6A 4WK1A 2E1RA 3BEXA 1LFWA 2P9CA 2GTDA 4FXVA 1AFIA 3S3MA 3N4QA 4UT4A 2HNYB 3EJMA 5GADI 5AQXA 3DOLB 2DEIA 1DQ8A 1OYDA 3MCOA 3OTDA 1FRMA 2QWMA 4OLPA 1HNWF 3RR7A 4JI0J 2GMLA 2FVRA 2HOEA 3DXSX 4LFAJ 1C0TA 4RJVA 5HVFA 1S6PA 4LF7K 4EP4A 2GMJA 1F9EB 2M9KA 3QT5A 3N6MA 2QEXN 3FFIA 5AXMA 4C8MA 1H1VA 4M5NA 4I9LA 1SQEA 3BEGB 1NK6A 3QMLA 4RCHA 1WN7A 1X5SA 4CHNA 2Z1IA 5M2UA 1U2VA 1H3DA 1U0HB 1J5OA 3NNHA 2DPIA 2XMJA 1LWCA 2WAQD 3SSSA 2JVOA 5HOOA 3U3GA 3F5TA 5C2GA 1X7VA 4URGA 4ZLPA 1RNHA 5DDQC 1IJJA 2IBKA 5LM7E 3IWXA 3HCXA 1VRTB 3ZTSA 4HT7A 3TTCA 3I5CA 3RBDA 3THYA 1GK8A 3QESA 2ZH4A 3HF5A 2AYMA 2JDJA 1F2GA 4MH8A 2YWHA 1RDRA 3H42A 4JI2J 4A8FA 3TUJC 4BVOA 4FKXA 1SJQA 4H0TB 3NCQA 4LFAF 1BQMB 2OPSA 5EWGA 1TL4A 2MQQA 4KTQA 2FSJA 2J7UA 4LRCA 5EHHA 3AA5X 5GAGP 4O55A 1IM4A 4OHZA 4PWWA 2XLIA 2I7NA 3E9OA 1WSJA 4O0IA 1NLVA 3SBGA 2WW4A 1QZ5A 3EGNA 1Y3JA 3BKUA 3POTB 2B4VA 3R3TA 2CQIA 3DRSB 4LF7F 1UPMB 4XH5A 2X74A 2A18A 3J7A1 3OPKA 1XR5A 2Y1RI 4CGFA 2YX1A 4KB1A 2N7CA 4DL5A 4HEA9 2NREA 4C11B 3JQMA 4DQRA 2G8WA 3CCEN 5DQGA 4UY8O 4NOHA 1W0HA 4JKGB 4J9UE 2DFHA 5EOYA 1KQSM 2K1RB 4A8MP 2ZE2A 1WTFA 4I0WA 2UXDJ 3S6EA 4FF3A 4B3TJ 1YLXA 1YI2N 2FPHX 1K44A 2LDYA 3LAMA 3NH2A 3KLFA 4J5OA 4CO0A 3M9NB 1X5PA 3SAFA 2U2FA 4ZTJA 3DRRA 4K4YA 1BDGA 3PYEA 3EGZA 2IGIA 1U8SA 4HACB 1A7GE 3KWMA 2RU9A 2YKAA 4B3OB 4RW7B 4USTA 3I8DA 2M70A 2OJ3A 2W25A 1U6BA 4I67A 1QSLA 3K7RA 2HLTA 2CNOB 3R27A 3S3NA 4DV6K 1QHAA 5L1JA 2CQGA 4BVPA 2KJVA 4C6AA 3QT6A 3MD1A 5KFSA 3VAIA 1M1KT 4EK2A 3CC7S 3KMQA 4LFCJ 4RNHA 2BRKA 3KNAA 5L8RC 1N5VA 3NEKA 4K50A 2GQCA 2FLPA 2YQ1A 1V5IB 1VQ7S 2UYTA 4KE5A 2RS2A 3QPIA 3CCVN 3W2VA 1O13A 1VQ4N 3C65A 2GX9A 3FRYA 2ZVSA 1I39A 4FN5A 2B6AB 2LKZA 2XMAA 2WONB 4IUFA 2B9YA 1FJGF 3PJXA 5EDWA 5GAEI 1J53A 4QYRA 4ITSA 3BR8A 