5C42A

Crystal structure of hiv-1 reverse transcriptase (k101p) variant in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
547
structure length
544
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent Inhibitors Active against HIV Reverse Transcriptase with K101P, a Mutation Conferring Rilpivirine Resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 131
structure length 544
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c42A05
3ALYA 1TK5A 5KT5A 3DDKA 3P5JA 1CXUA 3T1AA 4QPXA 5J2MA 3AO2A 3SI6A 3KLHA 3NF6A 1NHVA 4DTOA 5C42A 4DFPA 4O4GA 3UR0A 5J2PA 2YKNB 4RW6A 4KB7A 4EEYA 1T03B 3HO1A 1YT3A 2E9RX 2BGGA 4EYHB 1RAJA 4CE9A 4ZP9A 2O4IA 5KFEA 3ZSZA 3Q8RB 2HNDA 1JLQB 3OY9A 4N76A 1XI1A 4AILC 4XO0A 3MXMA 4CJPA 1VSDA 4X2BA 3G10A 2BQUA 4XIUA 3HHKA 1UWBB 3MAQA 3I0SA 4PQUA 3S3NA 1VSLA 1UWBA 4DG1A 2XGPA 3SPYA 3MECA 1C0TB 3BGRB 1ZBFA 3L2RA 3ICLA 1G15A 1T94A 5K14A 4R8UB 1N48A 3RWUA 4DL6A 4EO6A 2X74A 2R8JA 4E7LA 4KO0B 2AGQA 3OYIA 2RKIB 3H4BA 3DLKB 4ED6A 3B6PA 2ZKUA 4EZ9A 2ALZA 1RT3B 3V6KA 1N5YB 2ASLA 3AA4A 1RTIB 4KV8B 2Z1HA 3N6NA 2FC0A 3M8PA 3BQ2A 4EP4A 3O3GA 3HM9A 5KFIA 4CJ4A 3KOAA 4QCLA 1F21A 4DF4A 2VG7B 1JLEB 4OVLA 1QSYA 3ZSWA 1N6QB 1LWFA 1NOYA 4CEDA 5FDLA 2XI2A 4UQGA 1IG9A 3DM2B 4ID5B 4BDPA 4O3RA 3THVA 3FRZA 3KMQA 2P5GA 1ITGA 4FS1A 3KK3A 4MFBB 4M3RA 4FM0A 1CXQA 4AHCA 4DTUA 2JC0A 4CJRA 5FRNA 4EYIB 3PJWA 4WXOA 1S9FA 1QSSA 1FK9B 3BQ1A 3QGIA 4ZPBA 4DSEA 1S9EB 4QW8A 4U6PA 2ATQA 3CDWA 1TAQA 2C28A 4FZZA 2W9BB 3ISNC 4ICLA 2PYLA 3RB6A 5EWFA 4FJ8A 1JLCA 4AHTA 1UAXA 2HW3A 5KT7A 5DQHA 5KFZA 4F4ZA 5KFGA 4DTRA 2YNGA 4DQRA 2YNHA 1IKXA 3EPIA 1YVFA 1EP4A 1JLGB 4Q43A 1RTJA 4J9OA 4HTUA 3OHBA 3TANA 2J6SA 4FJNA 1SUQA 1W0HA 3O4NA 2HHUA 1S1TB 5KFNA 2OPRB 5KG1A 3V6JA 1B9DA 4F8RA 4LQ9A 3PR4A 1RT1B 2OPQB 3DRRB 4TY8B 2AU0A 4CEBA 2G8WA 1RT2B 3QLHA 3MTKA 2XGQA 4ED0A 3MEGA 3O3FA 4CJVA 3OYNA 2R8IA 4OGEA 2C2EA 3LALA 3OYHA 2YHAA 4O3SA 3DYAA 4DL5A 4CGDA 1XHZA 1JXLA 3PUFA 4CFBA 1XR6A 1CLQA 4FLUA 5CYMA 3HSTB 3KD1E 4I2PB 5KFRA 3QEIA 5I3UA 1RTDB 1ZBLA 4B9LA 3I0RA 1JLAA 5KFPA 3M9OB 3V9UA 3NH2A 2VWKA 3ZT4A 4O0JA 2G8VA 4IR1A 3L2WA 3PR5B 3RR7A 2I1RA 4RW7A 4HUEA 2HHTA 3K57A 2UVUA 3D28A 1LV5A 3F9KA 3IG1B 5F8IA 1ZTTA 4DTXA 3VQ5A 3LZJA 4IH5A 1RDBA 1NK5A 3IAYA 1IH7A 3H08A 3DOLA 1VSKA 2PY5A 1L3VA 3AO4A 2KW4A 3C95A 4OKEA 4FK2A 3HPHA 4ZTJA 4HUGA 4ED8A 3PW7A 1VSJA 1KLMB 3M9NB 2EHGA 3LP2B 4N5SA 4RW7B 4F3TA 2ASDA 3CFOA 2WK4A 1NNDA 5C24B 4WFXA 1JLFB 3SYZA 3K58A 4AHVA 1BQNB 3L2VA 1JKHA 1N4LA 4QW9A 1EKEA 3G6VA 3SFGA 1WSFA 3AVJA 2VG6B 5CYMB 1BIUA 2W9CA 5CZ1A 4K4WA 4C8OA 5F8NA 3DI6B 3SJJA 4Y1DA 2OPSA 3VQQA 4WYWA 1TKTA 4KTZA 4DLGA 4ECTA 1SV5A 1D1UA 4ED1A 1JXEA 4K50A 1S10A 3QZ8A 3DRRA 1QUVA 4L8RB 1C1BA 4KKOB 1FKOA 4CJ5A 4FJKA 3NBPA 2RN2A 4OLBA 5EWGA 5DK5A 4IBNA 3KD5E 4WXWA 3T5JA 2BRLA 1EP4B 1WSHA 3QIOA 4MH8A 3KLEA 2I5JB 2A1RA 1RYSA 1QHTA 3K59A 4W5NA 1U48A 2G8HA 4IRDA 3LP1A 2FJXA 3QNNA 1WSIA 1RNHA 4XPEA 4TY9A 1REVA 2XWYA 4M3XA 5KFDA 4CFDA 5KFVA 2JEGA 5KFUA 1NHUA 4ECVA 4Y2CA 1QTMA 3LP0A 2B5JB 3BDPA 1VRTA 3QESA 1RTHB 2FVCA 3V4IB 1S97A 3OL7A 4DFMA 1KHWA 5HROA 3IGNA 3KIOA 2JGUA 1TV6A 4ECQA 4BWJA 3Q8QB 4DTPA 1EETA 2WONB 2AGOA 1LWEA 1Y97A 3DM2A 3VQ8A 4JS5A 4ED7A 2BDPA 2BRKA 2V4RA 3FFIA 1HYSA 2X78A 4CGHA 5DGAA 4M95A 3RBEA 2ASJA 3V6DA 1A5XA 4N47A 2YNFA 1JLEA 4K4SA 3V81B 1T7PA 3HKWA 4KV8A 3KLIB 3KJVB 4LD0A 2D0CA 5KG2A 3UDLA 3NFAA 3OHAA 4B3OB 3MR3A 1BI4A 4KB1A 2DFHA 5J2NA 5K14B 4RU9A 5DMRA 1L5UA 4E1MA 1BQMB 4Q0BB 2DPIA 1TAUA 3U6FA 1VSEA 4M41A 1C0UB 4QWBA 4W5QA 4NCBA 2RF2B 1IKYB 1K6YA 4ZPCA 4IR9A 3H5SA 4NCGB 4URGA 1ZBUA 4JV1A 4OJRA 2J6TA 4YNQA 2D3ZA 3CDUA 1TL3B 3KLFA 2QE5A 4QWDA 4HHTA 2F8TA 1EETB 4NRUA 4KPYA 2HNDB 2BR0A 4ZP8A 4CEOA 3AVMA 2X6SA 4M3TA 2RF2A 1KVAA 3QZ7A 1KSPA 2GV9A 1GX5A 4PY5A 1BCOA 4TQRA 1NK4A 4Q0BA 1D0EA 1BQMA 3DLGB 2HMIA 1VRTB 2OH2A 1RT4B 2R2RA 3I5CA 1WAFA 3DMJB 3RB0A 4ZTFA 3G86A 3WNFA 4B3OA 1RT7B 5J2MB 5KFQA 4EBCA 4Q45A 2IM0A 4DSLA 4Z4FA 2F8SA 1VSHA 4FCYA 2QK9A 4F2RA 3AVNA 4DTJA 2P51A 3MFHA 2C22A 1IKVB 3BQ0A 3OYFA 3F73A 1BIZA 3CVKA 1KVBA 4TXSA 3MXJA 3L8BA 4BDZA 4KHMA 5KRTA 3S9HA 2V0NA 1S1XA 5KGXA 2BE2A 3AVHA 4IRCA 1HYSB 2HHSA 4ZHRA 3KK1A 1CSJA 4MIBA 3RRHA 3SQ0A 3HYFA 1TK8A 2E6MA 4R5PB 5KG7A 1GX6A 4YMEA 4IFVB 2WONA 1A5WA 1YVUA 4LH5A 5JUMA 4ECSA 3C6TA 2VG5B 1L3SA 3ZT0A 2ILYA 5KRSA 4PWDA 1Z26A 3QINA 5KFBA 4ECZA 2NUBA 4CIFA 2XY8A 3H2LA 5F8JA 3PZPA 5L1LA 3AVBA 3OS2A 2AWZA 4KI4A 4IKFA 1HNIB 4ED3A 3OSPA 1BISA 1WSGA 3D0PA 1LAVA 4M3WA 3PW0A 4FZYA 1RT5B 4NLUA 4FJIA 3DRPA 4E7IA 1S6QA 3N6MA 3MF5A 3VQPA 1X9MA 2BANA 3NL0A 1NK0A 2HNYB 1TKDA 3VQSA 5KG3A 3VQAA 3SPZA 1S1VA 1JLBA 1DLOA 4RUAA 1FKOB 2G8KA 4IH6A 2GC8A 2FVSA 4IG3A 3NF8A 4AH9A 4M3ZA 3EZ5A 3KNAA 4ID1A 1L3UA 4KSEB 4FW1A 1LW0B 1TKTB 3ZT3A 1U04A 1HNIA 1KHVA 2CKWA 4J9RA 5HRPA 4BE1A 5SZTA 1JLAB 2O4GA 4I2PA 3K5OA 1TVRB 4KE5A 4CFCA 4O3PA 2R8GA 2UVRA 4DFKA 3DYAB 3CYMA 1JLFA 4FJ7A 3H5UA 3HVTA 4J9QA 4MK7A 3B6OA 4DQSA 1KLMA 1RILA 1SKWA 3HK2A 4IG3B 3NGYA 1C1CB 4TY8A 5KG0A 4Q8EA 2OPQA 1HQUA 4CF1A 4CESA 3SQ2A 3U3GA 4DEZA 