5C42A

Crystal structure of hiv-1 reverse transcriptase (k101p) variant in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
547
structure length
544
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Potent Inhibitors Active against HIV Reverse Transcriptase with K101P, a Mutation Conferring Rilpivirine Resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 131
structure length 544
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c42A05
4Z4FA 4AHUA 3HVRA 4NLWA 1FKOA 3QEIA 3HSTB 2IJFA 3OL8A 5L1IA 4RUAA 3LZIA 4R8UA 3QINA 4E19A 4O0IA 4O3OA 1JLGB 1RTJA 5KRSA 1Q9YA 3OL7A 3NF9A 1UOCA 4Y3CA 3WNHA 4GC7A 3SV4A 5DG9A 4DTPA 3HT3A 4TYAA 4H4MB 4ECZA 4EEYA 2D0BA 4M3WA 3JSMA 2IOCA 4WE1A 3E01A 4CGJA 3KLEA 4MIAA 4M3ZA 3NAHA 1CZ9A 3QEPA 3KK3A 2XGPA 4ID1A 2QE5A 2G8HA 1B9FA 4HYKA 1CLQA 4IRDA 3D0PA 3I0RB 4OGEA 3FQLA 3OYBA 5KG4A 4XO0A 4C8LA 2OA8A 2XY5A 4DL5A 4ECQA 4CIFA 3OLAA 4ED6A 1JLQB 3P1GA 3SFUA 3LWLA 1JLEB 1QSYA 4BDYA 3EZUA 1VSEA 2FBYA 1TV6A 5F9NA 4FJ9A 1NK0A 5EU7A 3NF6A 3ASMA 4YFUA 3KD1E 2HHVA 1GOBA 3KLIB 3LPTA 4G1QA 5JS1A 3RB3A 5DMRA 1DLOB 1Y97A 2HNDB 4ECXA 4CEFA 2HMIA 2YHAA 2PY5A 3NBPA 1KLMB 4KB1A 1S0MA 4WYWA 4LH4A 4CEQA 2PZSA 1RT1B 5KT4A 2XY8A 1KVBA 1R0AB 1U09A 4ZPDA 2WK4A 4EO8A 4ZP9A 3SCXA 3ZSZA 3KJVA 3BQ0A 2C22A 3LP1B 1ZBFA 3I5BA 4Q0BA 1L3TA 4WYLA 2Q3SA 1ZYQA 3V6DA 2FBXA 3SFGA 4IBNA 3A2FA 3SI6A 3KK1B 4BDPA 5L1JA 3G6VA 5C5JA 2PYLA 1JL1A 2DFFA 3I0SB 1HNVA 4JV0A 2ZD1A 4WXWA 4Y1DA 3L2WA 3TAGA 2R2TA 4JV1A 5I3UA 3I5CA 1MMLA 2ASJA 2AGPA 1RT7B 4OGCA 2AGQA 1K1SA 2BR0A 1J53A 2X78A 5HRPA 2F8TA 3TARA 2W9CA 3QEVA 2ETJA 4IH6A 3THVA 1ZTTA 3KLGB 3CQ8A 5CYQA 4FW2A 1TAQA 3OYCA 1CXUA 4KB0A 3OYLA 1RT4A 4F4YA 3CFRA 4QWBA 2WB4A 1SH0A 1C1BA 3BQ1A 3SNNA 2KZZA 5F8MA 4ECTA 4B9TA 4FJ8A 1BQNA 3S3MA 4CEBA 4NYFA 1RTIB 1XWLA 2FBTA 3VA3A 3MR3A 1EETA 4ICLA 4KKOB 4Q8EA 1JL2A 2IS3A 1VRUA 1LW0B 3KMSA 3QGGA 3NGDA 1BI4A 3OYIA 4MK7A 4RW6B 4NYNA 4TY9A 2WONB 5KG5A 1JX4A 2OPRA 1UWBB 4DU4A 2VWKA 4FM1A 4KHQA 4B8CA 3QIDA 4CJWA 4DQPA 3DOKB 4JS5A 4DLEA 4ID5B 4DQQA 5F8GA 2ATLA 4K8XA 5KFJA 1W9HA 1HYSB 4CEZA 4OPKA 3AVMA 3TAFA 4K8ZA 4O3NA 2EHGA 1TKXA 3G86A 1LWCB 4DFKA 1KFDA 2IJNA 3QGIA 4Y2AA 3QNOA 4C8OA 3PUFA 4KE5A 4O3SA 1TQLA 3DMJB 2BQUA 1RT5B 4DG1B 4IQXA 2XRIA 1KLNA 4KFBB 2IAJA 4CECA 5KG3A 2EX3A 4DFPA 3HVTB 4FBTA 3ZT4A 4NLGA 4RNMA 3MXMA 1KFSA 3CFOA 3AVAA 3KLHB 4IDKB 3PJWA 1L3UA 4B9NA 1LAWA 3CFPA 4FJ5A 2ALZA 3L2QA 4LQ3A 1D9FA 4CJPA 3T5LA 3DYAB 3LP0A 3AVIA 2VG7A 1RNHA 3TABA 3OHAA 3PX0A 5FRNA 2YHBA 4YR2A 3VA0A 3PW7A 4M3TA 1N5YA 1S1WA 5KI6A 2AJQA 1WNSA 4I7FA 4CEEA 4KTWA 3OS1A 3C95A 2X6SA 3K59A 2W9BA 2B4JA 1RT6B 3NGZA 3M8QB 3RRGA 4FYDA 4EYHB 2RF2B 4HHTA 3UR0A 3HKWA 3QO9A 1G15A 4K4UA 3PX4A 4PQUB 3LP2B 1TL1B 1LWFA 2VG5A 2VG6A 3DM2B 1GX5A 3G0ZA 3OS2A 1T7PA 1JIHA 1X1PA 4FJMA 1NKEA 1X9WA 4DQRA 5KT7A 1T3NA 3IS9B 1WSEA 3VQ6A 4LD0A 3DI6B 1NK7A 3QIPA 3BSOA 4HTUA 2P1JA 4Z4EA 3OHBA 4QCLA 3QGHA 1WNEA 4KHNA 3H40A 2B5JB 4B9SA 4URQU 2ZQBA 4KHSA 4WZMA 3G6YA 4FJLA 3C6TA 4IH7A 2ZE2A 1NOZA 1TKDA 3NFAA 5D3GB 4TSXA 4J9KA 4FM0A 3TAMB 3SUNA 1U49A 4N5SA 4IRKA 1HMVA 5KFLA 3RRHA 1NJXA 1Z26A 4NLVA 4IKAA 2Z1IA 1QSLA 1C1CA 3N6MA 4QW9A 1SUQA 2F8SA 3RTVA 1S97A 3HO1A 2RPIA 4NLXA 3TANA 4IG0A 3L3UA 3QEXA 2D41A 3MEEA 1HYZA 1DTQB 2YNIA 4L8RB 5J2PA 3GV5B 1U4BA 4DS5A 3NL0A 5HBMB 4CHOA 4RW7B 1CXQA 3MXIA 1BHLA 3B6PA 4CK1A 2YNGB 4EYIB 1XHXA 1HQUB 4R8UB 1TAUA 2G8FA 1LW2A 3MEDA 2GIRA 3VQ4A 1K1QA 4DTUA 3HK2A 1SV5B 2OPPA 3JSMB 2P5GA 4LQ9A 3E01B 1T8EA 3KLEB 3IGNA 3CDWA 4QWDA 1RBVA 2QXFA 1HNIA 4B9UA 3CWJA 4B3OA 3O3GA 3HP6A 2DTUA 3KTQA 1RA7A 4ZP8A 2UVWA 3JYTB 2IDOA 3S9HA 3NGYA 2BRKA 1ZBHA 4CGIA 5HLFB 5KFFA 3SV3A 1YTAA 4K4TA 3RMBA 4J2AA 4DQIA 5KFKA 2J6UA 2WRMA 1NJWA 5L1KA 4H8KA 4RNHA 3DOLA 3D5MA 1JKHA 5KFPA 3AO5A 3TQ1A 1NK9A 1WSHA 2X74A 4DWIA 3L2RA 2O5DA 3LAMA 5HP1A 3I5AA 5EWFA 3TVKA 3KHLA 2CJQA 3CJ4A 2D0AA 3VN5A 3SI8A 2HMIB 3GIKA 4OKEA 4BACA 5SWMA 1HQEA 3OYMA 5CYMB 4Z4HA 3CVKA 5HROB 3AVKA 4KTQA 4KI4A 3AVBA 3KLVA 4CCHA 4CHQA 1DTTB 5J2QB 5DG8A 1LAVA 5HRSA 3DRPB 1WN7A 3K57A 3L8BA 5C42A 1JLBB 1L3SA 1RYSA 3PX6A 1EP4A 4ZMMA 1VSHA 4XPEA 1TK0A 4ECYA 1KCFA 4IKFA 3SUPA 4QWEA 4ED3A 4K50A 3ZSXA 2J6SA 3OYGA 4I2QA 3MECB 4M3UA 4MIBA 4IH5A 4JUZA 5EUHA 2ZD1B 2BE2A 1RTDA 3MEGB 4YP3A 5I3UB 3KLFA 2I5JA 5KFSA 3DRSB 2R8GA 3HM9A 4FLWA 5KFMA 4O44B 2JEGA 5CY4A 1BCOA 4DFMA 4ZP6A 4XPCA 4J9SA 3Q8RB 4HUGA 5KT6A 4NLPA 3DLEA 2XI3A 4RZRA 5KG6A 3CO9A 2RDJA 5KFNA 5L9XA 2Z1GA 4DTOA 3QETA 2W8KA 4M42A 2LSNA 4Q5VA 3OYFA 3T19A 4QWCA 1BGXT 4CIEA 2QKKA 4ZTJA 1BQNB 4Y2CA 4KO0A 1J5OA 4CEDA 4KBIA 1D5AA 4K4VA 2HB5A 2G8VA 1RT3A 4DU1A 1T05B 2F96A 2OYQA 4WXOA 2GUIA 1IH7A 5DQHA 4B9MA 1D8YA 2DPIA 2G8WA 3LP3A 5CZ2A 1S9EA 3ITHA 3IG1A 4DTNA 5I42A 2YNHA 4IFYA 4CHNA 3GV8B 2EC0A 5DG7A 2ILZA 4CGDA 3DLGA 2VA2A 1WAFA 1IKXA 4NLOA 4DU3A 4DEZA 4KV8B 1NOYA 3OYAA 3CDEA 2DPJA 1QAJA 4DF8A 2E9RX 4CHPA 2IM2A 2UVUA 4HCBA 2YKNB 1S1XB 3ZSYA 1TKXB 3DLKA 1NHUA 4Q8FA 4BDZA 3BQ2A 1O1WA 3M9NB 2B6AA 4X2BA 4CJSA 3AA2A 2DY4A 2IMWP 5KFGA 4W5RA 4CERA 2OPSB 4MFBA 5KFIA 4M94A 3VQCA 