2HAFA 3SI8A 3VCDA 2YHAA 4X64F 3EVMA 2GMHA 3ZTQA 2BZ2A 3G0ZA 1WTBA 2AJ0A 3NCRA 2XQCA 2UUTA 4CD1A 1FEHA 2D3OR 5ETSA 2PEHA 3LDQA 1P90A 4WQ4C 5B0FA 5I42B 1HWJA 3ELHA 1OO0B 2CVIA 4ISEA 3KLVA 1X31C 2DGXA 1HBUA 3CQYA 3MOJB 1J6ZA 3TAMA 2KXNB 1BCOA 3NF8A 1VQ6N 3EX7B 4FZZA 3CPWR 1N5SA 4FVMA 1U0HA 1S3XA 2DYAA 4PKDB 4CEAA 4BBYA 2CG8A 5KFMA 3LWMA 2QIFA 1OH5A 5EX3A 3QINA 2BE2A 5C2CA 2F8MA 2G2ZA 1FKPB 4IFEA 2QMUB 3J7Z5 4JI7J 2HRYA 4TYAA 3FZ2A 5LSOA 2Z2LA 4E7HA 2YX4A 3W62A 2JFDA 1WUAA 2XZDB 4RX6A 2E2OA 1U6FA 2KRRA 2UXDF 5A0YB 3KJVA 1JJHA 5F0UA 4H03B 2FZKB 3HVTB 1RT4A 2HVZA 3ZCMA 3QICA 1F3FA 1R0AA 3V1RA 1WC4A 3RGIA 1S76D 2BANA 4O44B 3AV9A 1NKCA 2O66A 3JS9A 3QGIA 1P9QC 3M1VB 4DV0J 5U47A 4EBDA 2R7TA 4WFYA 2DR5A 1MMDA 4MJKA 2NXCA 2W6KA 4M95A 3OYDA 1RAHB 3SPYA 2CGJA 4CO1A 3PX0A 4MKAA 4Z4CA 4FJHA 4BR7A 3ISNC 3NP5A 4HWIA 2AJ4A 4FYYB 5HROB 1RT6A 4FWOA 4WQ5A 3KTQA 1RLDA 3CO0P 2YH1A 4CNYA 3O08A 1Z2ZA 2ZD1B 2L41A 1U24A 2UU9K 4K5RA 1IKXB 2D69A 1FVSA 4PXBA 3ILIA 4QR1A 2X1BA 5JVGQ 4K4SA 1VC6A 3QZ8A 1TUYA 4EZ6A 2GA7A 3P5TL 1S0NA 3MEEB 4JKEA 4PEOA 5KFCA 1RWXB 1JLFB 4A57A 3GE9A 3M8QB 4KHMA 4BC7A 1S9GB 1HHQA 2W9BA 3NMRA 3ET6A 2VC1A 1M5VC 3OYHA 1CC8A 4P9SA 2C42A 2NSBA 2UUWA 3OVBA 4UZBA 3AVAA 4JN4A 5H9FK 1FRIA 2J0XA 2LU1A 1RAGB 4H4OA 4KHQA 3MR7A 3D7SB 3VGLA 3QQCD 2X3DA 3K5MA 3CE8A 2VJVA 4H0PA 1IBCB 3U27A 3TWHA 2UXBK 3K8VA 1IH7A 2EWSA 2V67A 1KQSR 2Q3PA 2RKIA 3DHXA 2HHUA 2DNGA 1TP7A 2CYYA 3BZCA 5J2NB 2W2NP 3MEDA 5AE2A 1X4AA 3ZETA 3DU6A 1WLJA 2XNRA 4CZHA 3PLAA 2QC3A 3NGKA 3N0VA 2BQ3A 3S9HA 3F41A 2KW4A 2UVRA 2Q97A 3TX0A 1Q1KA 1N34K 3OL8A 2HBYB 4NLDA 4B3SF 2GAGC 3A8YA 4HT5A 2ZM6K 1OVYA 2F40A 1HBOB 3TVKA 1D8YA 4QIEA 2KI2A 3IRXB 5B09A 4OYPA 2KT2A 3C6TB 4O4GB 1R8CA 4RR5A 2AHOB 2IPOB 2I2YA 1U25A 1X0PA 4ECZA 