5C42B

Crystal structure of hiv-1 reverse transcriptase (k101p) variant in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
424
structure length
424
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
molecule tags Transferase, hydrolase/inhibitor
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
publication title Potent Inhibitors Active against HIV Reverse Transcriptase with K101P, a Mutation Conferring Rilpivirine Resistance.
pubmed doi rcsb
total genus 100
structure length 424
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c42B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B03
3V4IB 5HP1A 2WCXA 1IKYA 4GC6A 1TL3B 1SV5B 1T94A 3TQ1A 4IKAA 2UVWA 1WNEA 1GX6A 2GC8A 3OLBA 3MR5A 2VG5B 5J2QA 3IRXA 4IDKB 3Q8QB 3EPGA 1XR6A 5KG6A 4IRKA 4NLUA 3CJ5A 4F50A 1IKWB 1S6QA 3DRSA 4KE5A 3JYTB 4J9OA 2GIQA 1VRUB 4TY8A 3DLKA 4ECSA 4F4XA 2ZE2A 1RT6B 2D41A 4NLVA 4QW8A 4ZVFA 5F9LA 5KFEA 4ECTA 2XC9A 2HNYA 3T1AA 5FDLB 4EBEA 4URQU 4FS2A 2JEJA 5DQHA 3QZ7A 3KK3B 3FQKA 1ZTWA 4ZPDA 2J6SA 1S9EA 2YNHA 1RTHB 5C42A 4ZP7A 2UVVA 3I5CA 1HMVA 3KK3A 2FJVA 4MFBA 3G6VA 1DTQB 3HHKA 3LP0B 3QO9B 1S1VB 1BQNA 2HNYB 1S4FA 2E9TA 5J1EB 2VG6B 3FDSA 1HYSB 5DQIA 2HWHA 5F8HA 1RT5B 5DG9A 5HBMB 3D28A 5CYMA 4RNOA 3DMJA 3MEEB 3NGDA 5EWFA 3T5JA 3TAMA 3MR2A 2FJWA 4J9KA 3I0RB 4ZVGA 3NBPA 4RW4A 3TAMB 3NAIA 2RDIA 5JUMA 1ZTTA 1C2PA 3KMSA 4PQUB 1TP7A 3GV5B 2GIRA 5KFNA 2EC0A 5J2QB 2E9ZA 2JEIA 4EBCA 1HARA 3DYAB 4RU9A 2D7SA 1HQUB 4PQUA 5L1IA 4URSA 4ED7A 3V81B 1SV5A 5KG2A 5HROB 5FDLA 4G1QB 3DYAA 4H4MB 1IM4A 5J2NB 1OS5A 4NYZA 5KFOA 4K50A 4EO6A 2BRLA 1D0EA 3I5BA 4K4TA 3DLKB 4J9QA 3NBPB 3KLIB 3MR6A 2W7PA 3C6UB 3CDEA 1VRTA 2I5JA 1TV6A 2BE2B 5I3UB 1RTDB 3QIPA 1N5YB 4MH8A 1IKWA 2BANA 3H59A 1U09A 3FFIB 2YKNB 2OPSA 2FVCA 3QO9A 2R8HA 3FSIA 4MIAA 4YR0A 1TKXB 4KV8A 4QWCA 4RNHA 4H4OB 1HYSA 3KLGB 4R8UA 2WOMA 