2DFFA 4HUFA 2DY4A 3DOLB 2OPPA 1XR5A 2XCAA 4RZRA 3TARA 4CF8A 3DRPB 1RBTA 3RMBA 5F9LA 3AV9A 4HKQA 4JS4A 2YNHB 3NAHA 2IS3A 2E6LA 4F2SA 5I42A 4O5BA 1IKVA 1VSIA 4ZVEA 2HHXA 2HB5A 4O4RA 3PO5A 2QKBA 1YTUA 1FXXA 2XCPA 2AJQA 5CZ2A 1BL3A 3TQ1A 3FQLA 1SH3A 3QGGA 5HBMA 1RT4A 4CHZA 4URSA 3RB4A 4KREA 2FVRA 4Z4GA 2IC3A 3OYBA 4MFBA 4I2QA 1XR7A 4ZVFA 3JSMA 3QERA 3ZSXA 5L1IA 4MKBA 4O44B 3AA5X 4IFVA 1RT1A 4NCAA 1TL3A 3M8QB 4O3NA 4FM2A 1C6VA 4TQSA 1SH0A 4W5RA 4WYLA 4CGJA 1NKCA 3I5BA 1IKWA 1ASWA 4EO8A 1WSEA 2FBVA 1RDAA 3OS0A 5JS1A 4WE1A 2YHBA 3OL8A 4YP3A 4TSXA 3DOKA 5SWMA 4IRKA 3BSOA 4I7FB 5DG8A 4F50A 4K4VA 3NMAA 4HVJA 3TAEA 3ULDA 3GILA 3CM6A 4FXDA 3SV4A 2R2TA 1ASVA 1UOCA 3ZSOA 4NLTA 4KO0A 3DLRA 5KTQA 1HPZB 1JXBA 3LWMA 3DMJA 3KLIA 2XY6A 5FRMA 3M8SA 3HPGA 3AVCA 3BSNA 2KZZA 3NDKA 2D0BA 4WE1B 4FJGA 3AVLA 3KLFB 4OGCA 4C8KA 5CYQA 2IMWP 1JLQA 1I3AA 2FBXA 3I8DA 3LZIA 4G3IA 1SL2A 1I39A 5FDLB 3NCIA 3NF7A 4FLXA 4DTSA 3AVIA 3GIIA 1IKYA 4OPKA 3S3OA 4B9VA 1RBSA 3H40A 2KTQA 4NLWA 1RBUA 2XO7A 2R8KA 2YKNA 3RMCA 3DLEB 1HNVB 2JEJA 3HP6A 5C42B 3ZSYA 3KLHB 2R2SA 3NF9A 4JRPA 5KT3A 5C5JA 1WAJA 4ECUA 4DQQA 5KFLA 3D5MA 1FKPA 2R8HA 4YR0A 3VA0A 4ZPAA 2B6AB 3C6UB 2F96A 4BE2A 2QV6A 2HAIA 4KAZA 3MXIA 2UUTA 2XC9A 4F4XA 2RDJA 2HHVA 1KFDA 1D9DA 2ZQBA 4FJLA 3PX6A 3QNOA 4CCHA 1X1PA 2RPIA 3MEEA 2EC0A 4DS4A 1O1WA 4QAGA 1Q9XA 3M8QA 1LW2B 1D9FA 3CFPA 4MIAA 4H54A 4IH7A 2UUWA 2R7YA 3KKRA 3JSMB 3QO9B 3KLGB 3KHGA 5KFMA 5HROB 3PW5A 4CHQA 3ASMA 5KFAA 1HYZA 5HRSA 5KFFA 4RW6B 4FZXC 2OA8A 5J2PB 3EZUA 1VRUB 3SQ1A 4Y3CA 3WNHA 5DG7A 1BQNA 3VQDA 4FLTA 2HVHA 3K5NA 2W42A 4FJXA 5HRNA 3M8RA 2KFNA 4J9PA 5F8HA 4PUOA 3QEVA 1LAWA 1S1WB 2HWIA 3K5LA 1S1VB 3T5LA 1RA6A 4F4KA 1C0MA 5J2QA 4B8AB 2LSNA 3FSIA 2OPPB 1R0AB 1S6PA 3AA3A 3HVAA 2FJVA 3LANA 1HQUB 4AHSA 1C1CA 3VA3A 4CHNA 1NJXA 3KK2A 2VA3A 1S5JA 2UVVA 2YV0X 3V9WA 2Z1GA 3HVTB 4LQ3A 3HPOA 4J2EA 3NHGA 3Q8PB 1J54A 1U47A 4FM1A 5I3UB 1RTDA 1TVRA 3FDSA 3ZSQA 3CFRA 1RDDA 1KCFA 1D8YA 4Y2AA 3RMAA 4BDYA 2D41A 1SL1A 4CF2A 5KFOA 2HHWA 2D0AA 3RMDA 5KFKA 1LW0A 4E7JA 1U49A 2IJFA 3MEGB 4GC7A 3ZCMA 3HXMA 2W7PA 1RT2A 3QLHB 3KHHA 1DLOB 1JLBB 3QIPB 2YKMB 2JLEA 4QWEA 2OPRA 1EX4A 2HNYA 4ZHRB 2BANB 4DL2A 4RW9B 1RTJB 5EWEA 3PO4A 2KFZA 4I9QA 3FQKA 1LWCB 3G0ZA 1RT5A 1KRPA 4J2AA 3RAQA 3DLHA 3UQSA 1BGXT 3OYDA 1TKZA 3NGDA 4OPJA 4CEEA 1KFSA 4O3QA 1JLCB 4FS2A 2QXFA 1HRHA 5DG9A 5HP1B 3MR5A 3V9SA 1CZBA 2W9AA 1C2PA 2BQ3A 1RT7A 1S9EA 1JL2A 1RCHA 4E19A 2HVIA 4CIGA 4QWAA 2PYJA 3LPTA 3DLGA 4EZ6A 3SUNA 2GIQA 2KQ2A 1D5AA 3KK3B 4TYBA 3BR9A 4Y34A 1TQLA 5KT2A 4J2DA 2HNZA 4K4UA 2Y1JA 1MU2B 4GVMA 1S0NA 4C8NA 3TAFA 1L3TA 4R5PA 3SI8A 4B9UA 3AA2A 3AO5A 3GV7B 3KHRA 4NCGA 3KK1B 1DTTB 3MEEB 1J53A 4AHUA 1LWFB 4O3OA 4FJ9A 4DFJA 1JLGA 1N6QA 1NKBA 4B9SA 4K4YA 1TGOA 2HWHA 1ZBIA 1C0UA 3VQ7A 3PY8A 1S49A 3OYCA 2VG7A 2Y1IA 1XHXA 4CGFA 5L9XA 4CJWA 3C6UA 4NLXA 3SV3A 4NLSA 4FJMA 4LSNB 4NLGA 3HL8A 1RT6A 3H98A 5KFJA 3AO3A 1HYVA 3TABA 4DSKA 4F4WA 1NK8A 4KHRA 1W25A 2AX1A 4RNNA 2RKIA 1W9HA 2W7OA 3D45A 4O55A 4Z4CA 4IG0B 3KJVA 5HLFA 4FK4A 1FK9A 4B8CA 4KHNA 3E01A 4W5OA 1TP7A 2HMIB 3V81A 1TK0A 4M45A 3MECB 4DG1B 2D7SA 3CIZA 1IM4A 3V6DB 3I0SB 4IDKB 5DLFA 3NAEA 5C25B 1Z25A 4DSJA 3CJ2A 2ZD1A 4FJ5A 4NLOA 3NKYA 1GOAA 1LWEB 1CZ9A 3I5AA 4JV2A 3K5MA 2PZSA 4NLVA 1TV6B 4MK8A 3ZSRA 3RB3A 4HCBA 5F8MA 3OYKA 4CJFA 3UPFA 4KBIA 3CDEA 1B9FA 4O4GB 4DL3A 4O0IA 1RTIA 1HPZA 2ZE2B 3LP0B 3ZT2A 4QOZB 1BI4B 1QE1B 4KAIA 4MK9A 4TYAA 3LWLA 1REVB 4CJQA 4B08A 3OL9A 1J5OA 1TKXA 4CJUA 1DTQA 3MEDA 5F9NA 2IBKA 1ASUA 3NGIA 2E9TA 1C0TA 4I7FA 3QEXA 2IOCA 1S1UB 3CO9A 1KTQA 5KG5A 3GYNA 3TAQA 1B92A 3IRXB 4FLZA 4EP5A 3FFIB 1K1SA 4J9NA 2XY7A 4CEAA 3E01B 1ZETA 2DFEA 3DLBA 1HQEA 4CEFA 3NBPB 1UA0A 1ZYQA 3AVAA 1QAJA 4DQIA 4O44A 4H4MB 2ILZA 1ZTWA 2P1JA 4AHRA 4TN2A 3Q8SB 2FLNA 3VQEA 1KLNA 4RNHA 4I2QB 2FLLA 4LSNA 4RW4A 4JRQA 5T14A 2IC3B 3MR6A 1T03A 4DF8A 3V4IA 2WRMA 2W9CB 4YR2A 4G1QB 5HBMB 4Z4IA 2E9ZA 2B5JA 5CY4A 3U3YA 1HMVA 3CJ5A 4E1NA 1TL1B 4KFBA 3T5HA 2X6NA 4H4OB 3HP9A 5C24A 1U4BA 1KVCA 1VSMA 4JUZA 2GUIA 3LP2A 4CK2A 4TLRA 3LP1B 4CK3A 2XY5A 3AO1A 3T19A 3KLEB 3KMSA 4J9KA 3NH1A 3OJSA 3NAIA 4K8XA 3IS9A 3G6XA 4Z0UA 1WLJA 2IAJB 3DRSA 2FBTA 3TAPA 4CJLA 4LSLB 3GIJA 1S4FA 1T3NA 3L3UA 4ECWA 4KHUA 4M3YA 4DMNA 4FLWA 4ZVGA 5DGBA 4ECXA 2BQRA 4B9MA 3AVKA 1NK9A 1SKRA 3OYJA 4CF9A 3BSAA 2JC1A 3KHLA 2VG6A 4NZ0A 4DSIA 3P1GA 1JKHB 4CK1A 4RW9A 3LDSA 3BREA 2YKMA 4NLRA 2Z1IA 4HYKA 3QIPA 2IA6A 3QYYA 2ATLA 2ETJA 1NOZA 1S0OA 3ITHB 4R0EA 4M94A 4ED2A 3ZSVA 4WZQA 3V6HA 3TAMA 1WN7A 1JL1A 3SFUA 4K4XA 4E7KA 1IKXB 3NE6A 4FBTA 2YNGB 5J1EB 1GOBA 3WNGA 4ZMMA 3A2FA 4KHWA 1WNEA 3RBDA 1VK0A 3V9ZA 2JEFA 4ELTA 2P5OA 3PX0A 3VN5A 1OS5A 4DL7A 4H8KA 4CJ3A 2WB4A 3I0RB 2GIRA 3L3VA 1S6PB 1UA1A 3OSNA 4Y1CA 5DLGA 5J2QB 5KT4A 4DWIA 2G8IA 2VG5A 5KFHA 4KHQA 3MFIA 3C94A 1XC9A 3TI0A 1T05A 4CJEA 4ID5A 1NJZA 3H5XA 3VQ6A 3H5YA 4DL4A 4CHPA 3LPUA 4BWMA 4DU3A 1S1TA 3V1OA 1SUQB 4NLYA 5KFCA 4NRTA 4YR3A 3SUQA 1JX4A 3KLVA 1HMVB 3VQBA 1QS4A 2R2UA 3N6LA 2IM2A 1VRUA 3GV5B 4DLEA 4KRFA 3L2QA 4LH4A 4RW8A 2V4QA 4OLAA 3IGVA 