2M88A 5AQFA 2GJ2A 2BMBA 2NRHA 4CJVA 1RAOA 4TVAB 1KQGB 5D6GA 4FF2A 3DRXA 2D0BA 3R5GA 3RR8A 4WYWA 4KGVB 4NLOA 1S9EB 3PX6A 4WP3A 4WCEQ 1UFWA 5E3AA 5DLFA 1U47A 2HIQA 4BG8A 4FJXA 1HX1A 1WOQA 2DR6A 4OLOA 2W4PA 5JICA 5LMUK 1CJKA 3H08A 3MPYA 5J1NA 7AT1B 2OTLN 4NLGA 5FLXO 3G86A 3FGUA 3AVCA 4NLPA 3RB3A 1YITS 3GSDA 3H0PA 4I6MA 5TKWA 2A6OA 3HOTA 2FC0A 2BGGA 1NZAA 1RTJB 2VQFF 1RKIA 1RCOB 2VH7A 3CCQN 4B9LA 2KHCA 4CIFA 3F0NA 2C2MB 1NGAA 2DCLA 4RKUC 1SL2A 3OYFA 3SEOA 3ILOA 3PEHA 4ZDNA 3K5LA 4W90B 2KT3A 5AFUA 5HMWA 2DTUA 2KFZA 3MM8B 1NM2A 2NRVA 4KHPF 5DJBA 4IBNA 2NZCA 2IFXA 4CLYA 3RAQA 4CQ1A 2HQFA 2P9PB 4K2JA 4ZP9A 4DTJA 2OEJA 3DXMB 2KO1A 1RI7A 2FZGB 2GV9A 3KMSA 5HROA 1RT6B 3DXKB 3HP9A 2C22A 2Y0SD 2RN2A 4YOYA 4CYUB 4YOEA 3QFWA 5I9EB 3HHEA 4KGXB 1W9HA 2VICA 3VF2A 3FBFA 3TVYA 3J7YP 5KT7A 4IQXA 3H5YA 1ZH5A 1PILA 1SC4B 3B8AX 1HQUA 3CJQA 3VQ7A 4CHOA 4BRIA 3P83D 2LYVA 4URSA 4OX9K 3DM2B 5C24B 3BF3A 3AA2A 2VWBA 3FUYA 1NGCA 3DLEB 1PC4A 3SI6A 3IWNC 2V6AA 4KB0A 1KLMB 4KFBA 2OEKA 4ZVEA 2K2PA 2FGCA 5BJRA 1MROB 5LL6Z 2P9NA 4X66K 2G8UA 1SL0A 2J0SD 3NE6A 4KAIA 4BY9C 1FNMA 2LEPA 4MIWA 4HR2A 2IJRA 3B78A 3TP2A 3DMJB 4UY85 1HPZB 3MOZA 2CPZA 4CJQA 3UR3C 2FF6A 1XMQJ 2D0PA 4KHNA 4DZ6A 1NHUA 3UCUP 2DH9A 2XSJA 3I56S 3H5UA 3C15A 1VHIA 2BEFA 4RO0A 5KT3A 5CR4A 5CHCB 4WP8A 4JB8B 3WEEA 4MQ3A 1D9DA 1G4CA 3FSIA 3MECB 4UOCA 4ZPWR 3T1HF 3V1QA 4WZQA 3VERA 2HFOA 3HHLA 3L0QA 3GILA 3C6AA 5HMXA 5AJ3F 4NLQA 2LQBA 1SIWB 1RT3B 3ZFVA 4AUKA 4M3WA 2YVSA 3CJRA 1TK5A 3CJAA 3QJLA 2HQIA 5A8RA 4XO0A 2ILYA 4O0JA 1CJVA 3AO4A 3BQ1A 3JXUA 4IFYA 3RRKA 3CD6N 3PKYA 1FNXH 1HHTP 3OHRA 1S49A 4BC3A 1Y0HA 1M1GA 2B8PA 5ADXA 1A5XA 2RNEA 2UVVA 4ALZA 4I69A 3GB0A 2NXUA 1FVQA 2RRBA 3G87A 3BSCA 2ZZNA 4E19A 2MQNA 3MAAA 1SC3B 2PI4A 3BQ0A 2ABYA 3EXCX