2B5JA 3DRRB 5I42A 4MFBB 3CWJA 4MKBA 4Q8FA 1LW0B 1TQLA 4RW9B 3DOLA 3LP0A 5KFZA 1S9EB 2YNHB 3OSNA 1LWEB 3RAQA 5HLFB 2AQ4A 4IRCA 2OPSB 5KFMA 1MMLA 2R2RA 1JLFA 4NLWA 5KT6A 3G6XA 3M9NB 5F8GA 4JV0A 2R2TA 1C1BA 1T05B 4PUOA 2W9BA 3OSPA 4NLXA 2IM1A 5HROA 1T05A 2XGPA 4NRTA 1RTDA 1DTTA 3JSMA 4G3IA 4RW4B 1T03B 1T3NA 1JLAA 3DI6A 3RB6A 5C25A 3DRSB 1UWBA 3BJYA 4F4WA 4F4ZA 3IS9A 1RYSA 1JLFB 5DLGA 2VG7B 4NCGB 3PZPA 4IQXA 2WONB 1S1XA 4QPXA 4QWAA 4URGA 4OL8A 5C24A 4WXWA 2JEFA 4IH7A 5KFJA 3GIKA 2R8IA 5L1LA 3RBEA 4IR9A 2B6AA 3IGVA 3DMJB 3MEEA 3DLEA 4H4OA 1S0NA 2IJNA 3PR4A 3BGRA 4WYLA 3MEDB 4J9NA 2ALZA 1RTHA 5C42B 3H98A 5F8JA 1FKOA 3I0SA 4TLRA 3V4IA 2XCPA 3CDUA 2VG7A 4NCGA 3VQSA 4ED8A 5KFGA 1BQMB 1JLGB 4O3SA 3DLGB 1EP4A 3DRPA 1QE1B 2BQ3A 2YNIB 1RT4A 1RT7A 1S1UB 1N4LA 4HYKA 3BQ0A 1HNIA 4YP3A 3QYYA 3TVKA 2R8JA 4MIBA 3H2LA 5KFWA 5KFSA 3GYNA 4DL3A 4NLQA 4ID5B 5KFPA 5DG8A 5KFHA 1TL1B 4KO0A 2JEGA 2V0NA 3IS9B 4J9SA 4FS1A 5KFTA 5KT5A 3HVTA 4ICLA 2JC1A 1R0AA 4JUZA 3M8PA 4ECUA 4KAIA 3M8QA 4Q45A 1RT2B 1S1TB 1HNIB 3V81A 4NRUA 4DL6A 4R8UB 4O4RA 3DM2A 5J1EA 4IH5A 5KFRA 2D3ZA 4RW7B 4M94A 4YR3A 5HP1B 1JLCA 1DTQA 1RA7A 1RAJA 2OPRA 4I2PA 1YVFA 4WZMA 3LP1A 1RTJA 2ZD1A 4LSNA 2R2UA 1BQMA 4NLPA 2OPQB 2WB4A 2YNFA 4PWDA 4FBUA 2ZD1B 4LSNB 1RTIA 2HNDA 4LSLB 2ILYA 1C0TB 4IR1A 5KG0A 2W8KA 4ZVEA 5DLFA 1TVRA 4G1QA 4H4MA 1C0TA 4O44A 2R8GA 4EYIB 4WE1B 3PW2A 2IC3B 3KK1A 4TN2A 2VA3A 3FFIA 3OL6A 3MFIA 3JYTA 2BQRA 5EDWA 3CO9A 4ECZA 3GV7B 4DL2A 4IH6A 3H4DA 1RT1B 1S9GB 1TKZB 3E01B 4QWDA 5KG7A 4MK8A 3RB4A 4B3OB 3DM2B 3RB3A 1TKZA 3E51A 3CVKA 4IFYB 4ZP6A 2RDJA 2R8KA 4ZMMA 3V6KA 1KLMB 1BQNB 3BSCA 1R0AB 3BQ2A 4IOBA 5KFDA 1JX4A 3DOLB 1JLQA 1LWCA 4RW9A 2UUWA 3CJ2A 1IKXA 3PW4A 3N6NA 1SUQA 3BR9A 2JLEA 1N6QA 4RW6B 3QGIA 1XR5A 2VG5A 2BRKA 4NLYA 1ZETA 2HNZB 3N6MA 1S9FA 2B5JB 4ED0A 3CDWA 2W9AA 3OLAA 1FK9B 2BQUA 4Q44A 1TKTB 