3CM5A 4ICLB 2W9BA 1RT3A 1C1AA 4CF0A 4LSLA 3PJXA 4FW2A 4NLQA 2IAJA 5KT6A 2OYQA 3PV8A 3IS9B 3NH0A 3LP3A 3VQCA 3P83D 4IQXA 2J6UA 4R8UA 5KFWA 3JYTB 3BGRA 4ZP7A 3IRXA 2JEIA 5KG4A 1WNSA 3RR8A 5KG6A 4BE0A 2FLPA 5DQIA 4C8MA 2UVWA 5EUHA 1QQCA 1NKEA 2B6AA 1J5OB 2WCXA 4LY7A 5KI6A 1Q8IA 4FJHA 3GIMA 4K4ZA 4J9SA 2AGPA 4H4OA 2FVPA 5JXSA 1FKPB 4XPCA 4JV0A 4WZMA 3T3FA 2HHQA 4NYFA 3QGHA 3TR8A 1HNVA 2WOMB 3L2UA 3OLAA 1QSLA 3DLEA 3AVFA 4CJSA 5D3GB 4IOBA 4RUCA 1N56A 4DU1A 3OYEA 3AVGA 3M8PB 5J2NB 2WOMA 3PX4A 2GBZA 4NLDA 3UIQA 4CEZA 3TVKA 1N5YA 4JLHA 4DU4A 5KFTA 5KFSA 4KHYA 3GQCA 4H4MA 3OL6A 3DLKA 2V9WA 2Z1JA 5CYQB 2WTFA 4MKAA 3PVXA 2W8KA 1Z4UA 4EBDA 4ECRA 2YNFB 4QWCA 3O3HA 1S9GB 4IDKA 4FK0A 4MQ3A 3SQ4A 3CJ3A 4J2BA 4PQUB 1S1UA 4DTMA 3K2PA 3MEDB 1DTQB 4CHYA 4OKJA 5JS2A 3V1QA 3SCXA 1TKXB 3LAKA 5E41A 2CJQA 4IG0A 3EPGA 3M9MB 2E4LA 1GOCA 3RTVA 4Q5VA 2XRIA 3SNNA 4DSFA 2IDOA 4CFAA 1QE1A 4KHSA 3SUOA 1SL0A 2ZE2A 4KB0A 1RT6B 3SUPA 1VSFA 4E89A 3EY1A 3TWHA 3E51A 4YQWA 1HJRA 2ITGA 2G8FA 2FJWA 1RTHA 5L1JA 5D3GA 4KTQA 3HVWA 4Z4EA 3HVRA 3DOKB 2XI3A 4RNMA 3QETA 4J9LA 1IKWB 3OYAA 1DTTA 3TAGA 1RBRA 4ECYA 2YNIB 2B4JA 4RG8A 4IKAA 1MU2A 2ZD1B 4J9MA 1T05B 4CIEA 2I5JA 5C25A 3ZT1A 1JIHA 1Q9YA 4FVMA 3HT3A 4DTNA 2QKKA 2Q3SA 4Q8FA 4URQU 5HRRA 3JYTA 4BACA 2DTUA 2VA2A 3KKSA 5HLFB 4ZPDA 1XWLA 3T5KA 1SKSA 1C1BB 4KKOA 4E3SA 4E7HA 4CGIA 1SV5B 3ISND 2D3UA 3VQ9A 3RAXA 3CWJA 3G6YA 2IJNA 2OPSB 3O4QA 3DI6A 4RW8B 4CECA 5I42B 4ZP6A 4IFYA 1TKZB 3QEWA 2FVQA 1NK6A 2RDIA 4NLPA 2AQ4A 1LWCA 1RYRA 3MR2A 4GMJB 4CJKA 3PHEA 4B9NA 4WFZA 4GW6A 4WFYA 3TAMB 1T8EA 3IN5A 2XHBA 3OVNA 4Z4HA 3ITHA 1X9WA 3OLBA 4KTWA 4CERA 1S48A 4FLYA 3RRGA 4B9TA 2F8EX 1RA7A 4ZVHA 4EBEA 4PA1A 2HNZB 2O5DA 5DQGA 5F8GA 1ZBHA 2IM3A 1NK7A 1NJWA 1EXQA 3V9XA 4ELVA 1BCMA 3V1RA 3OS1A 4FYDA 2W8LA 2DPJA 1U09A 3NGZA 3IG1A 4M3UA 1SH2A 4IFYB 1RDCA 4FBUA 5HP1A 5KGWA 3VQ4A 3PW4A 2OZSA 1K1QA 4HCCA 4DQPA 5F8LA 2D5RA 2A1SA 2OZMA 3OJUA 4YFUA 3GIKA 3OYLA 3DRSB 4OL8A 5J1EA 4OKKA 4FLVA 4N41A 3OYGA 5L1KA 4CJTA 3H4DA 5KFYA 3QIDA 1R0AA 1IO2A 2FBYA 4NYNA 1HARA 2C2RA 4CGGA 4RNOA 1S6QB 4DS5A 4F4YA 1BHLA 2G8UA 2WHOA 3CQ8A 4FJJA 4PUOB 3HJFA 5T7BA 3H59A 1RBVA 2VWJA 1NJYA 4RNFA 4KFBB 4U7CA 1TL1A 2IM1A 4Q44A 4K4TA 4W5TA 1S0MA 2AX0A 2EX3A 5FROA 1I6JA 4G1QA 5EU7A 3QEPA 3KTQA 4PWDB 1YTAA 1X9SA 3LAMA 4KI6A 3SZ2A 1U45A 4RW4B 3QO9A 3C6TB 3KLGA 2B43A 3GV8B 3BJYA 3WNEA 4GC6A 3KK2B 5KFXA 4F3OA 3CG7A 1J9AA 1MMLA 2KZMA 3CJ4A 3EYZA 4M42A 3CJ0A 1LW2A 4ELUA 1HQEB 1RDRA 4E0DA 1A5VA 4C8LA 4I9LA 5EDWA 2BE2B 1S1XB 4N56A 2IGIA 3BSCA 3OYMA 4CEQA 1S9GA 3PW2A 4NYZA 2C2DA 4K8ZA 1WSJA 1S1WA 4CHOA 2YNIA 3S3MA 1QAIA
chains in the Genus database with same CATH superfamily
3P5JA 2D74B 2MB0B 3T1HJ 3T1AA 1RCOB 4QPXA 2JVRA 5J2MA 4F67A 3AO2A 4YN3B 1NHVA 2CFXA 3RAMA 4DFPA 1JJCB 1TUUA 1HKBA 4Z94A 2GQ2A 2VFSA 1U6BA 2E9RX 3Q86A 7AT1B 3TJ8A 3TZWA 2E5LK 5KFEA 2VZ9A 3ZSZA 2ZNYA 2HAFA 2P9NA 3F0NA 3OY9A 2WBRA 1XI1A 2IRYA 3PTWA 3G10A 1I1GA 5M1PA 4JAXA 3P96A 3O4WA 2OMLA 1X5TA 4CH0S 3WXMB 3DLLQ 3BDEA 2G13A 3ICLA 2PI5A 1NPPA 4CZIA 4R8UB 3RWUA 3VEVA 2GMLA 2UXCJ 2PO4A 4DV7K 2RKIB 2FXUA 3TZXA 3MTJA 2KG0A 4WP3A 2B9YA 4ZLNA 5IXUA 1HNWK 1RTIB 4O5FA 1XNQJ 3L95X 5E2QA 3KOAA 3ZZ0A 1F21A 4DF4A 2VG7B 3N4PA 2RH3A 1RABB 4JI5J 4USHA 4ILMA 3QATA 4CEDA 5E5NA 2VFTA 4CJ7A 1RSCA 1IG9A 3DM2B 4DR5J 2OUGA 4NXNF 1RWNB 2LQBA 2RDDA 4ID5B 2J0SD 3D0GE 4O3RA 3RGIA 3KNGA 2Z2ZA 4HL9A 1ITGA 3TSQA 2LEPA 4FS1A 3KK3A 4XK8C 4AHCA 4G65A 2HSTA 4DB3A 3VETA 5FRNA 4L74A 1FNMA 1NJIT 5BYSA 4OQJA 3D4JA 4D3HA 1R8BA 2GMJA 1UFWA 1S9EB 1WTBA 4OHWA 1T11A 2C28A 1G4CA 2PYLA 3ISNC 3G87A 5A8RB 2CIMA 5C7PA 4U7UD 5KFZA 5KFGA 3MUMP 4DTRA 2YNGA 2MSSA 4DV2J 2YNHA 1AZSA 4P74A 3EPIA 2QLXA 4JI1J 4HTUA 3OHBA 5LJVA 2E44A 1S1TB 3MM9B 1FXLA 2NSBA 1RT1B 4CEBA 3AJ1A 2AU0A 2XGQA 2F9DA 2OTLN 3THXB 2R8IA 5D0EA 4OGEA 3R3TA 2VWBA 3LALA 1MN9A 3DYAA 4DL5A 1TUYA 1JXLA 4CFBA 4FLUA 2QWMA 4LFBK 3TP2A 1ZBLA 4U7BA 3M9OB 3AA9A 3P4UB 2NLXA 3VAFA 4JKBA 4O0JA 2G8VA 2BBEA 4MDBA 4LFAK 4IR1A 4K7QA 5CAAA 3OPKA 2I1RA 2HHTA 5L9NA 4LVNP 2UVUA 2F40A 4RO0A 3F5TA 3IAYA 1WEYA 1IH7A 1RUSA 3WXIA 5BN9A 4KIAA 1Q53A 3D68A 3IR7B 3TUZC 3ENOA 2PY5A 4HTIA 5HVGA 4PR6A 2GTDA 2MZ1A 1YX2A 2VOPA 1QVFR 3JSRA 5K9FA 3Q2SC 4LF9J 3LP2B 2IJRA 4RW7B 2KXNB 4BR4A 5C24B 2XMKA 3C16A 3SYZA 3FFKB 4AHVA 4IUFA 4BVOA 1XTZA 2KM8C 3MM8A 2CJBA 5CYMB 4I6MB 1H7XA 5GMKa 3JSYA 5G0RB 2HURA 3HZEA 2HK3A 2UUAJ 3RBXA 3ZEUA 4WYWA 2OO4A 1NU4A 1YVNA 2C42A 1NXIA 4ED1A 1JXEA 3QZ8A 4DPUA 4EIAA 3NOGA 3CJSA 1ZM3A 5LOQA 3DN9A 4FF2A 2BW2A 2RN2A 4WXWA 3T5JA 4BRDA 3VGTA 4B1ZA 1K8KA 2HQGA 4A2BA 2A1RA 3BR8A 3RBZA 1WSRA 2LVWA 1U48A 3LW5C 3CF5L 3QNNA 1WSIA 4XPEA 2DT9A 1REVA 4M3XA 5KFDA 2QEXS 3KDNA 1QTMA 5AQMA 2GJIA 1BWFO 2QRRA 1WC4A 1U2RA 3BDPA 2XG8A 1VRTA 4QYRA 1A9NB 2MZSA 1KTVA 4DFMA 4DPYA 1OYDA 3AY0A 3IGNA 2OIHA 3CGIA 4ECQA 5E26A 2HBJA 4A8XA 3UW1A 4DHYA 1TL7A 2WONB 1DARA 1LWEA 1QJHA 3R5AA 3ID6A 4JS5A 2G2ZA 2MKJA 2BDPA 2ZBRA 5LMUF 2QA4S 1RK8A 3CF5Q 2NRHA 3G82A 4CGHA 3GJSB 4M95A 3W62A 1AYEA 3CTRA 4N47A 1NSKL 2LXUA 4EFAC 2ZITA 