5C42A

Crystal structure of hiv-1 reverse transcriptase (k101p) variant in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
547
structure length
544
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Potent Inhibitors Active against HIV Reverse Transcriptase with K101P, a Mutation Conferring Rilpivirine Resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 131
structure length 544
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c42A05
2XHBA 4NLRA 2UVRA 1S9EA 4DTPA 1HMVB 4NLGA 4JRQA 3VQDA 1RDRA 3H98A 3QO9A 4FLXA 4J2EA 1KHWA 1TV6B 3KK1B 2OPQA 4RW4A 1ZBUA 3RMBA 1HQEA 3DLKB 1NJYA 4KHSA 5JXSA 5KG5A 3MECB 3DLEB 3TABA 4NLSA 4NLUA 4CEEA 4KTQA 1JLBA 3NBPA 3DDKA 5KFDA 4FJHA 4M3WA 1HQUA 4TQSA 1RTDA 2DTUA 4PA1A 3NAEA 4FLZA 1S4FA 3K5NA 4PUOB 2I5JB 2IJNA 1BISA 3M8RA 1XR7A 2BANB 4F4ZA 1VSJA 1CXUA 1C1CA 2OPSB 4OPKA 4H54A 4O44B 5CYMA 4FZYA 1W25A 3S9HA 3L2UA 2FBYA 4F2RA 5KFGA 3OYMA 2IC3A 4CEBA 3CFRA 3QIDA 2X74A 3G10A 4FW2A 4N56A 3T5JA 4DSLA 5C5JA 4WFXA 4KV8B 4CJWA 4W5QA 3M8PA 3HXMA 3I8DA 4ECXA 1VRTA 4J9MA 5F8JA 4ZPCA 3V81B 1ZTWA 1K6YA 5FDLA 3BSOA 4M3UA 5JS1A 4AILC 3NHGA 2IS3A 2AU0A 5KFVA 1UWBA 5KFNA 3I0RB 5F8IA 1KVBA 3AVAA 3BGRB 2DPJA 2O4GA 1S9GB 4ECSA 4HKQA 2DPIA 4C8KA 3QNNA 4OKEA 4CHYA 4NYZA 4TQRA 1KVCA 4CEDA 1SL1A 1DTTA 2IA6A 4O0IA 2R2RA 1RILA 4FZXC 3QEIA 3WNEA 3OS0A 4J9KA 4DMNA 3KMSA 4XO0A 4KBIA 4O5BA 4H4OA 3I5CA 1CSJA 3IG1A 3T19A 3AA2A 3VA3A 4AHSA 2J6UA 1LV5A 5K14A 1S0NA 4XPCA 2YHBA 4KHNA 5EDWA 4C8LA 1ZYQA 4WYWA 1T3NA 3TAMA 5KT4A 2JEGA 1HRHA 4DU3A 3L2QA 1VSLA 2KFZA 2JC1A 4QWDA 4ZTFA 1NK0A 2KQ2A 4H8KA 4BE1A 4DTNA 3RAXA 2ZE2A 3UIQA 2XRIA 4RW8A 3ULDA 3TAFA 5T14A 4O55A 1S49A 3T3FA 2HHWA 2FLLA 4QWAA 3IAYA 4R8UB 3I5BA 4NYFA 3HPGA 2AX0A 5C25A 3H4BA 3N6MA 2W9BA 1L3UA 1MU2B 3MR3A 3VQQA 1T05B 4CGGA 4Q45A 2FJVA 4URQU 1JLEB 2RDIA 4AHVA 4DTXA 1S6PB 1KFDA 3DLGB 1DTQB 3HJFA 5KT5A 1TKXB 4EP5A 2QKKA 4Q8EA 2V4RA 4O4GA 1X1PA 2BQ3A 3BR9A 3OLAA 1BQMA 4RNFA 3AV9A 3HVWA 5KI6A 1JXLA 3HVAA 4CF8A 4WXOA 2AGOA 4C8NA 3PO4A 3H5UA 4K4VA 5DQGA 4H4MB 2V9WA 1RTHB 3SI8A 5HROB 3P83D 4NCBA 3HSTB 4FJ9A 3I0SB 4ID5B 1LWCB 4LQ9A 2IJFA 1TK5A 4YNQA 4CESA 4FZZA 3RRHA 3SFGA 4QWEA 1NOYA 4CFBA 3CM5A 1NKCA 4X2BA 5KFAA 3K59A 3S3NA 5KFOA 5L9XA 2HNZA 4GW6A 4EP4A 4Y34A 2YNFA 2UVWA 3KTQA 3CFOA 3NH1A 3M8QB 3CWJA 2JC0A 4FJ5A 3NFAA 3VQAA 5KG3A 1DLOB 1RDAA 1C1BA 2XI3A 1EXQA 1QHTA 2KW4A 2HNYA 2BRKA 3PX6A 2VWJA 5EWGA 4E3SA 3LPTA 1C0TB 2VG7B 2X78A 1S1UB 3ITHA 4DSJA 1S5JA 3DMJA 4WYLA 3C94A 3V6HA 4BWJA 4IH6A 1S6QA 2BE2B 4O4RA 1LWEB 3IRXB 4EYHB 3EY1A 3RBEA 4Y1CA 3G0ZA 3HVTB 4PWDB 4I2PB 4DTJA 1A5XA 4YP3A 4F3TA 1UA0A 3HPOA 4ZVGA 1TKZB 4CJFA 1BGXT 2D3UA 1RT3A 1JLAA 5HP1A 4ECRA 1NHVA 2XGPA 2J6SA 1I3AA 1C6VA 2IAJB 5KT6A 3AVMA 1TKTA 4IFYA 1GOAA 3H40A 1VSKA 3TAGA 1RTIA 5KG1A 4BDPA 1NJXA 3GIIA 3LP2A 3RAQA 1ZETA 3KNAA 4HUGA 5FROA 5HRSA 2Y1IA 4ZP6A 2PY5A 3TWHA 3M9MB 3MEEA 4RZRA 3CJ0A 4DSIA 3IGVA 5I42A 2D7SA 4URSA 4O3RA 1RT2B 4JUZA 4FJGA 5KRSA 1NJZA 2VWKA 4ZP9A 1ZBIA 1HNVA 3OYCA 4B9VA 3AO3A 2ATQA 4F50A 3ZSZA 1HMVA 3D45A 4M3ZA 4IFVB 2WK4A 2C28A 4QCLA 3MAQA 3DYAB 3ALYA 5DG7A 4QAGA 4YFUA 4ECQA 1JLQB 3RRGA 3AO1A 3PW5A 4AHRA 4KREA 3NF7A 3BQ2A 1O1WA 1L3TA 1WSIA 3DLKA 3SNNA 3DLEA 4KHWA 2RF2B 4CJKA 4AHUA 1I6JA 3RMDA 2IMWP 4J9RA 2ZD1A 4NZ0A 4DG1B 3G6YA 2FVPA 2D41A 2W9CB 2OPRB 2XGQA 1N56A 4PQUB 4PUOA 2E6LA 2I5JA 5HRNA 5J2QB 4BACA 3C6TB 4DL3A 3VQEA 2BANA 3VQ8A 3O3GA 3QEWA 2OPSA 1G15A 4J9SA 4ZMMA 3NMAA 5FRNA 1CZBA 4DL4A 4O44A 4DF8A 2JEJA 4EO6A 2J6TA 3Q8SB 1IKYB 4B9TA 3S3OA 1TVRB 4YMEA 2KTQA 1KLNA 3ZSOA 4KB1A 3OSNA 1RT4B 2PYJA 1REVB 4KV8A 3DI6B 4JLHA 2B43A 4IR9A 2W8KA 4TXSA 3AO2A 3KLIA 4J9QA 3UDLA 4DFPA 4GVMA 4ELTA 1HYVA 1QE1B 3V81A 5DLFA 4LQ3A 1ZTTA 2FVSA 2AX1A 4M94A 4IBNA 4IRDA 3HK2A 3D28A 3ZT3A 4KHMA 3AO5A 3I0RA 4CCHA 3BGRA 1BCMA 1S9GA 2FLNA 4O3SA 4FS2A 4DTSA 3ZT0A 4CJEA 4KKOB 4LH4A 3HVRA 1UA1A 2Y1JA 3CJ2A 4B8AB 3KHHA 3SV4A 1SV5B 2WOMB 3PR5B 3OJSA 1FKOB 2UVUA 1NJWA 1GOCA 1EP4B 1WNEA 2YNIB 3RTVA 5KFZA 3N6NA 2DFHA 2G8FA 4K50A 4I9LA 3VQCA 4N76A 1U45A 4RG8A 4E19A 3C95A 2C2EA 4E7HA 3RR8A 5T7BA 5KT7A 4EO8A 2WCXA 1KSPA 3P1GA 4LSNA 5CYQB 3RR7A 1QSYA 1JXBA 4DFJA 3ZCMA 4KB7A 2D0BA 4ZP8A 3LDSA 5KFWA 2E9ZA 4AHCA 4IG3B 3QINA 4MFBB 3H5SA 5F8LA 3MR5A 5EWEA 5EUHA 1FKPB 4M41A 2CKWA 4I2QB 3AVHA 2OPPA 5J1EB 5HRPA 2UUTA 3KKSA 1QAIA 5KT3A 4R8UA 3QEXA 4J2DA 1S1VB 3V1RA 4ZTJA 2AQ4A 3CDWA 1MU2A 4WE1B 3KK2A 5KFRA 3F9KA 4MQ3A 3KLFB 1A5VA 4LD0A 2F8SA 3GIJA 3NGZA 3G6VA 4NRUA 2ETJA 3DLGA 1DTQA 1TKXA 2XY6A 5FRMA 1T03A 2YNHA 2OA8A 4ZPDA 1S48A 3LP0A 1VSHA 1RYSA 1K1SA 5KFLA 3OHBA 3MXJA 3AVIA 3SQ1A 3WNHA 4KFBB 2G8IA 3QGIA 4NLXA 1FXXA 3EYZA 1RTHA 5HROA 4N5SA 4ED2A 2AGPA 3I0SA 4EYIB 5E41A 3LP1B 3SUPA 4ID5A 4MH8A 3VQ9A 3IS9B 1LWCA 4G1QA 4TYBA 1SH2A 4CJVA 4EBDA 4EEYA 4CFCA 3E01B 1U09A 4DLGA 4RW9A 3V6DB 3UPFA 5DQIA 4FW1A 4CJPA 2HVIA 5DG8A 3SUNA 3PW4A 2LSNA 3Q8RB 1JLFA 1ASUA 3QYYA 1I39A 2HWIA 4M95A 5J2MA 4HVJA 4JRPA 3DOLA 3SYZA 1ASVA 4IKAA 1JLGB 4RU9A 3L2WA 3CG7A 1SUQA 3DRSB 3M8QA 3SQ4A 3MEGA 3FFIB 3DLBA 1TK0A 5J2NB 4Y3CA 