1N56A 2E9TA 2Y1JA 2BANA 3AO4A 4FK2A 2BGGA 3DLBA 3O4NA 3QESA 3BGRA 3ZSRA 3OYJA 1WSJA 2IAJB 4E1MA 2ZKUA 1TVRB 4FXDA 4CGGA 1RBTA 2AX0A 3M9MB 3ALYA 3KNAA 2OPQA 2YKMA 4M95A 4EBDA 4N56A 4NLSA 1S49A 2KQ2A 1A5VA 3V81B 3KK2B 1S1UA 4K4ZA 1RDAA 3D45A 4DSKA 2E6MA 3LP0B 1WLJA 4OKKA 4M3XA 3ZT0A 1LV5A 3SQ4A 1VK0A 1REVA 5DGBA 3M8PA 3K5NA 3QZ7A 1QS4A 4RW8B 5E41A 4KRFA 2IM0A 3KKSA 1N5YB 1S1WB 4I9QA 1B9DA 4DSLA 3PR5B 3RB4A 1LWEB 5K14B 4NLQA 2C2RA 2JEJA 1SL2A 1XHZA 4MK9A 2W9BB 3P5JA 4OJRA 3GV7B 3V9XA 4RW4A 3AA5X 1TKZA 4OKJA 3QO9B 1XR6A 3V9SA 4YR3A 4CJKA 3HVAA 4DQSA 2FLNA 3ZT1A 3EY1A 2KW4A 2DFHA 3MR6A 4FW1A 3SZ2A 4J2BA 5F8LA 2CKWA 1XR7A 4QAGA 1QQCA 2OH2A 1VSKA 1N6QB 1VSFA 4CJLA 4KB7A 4DTMA 5F8JA 3QLHA 2I1RA 3CJ3A 2WOMA 2ILYA 4ZPAA 2XI2A 5FDLA 3IN5A 1VRTB 1Q9XA 4J2DA 1S6QA 3CM6A 4IFVA 4ECUA 1RILA 2ZE2B 4OVLA 4F3OA 4NLTA 2VWJA 3I8DA 5T14A 4I2PA 2IGIA 3HJFA 3BDPA 3LALA 4KTZA 3NGIA 3HPGA 4PA1A 4AHTA 1FK9B 4JLHA 4NLYA 4NCAA 3GYNA 4PUOB 3RBDA 2XY6A 3MEEB 5KG0A 2AGOA 2XWYA 4ZVFA 4E0DA 5J2PB 4EBEA 4ED1A 5JUMA 2VA3A 3QERA 4DFJA 4H4OA 1RBRA 4TN2A 5KFCA 2HHUA 4ZPCA 4BE1A 3OSNA 4CEAA 2OPPB 1ASUA 1NKCA 5C25A 4FJNA 1HPZA 3U6FA 1NJZA 3ZSWA 3O4QA 2R2SA 1IKVB 3PZPA 3KHGA 4LSNA 4CFBA 3DLHA 2RDIA 1IKYB 4HCCA 1S48A 4EBCA 3H5SA 1JLGA 4CFCA 1JLCB 1X9SA 1TKTB 1VSIA 3KHHA 4F3TA 3CJ5A 4ECVA 3PW2A 5J2NB 4ZHRB 4H4MA 3ISNC 4BWMA 4C8KA 1S9GB 3AA3A 4TY8A 4E3SA 2D7SA 3ZT3A 1WSIA 1W0HA 2IC3B 2KTQA 4ZPBA 4TYBA 4KHWA 2HNYB 3I0RA 3RR7A 1MU2A 2NUBA 3WNGA 3RBEA 3SUOA 2AX1A 1KHWA 4NCGA 3RMAA 1BIZA 2Z1HA 1HQEB 1RBSA 1JLEA 5KGXA 4CGFA 3K5OA 3PY8A 3KIOA 1I3AA 4K4YA 4Q43A 4FCYA 3NH0A 3IGVA 3SQ0A 3K58A 4EO6A 3KLIA 4JRPA 4LH5A 4ECRA 1DLOA 5EWGA 4O55A 2KFZA 5KFHA 2HNZB 4Y1CA 3OYKA 4MQ3A 4TQRA 4URSA 1KLMA 4RW9B 1RTHB 3AV9A 4LY7A 5J1EB 3S3NA 3PV8A 3F73A 1JLAA 1RA6A 4GVMA 1RT2B 4HUEA 1JLFB 4W5TA 1L3VA 1S1TB 4YR0A 4E7KA 1R0AA 4CF9A 5L1LA 3AO3A 4IG3B 3GIMA 1QE1B 1U45A 1C0TA 5KFRA 3VQ9A 4J9OA 4FZZA 3BSNA 4C8NA 3FFIB 3CJ2A 1XC9A 2AQ4A 3LP1A 3T1AA 3CDUA 3ZSVA 4FM2A 4J9LA 4AHCA 3VQBA 3OY9A 1L5UA 4JS4A 4MKBA 4CHYA 4XIUA 4AHVA 4FJXA 5C24A 4WFYA 3V6KA 2FJWA 3VQSA 1U04A 2QKBA 4N76A 3I0SA 4LSLB 5KRTA 4W5NA 3KMQA 4F2SA 3AVLA 3NCIA 1RT7A 2QK9A 1C0UA 4KO0B 2JEIA 1QHTA 3DRRB 2HHQA 1S6PB 3V4IB 4E1NA 3FSIA 1T03A 1JXLA 1RT3B 4CFDA 1SL0A 2XHBA 4URGA 4KI6A 4FS2A 1C6VA 4Z4IA 4K4WA 4R0EA 2ASLA 1Z25A 2RKIB 1FKOB 3ZT2A 4CK3A 4BE2A 4IFYB 4FZYA 4M41A 1RTJB 4ZVEA 1WSGA 1RTIA 4OL8A 4Y34A 5EDWA 2HVIA 4CGHA 3QEWA 2FVQA 4KKOA 4EP5A 2HW3A 4WE1B 1S1VA 4PWDA 2D3UA 2XC9A 3AVFA 1LW0A 3BR9A 3IRXA 1F21A 3KK3B 2E6LA 3MR2A 3DLKB 4RW6A 5F8HA 3HPHA 1S5JA 4E7JA 2B6AB 2WONA 5T7BA 1UWBA 4KHYA 3AVNA 4BWJA 3BSCA 4AH9A 3M8SA 2BANB 3PW5A 1VSDA 4KPYA 2WHOA 4RNNA 4Z4CA 3DOKA 2XO7A 3BGRB 4F50A 1S0NA 4QWAA 4DTXA 3MFHA 1LWCA 1TV6B 4O3PA 2OPQB 1XR5A 4ECSA 3H08A 4J9QA 1HRHA 4G1QB 3PW0A 5JS2A 3KHRA 4FVMA 3DMJA 5KGWA 3CG7A 1RT5A 1YVUA 3PVXA 1RYRA 3M8PB 2G8KA 3NBPB 4EP4A 4CF1A 1IKWA 4KFBA 4MH8A 4KHRA 2OZMA 3HVTA 3PO5A 1HJRA 1KTQA 4O3RA 3KLHA 4HKQA 4IDKA 3HPOA 1S10A 4EZ6A 3G6XA 3ZCMA 4RW4B 4WFZA 3KJVB 3DYAA 4Q0BB 4CF2A 2P5OA 4YMEA 3V6DB 1NK6A 1HARA 1SL1A 5DQGA 4GMJB 1W25A 1HNVB 1ASVA 3CIZA 4F4KA 3HYFA 1FXXA 4O4GA 3SPZA 2GBZA 1RT6A 1FKPA 5CZ1A 4DS4A 3HVWA 2RF2A 3NF8A 3UPFA 2XCAA 2W9CB 3ZSOA 3SQ1A 4PQUA 3LP2A 1TL1A 2R8HA 5CYQB 4ELUA 4DL7A 2R2RA 1C2PA 1S9FA 4FLUA 1TK8A 2PYJA 1NHVA 2HVHA 1RT4B 1C1BB 3K5LA 2FVRA 4G3IA 3ULDA 5SZTA 1TL3A 1BL3A 3CJ0A 2BQRA 3V6JA 4CFAA 3GIIA 5KT5A 3QNNA 1EETB 1NK8A 4ICLB 3AO2A 4FJJA 4RUCA 1EX4A 1VRUB 1RDRA 1SKRA 4ZP7A 3TAMA 1BI4B 1ASWA 2X6NA 4F2RA 3RB6A 2YNFA 2XCPA 2E9ZA 4Z0UA 2OPRB 3OYNA 3NF7A 5JXSA 4F8RA 2J6TA 3LPUA 2FVPA 4ED0A 1CZBA 2FC0A 3Q8QB 3L3VA 3H4BA 3FQKA 4R5PA 3GILA 4B9LA 1DTQA 4AILC 2BQ3A 1BCMA 4FJHA 3V1RA 1GX6A 2BDPA 4LSNB 5HBMA 3VQEA 4RW7A 4FLVA 2FLLA 2YNGA 1HQUA 4TXSA 4CJTA 5KG1A 4J9PA 4NYZA 1JXEA 1RDBA 4TLRA 2R8IA 4CF8A 3AO1A 5KFXA 4DL3A 3K5MA 3Q8SB 3H5XA 1SV5A 1A5WA 4TY8B 3MFIA 1RCHA 2IM3A 5KFOA 3OYEA 4PY5A 3LANA 3OYHA 2WCXA 2GV9A 4ECWA 4QOZB 1KVAA 4QPXA 1A5XA 2FJVA 3V9UA 4FJIA 5KFQA 5J2MA 3JYTA 1MU2B 4O4RA 2ITGA 4DSFA 1QTMA 2RN2A 4DLGA 4K4XA 3NHGA 4NCGB 5HLFA 1IO2A 4CJFA 4J9MA 2VG7B 3VQ5A 3SUQA 1ZBIA 3OSPA 3HHKA 2D5RA 5KFTA 4CK2A 5KFUA 3F9KA 1N48A 4M45A 3V9WA 1TK5A 1KHVA 1TGOA 4FJGA 1WAJA 4I7FB 1NNDA 4I9LA 3OL6A 3OL9A 2A1RA 5F9LA 4NLRA 2HHWA 4FK0A 3H5UA 3H5YA 1QAIA 5CYMA 2AWZA 3FDSA 3DLRA 3PO4A 5HROA 3UDLA 1C0MA 2YV0X 1JLAB 4UQGA 4YQWA 1LWFB 2VG5B 2VG6B 2R8KA 1DTTA 5J2QA 4BE0A 3DRPA 3MAQA 5KFWA 5KT2A 1C0TB 3EPGA 1BIUA 1JLBA 4CJVA 1ITGA 1IM4A 1JXBA 2V4QA 4J9NA 3QIPB 2R8JA 3NH1A 2C28A 2WTFA 3OJUA 4ZVHA 3SYZA 1GOCA 3V9ZA 4DTJA 1NK4A 5C24B 4FJKA 1BQMA 2QV6A 3ISND 3MECA 1J54A 3C6TB 2W9AA 3VQQA 3C6UA 3SQ2A 4F4XA 2DFEA 4JRQA 3B6OA 3OJSA 4WFXA 2HHTA 4DSEA 5KFAA 3MEGA 2GC8A 3BREA 3T3FA 4FLXA 3DRSA 3VQPA 2AU0A 1C0UB 3RWUA 1HMVB 3VQDA 3RMDA 4O44A 3RMCA 4RNFA 1T03B 1C1CB 2UVVA 1SUQB 5KFBA 2B43A 4NLDA 1NJYA 4IG0B 2OZSA 5KG7A 5EWEA 3OYDA 3RR8A 4B8AB 2FLPA 4MK8A 2YNIB 3CYMA 2V4RA 3ICLA 2JGUA 2JEFA 