3QGHA 3H5SA 1TVRB 4O44B 1S48A 4TQRA 2ASDA 3KLHB 1RTJB 1TKTA 4KFBA 4ZHRA 5EWGA 3QIPB 1N5YA 5KFLA 3UDLA 1IKXB 2XGQA 1EETB 5KFXA 3RB0A 3C6TB 5L1JA 4RW6A 2UVUA 1JKHA 4DL5A 1S1XB 1JLEA 1S10A 5J2MA 5KG3A 4IG3B 3KLEB 3BSNA 3T5HA 4Y2CA 1DTTB 2F8EX 4YMEA 4I7FB 4IFVA 4NLRA 5EWEA 3H40A 5DQGA 2OPPA 4I2QB 3KLFB 3KLEA 5F8MA 3LP2B 4Y3CA 3KK2A 4RNMA 4DG1B 4FBTA 3DOKA 4ZVHA 3MEGA 1IKYB 4JV2A 1EETA 2FJXA 1VRUA 2ATLA 3LAKA 3DDKA 3HVTB 4ICLB 2WTFA 5KFYA 4K4YA 4QWBA 1JLGA 1RDRA 1C1CB 4IG3A 2AGOA 1I6JA 5K14A 5I42B 2VG6A 1HPZB 2RF2A 3QLHB 4QWEA 2UVRA 3SFUA 3LP2A 3N6LA 5CYQA 4MK7A 4TQSA 1HNVB 2FVSA 4Q0BA 4KKOB 2ZKUA 1HNVA 3LANA 4WZQA 2DPJA 1JLBA 4RW8B 1EP4B 4ECYA 2AWZA 3D5MA 4WFZA 2HNZA 5K14B 2YNFB 4PWDB 2IMWP 2IAJB 2E9RX 1HQEA 1REVA 5L1KA 4O3OA 2B6AB 4ED3A 4NLSA 2CJQA 1S1WB 2OPRB 4I2PB 5EUHA 2IA6A 3RAXA 2OPPB 4I2QA 4O4GB 3KLFA 4XPCA 1RA6A 2FVRA 2IM2A 2WRMA 4ED6A 2C2EA 2WONA 3H5XA 3NL0A 3KK2B 3KHHA 3LALA 4RNNA 2V4QA 2AX0A 4LQ9A 4TY8B 3KNAA 4K4UA 1SH0A 4KB7A 2BANB 4DL7A 1KHVA 1C1BB 1S49A 5KG5A 4U6PA 4J9LA 2RKIA 4NZ0A 5KFUA 4ED1A 1N48A 1FKPB 2BR0A 4F4YA 1RT1A 1S9GA 1JKHB 3E01A 2AU0A 5CYMB 2YNGB 2DPIA 3IRXB 1JLAB 3IN5A 3MEGB 2WOMB 4QW9A 4IFYA 4ZP8A 4IFVB 4I7FA 3H5YA 4KFBB 4ZHRB 2HWIA 4EYHB 2C22A 4ECVA 1GX5A 2JC0A 1QE1A 4ECQA 2AGQA 4J9RA 3V6JA 3KJVB 4RW8A 5F8LA 3IG1A 4K4SA 1N6QB 5DG7A 2AX1A 4WFXA 1CSJA 4WFYA 2CKWA 1LW0A 5KFFA 2FLNA 1FK9A 3KLGA 4DG1A 4RW7A 5D3GB 5KG1A 3LAMA 4R5PB 1JLBB 4TXSA 4O3NA 3KLHA 5KT3A 5CYQB 3KHLA 1C0UB 1QAJA 3M8PB 3I5AA 3EPIA 4EBDA 4HKQA 1RT2A 3MF5A 4RZRA 4KSEB 4J9PA 1K1SA 1SH2A 1S97A 1JLQB 1LWCB 4R0EA 5KFKA 5C24B 2J6UA 5KFAA 1IKVB 1LWFB 4DEZA 5KT7A 2V4RA 4K4ZA 1FKPA 4K4VA 3CIZA 3I0RA 1JLCB 2FVPA 4O3PA 3QGGA 4Q43A 3OL9A 1JXLA 1KLMA 3CJ0A 3UQSA 1C0UA 1TL1A 1S1WA 4KO0B 1T03A 1W25A 3PW5A 2RKIB 3CJ3A 3DOKB 2XI3A 3SI8A 4JV1A 5DGAA 4Y2AA 4RNFA 4IDKA 4ZPAA 2R2SA 