3EE8A 3KJVB 2K2PA 5BREA 3ILIA 2RVJA 5D4LA 2D0CA 4FVUA 1FRJA 2YJFA 1BUXA 3NFAA 1YZ7A 2JSXA 1UVLA 2PEHA 3BF4A 4LFCJ 5K14B 2H5EA 1JJ4A 2DCLA 1BQMB 2FIUA 4Y2IA 2RIJA 1YF5L 1VSEA 1C0UB 4CZLA 3B8HA 3AD9C 3QPIA 1IKYB 2AEJA 1P6TA 3NS7B 1FDAA 4PG8A 2OANA 1H2VZ 4XH1A 4OJRA 3POTB 1TL3B 2O8EA 4QWDA 2PI4A 1EETB 4CLTA 4ZP8A 2XSJA 3AVMA 2C2MB 2RF2A 2FZCB 3QZ7A 2A42A 1YJ9S 4TQRA 1RCXB 4OZNA 1D0EA 2LA4A 3ZC4A 1VRTB 3J7YU 3DMJB 2DNKA 3RB0A 1QUPA 2I2YA 2GQCA 3HFKA 1T44A 2D4WA 4B3OA 5J2MB 5TKYA 4Z4FA 1JWWA 2QK9A 2APOA 3R5DA 3BQ0A 4A8WA 2WC9A 2P6SA 3LUYA 4DV0J 1F3FA 4DUZJ 4TXSA 3L8BA 4BDZA 1FE0A 4BRPA 1S1XA 1Q82O 4ZHRA 2RSQA 2DRBA 1RB0A 5RUBA 3VTHA 1TK8A 4R5PB 1OPIA 5KG7A 1HL6A 2HMPA 3TEGA 2BX6A 1S3XA 4CWBA 1NGEA 4ECSA 3OBWA 3P49B 3KG1A 3AAWB 3VALA 3ZZUA 3FEYB 4C97A 3A3NB 2ILYA 3ZTPA 4ECZA 5IFMA 3H45C 2N3OA 4Y0FA 1KBRA 2U2FA 3AY9A 3TOQA 4CIFA 4L76A 3H2LA 4KT0C 5F8JA 2CJAA 4QS7A 2M4MA 1V5IB 3DGVA 4G1IA 2YTCA 2NREA 2KJWA 2DH7A 4OO1J 4FZYA 5H1SQ 4A2AA 1IQTA 2R7SA 1UJ5A 4FJIA 3I82A 3VAKA 5AQVA 3QT8A 3NL0A 3A0IX 2HNYB 2R4FA 4DV4F 1DLOA 4IH6A 3J81O 3EJMA 1IBKJ 3UB5A 3ZZRA 3OBIA 1U04A 1X4DA 4YOUA 1KHVA 2CKWA 4CD1A 4WQ4C 5AQNA 2GQQA 3G96A 2DEIA 1FRIA 2O4GA 3G2XA 4I2PA 4KE5A 3LO3A 5HJYA 2R8GA 4A8FA 4WIQA 3G6ES 3GG1A 4GVLA 1Y5LB 2AMCB 1N33J 3SXLA 1SBRA 3VCDA 4CZFA 1EHWA 2H9ZA 1U2VA 1KLMA 3NG8A 1R8PA 1GXLA 3NGYA 1DURA 3A8KA 2VQEF 4CESA 3U3GA 2NUHA 3BZKA 4QS9A 3DOLB 1AUDA 3OQ2A 2FJEB 1S6UA 4CLLA 3DGPB 1SC3B 5AJ3F 4JS4A 4IQMA 2QLFB 1MROB 2POKA 5F3TA 2RAQA 2HS4A 1VSIA 4FYYB 4UY8O 3I55S 1UKUA 4O4RA 1IG8A 4GKJJ 3PO5A 2QKBA 2GVDB 4YDDB 1BL3A 1SH3A 5IS2A 4CHZA 2FVRA 1HFEL 2KHCA 1R0BG 2IC3A 3K9KA 3GSDA 4M5HA 1RAHB 3D6MB 3QERA 2PN6A 5HQMA 3E1YA 1FD2A 4IFVA 3OXGA 3M8QB 4O3NA 3DNCA 4EGLA 1VQPN 4W5RA 3D2WA 2Q3PA 1SJRA 1WSEA 2ZC4A 1H38A 3OS0A 3DOKA 1NU0A 3FK4A 4I7FB 2NSCA 1O6XA 4BRIA 4K4VA 4CZHA 1NG9A 3F56A 1N34K 2V51B 3ULDA 2WSEC 4FXDA 3HHLB 3SV4A 2JNJA 4OYXA 1DGKN 3ZSOA 3K8VA 3VEYA 4KO0A 1OSDA 5KTQA 1SPBP 4AQYK 2M8HA 1NB2A 3LWMA 2BXJA 1HUXA 5E7OB 3HPGA 3HLUA 4MKVA 3AVCA 2KZZA 4JD2A 2D0BA 1Q5YA 4WE1B 1KEKA 3EVOA 3JTOA 4NB4A 1V4TA 2VU5A 4NLBA 3LDPA 2VJVA 4OGCA 3U7JA 4NO7A 1JLQA 2A41A 3EEQA 1JMTA 1SL2A 1I39A 1VQSA 4L3QA 2ZHBA 3O9UA 1H1VA 1OIAA 3B4MA 5B08A 2KTQA 3FZMA 4ILGB 1HNXJ 3DLEB 3HULA 4O23A 5HJXA 1KQSM 1HNVB 2W2QP 3HP6A 1B0TA 3CCVN 3NF9A 3WQPA 1U8WA 3AARA 2QT7A 2P9GA 4YR0A 2CQCA 3Q8YA 4NA1A 3DXMA 2HAIA 2CWXA 4H5NA 3MXIA 3QRPA 4F4XA 4JOUA 4E98A 1NMEB 3N4WA 4LUBA 4FJLA 1X3MA 3QNOA 1YQHA 3CJ7A 3MEEA 2LXFA 2N3LA 3VZHA 3UD4P 2EC0A 1O1WA 1M1KT 4JEPA 1Q9XA 2YKQA 3W65A 1Z6RA 1LW2B 2DNPA 1R89A 4I6AA 1YJNN 1U2VB 5KFMA 2P9SA 4CHQA 3ASMA 2P9LB 3B8AX 1RAOA 4RW6B 5KFFA 4LFCK 5J2PB 1SC6A 4FXWA 1PJ7A 2Q43A 1Z05A 3SQ1A 5K8PA 1YGYA 2V2VA 3VQDA 2LXIA 1M5OC 2O66A 1S22A 4O0NA 1OSCA 4DR2F 4J9PA 4ISGA 2RT3A 4ILRA 4WFAL 2DH8A 4OLPA 3P3DA 5ETKA 1KAYA 1KXPA 1E6YB 1S1VB 1WKKA 2DY9A 2OI2A 2YX7A 1RA6A 4B8AB 1BD6A 4ZLPA 1R0AB 1XBWA 3J81j 2OSQA 3AAQA 3TX8A 3VA3A 4U7UK 4CHNA 4BRAA 1NJXA 5AFUH 1S5JA 2IFXA 2UVVA 1UZDA 2BUNA 1Y5IB 4X66F 4M5GA 2HSEB 2NXUA 3KK7A 5E3QA 3NHGA 3Q8PB 5I3UB 3B4DA 4CT8A 1TVRA 2O8BA 3VR1A 1KCFA 5KFOA 2F4VK 4YOVA 2MJUA 2ERRA 1LW0A 3CJ1A 1LK7A 1GTHA 4E7JA 4CRJA 3ZCMA 4M5LA 3VAJA 3HXMA 1FJEB 5DM6L 1GMUA 1DLOB 3QIPB 2UV8G 2ZH2A 2OPRA 1NBWA 1EX4A 4ZHRB 2BANB 1CQMA 2XS2A 2KFZA 1RWVB 4LC9B 1RT5A 3L4QA 3O8MA 3K17A 3RAQA 1X4HA 3UQSA 2I9SA 3OYDA 1TKZA 4OPJA 1AFIA 3NS6A 1B3TA 1HRHA 2QXFA 5HP1B 3MR5A 1RWKB 4ZIVA 3FCVA 2W9AA 2W4CA 1JL2A 2KRRA 3N4QA 1RU1A 1P1LA 2WVCA 2PYJA 4EHTA 1CJUB 4EZ6A 1NLKL 1DQ9A 3QICA 3CCZA 5KT2A 2HG4A 4K4UA 2VB6A 5CE3A 1MU2B 1S0NA 1L3TA 3NY0A 3SI8A 3KHRA 3KK1B 3M2VB 1VC0A 3MEEB 4AHUA 1H6KX 3PIPQ 4B3RK 1NWKA 1UW4A 2JDJA 4WQ5A 3JAMU 2Y1IA 3GONA 4H0TB 2CH6A 4CJWA 4P10A 3C6UA 2RILA 4B02A 3NGRA 5KFJA 4JI2K 2W2PP 4F4WA 2X7IA 2DIUA 1W25A 2YX4A 4DCJB 4KGKA 4RNNA 1W9HA 3PEHA 4OV6A 2ZVIA 3D45A 4LIRA 4B8CA 2C2ZB 4W5OA 2QLBB 3VAHA 4R25A 1KD1T 4DG1B 1KONA 2C3OA 3V6DB 3I0SB 4I6WA 3CJ2A 2EBGA 3QAUA 4FJ5A 4YB7A 1NGHA 2V94A 4NI2A 4ES2A 4X62K 3GR0A 1LK5A 1CZ9A 1W7WA 1F9EB 4CI0B 4QPTA 6FD1A 3MM6B 2KLAA 5DDRC 4WFBQ 2YHXA 4HCBA 3OYKA 1B9FA 4JV5F 2A5XA 2CAJA 1H0HB 4DL3A 1HPZA 2E2PA 3AOCA 1WB9A 4MK9A 2K1RA 5E3AA 2HFSA 2HQDA 4G1PA 5IT9O 1HR0J 2AJ1A 3U1MA 2WVBA 2UXCF 1Q86O 2Q97A 1ASUA 2IBKA 1OQ6A 2E9TA 2VD3A 1S1UB 2YCHA 1B92A 3IRXB 1VR6A 3FFIB 1T6DA 4CZKA 2XY7A 4LF9F 5FPNA 4XH5A 4FOEA 4CEFA 3NBPB 5M1QA 4OZ1A 3AVAA 4FKYA 1T9YA 3NGTA 2P1JA 5D4OA 2PA3A 5BRHA 1VS3A 2HVDA 2FLNA 2FLLA 2MHNA 4C4WA 1UL3A 2O01C 3V4IA 4U96A 4G1QB 5HBMB 5DETA 4Z4IA 5CY4A 3U3YA 2ROGA 5J1NA 3CJ5A 5D0GA 4I6YA 6AT1B 4RUBA 1IBLF 4KFBA 4RR5A 3C16B 1HNXF 2BH1A 3HP9A 2QI2A 1VSMA 2GUIA 1SVDA 4IDHA 2ROPA 4CK3A 2EFQA 3RRKA 5IZHA 5DM7L 4B3SF 3LM9A 2WFBA 1WC5A 2A6AA 4ANEA 1IJEB 2CQ1A 4KPCA 4OHXA 1YJWN 3B6BA 5ETPA 1WLJA 2IAJB 4DV4K 2EWSA 4IEIA 4C11B 5AE3A 1S4FA 3L3UA 3DFEA 4FOIA 2L9NA 2XS7A 3PJ9A 3UR3C 3FR0A 1QZ5A 1YSJA 3CCVS 3TA1A 4HHJA 4H0PA 4NZ6A 2HFVA 4OX9F 3FGVA 3OYJA 4UOHA 2VG6A 4JN4A 2HRUA 3P1GA 