1X9MA 3LDSA 1ZETA 3PHEA 2Y1IA 1KRPA 5HRNA 1LW2B 3MEDB 3H2LA 3H4DA 1I39A 4E7LA 4AHSA 4CF0A 1T05A 1I6JA 2C2EA 3V6HA 1S1VB 4PWDB 2ATQA 4IRCA 1HNIB 3IRXB 4DSJA 3TAEA 1RDDA 3BSAA 4B3OB 1CSJA 2XGQA 4CJRA 1D1UA 4FLYA 3NMAA 4QW8A 4FBUA 4W5QA 4NRTA 1SH3A 3LWMA 1U47A 2GIQA 1K6YA 3WNFA 1ZTWA 2G8IA 4KV8A 5DLGA 3AVJA 4CJ3A 3EPIA 3V1QA 1ZBLA 2W8LA 3DOLB 2O4IA 2YKNA 1S1XA 1JKHB 3P83D 3LZJA 3N6NA 2V0NA 4CJ4A 2O4GA 3G10A 5HP1B 4GW6A 2OPSA 4E7HA 1S0OA 1IG9A 2E4LA 3PW4A 3LAKA 4F4ZA 2KFNA 1JLQA 1IKWB 1GOAA 5DLFA 2W7OA 4CJ5A 3QYYA 1TVRA 3EYZA 2JC1A 5DGAA 1BISA 1ZBUA 4U7CA 4RU9A 3MF5A 5C42B 3PJXA 3U3YA 3V81A 3KK2A 3AVHA 3IAYA 1EP4B 2HNDA 2IA6A 4IR9A 3HXMA 2R2UA 3RAQA 3CM5A 4RW8A 4KAIA 4FZXC 4E7IA 3QIOA 4I2QB 2XY7A 4CHZA 3NDKA 1RT1A 3TWHA 1EKEA 3NE6A 2BE2B 1LWEA 1RTDB 5K14A 1VSJA 4O4GB 4CEOA 4E89A 3KLFB 2I5JB 4CJUA 4ELVA 4ELTA 1FKPB 3NAEA 4Z4GA 4W5OA 4DTSA 2UVRA 2HWIA 4WZQA 3D28A 1HYVA 3DLEB 3KK1A 2R7YA 4EZ9A 4DF4A 2HHXA 1YTUA 3AA4A 4DL4A 3VQ8A 3NAIA 2JLEA 4CIGA 3H98A 2UUWA 2D3ZA 1N6QA 4ED7A 1TL3B 4CJEA 1J5OB 3K2PA 2UUTA 3UQSA 4IOBA 3HP9A 3KD5E 1VRTA 2W7PA 5KG2A 4Q45A 3KLGA 3WNEA 5FRMA 2ASDA 1UA1A 1YT3A 1VSLA 4O3QA 5DK5A 4CJQA 4YNQA 4FK4A 2YNFB 1S9EB 4RNOA 5KFVA 3ITHB 4HVJA 3IG1B 2A1SA 4DTRA 5I42B 1RDCA 2YNHB 1FK9A 1TP7A 3QZ8A 3NH2A 4PUOA 3DLGB 4B08A 1IKXB 4C8MA 4R5PB 3AVGA 3O3HA 3OLBA 3M8RA 3UIQA 2F8EX 4OPJA 4CE9A 3L2UA 3KOAA 3OS0A 4FJ7A 1UAXA 4DSIA 1U48A 1RBUA 4NCBA 2BRLA 1NK5A 3MR5A 3U3GA 2JC0A 1VSMA 1SH2A 1NKBA 4MFBB 2HAIA 5F8NA 1J9AA 2W42A 4O5BA 3T5KA 4TQSA 4ID5A 1IKVA 4M3YA 3GIJA 3V1OA 4O0JA 1HYSA 1RAJA 4OLBA 4U6PA 5J2MB 4N41A 1IKYA 2FVCA 5KT3A 2C2DA 4CESA 2YKMB 1JLCA 3TAPA 1QSSA 1TKTA 3TR8A 4NZ0A 5J2NA 2IM1A 1S1UB 4ZHRA 4NRUA 1T94A 1S9GA 1C1AA 1N4LA 5KFZA 4DG1A 3T5HA 1SKWA 4B9VA 1REVB 5KFDA 2IC3A 2P51A 2Z1JA 4ZVGA 3SJJA 4ED2A 5KFYA 2HNYA 4KHMA 4JV2A 4J2EA 4DL6A 3PR4A 4FLZA 3AVCA 4F4WA 3H59A 1EXQA 3RB0A 1D9DA 2HHSA 4ZTFA 3SPYA 1S4FA 4GC6A 4KHUA 2FBVA 3L2VA 2V9WA 3Q8PB 1TKZB 1UA0A 1KVCA 3M9OB 2IBKA 1XI1A 1D0EA 4IR1A 4RG8A 3N6LA 1KSPA 1SKSA 3VQ7A 2HWHA 5DQIA 3VQAA 5KTQA 4HUFA 3EZ5A 1YVFA 3DDKA 2HNZA 3M8QA 3T5JA 4DMNA 3GQCA 3QLHB 4RW9A 1RTHA 2WOMB 1QUVA 3BJYA 5J1EA 5FDLB 1BQMB 5HRRA 1S6QB 4IFVB 1RT2A 3C6UB 1JLFA 4FS1A 5FROA 3MXJA 1S1TA 4N47A 3DM2A 2FJXA 3KKRA 1Z4UA 4IG3A 3OVNA 4FLTA 1QE1A 4I2PB 5F8IA 3ZSQA 3FFIA 3MTKA 1WSFA 4ED8A 3IS9A 1OS5A 3DI6A 4OLAA 4KAZA 3C94A 1Q8IA 2B5JA 3E51A 3NKYA 2KZMA 4KSEB 3HL8A 3S3OA 4J9RA 4LSLA 5D3GA 3FRZA 4K4SA 4M3RA 3TAQA 4MKAA 4AHRA 2G8UA 4H4OB 3O3FA 4DL2A 3DRRA 4KREA 4H54A 1S6PA 3V4IA 2D0CA 1B92A 4Q44A 3TI0A 4NLUA 5C25B 5KFEA 1HPZB 2FVSA 3RAXA 2RKIA
chains in the Genus database with same CATH superfamily
4Z4FA 2H54B 4AHUA 3T6JA 2C1EB 1FJEB 3OL8A 2Q6BA 2CWKA 5L1IA 3KYLA 1IBKF 4E19A 1JLGB 3WEEB 1NZ8A 5CD4H 1RWXB 1GLFO 4ZVOB 4DTPA 3DU5A 3BUZB 4H4MB 4EEYA 2OTJN 1F3FA 2V7ZA 4WE1A 4CGJA 4M3ZA 1S0VA 1FFGB 2H1YA 1M1KO 1TFWA 2CQ3A 2OJ3A 2GA7A 3G71S 4GV3A 4NA1A 2OMOA 3I0RB 3OYBA 3FQLA 2I0XA 2HBJA 2PC6A 1WHVA 3AD9C 1S72S 4DL5A 2H48B 2YX7A 4CIFA 1U0HB 3Q2TC 4GKJF 4LF6K 4ED6A 2QMUB 1I94K 1UAWA 2GTDA 5E33A 1PCAA 3QB0A 1H7XA 1VFJA 5CQGA 1YVNA 1S79A 5BN8A 4FJ9A 1NK0A 1KP6A 5EU7A 3NS7B 3HRGA 2KJWA 3KWMA 2P9KA 3T9ZA 3L95X 4JB8B 4NMXA 1Y97A 4JK9A 4CEFA 2YHAA 1X4HA 3T1YJ 1G1XA 3C8YA 5M1KA 1RHJB 4OV6A 3NBPA 1KLMB 2LP4A 4KB1A 3VAKA 7AT1B 2YX4A 2O8DB 5GAGU 1W2BM 1NDPA 3K9JA 3J7YP 4JK7A 2BMBA 4EO8A 4ZP9A 3SCXA 1OQ3A 4A8WA 2P9CA 3ZSZA 4OPAA 3KJVA 1T3OA 3G6EN 1F9FA 3L09A 1ZBFA 2A6OA 4RU2A 3I5BA 4HTLA 1L3TA 4WYLA 1ZYQA 3V6DA 4JI7J 2VFSA 3KK1B 3WXIA 1FWKA 1RQ0A 3W2VB 1M0SA 1FTRA 5F2RA 1HNVA 4JV0A 5BYQA 5BRFA 4JV1A 5I3UA 4C48A 2BX6A 1D4XA 1MMLA 3ILJA 2QWLA 1F0XA 1J53A 2X78A 3CCRN 1CVJA 2FSNA 5LMNK 2F8TA 2MKHA 3TARA 1CS4A 4CLFA 1DZ5A 4BR4A 4IH6A 4H4KA 1ZTTA 5I4MA 1GLAG 3CQ8A 4BRQA 4FW2A 1TAQA 4FKYA 1VQ5S 4BR2A 4QR0A 4F4YA 1HBMA 3CFRA 4QWBA 3UNYA 4QS9A 1EHWA 1T6CA 1HW9A 2P2CB 3R3TA 3HZEA 2KZZA 3A13A 1SIWB 2JL9A 3D6FB 1BQNA 4O23A 1UWAA 4NYFA 1RTIB 4BLGA 2XMTA 5IC6B 1EETA 3CQYA 1R0BG 4Q8EA 2NRWA 2IS3A 1U8SA 1RFQA 1LW0B 4YEAA 2WONB 2OPRA 1PC5A 2BKNA 3BY5A 3QIDA 3J7YI 3GU0A 4DQPA 3THYB 2Z56B 3LL3A 2B9XA 3DOKB 5L9NA 2JWLA 4DLEA 2W2NP 3EL2A 3VAMA 5M2RA 1W9HA 4WK3A 1WORA 3KNGA 3TAFA 1G2EA 1SQEA 2HBRB 4CZLA 1LWCB 2AJFE 1Q82O 4Y2AA 1NB7A 3R2DJ 3W2WB 1UJ4A 1HNZK 3PUFA 4KE5A 4Q7AA 4DG1B 3SSQA 4WP3A 1DHMA 4GKJK 2QN6B 4IQXA 4UOHA 2JWKA 5B08A 1GLLO 4CECA 1FW6A 2EX3A 2GHWA 1F3VA 4KH0B 4NLGA 3MXMA 3CFOA 1B3TA 9ATCB 2K1RB 2EFOA 3PJWA 4LVOP 1L3UA 3VEOA 2G1HA 1X5OA 3SMPA 1QVFR 2HRUA 1KKHA 3L2QA 4BRMA 4QIWD 3OBWA 3TABA 2AF6A 4EFHA 1NRKA 3PX0A 3ZX0A 4M5HA 2NZTA 5M1OA 5IC4B 1CJTA 5FRNA 2YHBA 3OW2R 4IO1A 1M5KC 4AFFA 2HFNA 3PW7A 4M3TA 3QBWA 3VCDA 4I7FA 4USTA 1N5VA 3MN9A 4DUTA 3CJKA 4BR0A 3RRGA 4QYZK 4FYDA 3DXSX 1VC0A 2RF2B 3UR0A 3ZEUB 3QO9A 2RB7A 2HQCA 4PQUB 3LP2B 1TL1B 2VG5A 2VG6A 4M5NA 5ETTA 2HFUA 4ZCKA 5D6GA 4Z7CA 1GX5A 3G0ZA 3OS2A 4P2XA 4DQRA 1ULRA 3VAGA 3ZC4A 3LGMA 3VQ6A 5ETVA 4NASA 3RRKA 3BSOA 2SXLA 2P1JA 4Z4EA 1GT8A 1VBZA 1WNEA 2ZQBA 1Q7YT 