1NK8A 4IDKB 2WB4A 3JYTB 1HNIB 3QLHA 2QXFA 4KE5A 3SZ2A 4F4YA 2D5RA 1C0TA 2VG7A 3SV3A 4DS5A 1S1UA 5F8NA 1BI4B 5D3GB 3NL0A 4FYDA 4NLPA 3KJVB 1C0UB 4CGIA 2BE2A 3OYJA 3V9ZA 1LWEA 3IRXA 3BSNA 4FJKA 4OJRA 3FRZA 3HVTA 1RNHA 3KHRA 4I2PA 1LW0B 1Q9YA 3Q8QB 1HARA 4DSKA 3KLVA 2W7PA 3CVKA 1TKZA 1XR5A 4HUEA 3QZ7A 3G86A 2W9AA 4OPJA 1Z25A 2IAJA 4DTUA 4CFAA 3AVKA 4ELVA 1NOZA 3PR4A 1N48A 2NUBA 3OY9A 3OS1A 1C1AA 1KLMB 4CK2A 2OH2A 4Z4IA 3HKWA 3PW2A 4J9NA 4G3IA 1GX6A 3KKRA 5DLGA 5HBMB 4C8MA 3KK3B 1A5WA 4KSEB 2ASDA 3SUOA 4URGA 2VG6B 5L1IA 4DQSA 4JV0A 1RT2A 1TAUA 3DOKB 1EETA 3KLGB 3GV8B 3OYLA 1ZBLA 3CJ4A 1GX5A 1TGOA 4QWCA 4FK4A 2R2UA 1IKWA 3CFPA 4JS4A 4IFVA 4CJ4A 1ZBHA 4ED7A 3AVJA 1QS4A 3EZUA 2YHAA 4OGCA 2FVRA 1VSFA 5KFJA 2GBZA 4J2BA 4F4WA 1D1UA 3DRRA 1YTUA 3G6XA 4B3OB 3FSIA 2RF2A 4KRFA 3MR2A 4ED3A 3PVXA 1NHUA 4W5NA 1SKSA 1U49A 4DG1A 4CERA 1HPZA 1FK9A 2IM3A 2W9CA 2OPRA 4DU1A 2BR0A 1LAWA 1JXEA 3VQ6A 3QO9B 1S10A 3C6TA 3DRPB 2HNDA 5KFBA 3GYNA 3KLHB 4IH7A 2GC8A 3HM9A 4QOZB 3C6UB 3QIPB 1WN7A 3V4IA 4E89A 2HHUA 2ILZA 4ECWA 2HHTA 1IKYA 3LAKA 4NLYA 5DK5A 2R7YA 4DQQA 3QERA 1KRPA 4N41A 1KFSA 4KHQA 1J54A 1BHLA 3HP6A 3TVKA 4CF9A 1IO2A 1RT4A 1N6QB 4KTZA 1REVA 3OYFA 1WLJA 1X9MA 2ILYA 3WNGA 1BQNA 1K1QA 4KO0B 3AA3A 4CE9A 2QV6A 1JLCA 2BQUA 4TYAA 2WONB 3IN5A 2Z1GA 1Q8IA 4MKAA 3RMCA 3TR8A 3HT3A 4DS4A 4B8CA 3L3VA 1KHVA 4FLTA 3OL8A 3UQSA 2HWHA 1SKRA 1XHZA 4CEZA 1SL2A 5CYMB 1RT7B 3NGDA 4OL8A 4L8RB 1NNDA 3RBDA 2GIQA 3KLEA 2ALZA 2A1SA 4EBEA 1J5OB 2IC3B 1WSGA 4KKOA 2OZMA 4KAIA 1WSJA 3LANA 4HCCA 1QTMA 1SV5A 2WOMA 3LWMA 2ATLA 1FKOA 5I3UB 4IQXA 1EP4A 1IKVA 2IM2A 1F21A 2HHVA 2G8VA 2FVCA 2B4JA 5JUMA 2XWYA 1TAQA 3CIZA 1OS5A 5FDLB 3CDEA 3MF5A 3TAQA 1R0AB 1XHXA 4ECYA 4E1MA 1UWBB 2W42A 4CEAA 2XC9A 1S9FA 4MK8A 4RW7A 1JKHB 4IG3A 1D5AA 1NK7A 4LSLA 1JIHA 3MFIA 4TSXA 1D0EA 4CF2A 1FKPA 1DTTB 4RNOA 1B9DA 4I2QA 1VK0A 4IG0B 1C0MA 3V6JA 3MXIA 2C22A 1YT3A 1XI1A 4E7KA 2C2RA 4UQGA 1HYZA 4OKKA 5JS2A 1SL0A 3LP3A 4K4XA 3K2PA 1Y97A 3DLRA 3L3UA 1KTQA 2YNGB 3IG1B 4HCBA 4O0JA 5F9LA 2AGQA 5K14B 1S1TB 1ZBFA 1XWLA 3T5LA 3SI6A 1U47A 3FDSA 4ZVEA 1TV6A 4OLAA 3KK1A 3OYBA 5KFQA 4FLYA 5C42B 4B08A 2IDOA 3AO4A 3E51A 4K4SA 1KCFA 3LPUA 1L5UA 3MECA 2XY8A 3CJ5A 1IH7A 4RW8B 2JEFA 3V9XA 3B6PA 3HYFA 4KFBA 2RKIB 3SJJA 4BE0A 2UVVA 3EPGA 4QPXA 4CHPA 5HLFB 3PX4A 4FLUA 3HHKA 2IOCA 3CM6A 4I7FB 2F8TA 3O4NA 2KFNA 3LALA 3PO5A 4FJLA 3HPHA 3PX0A 2XCAA 2V4QA 4FM1A 3IS9A 5KFPA 1WSHA 2GV9A 4NRTA 3E01A 4FS1A 1W9HA 5HRRA 3PV8A 4WZMA 3V1QA 3V6DA 3GV5B 3V9UA 3V9SA 1NK6A 3GIKA 2HHXA 4ICLB 4O4GB 4F2SA 1BQMB 3CDUA 1U04A 4KI4A 4JV2A 1QAJA 4WFZA 2CJQA 3CQ8A 4DU4A 4RNHA 3JSMB 3OYKA 1RA6A 5KFMA 4Q5VA 4NCGB 4B9SA 1JLGA 3OHAA 3ZSVA 3DRSA 3L2RA 3NF6A 3FFIA 3U3YA 5J2NA 3KMQA 1NKEA 1BIZA 4RNMA 4DLEA 4B9MA 3QETA 3JYTA 1QSLA 4FJIA 3PUFA 1HNIA 2ASLA 4DQPA 2F8EX 3HL8A 4RNNA 4Q0BB 4IH5A 5D3GA 1C0UA 3NE6A 4YR3A 3PZPA 1GOBA 3F73A 4FM0A 2R8KA 2O5DA 1TQLA 4LY7A 3H59A 4Q43A 5L1JA 3NAHA 2XCPA 3SFUA 1TKDA 3QZ8A 1C2PA 4M3RA 1LWFB 2FBVA 1RTJB 4K4YA 1C1BB 4HYKA 1N5YB 3MFHA 2HNYB 3RB3A 3SQ2A 4R0EA 4FXDA 1NKBA 4KTWA 5KG6A 3ITHB 2GIRA 4CFDA 4MK7A 2B5JB 2FVQA 4IR1A 1QUVA 5HBMA 3MEDB 3KK3A 1VSIA 2FBXA 4AHTA 3NF9A 4Z4CA 3VQ5A 4QW9A 3DM2B 1CLQA 4TY9A 4IRKA 1RT3B 4E1NA 4DWIA 1WSFA 4DFMA 4F8RA 1RTIB 2Z1JA 1LW2B 1VRUB 3LWLA 4DTRA 4J9OA 4Q8FA 3ISND 3H4DA 4F4XA 3VQ4A 3ZT4A 3I5AA 3OYAA 2P5OA 1T05A 4FK0A 2VA3A 1S1WB 4FBTA 2KZMA 1JLEA 3ZSXA 4B3OA 4DSEA 1S97A 1S0MA 1S6PA 4Y2CA 4CHNA 3RWUA 4ZHRB 4YQWA 2HAIA 3AVBA 3ZT2A 1HNVB 4E7IA 3CO9A 4C8OA 4CK3A 4FJNA 3ZSQA 3BSAA 3OL9A 4CJ5A 3NKYA 3Q8PB 4CIEA 2IM0A 1HYSB 4TY8B 3KIOA 4FVMA 4FJ7A 3DRPA 4O3QA 3KLHA 1RCHA 4H4MA 5EWFA 3PW7A 3M9OB 3C6UA 3QIPA 1BCOA 3ZSWA 2E4LA 3QIOA 3EPIA 1NK4A 3VQBA 2ITGA 4JV1A 2ZD1B 1RBTA 5EU7A 2VG5B 3K57A 4FM2A 1N6QA 3NH0A 5KFKA 4FJJA 4Z0UA 4KO0A 1RAJA 3AA5X 1BIUA 2X6SA 3H5XA 4BDYA 3SQ0A 4KHYA 1U4BA 4K4UA 2WONA 3ZSRA 2QKBA 1HJRA 3K5OA 3PHEA 4M3XA 2ZQBA 4WZQA 4CGDA 4E7LA 1TL1B 1RBVA 4EZ6A 5KFCA 1CZ9A 1RT7A 1N4LA 4DTOA 1DLOA 1RA7A 2XI2A 5DMRA 4NCAA 2D3ZA 3O4QA 2BDPA 1RT1B 1J5OA 2ZKUA 1EX4A 4U6PA 4CJRA 1L3SA 5KFXA 5C24B 2BGGA 3V1OA 4NLTA 1T8EA 1X9SA 5SWMA 2F96A 4LH5A 5I3UA 4PWDA 5F8HA 2B6AB 4RW6B 4M42A 3PW0A 2EHGA 3KLIB 4Z4HA 4GC6A 2HMIB 3QEVA 4I9QA 3NH2A 2UUWA 3OSPA 2DFFA 1IKXB 4XPEA 1R0AA 1RT5B 3NF8A 1QSSA 4IKFA 4WFYA 4K4TA 3OYHA 4OVLA 4ID1A 4J9PA 1RT6B 1NK9A 4O3NA 1JKHA 2JGUA 4CJ3A 5SZTA 5KG0A 4EZ9A 1TL3B 3BJYA 1S1XB 3AVNA 3OL7A 1RBUA 3UR0A 1D9DA 4CEFA 2EX3A 4IG0A 2BQRA 3D0PA 4IOBA 4K8XA 2GUIA 1VSMA 3NGIA 4W5RA 2Z1HA 3L2VA 2HVHA 4K4WA 3HO1A 2YNGA 2P5GA 1XC9A 4LSNB 1B92A 3DYAA 4MIBA 1S1TA 3KD1E 4BE2A 1RDBA 1JLQA 4R5PB 3QGGA 2HB5A 4MIAA 1D8YA 4ECTA 3O3FA 3FQKA 3OVNA 1RBRA 5C42A 3MTKA 1SH0A 4CJQA 4QW8A 2XY5A 3GIMA 3SPYA 2OPPB 2YKNB 4TLRA 4Q44A 1WNSA 3KHLA 4CHQA 2YKMB 4CGHA 4IRCA 4XIUA 5J2PB 4ED8A 3NAIA 2RKIA 3OS2A 1S9EB 1T7PA 3KK2B 2FJWA 5HLFA 2RN2A 3RB4A 4KI6A 4I7FA 4PQUA 2FC0A 2G8KA 1J53A 5J2QA 4ECZA 1KVAA 2V0NA 3VQSA 3AVCA 4CGFA 4KB0A 1ITGA 3TARA 4HHTA 2OPQB 4RW4B 1LAVA 4ZPBA 1T03B 2YNHB 