3SFGA 3EZUA 2C2DA 4LQ3A 3DLGA 1IKVA 1LWFA 3DRPB 4NLGA 2IM0A 2ASJA 3C6TA 1S1UA 4IG0A 5KFVA 4WYWA 1J5OA 4EO8A 2XWYA 5KFQA 2W9CA 3NMAA 4K4WA 5F8IA 3G6YA 3KHGA 5KFCA 1KHWA 5F9NA 3NAHA 1XR7A 5D3GA 3Q8PB 3KJVA 4Q0BB 1TL3A 2WHOA 4K4XA 3T5KA 3M9OB 1TV6B 5I3UA 4O3RA 1RT4B 1RT7B 4WXOA 4O3QA 3PW0A 4KV8B 2XCAA 1S1VA 4LSLA 1RT6A 1HPZA 2RF2B 3GQCA 3BREA 3M8QB 1J5OB 3QIDA 4NLDA 4ECWA 1K1QA 4M95A 3HKWA 4ID5A 1S6QB 1DLOA 3MEDA 4XO0A 3V6DA 3OHBA 3KHRA 2I5JB 2I1RA 3PHEA 3MECA 5J2PA 3UR0A 3ITHA 3Q8SB 2HAIA 1UWBB 5C5JA 2ASLA 2YKMA 3GIJA 2V9WA 3MECB 5J2PB 2QE5A 4MKAA 5L9XA 1NHVA 3OL8A 2QV6A 3MR3A 1HQUA 5HBMA 4TY9A 1JLEB 2IBKA 4H54A 3GILA 3ISND 4PUOB 2W9BB 1DLOB 3V6DB 1LW2B 2FLPA 5F8NA 1MU2B 3GIIA 1NHUA 3BSOA 1HQEB 2J6TA 1NNDA 2ILZA 1RT5A 2IJFA 4RUAA 3V6HA 4KKOA 4WE1A 1LWEA 2OH2A 3BSAA 4RUCA 4EEYA 4MK9A 3HVAA 3RBDA 2HMIA 3G86A 2IM3A 1JIHA 4KHMA 2FVQA 1S1TA 4ZPCA 2IAJA 3GV8B 5KT4A 2W9CB 2D3UA 3IG1B 3KMQA 2YNIA 2O5DA 4U7CA 1C1CA 1TKXA 1Z4UA 1MU2A 3PVXA 1S6PA 2BE2A 3DI6B 5DGBA 2FLLA 4IG0B 3OHAA 3DRRA 3HVWA 3CJ4A 4NLOA 5KFIA 3KLVA 3UPFA 2ZE2B 2AGPA 5KT2A 1N56A 4IRDA 4GC7A 4Q8EA 5T14A 3BGRB 2HMIB 4ZPBA 3C6UA 5KG4A 4Y34A 2YKMB 3M9MB 4ED2A 1SH3A 3MFHA 1QAIA 1D1UA 4B3OA 2YKNA 5J2MB 3PJWA 5J2NA 3FRZA 3H4BA 2YNGA 3ISNC 1REVB 2UUTA 4KBIA 5JXSA 3KLIA 4YR2A 1QUVA 2VA2A 2IC3A 3KK1B 3JSMB 3BQ1A 5HLFA 2W8LA 1FKOB 3I0SB 4XPEA 4KHRA 4YQWA 2W7OA 2C2RA 4O4GA 5C25B 3T19A 2B43A 5KFBA 3OL7A 4ECRA 4NLTA 3Q8RB 4R5PA 2WK4A 4X2BA 3ITHB 4TYBA 3GIMA 4J9MA 3ICLA 3PR5B 3QZ8A 3PW7A 3FQLA 2XI2A 3T5LA 2C28A 1S0MA 1RYRA 4ECXA 3H5UA 3QLHA 1RTIB 2HNDB 1SUQB 3IGNA 1S0OA 1RT3B 3DLEB 1HMVB 1S6PB 3NKYA 4ZP9A 4DL4A 3PJXA 3KOAA 1LW2A 3LP1B 3MTKA 1RT3A 1VRTB 4TYAA 2OPQA
chains in the Genus database with same CATH superfamily