1M5SA 1FT8A 2ZE2A 4FF4A 4FM0A 3H1VX 1FE4A 1TZ0A 4IRKA 2PMZD 5LT5A 3TZZA 1Z26A 4NLVA 4DV0J 4QW9A 3RTVA 4CZGA 2MQLA 2L9NA 2CFXA 4FWPA 3NRBA 4IG0A 3L3UA 4FPBA 3MEEA 4NXNJ 2YNIA 4L8RB 5J2PA 4XDCA 3CF5L 3GSDA 4DS5A 3NL0A 1CXQA 3M8ZA 4CO1A 3B6PA 3LO3A 1XHXA 4OX6A 4R8UB 1WOPA 2ASOA 1DJ0A 3MEDA 1K1QA 4ZS6A 4DTUA 3ID8A 1AW0A 5HMWA 1SV5B 2OPPA 4LQ9A 1T8EA 1FA0A 3M1VB 3CDWA 1BE4A 3E9OA 1FVSA 4B9UA 2C3PA 4FF1A 5BPNA 2P9UA 1RGVA 3KTQA 3DNCA 4BR7A 1E6YA 4LF4J 1DFDA 2J76E 3NGYA 4KGXB 1HQ2A 5H9EJ 4WFAQ 2EG2A 5KFFA 3AXKA 1V9OA 1SC4B 2GZOA 4K4TA 2V8VA 2WRMA 5L1KA 1HFEL 3AO5A 2DGTA 1U8WA 1X5TA 4QU7A 2O5DA 4OYBA 1Y0HA 4DBQA 5EWFA 2CJQA 3VN5A 3JTNA 3CCSN 2YH0A 2EEYA 3M2RB 5CYMB 3NP5A 4ZVSB 3E66A 4KI4A 1NBEB 1HR0J 4CCHA 4CHQA 5DG8A 4X4VA 3DRPB 1TUWA 3M2VB 1YK9A 3SK3A 1RYSA 3BF3A 4WJBA 2YQ1A 1VSHA 4U7BA 2W2MP 1QVGR 2IVYA 3ZO7A 3H6EA 4ED3A 1AA1B 1GMWA 2ZITA 4I2QA 3FEYB 3MECB 1QQOA 1UVJA 3FBFA 4IH5A 2DRAA 2ZD1B 2BE2A 1MNEA 2ZHOA 3MMJA 3KLFA 2I5JA 2XMKA 1HNWJ 5KFSA 2R8GA 3PIOQ 4O44B 2CGJA 2JEGA 5CY4A 1BCOA 1YJNN 4LF7J 1C0FA 4J9SA 5C2FA 4NLPA 2I7PA 1O13A 1S6UA 4RZRA 2UV8G 5KG6A 2RDJA 5KFNA 3QETA 2W8KA 5AJ3K 3OYFA 3T19A 1BGXT 4NZ6A 5C2CA 2R4FA 4OHYA 2P9EA 2HRTA 1J5OA 2KG0A 4KBIA 2CQ2A 2YI1A 1N8RO 2XYHB 3JQMA 3EO3A 2F96A 1PAEX 4WXOA 1YJWN 1IH7A 5HATA 1D8YA 3UKUA 3PKMA 5LM7E 1RI7A 4QOTA 4HVZA 5JLHA 3ZYYX 4DTNA 1FCAA 3GV8B 4OV1A 2WVCA 1NJIO 2ILZA 1Z05A 1NGHA 4MMOA 1XJWB 3QMLA 2IYGA 3EDQB 2QIFA 2QW9A 4KV8B 1ATNA 3OYAA 3DHWC 4KY3A 1QJHA 4L76A 3FMWA 5FPEA 2V68A 4FYXB 1HI8A 3FK4A 2E9RX 2HZAA 2UVUA 3UO0A 4HCBA 1UVKA 1B4SA 1O1WA 4CJSA 3AA2A 1EARA 1YLXA 5KFGA 4W5RA 4CERA 2EKNA 5KFIA 3AJ1A 2BANA 4MYTA 3QESA 2M9KA 5ETLA 3ZSRA 5IM0B 4PPDA 5EX3A 1JMTA 4CGGA 1N33J 2MEWA 1RBTA 2YX6A 4CM2A 4Y28C 3M9MB 3ALYA 4HT7A 3KNAA 2DXEA 4RBUA 2YKMA 5F3TA 1MWZA 3D1QA 4UY8O 1OSCA 2ZZNA 2DNKA 3TX0A 1RDAA 2E6MA 3LP0B 4OKKA 2ZOMA 4BC4A 1LV5A 3ZT0A 3SQ4A 2VUGA 3M8PA 2QT7A 4UTGA 2L41A 3ZX3A 4KRFA 2UUCF 3KKSA 4PAAA 1N5YB 1OKJA 4I9QA 4F25A 4F3MA 2RNEA 3WXMB 5C2GA 4NLQA 2JEJA 1SL2A 4QIGA 4J8FA 3IAS9 3P5JA 3V9XA 2DH9A 4LUBA 2DNRA 3L7UA 2J0SD 4Q2LA 3HVAA 4QS7A 4DQSA 5DO2A 3ZT1A 2A2DA 2J7KA 1GLBG 5DDOC 2KW4A 4UZCA 3SZ2A 4USVA 2HHHJ 1T0TV 5F8LA 1XR7A 4YB1P 3CJSA 1IJJA 4M63C 2RIJA 1ZBTA 1R3NA 2L3MA 4CDIA 4J5OA 1FHTA 4CJLA 2M3DA 2PFDA 3BP8A 4CLTA 3CJ3A 4ZPAA 3J7AP 4J2DA 3IN5A 4X65J 1Q9XA 4IFVA 2U2FA 3CCJN 1RILA 3JQKA 3OXFA 3UE5A 4NLTA 2DRDA 2GJFA 3W8PA 2IRYA 4JAXA 3HJFA 3LALA 1Q8KA 3BKFA 3GFHA 3NGIA 3HPGA 4LR9A 1FK9B 5FLXU 1A9NB 3GYNA 4JV5J 4PUOB 1VC5A 2XY6A 2CJXB 4U95A 2AGOA 1FWPA 2MLYA 4JI2J 3VV2B 3HLUA 4DR3F 1YF5L 5JUMA 3QERA 4QS8A 1XNQF 4DFJA 2LU2A 2EG1A 4DR6F 2YTCA 4DPUA 2N3OA 2QYGA 5KFCA 2HHUA 4A2BA 1RWMB 2RD5C 1NKCA 4OLOA 1HPZA 3MEKA 1VQ7S 3PSIA 3U6FA 3ZSWA 3TUPA 4IUFA 5GADU 4PR6A 2D0PA 3D2FB 1S48A 2NSBA 2PT0A 3EZOA 1TKTB 2LMIA 4A2AA 3VETA 2GVDB 3PW2A 3A4TA 3HSJA 5SUHA 3AA3A 4TY8A 2E1MC 5DZ7A 1KAXA 3ZT3A 1R8AA 1W0HA 4ZPBA 5B8HA 2B7BB 5AE3A 3G4SS 1VQKS 3EN9A 3RBEA 3RGIA 2HRYA 1BIZA 1HQEB 2VGNA 4EFAC 3HSCA 1YG0A 1RBSA 1VQ8N 3GFYA 5KGXA 1U2CA 3PY8A 4M7YA 1KTVA 1FDNA 5DM6L 3NH0A 2UUCK 4ANDA 3IGVA 2GGPB 1H6KX 3KLIA 3MWTA 3NS6A 4ZJQA 4CO5A 5CA5A 3NGTA 3E9PA 4RW9B 4NA2A 3S3NA 3FZLA 4DR7J 3I8BA 3F73A 1JLAA 1RA6A 1NXIA 1ZXOA 2Q79A 3I55N 2PEBA 4A46A 1QE1B 3VQ9A 2LCWA 4C8NA 3FFIB 3M1FA 3LP1A 3CDUA 4XK8C 3VQBA 2LXUA 2LYVA 1LEOA 4JS4A 3ENQA 1SJ3P 1R6VA 4CHYA 4AHVA 5C24A 4WFYA 4LF9F 2FJWA 1F1BB 2G0CA 1U04A 1I51B 4N76A 1LK5A 4LSLB 3M3ZA 4ZPVR 4F2SA 2DGWA 2GELA 3AVLA 3NCIA 3IM8A 4N7TA 3V4IB 1BA1A 4DR5F 1RT3B 4KYZA 2KLAA 1SL0A 4URGA 2EFGA 1NSAA 1NGBA 2WC9A 2ASLA 2RKIB 4DZDA 2JNJA 4DR3K 1GTEA 4BE2A 1XNQK 3CCUN 4FZYA 4OL8A 4Y34A 4OX7A 3QEWA 3R2CJ 3FNNA 5D15A 2FVQA 5AQFA 4WE1B 2GHPA 2CH6A 2FHKA 2YQ0A 3IRXA 2GVZA 2FJDB 3DLKB 4RW6A 2KKZA 4R79A 1S5JA 1NLKL 1UPPA 5T7BA 2AD9A 2W01A 1FX4A 4BROA 2HIYA 1LK7A 4P2MA 3VEYA 3M8SA 2A2CA 1YBUA 1FF2A 4KPYA 4X62J 5K8NA 2XO7A 4F50A 1S0NA 2Q6CA 3TTCA 4DTXA 1T02A 1XR5A 4WTYA 4DR2F 3OHRA 1HRHA 5FPMA 3IKMA 2P9KB 5JS2A 3KHRA 3G71N 3D2WA 1RT5A 3U1NA 2GHVC 1S57A 2FPHX 1S72N 3NBPB 1U6ZA 3HCXA 2VQEF 4JKCA 3R7NB 1WUUA 4MH8A 3HVTA 1HJRA 2HQ3A 4PG7A 4FYWB 1ZA2B 3OTCA 4O3RA 3I33A 4HKQA 4IDKA 3HPOA 2YWFA 4W92B 2PI5A 3G6XA 5D78A 4WCEL 1RBAA 4Z7YA 1XQIA 4RW4B 4WFZA 3KJVB 1QLNA 3DYAA 3AY9A 4K5RA 4NE9C 1SJQA 3D6TB 5AFUH 1N5QA 2VASA 2P5OA 2Z8QA 3V6DB 2DNMA 4ZJOA 2DTJA 5ADXH 1HARA 2DY9A 5DQGA 2NYIA 2YHYA 1W25A 1HNVB 2J0XA 3QWUA 3DOMA 3R8EA 2GBZA 2Z4PA 1QVFM 3NCQA 1RT6A 1FKPA 4DS4A 1O51A 2XCAA 3OFGA 2R8HA 4KH1B 5EHHA 5HJYA 4NO7A 5BRHA 1C2PA 4QU6A 2HVHA 4LF9K 1HBNA 1U1QA 1RE1B 2V51B 2AKWB 4G3IA 2VIHA 2I9SA 4IWVA 3O80A 5CE3A 1BL3A 4FPRA 2WSFC 2XM3A 3GIIA 4DR5K 3QNNA 1EETB 5B0FA 4JI0F 1KQSR 2D3O1 2OLWA 4TU8A 4WQ5A 1VQ5N 4F2RA 1K0TA 2OPRB 3OYNA 1XERA 5LL6Z 4Y0WA 2FVPA 1IV0A 3Q8QB 4LF6J 3H4BA 2MQQA 3IO1A 1I94J 4ZVUB 1B64A 3FUYA 1DTQA 4P71A 4FJHA 1IQZA 3IR7B 3SIPB 4A5BA 2BDPA 1RWKB 3WIVA 5TKYA 3Q8YA 3GG0A 3DKDA 4NYZA 1RDBA 1YAGA 3R7SB 3FE1A 1R89A 3MMAB 4FWSA 3IDHA 2XMUA 5KFOA 