1HQEB 4B9LA 3M8SA 3SCXA 4ICLA 3LP0B 4CF1A 2RDJA 3A2FA 3OJUA 1JLBB 3NBPB 4DF4A 4ZVFA 4E7JA 4ZVHA 1TVRA 3JSMA 1SKWA 5KGXA 3OLBA 1XR6A 3NCIA 5L1LA 4F3OA 1HQUB 1Z4UA 2AWZA 4NCGA 2QE5A 3AVLA 1RTDB 4CIFA 4FBUA 1RYRA 2QK9A 3DI6A 3BDPA 2BRLA 4NLOA 4CK1A 5KGWA 5L1KA 4G1QB 3MXMA 1C1CB 4Q0BA 3OYEA 2R2TA 4RW9B 2X6NA 1QE1A 4J2AA 2P51A 3PJWA 4CF0A 5F8GA 1WSEA 4CIGA 1JLFB 4QWBA 5DG9A 2YV0X 5KG7A 5J2MB 1WAJA 3DOLB 4FLWA 3QESA 3KD5E 2HHQA 3K5MA 1SUQB 3K58A 3MEGB 2IBKA 1LWFA 2E9RX 2IM1A 1ASWA 1RTJA 4OLBA 1VSEA 1N5YA 4M3YA 2YNIA 3M8PB 2FLPA 3QLHB 3WNFA 2XY7A 2KZZA 1VRTB 5KFIA 3EZ5A 5KFSA 3VA0A 2R8JA 3H08A 1VSDA 2JLEA 1EKEA 3RB0A 2B5JA 3TQ1A 5KFHA 4N47A 3AVGA 3ZSYA 3MEDA 3D5MA 1SH3A 5CYQA 5KT2A 2A1RA 4CJSA 4MK9A 5KFFA 4K4ZA 4PY5A 4ED6A 4CJUA 1QQCA 3DM2A 3T5KA 3QGHA 4RUAA 1X9WA 3FQLA 2W8LA 4CHZA 5DGAA 4ZPAA 1CXQA 4CGJA 4NLWA 3L8BA 4JS5A 4Z4EA 3OYDA 4O3OA 2E9TA 4MFBA 3O3HA 1LW2A 1VRUA 1YVUA 2VA2A 2FJXA 2OYQA 5J1EA 5F8MA 4YR2A 4OKJA 1S1VA 1B9FA 4H4OB 2PYLA 4WE1A 3BREA 2AJQA 1WAFA 1S1WA 1IG9A 2O4IA 4RUCA 4KHUA 3KLFA 4Z4FA 5CZ2A 3RMAA 3M9NB 1YTAA 4HTUA 3AA4A 2WHOA 4NLVA 4ECVA 3KOAA 4KAZA 3BQ1A 4Y2AA 1EETB 4W5OA 1TP7A 1Q9XA 4K8ZA 5KG2A 4ZHRA 3TAMB 5KRTA 3CYMA 4WXWA 1IKWB 4NLDA 1IM4A 3H5YA 3TI0A 4KHRA 3T1AA 2ZE2B 2R8GA 1HYSA 4TY8A 3DLHA 2C2DA 4DSFA 5C25B 2W9BB 3OYGA 2PZSA 3BQ0A 3GQCA 3B6OA 3BSCA 1JX4A 3DRRB 5KG4A 5CZ1A 4ZP7A 4AH9A 3THVA 2OZSA 5KFUA 3LP1A 4OGEA 2WRMA 1UAXA 3CJ3A 1RDCA 3ASMA 1HPZB 5KFTA 1FK9B 2VG5A 2IGIA 3MR6A 1TK8A 3U6FA 3OL6A 3LZJA 4DL2A 3ICLA 3V6KA 1JL1A 3ISNC 1T94A 4J9LA 4DFKA 3P5JA 2HNDB 1BL3A 4DEZA 4CHOA 4DL7A 4M45A 3ZT1A 4W5TA 3K5LA 3S3MA 4ECUA 1TL1A 2G8UA 3SUQA 3NDKA 3H2LA 2JEIA 5CY4A 3TANA 4IDKA 3V4IB 4B9NA 3RB6A 3TAPA 2I1RA 4CECA 1W0HA 1RT1A 4NLQA 3PY8A 1BI4A 3V9WA 2XO7A 5C24A 3NGYA 1Z26A 3GILA 3KJVA 2DFEA 3SPZA 2WTFA 1JL2A 1BQNB 1L3VA 1LW0A 2B6AA 4RW6A 4ED1A 1JLCB 1RBSA 3OYNA 5KFYA 1S0OA 2HNZB 4MKBA 4Y1DA 2YNFB 5DQHA 4BDZA 4FJMA 4E0DA 4GC7A 2HMIA 4U7CA 3GV7B 3N6LA 4DTMA 3TAEA 4FCYA 2EC0A 4GMJB 3KHGA 4FJXA 1IKXA 5DGBA 4FLVA 3IGNA 4DQIA 1RT5A 3LZIA 4DL6A 1U48A 1UOCA 3VQPA 3KLEB 2G8HA 2RPIA 2HW3A 2D0CA 2ASJA 2DY4A 1KLMA 5KFEA 1D9FA 1J9AA 3T5HA 4NYNA 1RT6A 4B9UA 3DMJB 2Q3SA 2HHSA 1TL3A 1S6QB 2W7OA 1S1XA 4FJ8A 2VG6A 3VN5A 4HUFA 2G8WA 3DOKA 4YR0A 1IKVB 4CJLA 3VQ7A 3KLGA 4M3TA 3HP9A 4O3PA 4EBCA 1JLAB 4FK2A 5HP1B 3OYIA 4ELUA 1TKTB 4IFYB 2D0AA 3AVFA 3LAMA 2Z1IA 4DL5A 3LP2B 4KPYA 1MMLA 2R2SA 4CEOA 4R5PA 2P1JA 4Z4GA 5KTQA 4ED0A 4F4KA 4RW7B 4CJTA 4CEQA 3QNOA 2R8IA 4LSLB 2FBTA 3MEEB 4BWMA 4DQRA 2R8HA 5I42B 5F9NA 2YKNA 3PJXA 1RDDA 2YKMA 2E6MA 4TN2A 3QEPA 3U3GA 5J2PA 1YVFA 1NK5A
chains in the Genus database with same CATH superfamily
3B4MA 3SCKE 3E1YA 4NLGA 2NXCA 4P2XA 2GQQA 4P73A 1ZZFA 3QO9A 4B1WB 3ILJA 1PO6A 4GY2B 2OPQA 4RW4A 4C23A 4DV0K 2EKNA 1E4FT 3RMBA 1HQEA 5D4LA 4FL9A 4KHSA 2GVDA 5AE3A 5KG5A 2N3OA 3DLEB 3NBPA 3DDKA 3UCZP 5KFDA 2UZAA 1RBLA 3W2WA 4BHQA 4M3WA 1HQUA 2MKJA 3FCWA 3JSRA 1RTDA 4YB1P 2DTUA 3NAEA 4FLZA 4LF6F 2IJNA 1BISA 4DQ8A 3U02A 2ZH7A 4NYPA 3WIVA 1C1CA 2JZ5A 2J7KA 2QG9B 1J5EJ 4LF7F 1SJFA 3T1YF 1BA0A 2VODA 5AQRA 3S9HA 2MQLA 1MW7A 3IRWP 4TKTA 2FBYA 1S7IA 4F2RA 1F9FA 2RVJA 4IO1A 3EDRB 1HL6A 3S01A 3T5JA 3D6RA 5AQQA 2CPHA 4KV8B 3VESA 2ADCA 4W5QA 2AYMA 2FLOA 4X65J 3ULEB 4ECXA 1S79A 3QWPA 2GUPA 1VQOS 1R8AA 1K6YA 4I1TA 4LBIA 4H0VB 4CYUA 2J5AA 1VISA 5JS1A 2W41A 1FVQA 2AU0A 1PBUA 5KFVA 4J8FA 1UWBA 5LJWA 4L3NA 3PEHA 2NSBA 3HFZB 3BGRB 2DPJA 4A47A 4LF9K 2DPIA 3QNNA 4OKEA 4NYZA 1VQ5S 2MDAA 1KVCA 1M1KO 2J9EA 3MWPA 3G9CA 4F9OA 3B8AX 3QEIA 3WQTA 5GAGI 3DHXA 4O5BA 4H4OA 3AA2A 5GIOA 4AQYK 5K14A 2B0GA 4X4OA 3Q2TC 4C8LA 4HWIA 1T44A 1ZYQA 2E20A 1NM1A 3NRBA 1NGGA 3TAMA 2JEGA 4CZFA 1SZ2A 3DCAA 1NGAA 4DU3A 3IM9A 3L2QA 4ILRA 1RAEB 3QJJA 2KQ2A 3ATUA 1U1KA 2MYFA 3CIMA 1W7WA 2J0SD 5C25A 3H4BA 4ZJOA 3CPWM 1QAXA 4OMFG 4JV5J 2CZVC 5IM0B 3H25A 1Q18A 1JLEB 1ULRA 3QJPA 2RS8A 3W66A 1EZZB 4ILJA 4GNIA 2DNLA 3DLGB 1TKXB 5LXYA 2E1CA 1WG1A 4LFBK 2V4JB 3R1LA 2QKKA 2V4RA 1X1PA 5AQFA 2ZH1A 3HVWA 5I4MA 2SXLA 3HVAA 2HKEA 4WXOA 1EWRA 3OTOJ 1VLYA 2AJ4A 2V9WA 4KH5A 1BWFO 4G65A 4DHVA 2ZKTA 5GINA 3A13A 1APSA 2EC2A 4ID5B 2JNJA 4C11B 1F5CA 3S6EA 4DCPB 2PIIA 1AUSL 3BEGB 3GJTB 3G25A 2AJ2A 3S41A 1TL7A 3N5FA 3SCLE 1B0VA 5L9XA 3MUVP 3ZZUA 4GW6A 1IBKF 1WOPA 3KTQA 3CFOA 3CC4S 2LDIA 3CWJA 2JJ4D 5L9NA 4CLPA 3NFAA 3MN9A 3HSGA 5MLCV 1C1BA 1P8ZA 1QHTA 1PJ6A 2KYZA 1NSQA 2VWJA 3LPTA 4B1YB 2X78A 2F1FA 4DSJA 3VZIA 4C4WA 3DMJA 4WYLA 2ZH9A 5A2QY 1HW8A 4O4RA 4QIVA 4EYHB 1VQNN 4BC7A 2DR7A 3ET6A 3HVTB 3DDNA 2RD5C 4DTJA 2P9PA 4F3TA 2EBEA 3THXB 3MM8A 4ZVGA 3ID8A 1F9HA 1IBCB 2DR5A 3KWIA 1JLAA 4ECRA 3EZOA 1TKTA 4IFYA 1YGYA 1GOAA 1VSKA 1O8BA 1HIYA 3ILLA 3SDEB 1ZETA 3KNAA 1V3ZA 2XNRA 2GFFA 2Y1IA 1U1NA 2PY5A 3HHLB 5HJYA 3TX8A 1YDLA 3M9MB 3JS6A 3DC2A 1RZMA 3CPEA 3TA2A 4DSIA 2VICA 2POKA 2BZ2A 2K06A 1XUPO 1CJKB 4OHVA 3HSJA 4X4VA 4H4KC 4PL8A 1FJGF 4CZKA 1VIOA 2JWNA 1HNVA 3OYCA 4LJMA 2ZUGA 4AYBD 2WW8A 4M3ZA 1HHQA 1EO1A 3W0LA 3LL3A 3U1MA 5AQTA 4NLCA 2MSSA 5RUBA 5DG7A 4YFUA 2E1PA 5L39A 4AHRA 