3VF2A 4CK1A 1AT1B 4QYZJ 4ES1A 2CJ9A 5BRFA 5KPTA 2RU9A 3SMPA 1NDKA 3QIPA 4U95A 2IA6A 2RMLA 2ROEA 4WQ5C 2ZWOA 2FJBB 3MCAB 4R0EA 4M94A 2GFFA 4G6VB 4DUTA 3CCES 3MI7X 3V6HA 4WP8A 1WN7A 4E7KA 3CMES 1NGJA 4PXBA 2DHXA 4P6QA 1KQGB 3LGMA 3NE6A 1T3OA 1Q82T 1WNEA 2DJWA 4J5OA 4P72A 1T9WA 5CCMA 3EVMA 2DR9A 2ZUAA 4ELTA 2FJAB 3R6LB 2P5OA 1P9QC 4DCPB 2CH5A 3VN5A 3R6GB 2CGJA 3LGNA 5A0YB 1FJGF 1UZHA 5D4NA 2KH9A 3O3LA 4CJ3A 4HH1A 3IA0A 2RQCA 3L3VA 3ZTRA 4UZBA 1UA1A 3A1YG 2M8DB 2HK2A 3OSNA 4Y1CA 2IMOA 4JI7K 1B7FA 3FZ2A 2VG5A 4JK8A 1WUAA 1HBUB 3FMBA 3MFIA 2HHHK 3IR6B 2CRLA 5CHCB 4ID5A 3UCUP 3H5XA 1SAZA 3VQ6A 2X3DA 3V1OA 2U1AA 5DS7A 1NGFA 4FN5A 3D2FA 2YWFA 1JX4A 3KLVA 2HS0A 5AT1B 1VRUA 3GV5B 4DLEA 1VLOA 2FSNA 4LH4A 1VQ6N 2DVIA 5JJBA 2VQFK 4G9ZA 1FRHA 4LR7A 2FD2A 3M7VA 2NUUG 1C1AA 3A3OB 4C0BA 4LBHA 2CG4A 2W40A 2UU9F 4BRNA 1H2TZ 3LP3A 5LL6Z 3VQCA 3THWB 4UY85 3CMAN 1VQ7N 3ENHA 5KFWA 2UUCK 4OHVA 4UOFA 2XMMA 3AOAA 5C10A 3EGVA 5D8HB 4BE0A 4JV5K 5I3PA 3OVAA 1WOSA 2UVWA 5EUHA 1C4AA 2WCXA 3GIMA 4K4ZA 5LSOA 2AGPA 1WACA 5GADI 3CJQA 4DV6F 2L9WA 1HNVA 2WOMB 2Z30B 3M5RA 5D3GB 4IOBA 1JCGA 3H3OB 2PC6A 4ZVQB 4V1Ak 2QL5B 4NLDA 2GBZA 2BW7A 3QGPA 4CEZA 3TVKA 4JNEA 1J27A 4E8UA 4DBQA 3GQCA 4QBUA 2V9WA 2Q66A 2KN4A 2Z1JA 4M5KA 2E29A 2BJ8A 1BY9A 1IR0A 1Z4UA 3BS9A 2X3GA 4CH7A 3SLCA 3DJCA 2EC2A 2EG1A 4FK0A 1REGX 3O9RA 4UUWA 2WW8A 1D9AA 2VFVA 4PCQA 4DV5F 1DTQB 3J80U 3TX0A 5JS2A 1TKXB 3LAKA 5E41A 1P27B 1CULA 2CJQA 4IG0A 3M9MB 3RTVA 1HNZJ 4JI8J 1S77D 1HNWF 4GVBB 2IDOA 4KB0A 5LT5A 1IN0A 1VSFA 4BY9C 3D1HA 4YQWA 2VC1A 4NOHA 2LQ8A 3IBWA 3DOKB 1LWXA 4TLQA 4DX5A 1VQKS 1EARA 4RNMA 2CJKA 5AQUA 5HMWA 1IKWB 3OYAA 2F7TA 3ZZZA 2B9WA 1NM1A 4MMOA 1ZOTA 3TAGA 5AXKA 4HACA 3J7YI 4ECYA 2YNIB 1MU2A 5GAEU 2ZD1B 1T05B 3GFZA 2EXUA 1Q9YA 2KL8A 4FVMA 4JI7J 4RJVA 2Q3SA 1WI6A 2J0WA 4Q8FA 2OFGX 1O8BA 3D7EO 4BC4A 2DBBA 3T5KA 1SKSA 1IXKA 1C1BB 1K0TA 4E3SA 4CGIA 3GR1A 4AFFA 1HHQA 1KR4A 1U0SA 5I42B 2HPUA 2DISA 4IFYA 4DX7A 1IM6A 1V5VA 1LFWA 4B3TK 1NK6A 4BG8A 4DV4J 2AQ4A 3CCTA 2YX6A 3MR2A 4GMJB 1U0HA 4WFZA 4GW6A 5IWAF 4YS2A 5B7WA 2XQCA 4YUDA 1VFJA 3OVNA 2E1MC 1X4BA 4FLYA 2E1YA 1OJ4A 3SCIE 3AJDA 4ZVHA 4EBEA 2O5DA 2DNOA 2WW4A 5HVHA 4Y2KA 2NRZA 4KHPJ 1G3OA 1E6VB 3C3LA 2VFRA 1TUVA 5G4DA 2OJ3A 1BCMA 3FLCO 3OS1A 4FYDA 2VV5A 4AXIA 2DPJA 1MMNA 4FWMA 4M3UA 1SH2A 2VF3A 3PW4A 1FFGB 2V50A 3HI0A 3R5GA 2VDIA 1Y3JA 3OJUA 3RYLA 4DPWA 4YFUA 3GIKA 3DRSB 5J1EA 2Z58B 3A8IA 3WC0A 3H46O 1RZMA 1U26A 4DXLA 3CXCM 1S6QB 5KQDA 3FVYA 1YAGA 4F4YA 5JLFA 3M1VA 1NH7A 1VQ6S 2IDLA 3TW0A 2NNWA 4HTLA 3H59A 2ITMA 1C0GA 1RWUA 1HWIA 4IOXA 1LFPA 3CJRA 5AR0A 4KFBB 2IM1A 3PFOA 4J90A 2O8BB 1V3ZA 2ZDPA 3IWXA 5BR8K 4DV1K 4PWDB 1X9SA 3EN9A 2QXLA 3GZ7A 3SZ2A 5A8RA 2HBKA 3CPWR 3KLGA 2B43A 3MMVA 4CZGA 4JI6F 1J9AA 3EYZA 1LW2A 4ELUA 4HVZA 2HRYA 4C8LA 1GLBG 2OTJS 2GO9A 1PYSB 4I9LA 1LQ9A 1M5HA 2ZZTA 3CCUN 3BSCA 4CO2A 1VQYA 4K8ZA 2QA1A 1I94J 4Z7CA 4AQYJ 4Y0WA 4AT1B 3M6UA 2RE1A 5F0UA 1TK5A 4ANCA 2F5GA 2Y8WA 2VYPA 4ZDNA 2ZKTA 1S5ZA 3K5PA 3SI6A 3KLHA 3NF6A 4DTOA 5C42A 2X1AA 5IM0B 4ZN3A 3O6WA 4KR0B 3TUPA 4LFBJ 2YKNB 4USJC 2CQHA 4DPXA 3W1YC 1S72S 5ETVA 4CE9A 2O4IA 3JQKA 1X4GA 1WOPA 4CVNE 4CM2A 2HNDA 1MWKA 2F65A 3GE1A 4ED5A 2Y8YA 3Q83A 1JLQB 4N76A 1QD1A 1ZH5A 4CJPA 3MXMA 1VSDA 4XIUA 4U8VA 4JHDB 5JVHQ 2YH0A 3JAMO 1CG2A 1VSLA 4BBYA 3ZETA 2XGPA 5C2CA 3ZTQA 3MECA 2W2OP 1C0TB 3BGRB 1H73A 1ZBFA 1JCFA 1CBKA 1TU0B 1ROFA 1N48A 4DL6A 2X74A 4E7LA 4W4MA 3LA0A 3DLKB 3B6PA 2ZKUA 4EZ9A 3BO3A 2ALZA 2I6WA 1OVQA 3VAIA 1N5YB 3QAEA 3L7OA 2DHHA 3SSSA 1NHKL 3N6NA 2FC0A 3HM9A 4EP4A 3BF3A 4CJ4A 3VESA 2FDNA 3A5NC 3F2KA 2D9PA 4QCLA 5A2QO 4OZ2A 1B7YB 5F1XA 1NB7A 1QSYA 3NWGA 2OKQA 2VBYA 3HKZD 2RHKA 2V8DA 5E33A 2XI2A 2BUPA 1CC7A 1NPKA 2M5YA 3KG4A 3R5BA 4ZKAA 3IWNC 2YWEA 2P5GA 2ZH7A 2V5HG 4FWPA 4DN0A 4MFBB 4M3RA 2DKOB 4DTUA 4H03B 1PCAA 2CQ2A 4NMXA 4CJRA 4K2JA 3GG4A 1FWPA 4WXOA 3ET6A 3BQ1A 3PYFA 4ZPBA 4DSEA 4B3MJ 4DR6F 2C3UA 4QW8A 4U6PA 3BKUA 4GKJF 2ATQA 1TAQA 4USIA 1TMMA 2H5IB 2JVOA 2W9BB 4ICLA 4NXMF 1GNKA 3RB6A 1JLCA 1KQSR 4AHTA 2CQ3A 2O67A 1SCJB 3VENA 4K5RA 3EKSA 3VGLA 4HHUA 1H2UX 1M1KO 4DV3K 1IKXA 4CYUA 2YWGA 1M1HA 1R27B 1YVFA 4J9OA 2WUSA 3O4NA 1W0HA 2V67A 2HHUA 2YI1A 2QW9A 4ZVPB 4MO4A 1I3OB 5KG1A 3I32A 1B9DA 4F8RA 1CJKA 2AJ2A 2GIFA 3QNWB 4JI5F 5AFUA 1HNXK 3DRRB 4PPDA 1RT2B 3MTKA 5MLCV 3HOSA 3O3FA 4CJVA 1E4GT 5LJWA 5DDPC 4CGDA 1YBAA 1NJIO 4X64J 4C9DA 4CLSA 3KD1E 1EZZB 1JLAA 3NH2A 3BGFA 2QWQA 2OGUA 1Y11A 5A0YA 3M32B 3L2WA 5A8KB 3S1TA 3RR7A 5CCLA 4JYAK 5AQGA 4RW7A 5E84A 1TTHB 4LSZB 3K57A 4L3NA 3QFPA 4NWBA 3IG1B 1ZTTA 3MPUB 4DTXA 2EW9A 4IH5A 1NK5A 3TUIC 4JI3J 2CQDA 3IP0A 3H08A 2F9WA 1Y0HA 3MUVP 3UNYA 3CIMA 3M2RB 1VSKA 2O1PA 4QIVA 2Q1NA 3W2VB 1M5KC 1L3VA 2KW4A 1HI1A 3H3NO 4FK2A 1SZ2A 4ZTJA 3PW7A 3CB4A 4OYMA 4H5RA 4X84A 3M9NB 4N5SA 4F3TA 4XTTA 2ASDA 3ILJA 3O6QA 3GWCA 2DIVA 3IAM9 3SDEA 3CMQA 4WFXA 2VICA 5M1OA 3OXLA 3SBTA 3K58A 2DRAA 1N32K 3L2VA 1JKHA 3G6VA 3SFGA 2QL9B 4LBIA 4J9UE 5CZ1A 4K4WA 4C8OA 4CLPA 4X65J 3CCLS 2P9SB 4Y1DA 2OPSA 3VQQA 4KTZA 2DNGA 1SS6A 1XQSC 4M1KA 4EU0A 3IXQA 