3OYEA 2DGXA 3BKUA 1ZZNA 3OYHA 2YKQA 4ECWA 4QOZB 1KVAA 3AB2B 1VQPS 1G7CB 5DJBA 5BR9A 4DCOB 5KPZA 1MU2B 4O4RA 4DSFA 2RDDA 5LJ5Y 2DHXA 2ZKTA 4DR2K 1IO2A 1ZAVA 1M90O 4XH4A 1ILYA 1KDNA 5LJ3Y 1Q78A 3TPQA 1YKWA 5D4OA 1ZBIA 1CJTB 3OSPA 3HHKA 4M8LA 3AAQA 3RG6A 2D5RA 5KFTA 1VC6A 2VQEK 5KFUA 1N48A 1TK5A 3N4PA 1PIEA 4I7FB 1NNDA 3CJKB 5F9LA 4NLRA 2EXUA 4FK0A 4BC9A 5LMNJ 2MLXA 3DLRA 3O8WA 2HIQA 2YV0X 4HWIA 4YQWA 2VG5B 2VG6B 2V4JA 3TSQA 1F2HA 1U1PA 3EPGA 1KR4A 2CJYB 1IM4A 2W6LA 3QBXA 5ETMA 1QAXA 1P27B 4OI2A 3SYZA 1GH8A 1ZPVA 2M52A 2GJ2A 1H98A 3I87A 4F04B 1UFWA 4UUXA 4FJKA 1BQMA 3F41A 3VQQA 3SQ2A 2DFEA 3NMRA 4JRQA 3EEQA 3B6OA 1U1NA 4WFXA 2HHTA 3MEGA 2DO0A 2GC8A 5AQGA 3F2KA 3BREA 3A5OC 3ATUA 2ZH7A 3VQPA 3VQDA 1QVGM 1FJGF 2CIMA 3X1LB 2Q1NA 1T03B 3P6YC 2UVVA 5CR4A 5KFBA 2QL9B 5KQDA 4IG0B 5KG7A 2CPFA 3EE3A 1W97L 4JI0K 3AOAA 2YNIB 5IS2A 4P10A 1NPKA 2WVDA 4CI6A 3KJFB 1REGX 2E7VA 1ZETA 3VESA 3KFWX 4BREA 3PHEA 1QQMA 1HNZJ 3MEDB 4OZLA 2W7AA 4E7LA 3O9SA 4AHSA 1N5TA 1J5EF 4GKJJ 2DXDA 2C2EA 1NU4A 4PWDB 4CBUA 4JI8F 5ETSA 3NNCA 4NZ7A 1N34F 2P9UB 2R7TA 1VHFA 3W9HA 1GMUA 1E6YB 3NMAA 1MWYA 2ALYB 3O1BA 1UMJA 1DBDA 3THXA 2RAQA 4FBUA 3LWMA 5LMUF 2R7QA 2G8IA 4PEOA 4ZLPA 3MM5B 5DLGA 1R31A 2JRSA 5E26A 3TTFA 1B70B 2HURA 2YKNA 2XSFA 1FRXA 2DR9A 3PKYA 3JXOA 3CT9A 2X51A 3RYLA 2XO6A 3IWLA 3G10A 3TVZA 2OPSA 3M32B 4E7HA 1ATSA 1S0OA 1VISA 3CB4A 1QQNA 4QYZJ 3OFEA 4CZJA 2R7SA 2ZBIA 3W60A 5D77A 3QJPA 2DR6A 5FIIA 2P5VA 1NGJA 2M8DB 2XMAA 1TVRA 3EYZA 3D6HB 1BISA 1U6BA 4RU9A 3EXCX 4CTAA 3PJXA 1W7WA 1RAGB 2BH1A 2NXJA 3HXMA 2R2UA 2ASYA 2R7WA 3EGWB 2KJVA 1E4GT 4I2QB 3TWHA 2AZ3A 3SCJE 4CBXA 1UEUA 2BE2B 2GWKA 3KLFB 2I5JB 3GTYX 4Z4GA 4IO8A 2ZC4A 4WZQA 3D28A 4B1XB 2I7NA 1UVMA 4EZ9A 1SBRA 3BPDA 4YDDB 4DF4A 1YTUA 2DO4A 4DL4A 3NAIA 2JLEA 1JNZB 1N6QA 4ED7A 2KI2A 4BG9A 1J5OB 1FJGK 4IOBA 4DUZF 3HP9A 4PWWA 5KG2A 1YIJN 3KLGA 5FRMA 3SAFA 1PBAA 1X5SA 2XMVA 5D0HA 3OXGA 3NCRA 2E7WA 2UUBF 4YNQA 3PCOB 3QAEA 4FWMA 4HVJA 2QA4S 2A1SA 1BWVA 3VZIA 4OI0A 3NH2A 3WXLA 4R5PB 3AVGA 1Q0NA 2QLBB 3UIQA 1J5EK 2F8EX 4OPJA 3FSXA 1Q86T 3R6MA 2JVRA 2D4WA 4FJ7A 1K73T 2YXLA 4HT5A 4PXDA 1NK5A 1N34K 2JC0A 1VSMA 4DHVA 2HAIA 3GR0A 3UDVA 1CQMA 3TRGA 2AHOB 1CLFA 3C15A 5LMUK 2VPZB 3W3SA 2VJVA 4DV1F 3NOGA 5CD4A 2L48A 4ID5A 2PAVA 4NMLA 4M5DB 4O0JA 1HYSA 1HLWA 1RAJA 2C2OB 4U6PA 4N41A 5LY3A 1KC8T 5KT3A 1IBLF 1O8BA 1JXVA 3MM7A 3RW6A 4C23A 2YKMB 3TAPA 4BR9A 2J0WA 2APOA 1CEZA 1NAQA 1WHYA 3A5MC 3T5HA 3THWA 4B9VA 3B8HA 3B4MA 4UOGA 3QFPA 1MROA 3SBGA 4ZVGA 4HR2A 1XMBA 3I4PA 2HNYA 4J2EA 3C14B 3PR4A 1YTYA 5GINA 3BR8A 4MIWA 3H59A 5AQJA 2YBVA 2BZ2A 4U7UK 3MOZA 2GW8A 3RB0A 1FESA 2K8GA 4OJ3A 3KDNA 1X31C 3L2VA 2V9WA 4LT6A 4K2JA 3M9OB 2ZUGA 1RJJA 2IBKA 4YOEA 5D8HB 5K8OA 4L75A 1D0EA 2YJFA 2J4RA 1KS2A 3SCIE 4WF9Q 4RG8A 2OUGA 5AJ3J 4ERDA 1Q4RA 2LA6A 4C3KA 5DQIA 1JJ4A 2KO1A 3A8IA 4HUFA 3O5TB 3MMBB 3T5JA 3VHQA 2KHOA 3O9RA 3PYGA 2C2MB 4B1VA 1RTHA 1QUVA 1TR0A 5HRRA 2V7YA 1VIOA 4IFVB 1JLFA 5FROA 4PABA 4N47A 2EPIA 3KKRA 4L3QA 1URRA 4FLTA 4I69A 2NRZA 2CQDA 3OA9A 2I2YA 3IS9A 3DI6A 3CJ1A 2HQGA 2F5GA 2RU3A 4DUZK 2B5JA 1DARA 3E51A 1RK8A 1RDUA 4J9RA 2VL1A 4MT1A 3MX2A 4M3RA 4W98A 4F26A 2UUBK 5E3RA 2W2PP 1VOMA 1X3MA 4KREA 4A8YA 2KXNB 3AOBA 3PLAA 2D0CA 4DPXA 2FIUA 4JI4F 1WTFA 4C11B 1RAAB 2DISA 1HPZB 1YJ9S 1WHWA 4OI6A 3UKRA 3HVRA 1FKOA 4WFBL 3QEIA 1OQ6A 3O9UA 2ZDPA 1CJVA 3UDEA 4B1YB 4L73A 2N7CA 1RTJA 2V8DA 4TKTA 3OL7A 1N8RT 3WNHA 2ITMA 2M0GB 3SV4A 2GAGC 5DG9A 2DHSA 4TYAA 4ZVRB 4ILLA 3JSMA 3HF5A 1SS6A 4MTPA 3KLEA 2J9EA 4DV1K 4ID1A 1VQ7N 5I3PA 4U96A 2J8SA 1FRKA 5HJXA 3MMCB 4OGEA 5KG4A 4XO0A 2RRAA 1IBLK 2V5HG 2XY5A 3O8MA 1CBKA 1K8AT 3OLAA 1BA0A 1WG5A 1BDGA 1JLQB 3P1GA 2Z2MA 3SFUA 1WSRA 2P8IA 4MAKA 5E3CA 4WKRA 3JXUA 1DQAA 1HWLA 3J81Y 3CD6S 4BDYA 1VSEA 2FBYA 2LQ9A 3NF6A 4ES1A 3ASMA 3R5DA 3KD1E 1GOBA 5JVGL 3KLIB 4J7CA 2GX8A 3W7BA 3LPTA 2VOPA 3RB3A 2X1FA 4ECXA 2HMIA 4NX9A 4EMDA 2LQBA 1RP5A 3CCVS 1VBYA 2AV5A 2O1PA 3AA9A 4WYWA 2DHAA 5E3AA 2PZSA 5KT4A 1KVBA 1MN7A 2ZGYA 4P2FA 4L6V3 2WK4A 3BQ0A 3LP1B 3WC0A 1V3ZA 4Q0BA 2Q3SA 2FBXA 3LW5C 4IBNA 1C0GA 1X8DA 3CMEN 1XMOF 3CCMN 3G6VA 5C5JA 2PYLA 2QLJB 2PDAA 4CJ7A 5AQPA 2MHNA 3L2WA 4C6AA 4GMKA 1A0OB 4CLKA 2AGPA 1OIAA 1NEEA 3A3OB 4NI2B 2YCHA 1K1SA 3VEXA 5HRPA 4DXLA 2W9CA 3JTOA 3OYCA 1VK8A 3PRBA 1CXUA 4XH5A 3VENA 2UXCF 2WB4A 1SH0A 4F36A 1VS3A 3BH6B 4A8XA 4EIAA 2E5GA 3CDBA 3VA3A 3MR3A 3U1MA 2MZTA 4ICLA 4OI3A 3GJSB 4N77A 3A5LC 4JI4K 2HKEA 1GMVA 3QGGA 1BI4A 4DX7A 2GVZB 4RW6B 3BB5A 2MGZB 4XAKA 2Z2YB 2L08A 1U2VA 4KHQA 2RRNA 4PWUA 3EUNA 2EWSA 1GLDG 5E3QA 2XMJA 3TU5A 3VEVA 1KQSM 3P38A 3VGSA 1NGFA 4B1UB 4K8XA 4CEZA 3AVMA 4O3NA 2VB6A 3HBTA 2EHGA 2PA8D 1TKXA 2UUCJ 3G86A 2MPUA 4DFKA 1KFDA 2IJNA 1PJ5A 1YITN 3QNOA 3L4BC 3D2EB 4CQ1A 4C8OA 4O3SA 2BKOA 5JICA 4ZLJA 1RT5B 3J7Z5 1RKIA 3BBFA 1SQGA 1BWFO 1MG7A 1KLNA 3O2IA 3CMAN 2LVWA 5KG3A 3FGVA 3HVTB 3UDCA 4FBTA 1GEHA 4RNMA 1KFSA 3AVAA 5DDRC 3HD1A 2C3OA 4IDKB 3E1YA 4B9NA 1OPIA 5CXTA 4EK2A 1YRUA 3DYAB 3AVIA 4Q2MA 2KVQE 3OHAA 3SSRA 1XC3A 2VV5A 4YR2A 4GNIA 3J8AA 3NLCA 2JSXA 2AJQA 