4DSIA 1WNEA 4GC6A 1TL3B 1SV5B 1TAQA 2XS5A 3NNCA 4FF4A 1FX2A 1GX6A 1RCOB 2GC8A 2ZJPQ 2F8HA 3RAMA 2IRYA 3T1YF 3IRXA 2IVFB 2FJEB 1XR6A 4OV6A 2MLXA 3NMRA 4FNIA 2WVFA 3W5XA 2E5LF 1F60B 4BS2A 1FTCA 1WHVA 2ACMA 1D9AA 3QJPA 4NMLA 4ANEA 5D8HB 2Z8QA 4Q7AA 3EYZA 3CDAA 2P9CA 3R5BA 4HEA9 2XWXA 4CTAA 4TY8A 1H73A 1WSVA 5AJ3J 2VBZA 5U47A 2G0IA 2RRNA 2GHWA 1CJVB 3PX6A 4NLVA 3PM9A 4B3MJ 1NAQA 3T1AA 2JWNA 1BHNA 2WVDA 3N5BA 2EFGA 3TAQA 4ITSA 3THVA 1X9MA 4LR9A 2MKCA 4URQU 4FS2A 1R89A 4WKRA 2JEJA 4ZVUB 5DQHA 3SDEB 2YQ3A 3QZ7A 2EEYA 1LV5A 3FQKA 3D54A 1ROFA 3P45B 3MHYA 4OI2A 3EX7B 2E7XA 5H1SV 3I5CA 4XK8C 2N7YA 3L9ZA 3P8BB 4FYXB 3QT6A 2DYAA 3UI3A 2FJVA 1EJ7L 4BHQA 1DTQB 2DNNA 2VL1A 4AE5A 1B0VA 1CJKB 1UPMB 3QO9B 2XSFA 2XY7A 1BQNA 1T02A 2JFKA 4HHHA 5D15A 2RH3A 2DHXA 4M5GA 1F5CA 3H90A 2VONA 1OPZA 2F4FA 1FF2A 2IY5B 4JP8A 3KG0A 1DQ8A 2HWHA 3EMTA 5DQIA 3OW2R 2V4JB 3QJJA 5HBMB 2Q43A 5CYMA 3D28A 3MEEB 3POTB 4OI6A 3HHLD 1UVIA 3LH2S 3T5JA 3TAMA 3MR2A 2FJWA 2KTQA 2WAQD 2B9YA 2O01C 1AT1B 3GIRA 2DNHA 4RW4A 1TMMA 4M1KA 4OYXA 5D78A 2LDIA 3VGTA 4DLGA 2MQOA 1DHMA 3CIMA 1GTEA 2GIRA 1JMTA 2F5GA 2CPDA 2F65A 3SQGB 4F7VA 1HI8A 3TZXA 5KFNA 4X4SA 4F0KA 4RU9A 3TANA 4B3MF 5L1IA 9ATCB 1RP5A 4ED7A 1SV5A 4OYPA 1FVQA 2CZ9A 1VBYA 3QRQA 5FDLA 1H7WA 3DYAA 2AYGA 3BO2A 2MTLA 2VOPA 4I69A 5KOXA 5KFOA 4OFZA 2CYYA 3QBCA 2VC0A 1FCAA 2HFOA 1X4BA 2CRLA 1NEEA 2VV5A 4WU2A 2W7PA 3C6UB 3NG8A 4RKUC 1TV6A 3MM7A 2AJ0A 2L48A 2VF3A 1OO0B 4WU3A 2GS8A 1MSWD 2QX0A 4CLUA 1I1GA 3S1TA 3D6HB 3FFIB 2XYGB 2FVCA 3QO9A 3SEOA 3OFGA 4MIAA 4E2FB 4YR0A 2ZH3A 6AT1B 1U4BA 5G4DA 1FRHA 1O5JA 1Q7YT 1Z2LA 3IR7B 3AOAA 4O0NA 2AF6A 3JQMA 4ZVQB 2R4FA 2B5JA 4QZVB 4MFBB 1QD1A 3CWJA 4FN5A 2W1BA 2GNKA 3OUYB 1LW0B 4DZ6A 1XMQF 3DOLA 2M70A 3KNGA 5KFZA 3W2VB 2HHQA 2GVDB 2YNHB 1VLOA 1TAUA 4ZVPB 2UUCJ 3BZQA 1VQMS 3RGIA 1WC6A 1U6FA 4WIQA 1FFSB 4NLWA 4JUZA 5KT6A 4LBHA 2GO9A 1C1BA 3J7YU 4NCBA 2W9BA 2YPZA 2ZEJA 4NLXA 2IM1A 4CO0A 1T05A 2EK6A 2XGPA 4NRTA 