4KGXB 1APSA 1BMQB 3DRRA 1QUVA 4KKOB 2CVEA 4CNYA 2V2QA 2KB2A 4WTOB 1NRKA 3RW6A 1C0FA 3KD5E 4IOCL 4ZPTR 2BRLA 1CJTB 2GNKA 4PG6A 3UVJB 4MDAA 4UQTA 3KLEA 1ZS6A 3O44A 1NSQA 3BYPA 1RYSA 2PMWA 4L72B 4CLUA 4JKGB 4JI2F 2CDRB 2E2OA 5D77A 1UVKA 2XWYA 2BKNA 2KKHA 2V8VA 3O80A 2AYEA 4YEAA 4ECVA 2HF4A 4Y2CA 1I51B 2XMJA 5L39A 4DOZA 4AL6A 1RTHB 3OL7A 5HROA 4PKHA 1TV6A 3ZYYX 4DR5F 3Q8QB 1DHMA 3QWPA 3C2PA 2RRAA 2A3JA 1Y7PA 3CDBA 2MQLA 3QQCD 1RHRB 3A12A 3SIPB 5A2QY 4TU9A 1PKUA 4N7TA 3WQTA 3EDRB 2ZNZA 2XLJA 2V4RA 2V2ZA 4WF9Q 1HYSA 1I5OB 5M1NA 4MT1A 1F5CA 2LDYA 2ASJA 3V6DA 1PYOB 2H4YB 5M1KA 1ZPVA 5ETMA 2YNFA 3SBGA 1K47A 1NM2A 1WJ9A 3THTA 4LF7J 2AF6A 2ZBQA 3AQOA 3HKWA 3ZNUA 3VWSA 5KG2A 3UDLA 4C98A 3MR3A 4BRMA 1ZM9A 3ETOA 1U2CA 3Q22A 4E1MA 2B9EA 3IFRA 3T1HF 2HVEA 1Q1KA 4PG7A 4M41A 4QWBA 2BE7D 2RF2B 5JMVA 2C2KB 1K6YA 4O8UA 4F04B 1BA1A 3ZX3A 3H5SA 4NCGB 1ZBUA 4JV1A 2J6TA 4YNQA 2BABA 3KLFA 4DUZK 4UT4A 4HHTA 4NL5A 4KPYA 2BR0A 3VEOA 4HDGA 5DDOC 1PYTA 3M2UA 2ZHAA 4PYDA 3VERA 4X4VA 2QA2A 1GX5A 4PY5A 2KJVA 1BQMA 2NRTA 4LR8A 3EE9A 3R2DJ 3SSRA 4DR7K 5BR9A 1WAFA 2GGPA 1BWVA 1UFKA 3THWA 4M5IA 3PSFA 1BHNA 3HTVA 5CD4A 1VAZA 3AVNA 3I4PA 2P51A 3QFWA 2C22A 4K0KF 1IKVB 4FXVA 3A8YA 3WIUA 4JI8F 1HNZF 2EI5A 3MXJA 3D3BJ 1G6BA 2YKOA 3HHLC 3H42A 3FGUA 2PD1A 1CJTA 2M9KA 5JLHA 1HYSB 3SQ0A 3HYFA 1EWRA 2E6MA 3G8SA 2Q1LA 4DR3K 1A5WA 2YQ3A 1BDGA 1KAZA 5CHIA 3C6TA 1F5BA 2LYVA 2VG5B 3EGNA 4GMKA 3ONQA 1ELOA 3LDQA 4ALZA 4OLOA 3ZT0A 3MCOA 2AEFA 5KRSA 1VQKN 1Z26A 3QINA 1P8GA 5KFBA 3OTCA 2BZ2A 4I6MA 1IBMK 1UVMA 2W2MP 2G2YA 2VQFJ 1YLXA 2AWZA 2J9DA 4KI4A 4IKFA 1S76D 3OSPA 1Q8LA 3O1LA 1BUPA 1BISA 1WSGA 3D0PA 2N4CA 1HKAA 1YUWA 1RKIA 2KKZA 1EWQA 1RT5B 2NCKL 4NLUA 1MA9B 4E7IA 1S6QA 1SIWB 3D7SB 2PSZA 4ZCMA 3B54A 2KRBA 1LEOA 3VQSA 3VQAA 1S1VA 2ZH9A 4RUAA 2MKSA 1FKOB 1KOHA 3MN6A 4ZVTB 2FSJA 1RHKB 2NXEA 4UOGA 1HNIA 3W2WA 5HRPA 1VQON 3N9UC 1JLAB 4C3MA 4CFCA 4QR0A 3HFZB 5IQ6A 1Z2ZA 4FJ7A 3TRGA 3H5UA 4N77A 3B6OA 4LF6J 1C1CB 1BLUA 5KG0A 4Q8EA 3VEXA 3TJ9A 1HQUA 3GB0A 2R7UA 4CF1A 1O51A 3SQ2A 2ZVSA 3HHNB 5KAKA 2DFFA 2DY4A 2OPPA 1XR5A 5EGYA 2DR6A 2QEXN 3TARA 5ETSA 1RBTA 2BJ7A 5B0AA 4M7XA 4FWNA 3R7SB 2E6LA 3U9ZA 2ZGZA 3DXMB 4YOXA 4RL1A 4O5BA 4P2FA 2QGFB 2CPJA 1TMJA 1O13A 1NLVA 3J7AN 5EX5A 2K7KA 1IR1A 2XCPA 3IRWP 1VQPS 4OYWA 4KBOA 5CZ2A 3QGGA 4GKKF 5HBMA 1RT4A 2VGNA 5M1FA 5CR4A 3AFGA 2FYXA 4I2QA 1XR7A 3N5BA 3TZZA 3ZSXA 2Z8QA 4DQ8A 4LRAA 2QC3A 2MJNA 1TL3A 1HBMA 1E3MA 3H6EA 4WYLA 4CGJA 3J7ZT 2J8AA 1IKWA 1ASWA 4EO8A 2VIHA 2FBVA 3OL8A 4YP3A 4CYUB 1U8SA 3DLJA 3PLAA 3AB2B 1RKJA 3BSOA 4C1NK 2OELA 4BRHA 3C65A 3AA8A 1K44A 4DR3J 3NMAA 4MO5A 1YJUA 5GIOA 2R2TA 4V19X 4NLTA 4WP9A 1JXBA 2GW8A 5FRMA 3M8SA 1FERA 1RU2A 5A6WA 1DBDA 4IEEA 4YOTA 2ZJRQ 4H5VA 2QWOA 1DJ0A 4ZLJA 4C8KA 5CYQA 3B78A 3GL1A 1I3AA 4G3IA 2HBYB 3VEZA 1WEZA 5FDLB 3AVIA 3NEKA 3FSXA 2ADBA 1PC5A 3S3OA 3KUGA 1OWXA 3DDIA 1T95A 2YKNA 1TUWA 3RMCA 1R8HA 4DUYJ 4ZCKA 3KLHB 2R2SA 1FJCA 4DQQA 4JI4J 4MIWA 5KFLA 2O8CB 3M8ZA 3D5MA 3CERA 3NNHA 4DR6K 1ZAWA 1YJ7A 4F7VA 1VHXA 3CPWM 3VA0A 4ZPAA 1AA1B 2B6AB 3C6UB 4DR7J 4FKXA 2YVSA 2UUTA 3D3CJ 3HSZA 3D6HB 2VBZA 2EKNA 2RDJA 4CO4A 1RJJA 1KFDA 2ZQBA 1WWHA 3PX6A 4RBUA 3MCNA 4FVCA 3WZ0A 2GWJA 3R3LA 1YRUA 1QAYA 3M3ZA 3TVZA 5EX0A 1U1KA 4IOAQ 9RUBA 2W4DA 1NGGA 2AD9A 1YI2N 4UW2A 3WBZA 9ATCB 1ZPWX 4FSVA 1N88A 2DRDA 2UUWA 2BOPA 3QO9B 2OTLS 4QIGA 3W8PA 4AM7A 5ADZA 1EB0A 1VRUB 3MWTA 3IO1A 3TA2A 1V4SA 5DG7A 1BQNA 2HVHA 5AQLA 4YY3F 5K5MA 5CZVA 3H1QA 2GJ2A 1S1WB 1LAWA 4PXEA 2HWIA 3JSBA 4ZVSB 4F4KA 1G7CB 3PIOL 1R6VA 3UVJA 3G71S 4HLBA 3MK6A 1DAXA 4PXDA 1S6PA 5IV3A 3AA3A 1HQUB 3TSUA 3I33A 3FC9A 4DV2K 2XZDB 4PAAA 3NOCA 4KH0B 2Z1GA 4LQ3A 4KH4A 2BACA 2GVZB 5A8KA 5CXTA 4M5NA 1HWLA 1HNWJ 2QX0A 2CQGA 2QA4N 4FM1A 1R7IA 1N54B 2M3DA 4NEYA 3ZSQA 4WFNL 2M0GB 1D8YA 2D41A 1SL1A 4OI3A 1HBNB 2Q0UA 2YWKA 3RMDA 2QG9B 5KFKA 1ZA1B 1WG4A 1QTNB 1R6YA 1XMQF 1SJ1A 1U49A 4IJNA 3MEGB 3PIPL 1WTFA 4NE9C 2XYPB 3KHHA 2CQPA 2VPZB 2FHJA 2JLEA 4B3TF 3ELHA 2HNYA 2XS5A 4KH6A 1S79A 1V9OA 2UUAF 1ZC6A 5AQFA 1RTJB 1HLUA 3D67A 3NMUA 1LWCB 5CA5A 4J2AA 3DLHA 1BGXT 4RLEA 3NGDA 1KFSA 5FPDA 3VGKA 2UU9J 4FS2A 3CULA 2AT1B 5DG9A 3GOIA 3V9SA 4BS2A 4KH5A 4XDCA 4USVA 1RT7A 5JMNA 4E19A 1GTEA 2W7AA 5B0EA 4IZ9A 3ULHA 3LPTA 2XWXA 4CZEA 4DV0F 2GIQA 4KRWA 2KQ2A 1D5AA 3FNNA 1DT9A 3KK3B 1RGIA 4J2DA 2HNZA 1X4AA 2L08A 3KJNB 2MQ8A 1IJJA 1YDLA 4C8NA 3H25A 3A4TA 5EHHA 3MM9A 3AA2A 1VBZA 3IM8A 1DTTB 1FNXH 4O3OA 4FJ9A 1VJQA 3W5ZA 1N6QA 1NKBA 4B9SA 2Z57B 3VQ7A 5LSLA 2VG7A 1URRA 3A8EA 3PEJA 1S6OA 3I87A 3TABA 1NK8A 5LMUJ 4KHRA 3RVCA 2G0CA 2HGNA 5D0HA 3EKUA 4IG0B 3UDEA 1FF2A 1TP7A 3PRVA 3V81A 5LXYA 3MECB 2JRSA 3HHDA 2QYCA 4BC2A 4KH1B 1U1QA 5AQIA 2ASPA 4DSJA 1WC0A 2ZD1A 3GG0A 3NKYA 4UZCA 2XMWA 1OO0B 4FWSA 2ALYB 4YDUA 3E8OA 5CQGA 1Q95G 3I5AA 4E2FB 3K5MA 2DNYA 4X4SA 3QSIA 3IDHA 1S4EA 2ZC3A 3HD2A 4CJFA 3UPFA 4KBIA 4O4GB 4O0IA 4DR2J 4WTYA 1BI4B 3JAMY 2MY8A 4TYAA 1K0VA 4B08A 2RS2A 4H5WA 2N82B 1J5OA 1IWAA 1TKXA 4CJUA 1WORA 3WX4A 3MEDA 1AXQA 5F9NA 2FPHX 4F3QA 1KD1O 2IOCA 3U1LA 3AH6A 3CO9A 4LFCF 