5AZJA 5EVZA 1UVIA 2FLOA 4PCQA 3K59A 3ZFVA 1RT6B 5CZVA 3NGZA 2YX1A 2ZJQQ 4AL5A 1G15A 5IWAJ 2ZNZA 2FB0A 2QLXA 4ZLNA 3Q23A 3DM2B 2M70A 1WC0A 1XMOK 4C1NI 1RWPB 1T7PA 1HBNB 4CH0S 4DR3J 4FJMA 4JKEA 2WSCC 4OPHA 3VGTA 3GWCA 1XNQJ 5B0CA 3KG4A 3MGJA 3HD2A 1S6OA 3H3NO 3NNAA 1NK7A 5AQZA 2HQFA 4E98A 3OHBA 3H40A 3VMFB 4B9SA 4GVBA 4WIIA 3O6WA 4WZMA 3G6YA 4FJLA 2EFQA 3C6TA 2K3IA 4IH7A 1XIQA 3LM9A 1TKDA 3NFAA 5D3GB 4J9KA 3G8TA 3U1LA 2YVSA 2UXCK 5KFLA 3RRHA 2OP5A 4JNEA 3DLLQ 4IKAA 1QSLA 1SUQA 2RPIA 4NLXA 1HIYA 1X4GA 5IZHA 1DTQB 3I9V9 1I5OB 2P9SA 4WFAL 4L72B 4ZVTB 4CHOA 1EKSA 4ZIVA 3KVGA 3B54A 2G8FA 1LW2A 2GIRA 4PL8A 3VQ4A 2AP1A 1VHXA 1HD0A 4OYXA 2CQIA 2RJZA 5E0OA 3PM9A 2P5GA 3E01B 2A6AA 1SIZA 4AXJA 3H45C 4B3OA 3HP6A 4LMZA 1WOSA 4OZ2A 4CLZA 2IDOA 2ZOGA 2AYBA 3R97A 1RABB 2HFVA 1FD2A 1CULA 1S22A 1SAZA 1ZBHA 2CJAA 4N8NA 3CCTA 4BRGA 1YTAA 2ZJRQ 2O3DA 1NJWA 4H8KA 1DY3A 3LDNA 4LC9B 3TQ1A 2MZQA 3VVUA 1WSHA 4DWIA 3ZTRA 4LRFA 1VQPN 3MPUB 3CJ4A 2D0AA 4UUWA 2ZHBA 3SI8A 4ZCLA 2D9OA 4BACA 2ZH6A 3OYMA 4LF8F 3CVKA 3AVKA 2ZOFA 3QGPA 2V4JB 1LAVA 4LF9J 1WN7A 2VKRA 3CJCA 3K57A 5C42A 3VERA 3E3XA 3M5RA 4ZMMA 1XK8A 4XPEA 2EW9A 1YI2N 4U9RA 2MKJA 1VK3A 4F67A 3K7RA 4DR5J 2JZ5A 1KQFB 2NRTA 4K42A 2W4DA 3W63A 1T9UA 2DR5A 3M2UB 4M3UA 4HTJA 1RTDA 2QMWA 2V2KA 4DUYF 3MEGB 4YP3A 4LR8A 1TL5A 4QQBA 4BQZA 5KFMA 4KBOA 4QPTA 4USMA 4XPCA 4S0MA 4HUGA 3CIMA 1YGYA 4C9DA 3BO4A 2MTLA 3LUYA 3ZZZA 2XI3A 4BG8A 1WUAA 4USKA 5L9XA 2FGCA 4M42A 1IR1A 4RX6A 2K7KA 3CGIA 2CPJA 4LFCF 4ZTJA 4FVCA 2HB5A 2G8VA 3U8XA 1LQ9A 4ED5A 1WKJA 3LP3A 5CZ2A 3ITHA 3IG1A 3IC1A 5I42A 3THXB 2YKPA 4CGDA 4DR2J 3GDQA 1WJ9A 1IKXA 4NLOA 2M4MA 2QFIA 5FJ4A 2VZ9A 1ZC6A 2DPJA 1OSDA 2IVFB 4DF8A 4CHPA 2J7UA 2YKNB 2VQEJ 3MAAA 3M6GA 2XYGB 2X1AA 3ZSYA 2LEPA 3LF0A 1TL7B 2V2ZA 3NGUA 3M9NB 4X2BA 3OQ2A 4Y2MA 2QEXS 2IHR1 2OPSB 4MFBA 2LU1A 2E9TA 1VQNS 4FK2A 2BGGA 2N82B 3O4NA 4BRIA 5A8KB 1KAZA 2OGUA 5GAHU 2IAJB 2E5LF 1TVRB 4FXDA 3CW2C 1OY9A 1FNOA 1VHIA 4LIRA 2JDJA 4CZCA 2FHMA 2XZWA 2ROEA 4M95A 3H2VE 4CTAB 3K8WA 4WYBA 4NLSA 2KQ2A 1CQNA 3KJNB 3D45A 4DSKA 3J81O 2C3UA 1VK0A 2HBZB 1H2VZ 3K5NA 3QZ7A 4LF8K 2OO4A 3TEGA 1S1WB 1G4CA 1B9DA 2POKA 5HOOA 3DXMB 4I6AA 2DEIA 3Q8VA 2BUNA 1XHZA 2W9BB 4OJRA 3GV7B 1X0FA 4BBYA 3EZWA 3AA5X 3V9SA 5C15A 3MUTP 4NWBA 3P8BB 3EY1A 4FL9A 4JI0J 1TYQA 4FW1A 2KG1A 4FVUA 2CKWA 2Q1LA 3OFFA 4DUYK 2ZJPL 4ZN1A 4DN9A 4KR0B 1SJFA 1VSKA 5L38A 1S3XA 1N6QB 1VSFA 4DV3F 1BMQB 1U1LA 2WOMA 3KZBA 4O5FA 3CCLN 3CM6A 4LSZB 2RHSB 4AE5A 3I8DA 3BPSP 4W4MA 2VFTA 3C16A 2IYIA 2IGIA 3PFOA 4PHTX 4CVNE 3BDPA 3EX7B 1ITPA 5L39A 3TSUA 4PA1A 1KOHA 2NQPA 4M1KA 4JI1F 1V6HA 4JLHA 4NCAA 4LFCK 3ZZUA 3O1LA 2MJNA 3OBIA 2B8QA 2E29A 5KG0A 4NYPA 2IVMA 3CNQP 5FD1A 1SKUB 3EM1A 1Y5LB 5EY4A 2VA3A 3M4XA 4H4OA 4OYZA 1RBRA 5F41A 2HLUA 4TN2A 4X66F 4BE1A 5JVHL 5CHIA 4IOCL 2QA4N 3VGMA 4ETZA 3C15B 3JSBA 2A40A 2VOOA 3O4QA 2R2SA 3CTRA 3ZETA 2L9WA 4CFBA 3DLHA 5B0AA 4HCCA 4EBCA 3H5SA 3MCOA 3MM7B 1UEVA 2UUAF 4FNHA 3CJ5A 4F02A 4ECVA 3RBZA 1FTCA 3SDEB 4EGLA 1AYEA 2MQNA 2D7SA 3THWB 2KT3A 2IY5B 4TYBA 3CO0P 5BRDA 1SPBP 2FHJD 2E5LK 2O8EA 1Z2LA 2HNYB 2IIRA 3DLJA 4R0JA 3RR7A 1QHAA 4A62A 2WVEA 2ZWPA 3I32A 2NUBA 3SUOA 2V52B 3GG4A 3RMAA 2UP1A 4I6MA 3A3NB 2CQBA 5ITHA 2YWEA 4NL5A 3CC2S 3AGRA 3KIOA 2VBWA 1I3AA 1LOTB 2ZFHA 4LVNP 3GLJA 5EWGA 3UD4P 4LIWA 4OZ0A 2V9KA 4Y1CA 1FJGJ 3OYKA 2BM0A 3HI0A 4URSA 1RTHB 1SC3B 3DDNA 3PV8A 3H25A 1BUPA 4GVMA 4HUEA 1JLFB 4H5WA 1FKAF 4CZMA 1L3VA 1HUXA 4YR0A 1R0AA 5AFUA 4CF9A 2RRBA 1U45A 5KFRA 1NLVA 4J9OA 5ADXA 4FZZA 1X9JA 1XC9A 2HGMA 4J9LA 3DGPA 3EKSA 4DV3K 2I6WA 2LFVA 2OD4A 2FD2A 1J5EJ 4XIUA 3V6KA 2QKBA 4HDHA 2OEMA 1H2TZ 3I0SA 5KRTA 3MCMA 1N34J 3D1HA 1JK9B 1RT7A 1UZHA 3EE8A 1C0UA 4KO0B 2JEIA 2HHQA 1QHTA 1U26A 3A8KA 4FYVB 4JI1K 3FSIA 3QWPA 4CFDA 1WEZA 5LMUJ 1UPMB 1C6VA 4YDUC 3RAMA 2CNKB 3VALA 1G99A 2NUHA 3GE9A 3UKRB 4KJIA 1FKOB 3ZT2A 2YWGA 2CXEA 3W61A 4IFYB 5EX0A 4M41A 4OFZA 1RTJB 1WSGA 3RSEA 5EDWA 4CGHA 4X66K 4P6QA 4OZJA 1X4EA 2DYAA 4YDXA 3GOIA 2HW3A 1HBOA 3FRYA 2XC9A 1KD1O 3BR9A 2WSEC 1J6ZA 1YJ9N 4LRBA 2HVDA 5ETQA 2B6AB 2A41A 1UWBA 3IMQJ 3AVNA 3C6HA 4AL6A 4BWJA 1EX8A 3QFUA 1VSDA 2UUAK 1NCLA 3CF5Q 2HMPA 3C7NA 2DGVA 3BGRB 5K9FA 2MJUA 4WQ4C 2XNRA 2M2BA 3HFVA 2W2QP 3MFHA 3NWGA 3VQTA 2OPQB 3UCGA 2XS7A 3H08A 2NR0A 3RU0A 5KGWA 4KH6A 1YVUA 4BRAA 5ETOA 1RYRA 4RO0A 2G8KA 4CF1A 4CBWA 1KNZA 1IKWA 3O4WA 2OZMA 1BWEA 1KTQA 3AARA 3FZ2A 3CD6N 2N7YA 4B9QA 2HQDA 4QZVB 4EZ6A 2ASPA 2A3ZA 3LA0A 2M7SA 4Q0BB 2CPHA 4CF2A 5HQMA 4DUZJ 1N0UA 2DNYA 3VGUA 1EB0A 4CRJA 1X4DA 2VBYA 3CCVN 1OPZA 3J7YU 1SQKA 4JKGA 1ASVA 3G9CA 3HYFA 4DX5A 4O4GA 2UUBJ 3QT5A 5GIPA 2O8CB 1TU0B 4LFBF 3BKTA 2HS3A 5EXWA 1Y3JA 2Q97A 4CT9A 3AOCA 3UCUP 2W9CB 2KN4A 2W2OP 3OTDA 4UOCA 3FZKA 1W26A 2YHWA 5K8PA 2R2RA 4DOZA 2MKSA 2CPXA 1SXLA 1Y5NB 2MDAA 1IBMF 2FVRA 3BS9A 5IT9Y 4E8UA 4ZN3A 5BXIA 1TL3A 3CJ0A 5B0GA 2BQRA 1K9MO 3B6BA 2JOQA 4ICLB 2OSRA 5A76A 1FRHA 4OJHA 3AO2A 4RUCA 4DV1J 1EX4A 1RDRA 3TAMA 1BI4B 1WC1A 3OBYA 5BPMA 3RB6A 2E9ZA 4Z94A 3R5CA 1IBLJ 2BJ1A 3LPUA 3CPEA 1JJ2R 4QIFA 4WIQA 2F4FA 2NZCA 4KHPF 