3M2RA 4KREA 2Q6BA 4JI6F 3NF7A 2OD6A 2D3O1 3BQ2A 1W7AA 5HAOA 1SS6A 3DLEA 2RF2B 5I3PA 1HI0P 4Y6IA 1I6JA 3CNQP 1KDNA 4J9RA 4BRNA 2ZM6J 2CPFA 2ZOFA 1QTNB 1FVSA 2XGQA 1N56A 2E6LA 2KXFA 2QMWA 5HRNA 3I32A 4FPIA 1HWJA 4BACA 1U8SA 2RU3A 2ZBCA 3HD2A 3VQEA 1IBLF 2V50A 5C2GA 4PAAA 3BGFA 3UN3A 3O3GA 4GO5X 4C3KA 1XQSC 4BR7A 3NMAA 2RHKA 5FRNA 1FDNA 1CZBA 3WXIA 2JEJA 3RUBL 4S0MA 4GKKK 4U96A 1YBTA 1IKYB 3UVJB 3TR5A 1UVKA 1U7LA 3MOZA 4B3TF 2CVIA 4KV8A 1FW6A 1HUXA 2WUSA 4LBPA 1ZPVA 4ANDA 3ULEA 2GTDA 1I94J 4DFPA 2M9KA 4GVMA 1X3MA 3GZ7A 1HYVA 3THWA 5A6WA 4IXCA 5DLFA 4LQ3A 2FQQB 3QT8A 5BXIA 1G2EA 1T9XA 2AX1A 4M94A 4RKUC 4IRDA 4IBNA 3ZT3A 1TL4A 3AO5A 4JV5K 3BGRA 4O3SA 4FS2A 4M63A 1UA1A 1Q7YO 2QT7A 3HFVA 2XMUA 3KHHA 3VWSA 3SV4A 1SV5B 2WOMB 4ZVOB 3PR5B 4ZIVA 1UJ5A 2BACA 1GOCA 4EHUA 2CJKA 5KFZA 3N6NA 1UFWA 2K3KA 4M5DB 2EG2A 3SIPB 3ZXWA 3AXMA 3JTNA 2C2EA 3CJRA 5T7BA 5KT7A 2R42A 2WCXA 5F0XA 1QSYA 5AQGA 3G4SN 2J8SA 5IT9Y 2V6AA 6AT1B 4M41A 3W8GA 2XS5A 4ZVRB 1M5PC 5J1EB 4KHPJ 4ZIWA 3J7AN 5E26A 4DXLA 3X1LB 2CQ2A 2R7UA 1OSCA 3V1RA 2VHGA 3CDWA 4WE1B 4X66J 4RJVA 5IM0A 2E7VA 5KFRA 3OTEA 3F9KA 4MQ3A 4LD0A 2QWRA 2WBNA 2L9WA 1CJVA 4K42A 3D7EO 4IQMA 3BM7A 2ETJA 3DLGA 1JCEA 3OFGA 1TKXA 3CXCR 2V4JA 4I6MB 2DY1A 1OVQA 5F2RA 2VZ9A 3OHBA 3HHEA 1HFEL 4LREA 2G8IA 2UV8G 4JI1F 4OYAA 1YAGA 2D1CA 4WQ5C 4ZVQB 2BA9A 3I31A 4ED2A 1ROFA 2FZCB 3BBBA 1RHJB 2NRRA 1GMWA 4ID5A 4MH8A 4TYBA 4G1QA 1BUXA 3R5DA 4CFCA 4CH1A 4QU6A 1P27B 3N5BA 3CCSS 4N77A 4RW9A 3UPFA 4C11A 4QYZK 3RBXA 4FW1A 4CJPA 5H1SQ 3M4XA 5DG8A 3UD3P 1M5VC 1FRHA 2PSZA 3W9IA 3AQPA 2PDAA 3AODA 3FGUA 2ZHBA 2V8DA 3QYYA 1Y5NB 2BW2A 4WF9L 4HVJA 5J2MA 2J76E 4B1XB 1D9AA 3VV2B 4IKAA 3L2WA 3UDVA 3CG7A 1DGKN 2HRYA 3DLBA 5J2NB 1IBMJ 1MN7A 2OHDA 2XB2D 3JYTB 2OEKA 2GW8A 1LEOA 4KE5A 3SZ2A 1Y0HA 3UD4P 2FF6A 3SV3A 1BI4B 1XMQK 1X0PA 2MQOA 4RPFA 3KJVB 2B4PA 4DV6J 1C0UB 1GK8A 4FJKA 4OJRA 3HCXA 3HVTA 3KHRA 1V6HA 4DSKA 2W7PA 1BDGA 4HUEA 3PG9A 4WF9Q 3HZEA 1M5SA 4OPJA 2KLAA 3AVKA 1S12A 3OQ2A 3M1VA 4HT7A 3PR4A 1N48A 3WX8A 4DV7J 2ZM6K 1MMDA 2AMCB 1C1AA 4C1NI 3I56N 3HHLA 3JQJA 4G3IA 4K0KK 2CQ1A 1VHFA 1JNRB 2MKHA 3TVZA 3C46A 2MZQA 3SUOA 4P52A 1CJKA 3DOKB 5M2UA 2Y8YA 2B4UA 3GV8B 1KNZA 3BZCA 4WBFA 3CJ4A 4QWCA 4YDUA 6FD1A 4USWA 3M2VB 5L8RC 1N8RO 2XM3A 1HKCA 1ZBHA 1RSCA 2F7VA 4DOZA 3AVJA 2CGLA 3D1HA 3ENVA 2YHAA 4PL7A 9RUBA 4OYMA 2AF6A 4DR7J 5F0UA 3BY5A 5H9FJ 3ULHA 1I94K 5HATA 4YHHF 3FSIA 2RF2A 1HX1A 4ED3A 1SKSA 4CERA 1HPZA 3T69A 1N5TA 2IM3A 3BKFA 5KPRA 1JXEA 4OZ0A 1WG4A 1Z2LA 2GC8A 1NGJA 3HZGA 1Q95G 2EFNA 3QIPB 2DXFA 2KM8C 4E89A 1HR0J 1IKYA 3UVJA 3RZAA 3KG1A 1JK9B 5BRFA 4ETXA 4DQQA 3I96A 2ZH6A 5DM7L 1KFSA 2ASYA 4KHQA 2YI1A 1NZAA 1BHLA 4PG6A 3HP6A 4KTZA 2ZOMA 1X9MA 5KPZA 4CE9A 4DR5J 1HBOB 4TYAA 4KHPK 3AT1B 4FLTA 4OLPA 1SKRA 1FDBA 4J7CA 2VOOA 1JWWA 1RT7B 2UXCJ 4L8RB 2E5LK 3KLEA 1X4FA 5TKYA 4PWUA 4JI3J 1VS3A 2KXNB 2R7WA 2OZMA 1XMOJ 3LANA 4DUZK 5DM7Q 3UN2A 4HCCA 2U2FA 1QTMA 4JK9A 1UVJA 1SV5A 2WOMA 3M32B 3FGVA 1U2RA 3H8YA 1PYTA 2QTWA 2QW9A 4CBUA 2ZITA 1YX2A 4OX9J 3G8SA 2G0CA 2IM2A 1F21A 1RU2A 2FVCA 1M1HA 3GSDA 3MCSA 4WKYA 2AYBA 2B4JA 1TAQA 5JLHA 1SQEA 3MF5A 1XHXA 4DUYF 4ECYA 3P4IA 3CC2N 5AFUA 4A8YA 1EX8A 1GH8A 4YDDB 2L41A 2CGJA 3UE5A 1JKHB 2YX6A 4YB5A 1JIHA 2ACYA 4CLSA 1WF1A 3Q23A 2Z2ZA 5FJ4A 3C66A 4IG0B 1C0MA 5D4PA 1JJHA 4JI8F 2C22A 2P9KB 2QA2A 4UY8O 1TYQB 4K4XA 3IG1B 2LEPA 3R7NB 4LFAF 3A8IA 1OH6A 2AGQA 4AXIA 1UL3A 1A0OB 4W92B 1S1TB 1XWLA 4RU2A 3T5LA 3FLCO 3SI6A 4CO0A 3FDSA 5CHCB 4ZVEA 1TV6A 1WD6A 4ED5A 5K8PA 4OLAA 3O9QA 3KK1A 5KFQA 5AQNA 1F6TA 1D09B 1DARA 1UEKA 3L0QA 3BYRA 5M1FA 2IDOA 1A6LA 3AD9C 5BPNA 3MECA 4I6MA 3CJ5A 2BUPA 4RW8B 1D8ZA 1OJ4A 3ZTPA 3HYFA 4CZMA 1FEEA 4BE0A 5KQDA 4CLWA 3H45C 3H1VX 4FJLA 1N33J 3D67A 5KFPA 3MI7X 4FS1A 1OSDA 4WZMA 3V9SA 3GV5B 4CZLA 1VBKA 2DH9A 3PIOL 2DHAA 2HGLA 1ZBSA 3PYEA 3ZZYA 3MM6B 3JSMB 2OSRA 3PDNA 4FF2A 2OO4A 4EWTA 3E9LA 4A59A 3ZSVA 3U3YA 5J2NA 3KMQA 2P2CB 4RNMA 1U1LA 4B9MA 3L9ZA 5LJVA 3JYTA 4FJIA 1ZA2B 2HBRB 3HL8A 3WQUA 4FWKA 4YY3F 4IH5A 2ASMA 2DHHA 4IEEA 1C0UA 2UXDK 3F73A 1GOBA 2XMVA 5A8KB 2MPUA 3CDAA 3PIOQ 2GO8A 5H9FK 3EVOA 2Y3YA 5DZ7A 4ZITA 3VGKA 3SFUA 1TKDA 5ETTA 2MHNA 3QZ8A 2HHHJ 1M1GA 2BUNA 4A57A 4K4YA 3MFHA 1SC1B 5KAKA 1U1PA 1DEJA 2WTUA 3W5YA 4MK7A 3M6GA 2FC9A 2PMWA 1QUVA 3ILIA 3MEDB 4USIA 1UMJA 2Q6CA 3VQ5A 3HHLD 3DM2B 2O8EA 4AFFA 4E1NA 3MN7A 2HFZA 4EMDA 1WSFA 3VEYA 3NG8A 2GGPA 1RTIB 4ZDNA 1VQLN 3M2VA 4Q8FA 1URRA 3D2FB 3C16B 2CQGA 4F4XA 1MG7A 1TTHB 3BKTA 5M2RA 2NYHA 4DMZA 1RKJA 2OJ3A 1N0VC 5ETQA 4MYTA 4DUTA 1RI7A 2I0XA 4DSEA 2F8HA 1FRJA 1SQGA 2VBZA 1S97A 3N9UC 2UXCK 3AVBA 2DNZA 3ZT2A 3CJ1A 3K0JA 4J5OA 1YBUA 7AT1B 2VH7A 4WKRA 1LOUA 3BSAA 1Y9OA 4CJ5A 1EKSA 3WX4A 1HYSB 3IFRA 1FDAA 2O1PA 3CC2S 2GQCA 5A76A 1UTAA 2ZNYA 1ZAXA 3JSBA 3JTPA 4W98A 3QIPA 2PEBA 2A2CA 2CQ4A 5C2FA 3F56A 4C3MA 2R9LA 4BS2A 2B9WA 4JV1A 4JI0J 3QSIA 1CVJA 5CCMA 3K57A 1GLBG 2YTCA 3KJFB 4FJJA 3NS6A 2X6SA 3H5XA 4KHYA 5A0YA 2NREA 2C2ZB 4I64A 1HJRA 3DOMB 4WZQA 4OQJA 4E7LA 3LPYA 1RT7A 2K8GA 1N4LA 1KD1T 3NP5A 3M6VA 3SLCA 3VPZA 5MAOA 