4ZOSA 2W25A 1UMJA 4AUKA 2G1DA 1DTTA 3JSMA 2YWHA 2J7KA 2P5VA 1H2VZ 4EMDA 1T3NA 1JLAA 2E1AA 2W7AA 3GU0A 5DRKA 1Q86T 2WSEC 1UEKA 2VBYA 2RDDA 2UZAA 3BJYA 5IZHA 4ES1A 1RKJA 3IS9A 2PI4A 3A3OB 3M2VA 2BACA 3N79A 3NOCA 3PZPA 4RX6A 2DNPA 4F36A 3LGHA 2FQQB 4WXWA 1Y9OA 1VK3A 3MURP 5DM7Q 3SCJE 5JVHQ 1RISA 1BXNA 4JV5J 2V8PA 1AUSL 2EW9A 1KN6A 5HO4A 2B7CB 3IGVA 3KUEA 2F9JA 4A48A 4DZDA 5A6PA 3M6WA 3RRGA 3NLCA 4X4NA 4P75A 1YWXA 2IJNA 2O66A 2LEBA 3MEDB 4DCJB 5C42B 3BM7A 2BE7D 3I0SA 4TLRA 4C3KA 2XCPA 4AXJA 4ILMA 4B02A 2ZZNA 2I9SA 3MMBB 3VV2B 5KFGA 2CPZA 3DLGB 3EZOA 4AQYJ 3PX4A 1J5EJ 5T41A 2P6TA 3DDIA 2E5HA 1B99A 2B8QA 3AJDA 3BDEA 3QYYA 3D68A 3TVKA 3BGFA 1ZS6A 3H2LA 3G4SS 4K2XA 5HJXA 5KFPA 3GSDA 5KFHA 4TU9A 1PO6A 1TL1B 4KO0A 4JI2F 2JEGA 3IS9B 4I4BA 2QLWA 5GAHI 4J9SA 4ED4A 4FS1A 2C3MA 2JC1A 2UV8G 3RRKA 3HO1A 1I3OB 2N3LA 3M8PA 1WC1A 2C2NA 2CQBA 2JJ4D 3BS9A 4KAIA 2E7VA 5E3RA 4PKDB 4OV1A 1UZDA 3FMWA 4TU8A 1HNIB 3V81A 1TUVA 4DL6A 2XO6A 3TA0A 4R8UB 3DM2A 5J1EA 4U7UD 3TOQA 4MKVA 2RMLA 3M1VB 5KFRA 2ACYA 3DNCA 1NDLA 4C3LA 3FBBA 5LSRA 3CEDA 1XWLA 1GMWA 4M94A 3I4HX 1MROB 4PEOA 4ATNA 3F73A 1CC7A 3OXLA 3PXGa 1YVFA 4DL0C 2QFJA 5CD4H 1KC8T 4WZMA 3LP1A 2NSBA 4L73A 4C48A 2Z0GA 3DU6A 2CA9A 1BQMA 3MCOA 3QATA 5IT4A 2OPQB 1IUJA 1LK5A 1N0VC 2PMZD 1NDKA 4MKYA 3PACA 2ZD1B 4LSNB 2WZ1A 2HNDA 4DPXA 4DV0F 4DPYA 4IR1A 3SQOP 4KY3A 1X0FA 2W8KA 3CDBA 1WKKA 2JX2A 1UJ5A 3SDEA 1TVRA 4G1QA 5IWAJ 3I55S 1AA1B 1E6YB 1MWQA 4MYTA 2IC3B 3KK1A 1U8WA 3FFIA 4CNZA 2HHHJ 4PXEA 1DQ9A 2QRRA 3MFIA 3U1LA 1L3TA 4KJIA 3CULA 4UOGA 3EGVA 1HD0A 4YHHF 2HHVA 2NXEA 3MM8B 4IH6A 3BN7A 1SPBP 2HAFA 4X65J 4QWDA 2GJIA 9RUBA 1Q1KA 2GX8A 2P9EA 3J80U 2LQJA 3B82A 4BC7A 3M6UA 3Q24A 1T9YA 4L3KA 1VC5A 2AZ1A 1ELOA 1XEZA 1X4HA 2DBBA 2WVBA 3NS7B 3E8OA 4HT7A 1H7XA 4ZP6A 2EFOA 5EX0A 3MMCA 1M5HA 4A8XA 4AXIA 2ZJQQ 4U9RA 4JV5F 1R0AB 5H9EK 1OSCA 