3QRRA 1RWUA 2MHEA 3JQJA 1EKRA 4CT8A 2CQGA 4OMFG 2VICA 3V1RA 1NNEA 2P9IA 3MM8A 4LSNB 4RW7A 2B9WA 4KC5A 2YNGA 2KT5A 4TXSA 4J9PA 2IJRA 2WZ1A 2R8IA 3AODA 3AO1A 5KFXA 3PG9A 5FPNA 3K5MA 4DV4F 3Q8SB 3H5XA 1ZA1B 3FEXB 1R8HA 1A5WA 3CD7A 1NDKA 1M5OC 2FJAB 4FWRA 4X4QA 2WCXA 2GV9A 4V19S 2CJBA 4FJIA 5J2MA 1HNZF 4CI0B 1QTMA 2RN2A 2F65A 2H5JB 1P6TA 2DGUA 4NCGB 2KM8B 1KVJA 5HLFA 3TA2A 1VQ4S 4USJC 2ATCB 4J9MA 2R42A 2UU9F 1T11A 4PG6A 3VQ5A 1IJEB 1CJKA 3HULA 3R5JB 4CK2A 3V9WA 4M45A 2HZCA 2A0FB 1KWMA 1KHVA 3EJMA 3IWXA 1IR0A 4FJGA 1WAJA 2NRHA 4I9LA 3OL6A 3D0HE 2N4CA 5M1FA 4GO5X 2RU9A 3H5UA 1UW9A 5A8RA 3VVTA 2OD6A 3POTA 5HROA 1VR6A 4K0KF 2GAHC 1C0MA 2E20A 3S7RA 2R8KA 1TFYA 2WB1D 4KGVB 3MAQA 1C0TB 1BIUA 4M5LA 2XTJP 1Y10A 4I0WA 1WD6A 4BRFA 1MWQA 3FZHA 2V4QA 1X5PA 2E5IA 3J80Y 2AT1B 2R8JA 1YQHA 4LFBK 1X4FA 3NH1A 2WTFA 3OJUA 3Q22A 3LM2A 4GVBB 4JI4J 1J54A 3C6TB 1L3KA 2CGLA 1HJOA 1IXKA 5D4LA 4DZ6A 1ZM4A 2AU0A 1IBMK 3J7ZT 4DL0C 3RMCA 1SUQB 2VPYB 4NLDA 2ZGZA 1P9QC 4O0NA 3CXCR 1GQEA 1H72C 2FLPA 4MK8A 4B8AB 2P9SB 2M88A 2E1ZA 2V4RA 2BM1A 4J9VA 2JGUA 4HH1A 1KRPA 5HRNA 1LW2B 1RWOB 2OTJS 5BYRA 4KQZA 3H4DA 4CF0A 1T05A 4WWSA 2DJWA 1I6JA 3GMGA 2IA0A 3V6HA 3UNGC 4KHPK 1S1VB 2ATQA 1Q79A 5A0YA 2MB0B 4B3OB 4J90A 1D1UA 2W41A 2CADA 3R3LA 3MN7A 4W5QA 1SH3A 3T69A 3DRYA 4YN3B 1MN9A 3H2UB 1H3DA 4DV4K 3QICA 3CETA 2EBEA 2CPYA 3AVJA 2DHGA 3EPIA 3L0QA 2O4IA 4RPFA 4X4SA 1S1XA 3P83D 3D6MB 2CPEA 1VCTA 3WDOA 4CJ4A 2V0NA 1EQ0A 3H46O 2WAQD 1U0HA 2FY1A 2DH8A 5AT1B 5CHCB 4CH7A 3LAKA 4F4ZA 5E3PA 1H73A 2QA1A 2UU9K 4QIEA 5DLFA 2CZVC 1XMOJ 4QYRA 1H1VA 1RWWB 1VJQA 4I68A 5C42B 3BM7A 3G6ES 3U3YA 3V81A 3KK2A 4C8YA 3AVHA 3DN9A 3IAYA 3BDEA 2CNLB 2D74B 4QR2A 2VPWB 2X1GA 2D69A 3RAQA 4K59A 1XMQF 4RW8A 1NGIA 4FZXC 2DB1A 4OZ5A 4E7IA 4K0KK 3S01A 2XY7A 4OQJA 4CHZA 4KRWA 3M7VA 1Q7YO 3NE6A 4C3MA 1RTDB 4GV9A 5K14A 1VSJA 1VQ9S 2UXCJ 2CG8A 3CCRS 5KAKA 2K3KA 4ES2A 1AROP 3PACA 3FSYA 3L3CA 5DM6Q 2Z58B 3JS6A 3KK1A 4TU7A 2ZM6F 2HK3A 2HHXA 4OZ3A 3D67A 2WUSA 4E1JA 2QI2A 5F1XA 3VQ8A 3HHEA 4BGBA 4CIGA 3H98A 2CG4A 1HX1A 1Q5VA 3TUJC 2VONA 3UQSA 4ENOA 4DV5F 1VRTA 4H0OA 2DH7A 4FWLA 3VEZA 4ZVPB 2UZAA 1YJVA 2G9OA 5AJ3F 1UA1A 4WK1A 1VSLA 4O3QA 4B3RF 5DK5A 5GAEP 4IDHA 1UJ5A 1ROFA 4CO2A 1WC4A 2YNFB 4RNOA 3ITHB 3IG1B 1VAZA 5I42B 2NXNA 1HNXF 1RDCA 1TUVA 5KPRA 3NVMA 1HI0P 4I67A 1IKXB 4C8MA 3OLBA 3CPWR 2FJEB 1GAOA 2B4OA 3GJTB 2WW4A 3L2UA 3KOAA 2Q0RA 2LXIA 3MAAB 1CJUB 4H0YB 1RBUA 1RKJA 2GMLA 4NCBA 3MR5A 1WKKA 1NKBA 1NGGA 5J1PA 4MFBB 3VZHA 5F8NA 3R6GB 1F5CA 1VBKA 1J9AA 5C2DA 2W42A 2O66A 3MUVP 3T5KA 3TZXA 4BRLA 4M3YA 3GIJA 2KB2A 2X3DA 4ILHA 3V1OA 2FVCA 1FXRA 4BVOA 4PRFA 2JWNA 2NSCA 3W2WA 3IMXA 1QSSA 4C4WA 2AEFA 4LFAF 4WF9L 5J2NA 2B4VA 3TUIC 2IM1A 4NRUA 3M05A 2QWRA 4DG1A 1U2RA 3C0BA 3TQEA 1LFWA 5KFDA 2KKHA 2P51A 1VQNN 2Z1JA 4FPIA 5BJRA 4FLZA 4U67L 2B56A 4F4WA 3EVOA 4XH1A 5GAEI 2K1RA 1WB9A 2IIHA 4JI3F 4HEA9 2HHSA 4ZTFA 1S4FA 2ZBCA 4KHUA 3IUCA 3Q8PB 2JLFA 1UA0A 1UL3A 3L4IA 5B09A 3EGZA 4FXVA 2W6KA 1YXQA 1XI1A 2VDHA 5KPTA 5D0EA 5K20B 1XMQK 3SBMA 3N79A 3QSYB 1TYQB 3N6LA 1SKSA 3VQ7A 4X84A 3EZ5A 1YVFA 3DDKA 3FFKB 2HNZA 2PFFB 1R8PA 2FXUA 2HGLA 6AT1B 1RAHB 1RLCL 3GQCA 2WOMB 3W9JA 5J1EA 1WEYA 1RT2A 3C6UB 1S1TA 4HTIA 3W66A 1HI1A 4WCEQ 2DXFA 2ZM6K 1VIXA 3C16B 5F8IA 2DHHA 2CZ4A 3I56N 1N54B 2MSSA 2VBZA 2J9DE 3Q2SC 2UXDF 1S7HA 3TP2A 3W5YA 4MYUA 4DV5K 3W65A 4WU3A 3NKYA 4UF4A 4U8YA 3HL8A 1NSQA 5IT9O 2DPNA 3ZXWA 4B3RK 1RHUB 1FNXH 2G8UA 3EGNA 4H4OB 3M30A 2W40A 4NLCA 3DRRA 1JCEA 5HMZA 4KGKA 1S6PA 1HNXK 3PYEA 3B8AX 1HWUA 3CJ7A 3BZCA 2FVSA 2C3MA 3ZETB 3KG1A 3HSDA 4NLWA 3UN5A 1VQLN 4RUAA 4R8UA 4O0IA 3ET6A 4PYAA 3JSRA 3NF9A 1UOCA 4Y3CA 1PJ7A 5AQUA 3HT3A 4IFEA 2D0BA 2XHCA 3H90A 4MIAA 2P9NA 3A5NC 4LF8J 1V3RA 1LNQA 1CZ9A 3QEPA 2QE5A 5T7LB 2G8HA 5LJWA 1FERA 2O8EB 2XZDB 4IRDA 1EWRA 3I4HX 5HMXA 2OA8A 5BPLA 3N28A 4ECQA 4BRHA 1VBXA 1ZH5A 2JH3A 4LFAK 2E1CA 3HHLC 4I6MB 2YWKA 1C4CA 4H0XB 2NPFA 1X0PA 3CSKA 1QSYA 3EZUA 1NDCA 1MMNA 5K5MA 4D3HA 2FZCB 1TV6A 5F9NA 2NNWA 2KXFA 4A48A 4JHDB 1U25A 4YFUA 4DUYJ 2HHVA 2H3EB 3FLCO 5JS1A 3I6PA 5DMRA 3UD5A 4JI3K 2HNDB 3VWSA 1RBOB 3WUHA 3VEWA 1HHQA 3D68A 4LH4A 1RT1B 2WVBA 2IRXA 2KDOA 1R0AB 3B4DA 3D66A 1RWVB 3CC2N 2B4PA 4ZPDA 5AQIA 1YJNS 2QFJA 3ILLA 1YUWA 3GJRB 4GY2B 3A8YA 4F0HA 5AXLA 2C22A 4LFCJ 1X3NA 2VPXB 1BXNA 2EBGA 2YJEA 2Q31A 3SFGA 3LDLA 1K44A 3LGHA 4BDPA 3SI6A 3G96A 4ETXA 2XHWA 1F2GA 3HI9A 1HKCA 3OV7A 2AJ0A 1JL1A 3I0SB 2ZD1A 5DETA 3TAGA 3AB4B 2R2TA 2EFVA 3J80O 4AM6A 3IM9A 1KVIA 1NHKL 1RT7B 2V2VA 2EI5A 2BR0A 2IDLA 1FWLA 1FRMA 3LDPA 3N5FA 4B17A 3C46A 3P39A 2ZH9A 2UXDK 4BGAA 2XQCA 1VQOS 3FZMA 1H7WA 1RT4A 1RAFB 3G2XA 1LXJA 5E84A 3CJBA 2LQJA 2DNGA 2H65B 1RCXB 2PMWA 2HS0A 4TNOA 3BBBA 3RSEB 5IWAF 4CEBA 5HVGA 1OH7A 1XWLA 2XSJB 4LBPA 2VC0A 5C12A 3A12A 1HBOB 1QD1A 1QY7A 4C0BA 3NMUA 3TJ9A 1VRUA 3KMSA 1BUXA 1F60B 2E5LJ 3AT1B 4NYNA 2BA9A 1JX4A 1UWBB 4ER8A 4UY85 1PAUB 2DGOA 4A8QA 4FM1A 1WG4A 4B8CA 1YDLA 4ED4A 4L3KA 3SQOP 4CJWA 5AQWA 3IP0A 4EHUA 3C7NB 2NXEA 5AQQA 2W1BA 5F8GA 3CD5A 5KFJA 4JYAF 1OH6A 4OPKA 3WC2A 1UJ6A 