5E3CA 3GYNA 2QFIA 1WF2A 3WQUA 4DCHA 4EP5A 1K1SA 3E01B 1HBMB 4H0YB 3DLBA 1DZ5A 1V3SA 2JFKA 2DGSA 1ZYQA 2F4VF 4DQIA 4DV3J 4O44A 2ILZA 4BC9A 5BYRA 4NXNK 2O8FB 4AHRA 3CJTA 4DUZF 4ZVRB 4RNHA 4I2QB 4RW4A 3CC4S 3MR6A 2DK2A 1T03A 2AHOB 2BKOA 4DF8A 1FW6A 2WRMA 3J7AP 2YHYA 1HMVA 1WEXA 4E1NA 2JFDA 2VBWA 1TL1B 2C1EB 1WG5A 4H4OB 1KVCA 4JUZA 3NXZA 5GVQA 4KHPF 1CPZA 3J7ZO 4DZ6A 4JKGA 4IO8A 1MWYA 3PDNA 3M1VB 3MM7B 1NUEA 1H74A 1WSVA 4ZIWA 2CVIA 3T6JA 4K0KJ 3TTDA 2Q79A 1FXRA 2Z4PA 3W3SA 4J9KA 4K8XA 3T1YK 5GAEI 3B82A 2XMVA 2FBTA 3T69A 5KQ8A 4PL7A 4LSLB 3DLLL 3TTFA 4ECWA 3UKUB 2DGWA 3AVKA 1XERA 1NK9A 2CZ9A 2K3IA 2DNNA 2JC1A 2IIHA 4NZ0A 5AQTA 2KDOA 3MM8B 5BJRA 1SQKA 2IVMA 4RW9A 2HLUA 4ISEA 3LDSA 1IBMF 2XM3A 4HYKA 3NCQA 3O08A 2MKCA 1MLAA 1KAXA 2W41A 2H48B 2ETJA 4PKDB 4DU7A 3EL2A 2PMHA 2L48A 2HLTA 1RWPB 3WC2A 2RU3A 4WZQA 4H0VB 5KPRA 5DJBA 3ZZTA 2DCUB 2A10A 5U47A 5J1EB 3IUCA 2EFOA 3CT9A 3PX0A 1OS5A 2O8DA 4HTJA 4DL7A 5DO2A 2BM1A 3EGZA 2GZOA 4H8KA 2OEMA 2PA8D 2WB4A 4OYIA 4FF3A 2GIRA 2C3PA 2HEKA 2CNNB 2WVFA 1VBKA 3LDNA 5J2QB 2CJXB 1IR2A 4H0OA 3NWRA 4DWIA 4YDUC 2UP1A 5KFHA 2G2OA 3HSDA 2K06A 4X64K 1WDTA 3THXA 1XC9A 3TZYA 1U1NA 1MDUB 1NJZA 4DL4A 3LPUA 1VQ5N 1UTAA 3TU5A 2WVEA 4NLYA 1N33K 5KFCA 4YR3A 5AQJA 1XQIA 1JNRB 2Z56B 2COLA 2IM2A 4JI3K 4K43A 1VQ8S 2V4QA 2HFOA 2OD6A 1UVNA 2W9BA 2O8FA 7FD1A 1ILYA 4GVBA 2AA4A 1GMWA 1X5SA 3PJXA 3G4SS 2MQQA 3A5OC 4FW2A 3IWLA 1XUPO 1B99A 3E66A 3N28A 1CULB 4ETXA 3P83D 2GAGC 2J6UA 2V6AA 2KG1A 3PYDA 3U1NA 3CC2N 1WNSA 1M90O 4KQZA 3CJ8A 1N32J 3OW2M 4DR4K 4FPRA 2XSJB 3AXMA 1QQCA 1NKEA 2B6AA 1Q8IA 3KDOA 5AE1A 3S6EA 3MWPA 2FVPA 5JXSA 4LRFA 4BC5A 3CCLN 4OYPA 2O8CA 8ATCB 2BTFA 4BROA 3O5TB 3T3FA 3QGHA 3P4IA 3TR8A 3FSYA 3OLAA 1QSLA 3DLEA 4A5AA 4RUCA 2UUBF 1TYQB 3M8PB 2FHOB 2HHHF 1N5YA 4JLHA 1Z2LA 3EZWA 3KWGA 3BBBA 3M6WA 3T9ZA 4MKAA 3H2VE 2VH7A 4ECRA 3Q7CA 1T3VA 2YNFB 3GJRB 4F3MA 1S9GB 4DUYF 2DHSA 3SQ4A 3V5RA 1FFSB 4OMFG 5C15A 2MQNA 2LKZA 4BLGA 4IO1A 1B0VA 4KC5A 4CHYA 4OKJA 2J4RA 4N8NA 3O9SA 3DXBA 3CD7A 4FWQA 2P9NB 3OFHA 2B9XA 5F0WA 2XRIA 3SNNA 1RAIB 1RT6B 4WFAQ 3SUPA 4E89A 3DC2A 3EY1A 2IYIA 2ITGA 1C4CA 3WXKA 2G8FA 1W2BR 5D3GA 3HVWA 3I56S 3D0IE 4LFAJ 3QETA 1S57A 3CD6N 4J9LA 1DTTA 2A2CA 3M6VA 3CQYA 3E9OA 4YY3K 2B4JA 4C8YA 2J7WA 2CA9A 4Y65A 1KC8T 3KKFA 5C25A 4W92B 2OLWA 3VGVA 1U1OA 1YIJS 4JKFA 2ZM6F 1VBYA 3PHTA 3R5JB 2DTUA 1XWLA 2HRTA 4DR2K 4JI1K 1YIJN 2OD4A 2IHR1 2W6LA 4JB8B 1PC4A 2IJNA 4ZP6A 1NDCA 2QA4G 1KS2A 3CC7S 1LWCA 1UAWA 4CJKA 3H0PA 4B9NA 1HPMA 1F0XA 3TAMB 3KWIA 3IN5A 1N5SA 2XHBA 5B0GA 2CZVC 4CLFA 4OZ3A 1OH8A 4Z4HA 3ITHA 1X9WA 3R1HA 3OLBA 3RRGA 5EOYA 1KVIA 2V9KA 3HD1A 5DQGA 3S8SA 1ZBHA 1NK7A 1NJWA 5AZIB 3OTEA 1EQMA 4J8FA 4ELVA 3V1RA 4JI7F 4YOWA 2HVZA 3GFXA 1XMQJ 2NRVA 4CBUA 4GV3A 3UN5A 4USMA 5HP1A 5KGWA 1P9YA 1EKSA 3R2CJ 2OZSA 4C3KA 1K1QA 4HCCA 4DQPA 1PAEX 2AP6A 3L4BC 2DH9A 2ZM6K 3OYLA 3A13A 4NXMJ 4FLVA 1FNOA 3OYGA 2F9TA 5KFYA 3QIDA 3M6XA 5FLXY 2DNHA 2CQ4A 2C2RA 2LA6A 4IOCQ 4CDIA 3MM5A 1BHLA 3C7NB 2WHOA 3W5XA 3E9LA 3CQ8A 3R8YA 3QB0A 4PUOB 1RBVA 3BM7A 3KUHA 2N7YA 1NJYA 4DX8H 3P8BB 4FWRA 3ENAA 1PBUA 4Q44A 4K4TA 3SJHA 1FRLA 4G1QA 2FJDB 3KTQA 1YTAA 4FPAA 1Z1ZA 2LQ9A 3LAMA 1MWZA 4AF1A 3GV8B 4PPZA 5B0DA 4GC6A 1VQ9S 4F3OA 1AFJA 3CG7A 1MMLA 4M42A 3CJ0A 1XC3A 2A6MA 1VISA 3CCUS 2MQOA 1FJGJ 5EDWA 4JKCA 4B3SJ 4D3GA 4N56A 3FE1A 4WF9L 1E6YA 4CHOA 3BEGB 5AQZA 1S59A 4I1TA 2NXJA 5A8WA 1QAIA 5KT5A 2LDIA 3DDKA 4A4JA 4ISFA 1HW9A 1X60A 2Y3YA 3AXKA 4RCHA 2CPZA 3N5FA 1WKLA 2DXFA 4U67L 1VQ5S 1QVGR 1HWJA 4CLZA 4LF6K 2XHCA 1ZA2B 4L73A 5AE2A 2W6KA 3MMAB 3UR0A 5J2PA 3L7UA 2UXBK 4KB7A 4EEYA 1SQFA 3CCJN 2NXNA 4R79A 1F6TA 1M5SA 2VBXA 4EYHB 1RAJA 1MNEA 4CBXA 2UXDF 1N36F 2AJ4A 4JI0K 3Q8RB 5HQLA 4O8KA 2MZQA 5DDQC 4AILC 5FJ4A 1KQKA 2Y0SD 3ZXWA 3HHKA 1UWBB 3MAQA 3I0SA 1O0PA 2ZBPA 3R1LA 1UWBA 4DG1A 2GMHA 5IC4B 4U67Q 3VOVA 1VCTA 5ETTA 3L2RA 1G15A 3HHLD 5C2GA 2NZ4A 5K14A 5AXNA 3BV8A 4EO6A 2R8JA 1DY3A 4NMLA 4LR9A 2AGQA 3OYIA 3J7Z5 1VQMN 5HSPA 3H4BA 3O2IA 2AYGA 3V6KA 3AA4A 3TSPA 3SMSA 3UO0A 3BN7A 3QRRA 4KV8B 2Z1HA 3M8PA 2XNQA 3BQ2A 5KFIA 2H3EB 3Q23A 2E2QA 1FTCA 3THYB 4B3MK 4MTPA 2XB2D 5E0OA 3ZSWA 1N6QB 5K20B 1LWFA 4DN9A 3MPYA 4OPAA 1RISA 4CBWA 3EWGA 3GJQB 3OTOF 1NO8A 4BDPA 2V4JA 4PZVA 3FRZA 3KMQA 4QU7A 4FM0A 2VDHA 3D1OA 1CXQA 1EJ7L 4DR7F 2DXDA 2JC0A 5BPLA 1CJUA 2P2CB 4YY3J 4EYIB 2NRWA 1S9FA 1QSSA 1IBLK 2DR5A 3QGIA 3GFHA 3GMGA 2GHVC 3MEKA 3CDWA 4FZZA 5EWFA 3DOMA 4ETZA 1H3DA 1EKRA 1T6CA 4Y2MA 4CO3A 1UAXA 3SQGB 5K8NA 5DQHA 2F1FA 4WU2A 4I64A 3EGWB 3QMQA 5KOXA 4DQRA 4K8RA 1G2EA 1EP4A 1JLGB 4Q43A 3BB5A 3MGJA 2J6SA 4FJNA 1SUQA 4DX6A 3V6JA 4LQ9A 2OPQB 1GH8A 3P5TL 3QLHA 4FPBA 3D1QA 4GO5X 4M5DA 3C7NA 1UCNA 3CC4N 3RG6A 3OYNA 4HEA9 1B4SA 2HQCA 1XHZA 1XR6A 1EQYA 3HSTB 4I2PB 1X4FA 3QEIA 1RTDB 4LF7K 5F2RA 3V9UA 5HANA 2SXLA 4JI6J 2MZTA 2GX9A 3W2WB 1U24A 1VIXA 3PR5B 4FF4A 4P2XA 3D6FB 5ETQA 4PYAA 5BYQA 3CO0P 4A61A 2JHEA 1VQMS 2DEJA 3D28A 1LV5A 2EBEA 2X51A 3F9KA 3VQ5A 3LZJA 3Q2TC 2RQKA 1RDBA 2MQMA 2UXBJ 1ITPA 2P8IA 3DOLA 4WK3A 1WUUA 3AO4A 3MMBB 5DZ6A 4USWA 4NXMK 