4X4UA 1NDPA 2D3ZA 2PI5A 3O4QA 1JJ2M 2IDEA 4U6PA 3ZEUB 1L3SA 4X62F 5KFXA 2BGGA 2C3OA 2IA0A 1R8PA 2WZ1A 2DEJA 3FCVA 3M32A 3PKMA 4LH5A 3ZNUA 2FHOB 4AT1B 3PW0A 1L3KA 2KVQE 3IC1A 3GG4A 3OW2M 1PG5B 2HMIB 1GLCG 3SK3A 3NH2A 1MWMA 1HNZF 2UUWA 3OR1B 1AA1B 2GMJA 2VQEJ 3NF8A 1PC5A 1QSSA 5L46A 3MUTP 4K4TA 5CZXA 2HVDA 4PZVA 2K7JA 2OMOA 4O3NA 1JKHA 4JI4F 2JGUA 4CJ3A 1WWHA 2M4MA 1K73O 3A8KA 4A8MP 1S1XB 3VEVA 2YWHA 3OL7A 2ZVSA 1RBUA 3A3PB 3CPWR 1VQ6N 2Q79A 4RL1A 1WOOA 1FO1A 2DNHA 2EX3A 4IG0A 3GWCA 2IFXA 1SQFA 2P9KA 5CD4H 3W60A 4IOBA 4K8XA 3GDQA 3HO1A 3D6FB 4IZ9A 2PI4A 5C0YA 1AUDA 3R1HA 4Y65A 1XC9A 3C3LA 2UUCF 4KYZA 3OVSA 3DYAA 1S1TA 4FKXA 3QGGA 3R3TA 3O8MA 2BMBA 3O3FA 1M1KT 1UVMA 2X1FA 4QW8A 2XY5A 4WTYA 1LOTB 1WNSA 2YKMB 3X3UA 1CC8A 2LA6A 3BDEA 1NMNA 4DPOA 4NEZA 1WC0A 3SXLA 1SVDA 2P9SB 3NAIA 5BRDA 5ETMA 5C7PA 2YPZA 2HS4A 1T7PA 2C3PA 2IVOA 2H48B 1R8BA 4CNZA 2RN2A 4BGAA 5AQIA 3LGNA 2FC0A 5J2QA 4ECZA 1HNWJ 1KVAA 4WP3A 4KRWA 3AVCA 2ZJRL 2CPEA 4KB0A 1JB0C 3TARA 2AYEA 2JFKA 1WC4A 1S72S 4ZPBA 2F4VF 3SCXA 4PG5A 3K0SA 3MPUB 3GJSB 1X0FA 2V8PA 3JSMA 4ZCMA 1VQLS 5L1LA 2AWZA 4JK7A 3DI6A 3C15B 5ELZA 4NLOA 3MMCB 2HFVA 1KAZA 5L1KA 2HEKA 1RWWB 3CJKB 2I8EA 4BRGA 2ZJRQ 1NUEA 5A2QU 1T9TA 1MSWD 2P9LB 1FF2A 1RISA 3VENA 3NOGA 4CDIA 3PJWA 5IZHA 3NVMA 2WVCA 2Y0SD 5A8KA 2O01C 2IVMA 2YV0X 3DOLB 1VIXA 1UEUA 4A48A 4DR6J 3MEGB 1F60B 2IM1A 3ENOA 1ASWA 1GQEA 4M3YA 2FLPA 3QLHB 2HSEB 3R7BB 2QL5B 4LRBA 5KFIA 3AGRA 3EZ5A 3H08A 5KFHA 3PACA 4WU3A 3MEDA 2D9OA 3D5MA 1SH3A 5CYQA 2A1RA 4CJSA 3EWGA 4QR0A 5B0FA 4MK9A 4PY5A 3H20A 3DM2A 1YK9A 4CHZA 4Z4EA 1N54B 2XYHB 4MFBA 4U8VA 3O3HA 4OKJA 4LF4J 5M1OA 3C16A 3VERA 2OMLA 1S99A 3DU5A 2IRUA 3OXLA 2PYLA 4H0OA 2HFUA 3M9NB 1YTAA 4P71A 1UPMB 3BQ1A 2YX7A 3DN9A 3R5CA 1Q9XA 3M1FA 2YKQA 4K8ZA 3QBWA 3IR7B 2K1RA 3MM5B 5KRTA 3CYMA 1Q8LA 1IM4A 2JFDA 3H5YA 4M5NA 4KHRA 4MYUA 1PBAA 2ZE2B 4CLKA 1HYSA 2VFSA 1RGVA 1XC3A 1IR0A 4DSFA 2AP6A 2CJXB 2A42A 3MURP 4L6V3 2DPNA 2FJAB 3A5MC 5KG4A 5BR8K 5JMVA 1R0BG 2AW0A 2VQEK 1VQ6S 4NOHA 3BV8A 1WOSA 1RDCA 5B0AA 5B0EA 2IGIA 1TK8A 1JCFA 3T1HJ 3QNWB 1FCAA 2M7SA 3FEXB 4X4NA 1Q82T 4DFKA 3CC7N 2LQ5A 3EE3A 3P5JA 3ZZTA 2PO4A 3D6TB 3ZT1A 3UR3C 2A5XA 3K5LA 2CG8A 3Q89A 4ECUA 2G8UA 3LDLA 4G6VB 2QSWA 2WBRA 5CY4A 4X64F 4IDKA 2NZCA 2W2PP 1I5OB 3TAPA 3RB6A 5GAHP 4CECA 3BBFA 1W0HA 4NLQA 4AXJA 3ZEUA 3V9WA 3T1YJ 4BR0A 3LPEA 2V2KA 3FJ2A 3EKUA 1JLCB 1RBSA 3OYNA 4QIWD 4C3LA 4Y1DA 4JI8K 4BDZA 2DEIA 2HMIA 4MT1A 2XQCA 3GV7B 2DRAA 1FEHA 4FCYA 2EC0A 3KHGA 2B8PA 2N82B 1YSJA 3OR1A 2UUBF 1UOCA 2RPIA 4B3MK 1Y00A 3KG0A 1YJNN 1WC1A 3PEJA 3MCMA 4NYNA 1HNWK 3N4WA 2HHSA 1S6QB 1S1XA 1VQ9N 1W26A 2VG6A 3IWXA 4HUFA 2VWBA 4UUXA 3TO8A 2MZTA 3VAGA 4EBCA 5CXTA 1CEZA 2COLA 4IJAA 2D0AA 2HFNA 4FWPA 3HD1A 1UETA 3LP2B 1HI1A 2G9OA 3H90A 2P1JA 4Z4GA 4RW7B 2IVFB 4ZVSB 3MEEB 1UW9A 4QZVB 5I42B 5F9NA 1UVLA 3C14B 4PRFA 3BKUA 2Q1LA 2VQFJ 3PJXA 2XULA 4XDDA 3CSKA 2YKMA 2CRLA 3FRYA 2NUHA 1HLUA 3R9PA 1IR2A 2G13A 1YVFA 4K2XA 2HF4A 2V2VA 3VHQA 1Z6RA 1SIZA 4DTPA 2V7YA 2GVZB 1EARA 4EK2A 4RBVA 2OIHA 1GFWB 1CQNA 1VJWA 3VEWA 4OYOA 3ETOA 4HACB 4F36A 1X7VA 3I4PA 2ZWHA 4FLXA 1F9EB 2F5GA 2NRZA 2KFYA 3PRBA 3C0BA 1WI8A 1NJYA 3CCJN 2Z58B 2OI2A 1UP1A 4NLSA 1PSDA 4NLUA 4CEEA 3F9MA 4FJHA 3B8HA 3W1YC 4TQSA 2MHEA 3O3LA 1S4FA 3K5NA 3ZX0A 3NS7B 3O2IA 3THPA 3VQTA 3TZXA 1JJCB 5LL6Z 4XH5A 1LK5A 3ID6A 3M8RA 2DNYA 1XR7A 3EO3A 2X51A 2OPSB 2CJYB 2P9LA 4OPKA 2MZRA 4H54A 3BF4A 2A40A 2G2OA 5CYMA 1W25A 2DY9A 4M5IA 2HBLA 3O4WA 1ZH5A 1TFWA 2DGTA 1U6BA 3N01A 2O8BB 2IC3A 4ZPTR 2JWLA 3PNIA 2X74A 4CI0B 3G10A 4FW2A 1CBKA 5C5JA 4WFXA 2FXUA 4GMKA 3TEHB 1RLDA 3A3OB 2OANA 3M05A 4OYZA 4DV4F 1NAQA 5FD1A 4TVAB 3ZETB 5C15A 2Y9HA 4V19X 2GJ2A 3I8BA 1Z2ZA 5EHHA 3V81B 1ZTWA 3PYGA 4AILC 3NHGA 2IS3A 4YDXA 3DU6A 5KFNA 5CABA 1FA0A 2XSFA 4HKQA 1C0GA 2ZVIA 2VC1A 4USMA 1Y3JA 4CEDA 4CLYA 4GV9A 1SL1A 2IA6A 3EE9A 2E5GA 2V7ZA 3WNEA 1KQSR 4J9KA 4XAKA 2YQ0A 3A12A 4XO0A 3WXKA 4KBIA 2XMKA 1HHTP 4DPXA 3F44A 3I5CA 1Q81O 2H5EA 1FRIA 3VA3A 2CPXA 9ATCB 3OFFA 1SIWB 1LV5A 4XPCA 4LRAA 2V94A 2DK2A 1U1OA 5EDWA 3N28A 3ATVA 4E98A 2ZJQL 3QMQA 1T3NA 3WXMB 3MM5A 4UF4A 1VSLA 2KFZA 3AH6A 4ZTFA 1M0SA 2KHDA 4BE1A 2AT1B 3RBZA 4DTNA 3TTDA 2ZE2A 1FJGJ 5T14A 1VFJA 3T3FA 3HFKA 4QWAA 4JAXA 2VV5A 3I5BA 4R8UB 4UZBA 3HOSA 3R27A 1MU2B 3VQQA 4CGGA 2B7CB 4Q45A 5TKWA 1F5AA 2FJVA 4H0TB 3VETA 4AHVA 2UV8A 2QWMA 4DTXA 2DO0A 2BBEA 2XWXA 4A62A 3TUPA 2F8MA 3HJFA 4EP5A 2ZJQQ 4Q8EA 5D0EA 3O9SA 3J80U 3GYGA 4O4GA 4LRFA 2BQ3A 3AV9A 5KI6A 4RNFA 4A46A 4LBHA 1CS4B 1JXLA 2ZC4A 2AGOA 2I6WA 3PO4A 1ZAVA 3PTWA 4L76A 4H4MB 2KI2A 1RTHB 1LKZA 2H1YA 4CTAB 1HNZK 3SI8A 2CUYA 4NCBA 1IBLJ 3F5TA 2VONA 5CQGA 1LFWA 4PG8A 2IJFA 1TK5A 1HNXF 2V8GA 1KS2A 3RRHA 4FNIA 3SFGA 4Q2LA 4QWEA 4CFBA 4JI4K 1Q53A 2YWFA 4MLHA 2B8QA 4XK8C 3K59A 1V5IB 4M7YA 4P6QA 5KFOA 4EP4A 4Y34A 4JI7J 2VQFK 2MZSA 2UVWA 1Q86O 2H5IB 4Q7AA 1F3VA 2HBKA 3A8EA 4UOGA 2BM1A 3JAMO 1RDAA 1NBEB 2Q2RA 2XI3A 4EAHD 1S5ZA 4E3SA 2GO9A 1MWKA 2BABA 3SSSA 2J9DA 4Y28C 4BWJA 3V6HA 4IH6A 1S6QA 5ETRA 2ACMA 2BE2B 2LLZA 4FN5A 1RWKB 2YPYA 