4CNYA 1BY9A 1O5JA 1KOOA 5A2QY 1Q7LB 3UVJA 4L74A 1RZMA 1TQLA 3GZ7A 3GIRA 2E2PA 2FHOB 1Y3KA 3HHLB 2DD8S 3FBCA 1C4AA 4DFPA 4UT4A 3QPIA 3MM9A 2ZH1A 3AXMA 1UP1A 2OSQA 1LAWA 4FJ5A 4LQ3A 1GXUA 4CJPA 4A5AA 3T5LA 3LP0A 2VG7A 4DV3J 3OTEA 2O8FB 1XNRK 3VA0A 4BRPA 3TNVA 2CVEA 1N5YA 4K25A 5KI6A 4MDAA 1WNSA 4JKGB 2OTLN 2GX9A 1OMSA 5IOLA 4CEEA 3C95A 4OHXA 2C3YA 2X6SA 2B4JA 3M8QB 5AQVA 3U9ZA 4EYHB 4JI1J 4HHTA 1LFPA 4K4UA 3PX4A 1UTAA 2BW7A 2ZWHA 5LL6d 3MN5A 1OY6A 4WU2A 1X1PA 2D9PA 1NGDA 3DXKA 3QFHA 1S99A 4YOTA 1WSEA 4H4KC 3VR1A 3QIPA 4HTUA 1YWXA 4X66J 2CWXA 2QL5B 4QCLA 3QGHA 4KHNA 5FLXY 2ZH2A 1RHKB 2Z57B 4KHSA 5HN0A 2Z0GA 1NMNA 2V8PA 1NOZA 4FKXA 4X4RA 3TAMB 1Z1ZA 5I9EB 3NS5A 1TMJA 3G82B 5L46A 1U49A 5IT9U 3O08A 2OAUA 2ZZTA 2Z1IA 3ZZPA 1C1CA 3N6MA 2UUAJ 5IWAK 3TANA 1P90A 3H1QA 3QEXA 1HYZA 2E8AA 2U1AA 3AA8A 1P8GA 3BGOP 3MM8B 4X4NA 1HKGA 4RW7B 4YB5A 5HK4A 1Q81T 2YNGB 3VAIA 2CVIA 1TAUA 3Q7CA 4G9ZA 3H42A 3N0VA 4BVPA 3S1TA 3K8VA 4ILMA 2B9YA 2QA4G 2E1RA 4NEYA 3CXCM 3LTOA 3GFXA 4LJMA 5CAAA 2QXFA 1IWAA 1PO6A 1HNIA 2D1KA 2IFXA 1WI8A 3CWJA 2MKIA 3O3GA 4JYAK 2HFSA 3S9HA 2BRKA 3ZZRA 1IN0A 5C0YA 4A8OA 4CGIA 5HLFB 1VQ8S 2IVNA 3EICA 4DQIA 2J6UA 3WX8A 1HL6A 4RNHA 1AZSA 3D5MA 4MKYA 4OX9F 2HSTA 5KFPA 1IG8A 4CLPA 3LAMA 2OCEA 1U1RA 2GV1A 3MDQA 1OH5A 1EWQA 1NZAA 3MAHA 2PFUA 4OKEA 4YOXA 5SWMA 5A8RB 1J27A 1HQEA 2A3JA 3POTB 5HROB 5H9FK 4KTQA 1VQ4N 3AVBA 3KLVA 2QWPA 4ANEA 2KRBA 3OT9A 5HRSA 2W4PA 3AJDA 3L8BA 2BJ3A 1L3SA 5CABA 3PX6A 5EX5A 1EP4A 4WBFA 3I9ZA 2F9DA 1TK0A 3A3PB 3PHTA 1KCFA 1F6TA 1Y00A 3CJTA 4K50A 3H7HB 1N32F 2E66A 2J6SA 3AQPA 1HA1A 2O8BA 5GVQA 4IZ9A 3UN3A 3TR5A 2ZDOA 3R5AA 5I3UB 2NRVA 3J80U 3HM9A 4FLWA 4HI2A 3AJ2A 3ENBA 1CS4B 4DFMA 4ZP6A 3OW2M 3RZAA 4M63A 3Q8RB 4OIXA 2UXBF 3QT7A 3VF4A 1CG2A 5HQ8A 3HHLD 5JMVA 4ZPWR 4JI5F 3HM8A 3P5TL 1HBMB 2J9CA 2Z1GA 2RQKA 2LSNA 3D0GE 4BR5A 1RHMB 4QWCA 1ZS6A 1GXLA 2MQPA 2KFYA 1BQNB 1H38A 3I96A 2DR8A 7FD1A 1UVNA 4CEDA 3NVKA 1RT3A 4M5IA 1T05B 3P96A 2OYQA 4CH1A 3A8EA 3CDAA 4B9MA 1K8KA 1TELA 5A0YB 4ISFA 2FSJA 2XMWA 4FWQA 4NYOA 3P5BP 2OIHA 1S9EA 4RR5A 5DM7L 4RBVA 2BE9B 2R7XA 1RAEB 2YNHA 4CM0A 5AQLA 4CHNA 1MMDA 5DG7A 3R5GA 1K9MT 3DLGA 3NXZA 4FP9A 1NBWA 4CLYA 4IJAA 4DEZA 2MZRA 2LA4A 3SAGA 5AE2A 2NPIA 2HF3A 2HEKA 3SMZA 2IM2A 1S1XB 1TUYA 3ZZ0A 3DLKA 1NHUA 4Q8FA 4BDZA 3BQ2A 2MYFA 3MCSA 2IMWP 1YZ6A 3PFEA 3IR6B 3CPWM 4WFNL 5GMEA 1HHTP 5K8MA 1URNA 4B3TF 4PPZA 2Y8WA 3C2PA 3VAFA 3WZ0A 4WFBQ 3ZZOA 4ZITA 2NREA 3OYJA 2FTRA 4E1MA 2ZKUA 4P73A 1VLYA 3BBCA 4OX9K 3ZZTA 1ESVA 1Q18A 3UD3P 3FBBA 4M5KA 4EBDA 2NRRA 5CYJA 1SJRA 4PG5A 1R8CA 1S49A 1A5VA 1YJTA 3V81B 3KK2B 3KK7A 5KOXA 1S1UA 4IOAL 1M5PC 4LFBJ 1A6LA 5JJBA 1LCUA 1M1KT 1REVA 1QS4A 4RW8B 2P9GA 3W3DA 2IM0A 2FDNA 4PG4A 5K14B 3DHXA 2C2RA 3CCZA 4X4OA 2QA2A 1IBMJ 2AYMA 4Y6IA 2I38A 3FCHA 3FCVA 3A0IX 2ACMA 4RW4A 4K2XA 4LREA 1TL4A 1MLAA 3U4LA 1TKZA 3QO9B 3F0NA 4CJKA 4YOYA 3QJLA 2FLNA 1UKUA 3BZQA 4CIOA 3TX8A 1N32K 1FX2A 5JVGQ 3MR6A 4J2BA 1MWMA 4CW7B 2ZVIA 1QQCA 1H0HB 3HHNB 4IO9L 4PKGA 2OH2A 3JAMY 1SC6A 4FN5A 2DNLA 1VQ9N 4FXWA 1T9TA 3QLHA 2I1RA 2ILYA 3PEHA 2XI2A 5FDLA 1VRTB 3MN6A 1S76D 4KHPJ 1RCOB 3G87A 4ECUA 3HFZB 2UXBK 2HG4A 2ZE2B 3Q8UA 4OVLA 1DGKN 4F3OA 4GKKF 3DAWA 2MZSA 4P9SA 5T14A 3MXHP 4JI5K 2FJBB 4CYUA 3MMVA 3W62A 2YH1A 1AT1B 4KTZA 4FNIA 1Q16B 1QDUB 4LRAA 3CJ8A 2MMYA 2E2QA 4DV4J 3KWIA 3MEEB 4YOUA 3W1YC 2XWYA 4C2MA 4ZVFA 2JFKA 4CZIA 1U1KA 4E0DA 5J2PB 2JVOA 2Y1LB 4IYQA 1RUSA 3D3BJ 1RACB 3OSNA 4CEAA 1IBKK 2BJ8A 2OPPB 4DPOA 4DPTA 3OR1A 2UU9J 3HT0A 3SLCA 2J7WA 3KHGA 1ATRA 3MR7A 2Q66A 3PRVA 4K8RA 3QBCA 3V2UC 1OWXA 1BU6O 2XLJA 3P4IA 2G13A 3PIPL 1VSIA 4F3TA 3UWTA 3D7EO 4DR1F 5J2NB 2MKYA 4CLWA 2QLWA 4C8KA 3U02A 3MMAA 1IR2A 4B3TK 2CDRB 3P31A 2VQFF 2KTQA 3K5PA 4K0KJ 4P74A 5A2QO 4NOHA 3PTWA 1FDAA 1NM2A 3ZTOA 3GJQB 1R0CB 1MU2A 3R9LA 2V50A 1KHWA 2ERRA 2K2PA 3IRWP 3CI5A 2AW0A 1NG9A 4ZA1A 4AT1B 3HSGA 1ELOA 2MKKA 3NNHA 1JLEA 4CNZA 3PYDA 3ENVA 1Q82T 2R7OA 4CGFA 1IUJA 4K4YA 4Q43A 1OVYA 1MSWD 5EOYA 5GAGP 3K58A 2BOAA 4LH5A 1AUSL 1DLOA 4F9OA 2L9DA 4O55A 2YPZA 2KFZA 2RS8A 2HNZB 3ID6A 4MQ3A 4DV7F 5DRKA 3GR1A 3AV9A 2KRRA 5J1EB 4BRDA 1FXLA 5LOQA 1X7VA 1RT2B 4C0HA 1S1TB 4E7KA 1FDDA 2DY1A 5L1LA 3AO3A 3GIMA 2NYHA 5HL7L 1FD8A 3BSNA 2O01C 3T1AA 3ZSVA 4DCPB 4AHCA 3OY9A 2DNHA 3D54A 1FO1A 3VOVA 3BEXA 2ADBA 4B3SF 4BRKA 2AJ2A 4W5NA 4GKKK 1Q8LA 2B9EA 3WIUA 2OANA 1Q86O 3M30B 3DRRB 3CHWA 1K73O 2VJUA 4WP9A 5FLXO 1S6PB 1T03A 3M6VA 4BC7A 2H5IB 5MLCV 4KH4A 3D3CJ 4ALZA 1DEJA 4KI6A 1OVQA 3EVMA 4R0EA 1S77D 2F7TA 3UKUB 1TUGB 3T41A 4CK3A 2Q36A 2BEFA 3ET6B 1KC8O 2MQMA 2HVIA 5GAGI 3M6UA 1SVDA 5GMKa 3MPDA 4C0OC 2XG8A 4KKOA 4EP5A 2IDEA 3AVFA 4PWDA 2GJIA 4PXEA 4J37A 2P9NB 3D7SB 5B0EA 2Y8YA 3FMBA 4CLSA 5F8HA 5H1SV 3HPHA 3VF2A 3AD7C 4E7JA 4KHYA 3PRDA 1HBUA 3HMJG 2ZH8A 1VQ6S 3HX9A 2V69A 2BANB 2F9WA 1U7LA 4RBTA 4RNNA 3OVSA 4Z4CA 4DR1K 3MM5A 4USHA 2OELA 4F4AA 3FKBA 2GNKA 1PGZA 2Y3YA 1VQYA 2VQFK 1XMQJ 3OTBA 3W8GA 3PJ9A 1TV6B 4O3PA 2HYIB 1B7YB 4ECSA 3FJ2A 2X7IA 4H5VA 4J9QA 3JTPA 3M32A 1JWWA 3PW0A 4KGMA 4FVMA 3DMJA 3HZGA 5F0WA 4QJVA 3PVXA