4HUGA 1VSJA 4NYOA 2E5LF 1KLMB 3H1VX 2BJDA 1ZM2A 4BR9A 3DDNA 3CFOA 2VHGA 2NRXA 4B9QA 3CD5A 1JLFB 4OX7A 1UFLA 3ZZPA 5HL7Q 1BQNB 2E5IA 4OI0A 4JV5J 1N4LA 2YBVA 1EKEA 3SCLE 1WSFA 3AVJA 2VG6B 1LOUA 4DV0K 3P5BP 1BIUA 2MGZA 2W9CA 3PRBA 4I67A 2CQIA 1D8ZA 1WOOA 4DPTA 3DI6B 5B09A 2F3JA 4PHTX 2VQFF 4DLGA 4ECTA 1SV5A 1D1UA 4K50A 1S10A 1FKOA 3BPDA 3W9HA 5EY4A 3NBPA 4OLBA 5EWGA 4LT6A 1PBAA 5DK5A 5BN8A 4IBNA 1YG0A 1TR0A 5H1SV 2ZBCA 3QIOA 2MZRA 1WF0A 4MH8A 5FLXO 2J9EA 4W5NA 2G8HA 4IRDA 3M6GA 2J0QD 2HBLA 1FWKA 1N8RO 4TY9A 3HZGA 4CFDA 2JEGA 1H98A 5KFUA 2E1RA 1RLDA 1F2GA 1YK9A 2M52A 3PM9A 1BA0A 1VQNN 2I0XA 2FVCA 1S97A 1KHWA 1N5VA 4FL9A 3ENWA 4QQBA 3KIOA 5MAOA 4LRDA 3O8WA 2R7RA 1VDHA 1SKUB 3DM2A 3FZFA 1U02A 2HQIA 3I9ZA 3BGLA 1L3KA 2BRKA 3MX5A 3FFIA 1CZAN 3NLCA 1N34J 2X78A 2RD5C 4N8OA 5DGAA 3L4IA 4FF1A 3RBEA 4BC7A 1A5XA 1RHMB 1JLEA 3VZIA 3V81B 1T7PA 1VHIA 3KVGA 3KLIB 4LD0A 4H5TA 4ZA1A 5KPZA 1XNRK 2PDAA 4AQYF 2ZH3A 5A2QU 3OHAA 3HF5A 2OAUA 4KB1A 4MKYA 2DFHA 5J2NA 4CP5A 4RU9A 5DMRA 3CCRN 2RNEA 2DPIA 1TAUA 2RQMA 2I38A 3CCEN 2XMAA 1DRZA 4OI6A 3M2UB 1YKWA 5LJ5Y 4A8YA 2HHHJ 2D3ZA 4UUXA 4BQLA 4ES3A 3E3XA 3EDQB 4NI2B 1NCLA 4NRUA 2HNDB 2E66A 5CZXA 1FRXA 2X6SA 3R6MA 1KVAA 1KSPA 1BCOA 1NK4A 4Q0BA 5AXMA 4LIWA 2OH2A 2R2RA 3I5CA 4M5MA 3RW7A 1G1XA 4ZTFA 1GAOA 2E1AA 3G86A 3WNFA 4LF9K 5KFQA 2FGCA 4QU6A 2WBNA 4EBCA 4Q45A 4DSLA 2KVIA 2HWTA 1ZAVA 1VSHA 2F8SA 2BMBA 4F2RA 2DGTA 4M7YA 1SB6A 3MFHA 1LNQA 3G8TA 1BIZA 3GYGA 2IVYA 1KVBA 1MROA 5KRTA 3S9HA 2V0NA 5KGXA 2BE2A 3GDQA 3AVHA 2UV8A 3FCHA 2HHSA 2BJEA 4MIBA 1QZ6A 3T6BA 1T0TV 4IFVB 2WONA 3MHYA 4W98A 5JUMA 4CZMA 4PG5A 1HBUA 4QOTA 5ETLA 1YWXA 1L3SA 1D3WA 1Y64A 4L75A 2XYGB 4AL5A 2BJ9A 4PWDA 1MN7A 5IT9Y 3DRXA 1G99A 4LFBF 5L1LA 3AVBA 4CLKA 2CPHA 2VKZG 5EN1A 1S0VA 3P39A 3GTYX 1XN9A 3R9PA 1WHYA 4CO1A 3NNCA 1HNIB 4ED3A 3S41A 4RTFD 2QMWA 4PEOA 1HA1A 1FESA 1WD6A 2HGLA 3PW0A 2D3O1 1JQGA 3P45B 5CABA 1CC8A 1FDBA 3DRPA 1H72C 1VJWA 4JK7A 4A8OA 3VQPA 2FQQB 2AYBA 2BANA 1TKDA 4CLWA 3KG0A 2FHKA 4DR4J 4H0XB 4DV2F 1F9FA 3AOBA 5KG3A 3C0BA 3M8WA 5JVHL 2GC8A 1U6FA 3BN4A 4IG3A 4M3ZA 3VAMA 2HQFA 5AQSA 3S7RA 4ID1A 4FW1A 1LW0B 2WSFC 2MLZA 2M88A 5BXIA 1QQOA 4BE1A 2ZJPQ 2LU1A 2V7YA 4Z37A 1RAGB 2HQ3A 1HIYA 2CPXA 5IT9U 3K5OA 2Y0BB 1XNQF 3L9ZA 2AYMA 3DYAB 4A5BA 4X64F 1TUGB 4QIWD 2ZH1A 2LQ5A 4MK7A 4DQSA 1RILA 1ULRA 4USKA 3OFGA 4TY8A 5LL6d 4DHVA 3CETA 1M5PC 2OPQA 3JTNA 3DHXA 4TNOA 3MMBA 2WBMA 3UD5A 3I96A 3UN2A 3CJCA 2ZOMA 4F4AA 4QS8A 2FY8A 3CC2S 4DI6A 3T9NA 4CF8A 3AV9A 4JI3F 4EI2A 1URNA 5HMYA 4F2SA 3U4LA 1R3NA 4X62J 2KI2A 3K9JA 3SEOA 1NGIA 4JI6K 5AQPA 1IBKF 3Q24A 3KHYA 1FXXA 2AJQA 1OH5A 1VK8A 4BC3A 2HF3A 5D78A 1X31C 1FWLA 4URSA 3RB4A 5M2PA 2V69A 2IIRA 1RAFB 4MFBA 1HBOA 3H90A 4LRBA 4ZVFA 4ER8A 2DGUA 1Q8BA 1HKCA 1N36K 4K2XA 3A8JA 4NCAA 4X4OA 3POTA 4FM2A 4A8SA 1C6VA 2OHDA 1VIOA 4TQSA 1SH0A 3OHRA 1NPRA 4Y00A 3I5BA 2NQPA 3R7BB 1RDAA 3QT6A 1VQOS 4WE1A 2YHBA 2P9UB 3OTBA 2GV1A 3R27A 5SWMA 4IRKA 5DG8A 2NR0A 2DB1A 3DKDA 2A1BA 3AQPA 3QT5A 3QMLA 4HVJA 5H9FJ 3TAEA 3ZNJ1 1UEUA 5C2DA 3KJFB 3AHPA 1UOCA 2FHJD 4H4KC 3DMJA 3SAHA 3NVMA 1Y00A 4DUYK 3BSNA 3F44A 3T7ZA 1IQZA 3PSIA 1FRKA 4YB6A 4FJGA 3C8YA 3AVLA 3CI5A 4MLHA 4JI0F 2P9EA 2IMWP 1EQ0A 3LZIA 1Q5VA 5GADP 4BR5A 3IAS9 3AT1B 3NF7A 4FLXA 2GUPA 3JS6A 3GIIA 2W4PA 1IKYA 3E2EA 2QSWA 2CPEA 2V8PA 4OPKA 2N7CA 2EWHA 1RBSA 2QWNA 4CD3A 3H40A 2D1CA 3U02A 1RBUA 2AKWB 2RB7A 1A7GE 2CPDA 4MYUA 3CCMS 3IC1A 1YHQN 3ULEA 2JEJA 5TKWA 4ID8A 3OBYA 3S01A 1RGVA 3SCKE 1OQ3A 2C3YA 5KT3A 5C5JA 2FF6A 4ECUA 3R97A 4DR3F 2R8HA 1EAYC 2HS3A 2F96A 4BE2A 3ZFVA 1SJ3P 2CQ0A 3VTIA 3PG9A 3ZETB 1GMWD 1V3RA 4HR2A 1Q7YT 1D9DA 4GV9A 5LMNK 1KVJA 2AV5A 2PFFB 1X1PA 2Y1RI 3CJKA 4QAGA 2WTUA 2AJFE 1FT8A 3M8QA 1N8RT 1D9FA 3CFPA 1TL7B 3CIPA 2HHPA 4H54A 4IH7A 3KKRA 3JSMB 2VPWB 3M05A 4LF5K 3KLGB 3KHGA 4HI2A 3C6HA 2RRNA 2KHDA 1HYZA 2OA8A 3VF6A 2EKYA 3HFVA 1TFWA 1ATRA 1K9MT 4EHUA 1WC3A 5ETOA 3I56N 4Y3CA 3T41A 3WNHA 3FBFA 3ZLJA 3HT0A 1V6HA 1KC8O 2W42A 4ENOA 4FJXA 5HRNA 3ZZYA 3M8RA 5HL7L 3JXOA 4PUOA 4KY3A 3QEVA 2RHQB 1OMSA 4OPHA 1RADB 5AZJB 3K5LA 3T5LA 1NMNA 1K8AT 1C0MA 5J2QA 2HYIB 5L38A 4ATNA 2LSNA 2OSRA 4W90B 3PKMA 1ZZFA 3LANA 3NMRA 1ZBSA 2EK1A 4LF4K 3FEXB 1SXLA 4ZN1A 3KK2A 3EMTA 2VA3A 2YV0X 3HVTB 1WF1A 5MLCQ 2CWKA 4C0HA 3HPOA 1OYEA 2R7QA 4QYZK 4GKKJ 2D3OR 2P9PB 2FLOA 3NVKA 4NA3A 4L3KA 2AJ0A 1ESVA 3W7BA 2LCWA 2GS8A 1Q86T 1FJ7A 3CFRA 4B1UB 4Y2AA 3RMAA 2WAQD 2DNLA 1MG7A 2HHWA 4AD6A 2CPYA 2GVZA 4ZS6A 1W97L 2NZTA 2ZJPL 5GIPA 2IJFA 4LF5F 1D09B 2W7PA 1N34F 1RT2A 3FKBA 3RZAA 2BYCA 2OP5A 4E1JA 3P31A 4X4UA 3EVWA 3W2VA 4QWEA 3QBWA 3M2RA 1X7VA 1WBDA 4DL2A 5BPNA 3ILOA 4RW9B 1Q81O 1YITS 5EWEA 1FRMA 3PO4A 4I9QA 4CW7B 3FQKA 3G0ZA 1KRPA 1T9VA 4O3QA 1FJGK 1JLCB 2E7XA 4B3SK 2UYTA 2BQ3A 2IY5B 1S9EA 3LDOA 4OZJA 3HCXA 2CADA 4XDDA 2HVIA 3L0QA 4CIGA 1Q0NA 3WXJA 3DLGA 1SJQA 3MN9A 1S12A 3MAAB 3UWTA 1GLJO 3MMCA 4A8MP 1JNZB 3WHIA 3JB9k 4YHHK 2V4JB 2Y1JA 4GVMA 4DR5K 3TAFA 3ZTOA 2GAHC 3BO2A 1N33F 4LF6F 1LWFB 2YWWA 4DFJA 3LM2A 1JLGA 2DXEA 2HWHA 1ZBIA 5ETRA 3PY8A 4GNIA 1S49A 1B64A 3OYCA