2UXBJ 3RBEA 2G2YA 2VKZG 4PWDB 1A5XA 4YP3A 1UA0A 3HPOA 2DIUA 2OD4A 2DITA 2FZGB 4CJFA 4P9SA 1U1RA 4DR2F 5G0RB 1NHVA 5BN9A 4F0HA 1C6VA 3AVMA 2EFPA 2BEFA 4C97A 4CVNE 2BJ1A 3UDCA 2XHWA 3KHYA 2MEWA 4E8UA 3GIIA 3LP2A 1X4BA 2VFVA 5FROA 3AAPA 3M8ZA 2R7QA 3MUMP 2R7RA 3TWHA 4BLGA 4CBWA 1CJTB 3MEEA 3ONQA 3CJ0A 5THWA 5I42A 2DR9A 3UNYA 3C14A 2FHJA 5AJ3F 2X1AA 4KH1B 3MDQA 2FC8A 3CD6N 4RBUA 2GZOA 4JUZA 4DL0C 1NDKA 3FZ2A 4FJGA 2PA8D 2VWKA 1FXRA 1RB0A 3D7SB 2CADA 4B9VA 2GVZA 2FSJA 3ZSZA 1FRLA 3D45A 2Y1RI 2WK4A 2C28A 4QCLA 2D0PA 2MMYA 3MAQA 2BJ7A 3ALYA 3AAQA 4NWBA 4ATNA 2Y8WA 1N32F 4WQ4C 4IYQA 3FZMA 2D69A 3O8WA 3PW5A 3H0PA 3J80O 3LM2A 1L3TA 3J7YP 2F40A 3A0IX 4Q2MA 4IOCL 3ZTRA 4K5RA 3TOQA 4CJKA 5GMKa 4AHUA 3SAGA 1YHQS 1NMEB 3Q2SC 2ZH4A 2JWKA 2E2QA 2LA4A 4PQUB 1QQMA 1W2IA 3C6TB 4NL5A 3UW1A 3KNGA 3KDNA 3DRYA 2OPSA 1YJTA 1G15A 4DL4A 1Q4RA 2BV3A 4DF8A 3UI3A 3TX0A 3QICA 3M7VA 2CWKA 4UOFA 3A1YG 4IOCQ 4FWRA 4YMEA 2O8BA 1KLNA 3TP2A 3ZSOA 4FYWB 4QBUA 1RT4B 1P9QC 2M0GB 1QQOA 2JSXA 4IR9A 3BB5A 3L4BC 5CE3A 3AJ2A 1UVNA 1HLWA 1NGFA 3UDLA 3ZETA 2DTJA 1NLVA 4NB4A 1P1LA 4WCEL 5EX3A 3HM8A 1QE1B 3V81A 3FZLA 4ENOA 2GJIA 4B3SK 2V2ZA 3DXKB 1U26A 2FVSA 2KDOA 2H54B 3VZHA 2V68A 3D28A 4X4RA 1S4EA 1HBMB 3GIRA 5GAHI 4M7XA 3AY9A 3RG6A 3CJ2A 2NXUA 2GV1A 2EBGA 2MLZA 2EG1A 4UOCA 1NBWA 2CYYA 4HI1A 1NJWA 1EP4B 1WNEA 4WFBL 4OYBA 1NZ8A 1VGYA 5F3ZA 2W6LA 2VFUA 5U47A 1U45A 4EI2A 4BRCA 3C95A 1SB6A 4E7HA 4WCEQ 3RR8A 2HOEA 2FSKA 1KSPA 4ZN3A 3RR7A 4CD1A 4NI2B 3W64A 1JXBA 4DFJA 4KB7A 1H73A 2D0BA 4M5GA 1BC6A 5BYQA 1VQMS 3QINA 3J7ZO 2HS0A 3H5SA 2XLIA 3MR5A 3VVTA 2CKWA 4I2QB 3CJ7A 2R3VA 4GV6A 4OV6A 2DNNA 1CPZA 4LRDA 1QAIA 5KT3A 4WFBQ 4R8UA 3C2PA 3N79A 2ROEA 3CJAA 1MU2A 2HRTA 5FIIA 4LR8A 4JI7K 2MLYA 3KLFB 5EVZA 4R25A 4X64K 4LF9F 4LFCK 2J7WA 5DM6L 2NPIA 1IJEB 4FPRA 3MCAB 1T03A 1R6YA 5JMNA 4FKYA 1S48A 1MWQA 3GP9A 3LP0A 1VSHA 1A9NB 2WSFC 1CS4A 5KFLA 1N88A 4JKCA 3NXZA 4OJ1A 2FGOA 3M30B 2UXBK 3SQGB 3J7YU 5AQWA 4N8OA 1JJ2R 2GAHC 1QDUB 2NZ4A 1RTHA 4AQYF 4IDHA 3D2EA 4DV1J 3V2UC 2YWWA 4A4JA 2F9JA 2HLUA 4NA1A 4DR1J 3LP1B 3SUPA 3VQ9A 3NS5A 5LSOA 4CW7B 1SH2A 3QQCD 1OIAA 1NDCA 4EBDA 4EEYA 4CJVA 3O80A 5DM6Q 4ZKAA 1U09A 4JYAF 3CD6S 2LVWA 3CMAS 3V6DB 3OW2R 2Y1LB 2HVIA 1QY7A 2ZH8A 3OBYA 1CLFA 3AAWB 3PW4A 2LSNA 3ZX3A 1ASUA 3KWMA 2HRUA 2XTJP 2HWIA 1N5SA 5HO4A 1V3RA 1KVJA 4DR3K 3MD3A 3SYZA 2XZTB 5AQYA 1DAXA 1JLGB 1SUQA 4UW2A 4KGVB 4ISFA 2ZEJA 1NK8A 2WB4A 1EQMA 4QS8A 4AL5A 1HNIB 2QXFA 1KKHA 1VQKN 5IC6B 4DS5A 4FYDA 3CTRA 2BE2A 2RS2A 4HI2A 3OFEA 3CCRS 3BSNA 1VDHA 3PRDA 3IWNC 4QS7A 1LW0B 4AL7A 1WEXA 4J9UE 1HARA 1GTEA 3Q8QB 5GAGP 3KLVA 2BXJA 3CVKA 2VCPA 2FGCA 5G0RA 3FC9A 1MROA 4LMZA 1N34J 3FEZA 4FXVA 4ELVA 5D6GA 3MX2A 2BJEA 3NCQA 3OY9A 3OS1A 4OO1J 2A2DA 2H51B 1MLAA 4CK2A 1B0TA 2QFIA 3PW2A 1RBOB 1FD8A 1GX6A 1NDLA 1CJTA 1YZ6A 2W2NP 3IAM9 4C8MA 3KK3B 4DCJB 4URGA 4MTPA 4DQSA 1YUWA 5HSPA 1JJ4A 1DT9A 1EETA 3KLGB 2HZCA 1ZBLA 1GX5A 4OZJA 1TGOA 4BC4A 1IKWA 2CNKB 4CJ4A 1FX4A 5JLFA 1WHYA 3MMBA 1A7GE 4LFAJ 1AB8A 5CHIA 4BREA 3AD8C 4F4WA 1YTUA 4P72A 3BGLA 4KRFA 3MR2A 1U1QA 4W5NA 3OTCA 4P7VA 2FY1A 5ETVA 4DU1A 2U1AA 4P74A 3VQ6A 3QO9B 2CNOB 4HTLA 1S10A 3C6TA 3IXQA 4DV4K 4Y2IA 1CQMA 3CHWA 3DRPB 2HNDA 3A4TA 3KLHB 2QWNA 4IH7A 5K5MA 4KQZA 5EY4A 5E3CA 4ES3A 5GVQA 3C6UB 2WVEA 5LMNK 2PFFB 4O23A 2HHUA 2HHTA 5CH7B 4ECWA 2CGKA 2UU9K 5BJRA 3LAKA 2R7SA 3P5BP 2R7YA 3W2WB 1KRPA 1FKAF 4N41A 2XZWA 2P9GA 1TFYA 1KXPA 3T9ZA 3TVKA 1RT4A 4TU7A 1YRTA 1XNQJ 5GADP 1BQNA 3AA3A 4KO0B 2QV6A 2VPWB 2Z1GA 4BQLA 4MKAA 2HQFA 4DS4A 1KHVA 2N3LA 2HWHA 1XHZA 2JVOA 3O08A 3O1LA 4B1VA 3C19A 5D0HA 3DXKA 4OL8A 4FPAA 1W97L 5HL7L 2H4WB 4EFAC 4EBEA 1HBMA 3OTBA 5CYJA 1WSGA 5FPMA 1VI7A 2JOQA 3TW0A 4CZHA 2YHYA 3EXYA 4YOXA 1WDTA 5IWAJ 4KAIA 4USUA 4A8OA 2VD3A 5JJBA 3G82B 3LWMA 2B4VA 2ATLA 3BP8A 3D3CJ 1VBYA 1EP4A 3DXMB 3QT6A 3O1WA 3HJVA 3LOUA 2GQ2A 5CCLA 1H98A 2QSFA 2XWYA 1UFLA 4A8FA 1RHQB 3CDEA 2RRBA 4GKKF 5GAGU 1UWBB 3N4PA 4EHTA 2QA4S 1YVNA 4NPOA 2KO1A 1SC6A 5M1QA 1OPIA 5HL7Q 4DV1K 3D0GE 1SI9A 2CPIA 1D5AA 1I1GA 1NK7A 4LSLA 3MFIA 4DR1K 4H0YB 2BJDA 1GXTA 4I2QA 2NXJA 1NRKA 1IUJA 4X4PA 3PYFA 3MXIA 1YT3A 3VAMA 2W24A 1ZM2A 2E5IA 4WQ5A 4UT4A 1HYZA 5JS2A 3LP3A 4DZDA 1SJ1A 1DY3A 3K2PA 1Y97A 3ZTSA 3D4JA 4Z94A 1VQKS 4DR4J 5K14B 4JV5F 3GLJA 2HVEA 1U47A 4HVZA 1FD2A 5C42B 3R3LA 3E51A 1KCFA 1YQHA 2XMWA 1GMUA 1B7YB 3V9XA 3Q86A 4CO1A 2I2YA 3M30A 2UVVA 4D3HA 4P7TA 2QJ3A 4DCOB 3EPGA 4CHPA 2D74B 5HLFB 3HHKA 2H3EB 4C8YA 3O4NA 1U25A 2KFNA 1B3TA 3HPHA 3CCES 3PX0A 4M5MA 2V4QA 4LIWA 1WSHA 1K8AO 4NRTA 1YLXA 4ISEA 3V6DA 1FESA 2RSQA 3V9UA 4ICLB 4F2SA 1GTHA 1X4EA 3CDUA 4QIFA 4JV2A 1R0CB 2CJQA 1QD1A 1VQ5N 3OYKA 1RA6A 1IV0A 3NGSA 4A8SA 3E8OA 1JLGA 3GG1A 2EWHA 2VDIA 3OHAA 3NF6A 4MLEA 5FPDA 2CAJA 4DLEA 2HBQB 1S22A 3QETA 4NLBA 1RAIB 3GFXA 5DDOC 1HNIA 4PABA 4RNNA 2ZH3A 4OPAA 2FIUA 1BD6A 3FZBA 1BQXA 2R8KA 5AZIB 1TQLA 2GS8A 4X62J 4Q43A 2XCPA 3NNCA 2QX0A 4M3RA 3PRVA 1LWFB 3MOJB 2Z56B 3ILOA 2DB1A 1RTJB 1C1BB 1N5YB 2AKWB 3RB3A 4FXDA 3IMXA 2UUAK 7FD1A 5KG6A 4NXNK 2O3DA 3TEGA 3DKDA 2GIRA 1N32K 1Q78A 3KK3A 4PKHA 1VSIA 3ET6B 3HSZA 1ZAWA 2XSJB 2YY3A 3CJCA 5HQLA 1DKGD 2DH7A 4OX7A 4IRKA 4DFMA 3ZTQA 3LUYA 1EIYB 2QYGA 2Z1JA 1LW2B 4H03B 3MMAB 2HBJA 4J9OA 1YKWA 3H4DA 3VQ4A 4AM6A 3R6LB 2OP5A 2E1MC 2ZUAA 2LMIA 2HWTA 1RWPB 3L4IA 1T05A 2A6AA 4GVBB 1S1WB 4CH0S 4FBTA 2KZMA 2RU9A 3IMQJ 4BR9A 5AT1B 1S6PA 1UEVA 3RWUA 3LGHA 4ZHRB 4YQWA 4OYPA 1HNVB 5EGYA 3CO9A 3CQYA 4CK3A 2ZM6F 4FJNA 2FTRA 2LXFA 2G0IA 5IWAK 3GONA 3NKYA 2QWPA 3CC4N 1SXLA 4K0KF 2R4FA 3DRPA 3M2RB 3KLHA 2YWGA 4O3QA 3M5RA 3O6QA 1CZAN 4GV3A 4LVOP 3GFHA 4BY9C 3C6UA 4YOUA 2WFBA 2E4LA 3CCLN 1AT1B 2F4VJ 1LWXA 1N36J 5DO2A 3HI0A 1URNA 2M2BA 2EWSA 1IN0A 4NASA 3NH0A 5KFKA 5EX5A 4Z0UA 4KO0A 1RAJA 3MZIA 4K4UA 1RLCL 2FF3B 3K5OA 3PHEA 2WVBA 2CNLB 2ZQBA 1I94F 4CGDA 1YITN 1Y10A 5HMYA 1RBVA 1VQPS 1CZ9A 1YJRA 2VC0A 1K8KB 4DTOA 5SUHA 1Q5VA 1X5SA 4AD6A 1DLOA 4LT6A 2XI2A 3A8JA 4FF4A 1RT1B 2QN6B 3RJMB 3K8VA 4CJRA 1KEKA 5I9EB 3R5GA 2BKOA 3GFYA 2F96A 1U2FA 3G82A 5F8HA 2B6AB 4M42A 5ETKA 3DXMA 5AQOA 4FWOA 4Z4HA 5EXWA 1B4SA 3UCGA 2QLXA 4V1Ak 3THWB 2DFFA 3ZZRA 4Z7CA 3J7A1 4PG4A 1RJJA 2D0OA 4EGLA 3C6HA 1QVGR 4JK8A 1HBNA 1ZM3A 2PAVA 1RT6B 1SQKA 5ETLA 1NJIT 2GHPA 1T6DA 1TL3B 2AV5A 3BJYA 3R6GB 2BJ3A 4I6AA 3G6EN 3UR0A 5H9EJ 4CEFA 3GE9A 5K9FA 3OT9A 4KHPF 2QO3A 5IS2A 2RMLA 4YN3B 2Z1HA 2HVHA 3IR5B 4E1JA 3I9ZA 3LH2S 1VHIA 1Y7PA 1NGEA 3GPAA 5HVHA 2ERRA 2E5LF 1JNZB 4MIBA 3D66A 3HLUA 1JLQA 2HB5A 1WHWA 2AJ1A 4ECTA 3UFCX 4DUZF 3FQKA 2QL7B 3OVNA 4YB7A 4PEOA 5C42A 5LT5A 4JYAK 3GIMA 1V4SA 3SPYA 3M6UA 5LMUJ 4Q44A 2QRRA 3QSYB 2Z30B 4CGHA 3R97A 5J2PB 1Q81T 4QIEA 5DRKA 3OS2A 1O13A 3EGNA 1S9EB 2XHCA 2YQ3A 3MD1A 2FJWA 5HLFA 1GXLA 3RB4A 1NU4A 4KI6A 1HKAA 3EL2A 2G8KA 1J53A 3J8AA 2V0NA 4TNOA 5HQ8A 1CJVB 3PM9A 2FUG9 1ITGA 2C2NA 3BO3A 3VOVA 5AQPA 4B02A 2M8DB 1RU1A 3VEXA 4ICLA 4NA3A 4JI2K 3OJUA 1JLBB 4DF4A 2QC3A 4E7JA 4ZVHA 1TVRA 2DNRA 5KGXA 3NCIA 2XLKA 4F3OA 1Z4UA 4X4QA 2YQ1A 4HL9A 2QK9A 1FFSB 1F2GA 3BDPA 1X4GA 1FRXA 2BRLA 4ETZA 3O5BA 1KVKA 2AEMA 5KGWA 1WF0A 4JI5K 4G1QB 2P9IB 3OYEA 4J91A 3VAJA 4RW9B 2X6NA 3R2DJ 2P51A 1HWKA 1EB0A 5AZIA 5F8GA 2VPYB 1RWXB 2MQPA 1T95A 3TPQA 5E3AA 5M1NA 4DV3K 5J2MB 4M8LA 2PBDA 1C4AA 3KD5E 2HHQA 4JKFA 5K8NA 2IBKA 1LWFA 2VKRA 1YI2N 2E9RX 1SC4B 1Z1ZA 2NXNA 1RTJA 1N5YA 2YNIA 2CPZA 4AL6A 4C8ZA 2G1HA 1OY9A 5GADI 2R8JA 5D8HB 2YCHA 2JLEA 2MKCA 1NSKL 2UUBJ 1EKEA 2DXDA 3CCLS 3ZSYA 3CW2C 5KT2A 5MLCQ 2OEMA 3UNGC 2XSJA 1GXUA 4CJUA 1LK7A 1Q86T 2WAQD 3QGHA 4BRLA 4RUAA 3FQLA 2P6TA 2LDYA 1HBUB 4Y2KA 3OYDA 1R8CA 1OO0B 3M1VB 3E66A 1LW2A 4C48A 3MMAA 3DFEA 4MDAA 4YR2A 3CGIA 1YITS 3H2VE 2CQCA 4F3MA 2YHXA 1RDUA 4CBXA 1S1VA 3IBFB 3MGJA 1ELOA 4U95A 2UXDF 4H5WA 4KH6A 2MQMA 4GVBA 3I55N 1S1WA 3HMJG 3TUJC 3MM9B 4HTUA 2WHOA 2HAFA 4NLVA 4LF5J 4IOAL 3CCSN 3KK7A 1J5EK 1TP7A 4ZHRA 1VC6A 4OIXA 3NMUA 4B3RJ 2XMMA 2L9DA 1TUYA 4ZCIA 3TI0A 1R6VA 1KN6A 4X84A 4IO9L 3EGZA 5KOWA 1FHTA 3FR0A 3DLHA 1LXNA 2C2DA 2YXLA 1PC4A 3A5OC 2KG0A 2W9BB 3D9BA 3WXJA 1YTYA 4X65K 3AJDA 3GQCA 3B6OA 2R7XA 1TUUA 1O51A 4OI6A 2L08A 5KFUA 1F0XA 3G6ES 1HR0F 4IOAQ 4P75A 2RT3A 1IXKA 3DGPB 2NR0A 2LQ8A 1HPZB 5KFTA 1WUAA 1PJ5A 1KC8O 2HQGA 1NPPA 3U6FA 3GFZA 5LM7E 4IO9Q 1U02A 4DR5F 4P2MA 3P5TL 4J37A 5L38A 4M45A 4YOVA 2BKNA 2HMPA 2CQ3A 3SUQA 3H2LA 2JEIA 1WEYA 5IOLA 1K8KA 3MTJA 3TANA 3KKFA 3POTB 4C1NK 2BJ9A 2UXCF 2MXYA 1QJHA 4OHWA 2DNMA 4RWXA 1RT1A 3PY8A 4DU8A 2E1AA 2XO7A 3NGYA 3GILA 2CFXA 4BR4A 3N0VA 4F02A 4FWSA 2VU5A 3GU0A 1PYOB 2QWQA 2B6AA 2OGUA 1FTCA 2RDDA 5AQVA 2YNFB 3KWGA 3MN6A 1CULB 2DHGA 4OX9F 2CH6A 3N6LA 4DTMA 3TAEA 4GMJB 3HSCA 4DCHA 4FLVA 2KXHA 3Q83A 3LZIA 2IY5B 4JKGA 3KLEB 4YORA 4U7UD 2DY4A 1KLMA 1RKIA 1RT6A 4B9UA 5M1PA 1TL3A 2W7OA 5AQXA 3VGUA 1T9UA 3FZFA 3NGTA 2V34A 4YOYA 1QAYA 4YR0A 3U4LA 2KT2A 3HP9A 4O3PA 2KL8A 2XBPA 5E3RA 2MZJA 1R27B 3AQOA 3OTOK 3IP0A 1WBDA 4DL5A 4RUBA 1OQ3A 2FPHX 4DX6A 1G1XA 4CEOA 3FSYA 1Y64A 4KGZB 4ED0A 4F4KA 2ZJPL 2KJVA 4CJTA 3TUIC 2R8IA 1M5HA 1HW9A 2FBTA 3JQMA 4BWMA 2DNGA 1IM6A 5CAAA 1RDDA 4H5RA 4DV5J 2IBOA 4TN2A 5HANA 2DVIA 7FDRA 1YI2S 2QLBB 3QEPA 5J2PA 1NK5A 4HH0A 2ZH5A 1UFKA 1RFQA 2J8AA 5GAEI 2XHBA 4NLRA 2UVRA 2DGXA 1S9EA 2VJUA 4KGMA 1HMVB 3GMGA 1DHMA 2XEXA 2O8FB 3IWLA 4PKIA 4JRQA 3VQDA 2BH1A 4FYXB 1RDRA 3H98A 1S76D 1KHWA 1TV6B 3ZC4A 3KK1B 1NH8A 2ZJPQ 3DLKB 4ANEA 4HDHA 5JXSA 1TL5A 2FB0A 3KUEA 3MECB 1JLBA 4DDFA 2NXEA 2MZ1A 2XYPB 4BRKA 4OYWA 2FHMA 4ALZA 1C0FA 1U0HB 1HHSA 4PA1A 2I5JB 3CERA 5AQLA 2NLWA 5IXUA 2K2PA 3I55S 4F4ZA 2P9IA 3TJ9A 1VSJA 1H38A 1BA1A 1AZSB 2ZH2A 4P2FA 4ZLPA 5LXRA 2JDJA 3RW7A 1NGCA 5DS7A 3TZWA 4O44B 4FZYA 2M70A 3R6MA 5K20B 2PN6A 3D3BJ 4HEA9 2Q31A 5BYRA 2XS2A 3L2UA 1G3OA 2M3DA 3OYMA 3TNVA 2VUGA 4CEBA 3QIDA 4FVUA 4LF5K 3DLLL 4N56A 4Z7YA 4DSLA 2OFGX 1IQTA 2J0QD 4CJWA 3CJBA 2Z4PA 3ZZZA 3HXMA 4HHJA 2IYIA 4J9MA 5G4DA 1S3XA 4BRAA 1QM9A 3NCPA 5FDLA 4BGBA 2BM0A 3NGKA 4K59A 1E6YB 3D0HE 5AQJA 5LY3A 1PAEX 4V19S 3R7SB 3I0RB 5F8IA 2O4GA 2NRXA 4QIGA 3IAS9 1HBUA 3PXGa 4CHYA 1YIJN 3SAHA 2BVZA 3DLLQ 2QIFA 3HULA 1DTTA 4MAKA 5AXKA 4O0IA 1H3DA 1F2HA 2NLXA 4DR2J 3OS0A 4PHTX 4DMNA 3CEDA 2X1BA 3GR0A 3KMSA 4M5KA 5ADXA 3K5PA 3T19A 2HIQA 2KJWA 4AHSA 3MM9A 2OCEA 4QU7A 3AB2B 2YHBA 2A3JA 4KHNA 3WT0A 4ZJLA 2RAQA 3JAMY 3P6YC 3D1QA 1B99A 2O8EB 4WYWA 2OAUA 5KT4A 1DQAA 3C8YA 1HRHA 2H4YB 4ZA1A 2JC1A 3K9KA 5AJ3J 2GGPB 1NK0A 3NLCA 4H8KA 3UIQA 4ZLLA 3TAFA 1YJ9N 4O55A 2J0XA 4NYFA 3IAYA 3NMRA 1RCOB 1V4TA 2AX0A 3O6WA 1L3UA 2W9BA 3UD5A 1CJUB 1S7HA 3MR3A 2ZWOA 2P6SA 4URQU 5AFUH 4FVCA 4KH4A 2RDIA 1KQSM 1QUPA 1VBZA 4H5TA 4ZVPB 1WSVA 4G1IA 2HZAA 3DGPA 1EWQA 5KT5A 3W7BA 3IUCA 1WKLA 1NNEA 3VF4A 2CZ4A 2C1EB 2P9NA 2CG4A 1WI6A 1BQMA 3AFGA 4DV2J 4HDGA 4XH1A 3TTCA 4CF8A 4FSVA 2QEXN 3U1LA 1ATRA 4C8NA 4WU2A 3H5UA 4CIOA 4K4VA 2DR6A 2WW4A 1YRXA 2OLWA 1FJ7A 1FXDA 3MR7A 5HROB 3POTA 3RYLA 3HSTB 3LTOA 4FJ9A 3HHNB 2QYCA 1I51B 3I0SB 1Q1KA 2IDLA 1LWCB 4YNQA 4CESA 4FZZA 4CLLA 3Q24A 4KIAA 1NOYA 3OA9A 1JQGA 4O0NA 1NKCA 4X2BA 2LQBA 3J80Y 3JXUA 2OELA 5A0YB 2NNWA 3U1NA 2YNFA 1CULA 2JLFA 3NH1A 4DV5K 3M8QB 1T11A 1XJWB 3PHTA 1H1VA 2JC0A 1LQ9A 5BR8F 4M1KA 4LF8J 2VQEF 2HNYA 4DV0J 4C0OC 2KW4A 4X66K 2HYIB 5EWGA 2IVPA 1FDDA 1HPMA 1C0TB 5ETNA 1S1UB 3FE1A 3ITHA 4FWLA 4CLFA 5HJXA 1OYEA 3ENQA 3I33A 1LWEB 3IRXB 3EY1A 1FFWB 4Y1CA 3G0ZA 4I2PB 4F4AA 1TKZB 2XMJA 2D3UA 1RT3A 4Y0FA 2XGPA 2IAJB 3ZLJA 3H40A 3TAGA 5KG1A 4BDPA 4ANCA 3NNAA 4ZP6A 1AYEA 4JD2B 4OYXA 1BG3A 2PMHA 3MDFA 2DH8A 2HQIA 1EQ0A 3IGVA 2GA7A 2D7SA 1RWVB 1BLUA 4O3RA 1RT2B 4USHA 1UAWA 4OI0A 1Q7LB 2RH3A 2YWEA 4ZP9A 3K2YA 1ZBIA 1OVYA 3I87A 1CG2A 3AO3A 1HMVA 4B3MF 2O8FA 3DYAB 1VLOA 4ECQA 3GJQB 5HK4A 1HNWF 1IBMK 4F04B 3AO1A 3MX5A 3K17A 1TUGB 2RJZA 2BYCA 3DLKA 5HI7A 3SNNA 1YIJS 4KHWA 3KFWX 4A61A 4DV6K 2MJNA 3EVWA 3RMDA 2IMWP 3N4QA 2ZD1A 4DG1B 3G6YA 1U0HA 2FVPA 4AUKA 3QMLA 2I5JA 5J2QB 2CQ0A 1JXVA 4YOEA 5F0WA 2EW9A 3VQ8A 4AQYJ 4DV7K 5GMDA 4PWWA 4ILGB 1AZSA 4PXDA 4J9SA 1XNRJ 1BU6O 3Q7CA 4O44A 2DNQA 8ATCB 3KZBA 3CD5A 4EO6A 2J6TA 2AJFE 3RW6A 1YRUA 2GNKA 2HHPA 3BO4A 4UY85 2KTQA 3FZKA 2Q3PA 2YVSA 1SAZA 4H0PA 2IIHA 4Y2MA 1YJ9S 4BRFA 1VJQA 3OSNA 4JN4A 3L4QA 4DR6F 3DI6B 3RU0A 2A1BA 2W8KA 1MN9A 2HGMA 4IEIA 3AO2A 3KLIA 4J9QA 2G4BA 2HVZA 4PXBA 4ELTA 4IUFA 2I7PA 2J4RA 2DGUA 1RWUA 5AE1A 2VGMA 1ZTTA 1Z05A 4DR7K 1E6YA 1Q8KA 1IJFB 2AIRB 4LFBJ 3I0RA 4CCHA 1YJVA 1BCMA 3CI5A 3ZT0A 4LH4A 3HVRA 3L6QA 3BH6B 2Y1JA 4CO3A 2QEXS 3HDSA 3OJSA 1KONA 2UVUA 3EX7B 2O8DB 2DCLA 2RUSA 2DFHA 4KC5A 4I9LA 4N76A 5B0DA 8AT1B 4LF4F 2RILA 2LEBA 2IVYA 4DV2K 2RHQB 1Q5YA 1IVZA 3P1GA 4LSNA 5CYQB 4K41A 4KBOA 3OVAA 1PIEA 1RWMB 1QVFR 3AY0A 4ZLJA 4BG8A 4CZGA 1S72N 2VF3A 5DDQC 5KFWA 2E9ZA 3DXSX 4R79A 4IG3B 1HR0K 2F7TA 3M3ZA 3OHRA 5DETA 4MFBB 3QRPA 5F8LA 2VBWA 1FKPB 5EUHA 2OPPA 5AQSA 5HRPA 1ZM4A 2V69A 1R3NA 3NWGA 3QEXA 4J2DA 2E2OA 2QXLA 2I9SA 4A8XA 4ZTJA 4DR5K 2BX6A 1CJUA 1P6TA 2ZOGA 3KK2A 5AQMA 4JKHA 2E2PA 3IR6B 1KAYA 3S7RA 2XMTA 2ZBPA 3G6VA 4ERDA 3FBFA 2K1RB 4ZVTB 4LF8K 1RUSA 2RUGA 2XY6A 3P49B 5FRMA 2FY8A 2YNHA 1WTFA 2OA8A 2Z2MA 4K8RA 4ZPDA 2RE2A 4JI3K 1FNMA 2DRBA 3DHWC 1CC7A 1XMOK 3GE1A 1AFJA 5FLXO 3MXJA 3T1HF 2HURA 4CWBA 3AVIA 1KD1O 4KFBB 3PFEA 1FXXA 3EYZA 1VCTA 1O6XA 2ZWPA 4OX9K 4HTIA 1UJ6A 2BW7A 3THYA 1VK3A 5HROA 2W6KA 3I0SA 5E41A 4EYIB 2V52B 4ZCKA 4FWMA 1LWCA 2F65A 1MNEA 1HQ2A 3SUNA 4N8NA 4CO2A 5ADZA 2DJWA 1JLFA 1I39A 4M95A 4GKJJ 3U8XA 4ED4A 3DRSB 3M8QA 3LA0A 4DN9A 2I7NA 4Y3CA 1X4AA 4IDKB 2LECA 1NM2A 5C10A 4BQZA 1WJ9A 5CA5A 4ILHA 1C0TA 2VASA 1S1UA 2LXUA 5F8NA 2CIMA 2A3ZA 4CGIA 4AE5A 1XQIA 3OYJA 4PXCA 3ZNJ1 3V9ZA 3SBMA 2ADBA 1LWEA 3IRXA 2QM1A 1RNHA 4I2PA 4K43A 1Q9YA 1T0TV 2VPXB 3WC2A 1TKZA 3G86A 1Z25A 4WQ4A 2IAJA 4DTUA 4YUDA 3UCUP 1ZC6A 1VMBA 1TMMA 2ZHOA 4Z4IA 3HKWA 4J9NA 3BH7B 3CCVS 4JD2A 4GKKJ 3TQEA 3HKZD 3K7RA 3KKRA 3BR8A 1N33K 5E33A 2IJRA 4KSEB 2ASDA 2VG6B 2HK2A 2LQ9A 1RT2A 1XNRK 2CDQA 2VQFF 3OYLA 3QATA 3CCZA 3EICA 4ITSA 3RGIA 4WIQA 2LCWA 4CO5A 1H6KX 3CD0A 4MIWA 1RAOA 1R59O 1OY6A 5BYSA 4CO4A 3AJ1A 2PMZD 1NGHA 1VSFA 5KFJA 2GBZA 2VPZB 3F0NA 1D1UA 3DRRA 3G96A 4PG7A 2EFQA 3PVXA 2Z8QA 1NHUA 1WC5A 1HKGA 4QOTA 3EMTA 5BRHA 1IQZA 3A5LC 4DG1A 1QHAA 1FK9A 3W62A 4JKEA 2BR0A 1LAWA 3WHIA 5BPLA 2C3YA 2DT9A 1WEZA 2E5JA 1FJEB 2HHHK 2A41A 2ZDPA 4USJC 3FEYB 1Q79A 3V4IA 4ZPWR 2ILZA 1PJ7A 5DK5A 1VQSA 1NXIA 4DX7A 2NRWA 4HHUA 4IWVA 5D77A 1J54A 1OH8A 2CQIA 4CF9A 1IO2A 1N6QB 3G8TA 2X3GA 3OYFA 1WLJA 3EKSA 2ILYA 3WNGA 1VC0A 3WIUA 2BQUA 3IN5A 1Q8IA 3RMCA 1R43A 3TR8A 3BEXA 3L3VA 3AD7C 4TU9A 3OL8A 3UQSA 2JX2A 4CEZA 1SL2A 5CYMB 5AZJB 3KUGA 2F9WA 2ATCB 1NNDA 3RBDA 2GIQA 3MN5A 2ALZA 2A1SA 3TZZA 2W2MP 3U9ZA 2IC3B 1HWLA 1F3FA 1WSJA 4KY3A 2AYGA 2YJFA 5I3UB 4O8UA 1T3OA 2O8DA 1IKVA 4OLOA 4LIRA 2G8VA 4NXMJ 4A8WA 3CIZA 3C65A 2L48A 1GEHA 4V19J 3TAQA 4FWNA 3FFKB 4QYZJ 1C4CA 2G2ZA 2PFUA 2W42A 4MK8A 3US5A 4IG3A 1T9WA 4RO0A 4TSXA 3ZYYX 5HOOA 4CF2A 1FKPA 1DFDA 3W65A 4RNOA 1B9DA 4CJ7A 4F25A 4JI0K 2BTFA 1LFPA 3V6JA 1W2BR 5A6PA 1WF2A 4QPTA 1SL0A 3T6JA 3QWUA 2A6OA 1RAGB 4B3SF 3CJSA 2YNGB 3VGSA 1YF5L 4HCBA 4GKJK 2BOPA 3QPIA 5D15A 1EKRA 2X7IA 1XMQJ 1ZBFA 4OI4A 2O66A 2DHXA 1WELA 2CWXA 2PGCA 2NUUG 1Q82O 3FK4A 3QFHA 3E3XA 3AO4A 2FD2A 3M6WA 4K4SA 3LPUA 2C3MA 3M6XA 2CH5A 1IH7A 2JEFA 4KFBA 4KH0B 4BC5A 4OJGA 3O9UA 4QPXA 3J7AP 2LKZ<