3I9ZA 3FBFA 1X4DA 2UUWA 3PW4A 2LQBA 3N6NA 3BR9A 2YX7A 2ZOFA 2CQIA 5D77A 2VG5A 4WK3A 3US5A 4ZCIA 1S6OA 2LU1A 5IM0B 3HHNB 5HSPA 3OTOF 1S9FA 2DR9A 4L72B 4M5MA 3I82A 3K59A 3VVUA 2ZH6A 2OSQA 3NNAA 2LMIA 2VJUA 3KLHB 1B64A 1FWPA 1TKTA 2VZ9A 3GCWP 3QIPB 1N5YA 3VGUA 1APSA 3W8PA 1IKXB 1YJUA 4LF1A 4XDDA 2CWXA 1Y10A 2CVIA 1WG5A 2CQ4A 4RW6A 2YKQA 1NZ8A 4DL5A 2QLXA 1S1XB 1WF1A 5K8MA 1S10A 3T9ZA 5KG3A 3R7BB 1DTTB 1LK7A 3CO0P 4I7FB 3TR5A 3H40A 2MSTA 5DQGA 2OPPA 4E0DA 3J7AN 5FJ4A 2ZC4A 1UJ4A 1UFKA 2GHPA 3P3DA 4FYYB 1UA1A 2DR5A 1IVZA 1K44A 3WDOA 4HLBA 3F56A 1VJWA 3PIPQ 3M8RA 1RADB 4ZVHA 5HN0A 3BPDA 1RWUA 5B0EA 1NK8A 4FBTA 2MZ1A 5CXTA 1SVDA 2AEJA 2MZRA 4CTAB 1EAYC 4M5LA 4LRBA 1KQKA 2EFVA 2ATLA 1ZH5A 3DDKA 1UP1A 4P7TA 5A76A 4K4YA 3OVSA 1RDRA 4DQPA 1VDHA 5K14A 1YLXA 1T3OA 3SSRA 2XNRA 1AZSA 4I68A 2IIHA 4YEAA 2RF2A 4RUBA 1HR0J 1SC4B 2RUSA 2VBWA 2M52A 4YFUA 3N6LA 5CYQA 3G96A 2UVRA 2MZJA 4B9LA 1UL3A 1EARA 4LF5J 1YSJA 2XMJA 3UO0A 3NGRA 2K3KA 1HNVA 3C14A 4NXMJ 4WZQA 3TUIC 4F25A 4ECYA 4ED5A 1VS3A 2C3OA 2CQGA 3D6MB 3FGVA 3D5MA 3VAFA 3HFVA 1HR0F 1N5SA 2IMWP 2YNFB 3GP9A 3MD3A 5A0YA 2CAJA 3GONA 3IXQA 4M5NA 1N88A 1Q7LB 3N5FA 2RAQA 2Y0BB 2PC6A 2IA6A 2KU7A 3B4DA 3KLFA 1B0TA 1RA6A 4ED6A 2C2EA 1OQ6A 1NKBA 3NL0A 3KK2B 2KRBA 2V4QA 4USMA 3Q2TC 1M90T 2OAUA 1MG7A 1SH0A 2KN4A 4DL7A 1ZAVA 1U45A 1KHVA 4F67A 1FXRA 2VU5A 4J9LA 2RKIA 2E1MC 5ITHA 1FNMA 3FEYB 1RE1B 3UR3C 4ETZA 4LF6J 4K0KF 2R7VA 1TL4A 1VMBA 2IDLA 2KXNB 3OTOJ 1JKHB 3BYPA 4FNHA 5CYMB 4F4YA 2MY8A 3LWLA 4J90A 3UN5A 2DITA 3N0VA 3PW0A 4U8YA 3H5YA 1M5VC 4DU7A 4EYHB 4KFBB 4ZHRB 2HWIA 2DJWA 1SJFA 2RILA 1VRQC 3BGOP 2VIHA 1QE1A 3ILLA 2AGQA 3IR5B 4CO5A 4ZIWA 3SCKE 3J80Y 3KJVB 3T1HJ 5IQ6A 3W64A 1BLUA 3M2RB 1S5ZA 2JVRA 4ZJOA 4WFXA 5DG7A 1CSJA 3AOCA 2HGMA 2CKWA 4WFYA 1UJ6A 4FF3A 1KNZA 2Y0SD 1SJ1A 2LU2A 3M2UA 1U49A 1FK9A 4CLKA 1NH7A 3O3LA 2DNGA 5KG1A 1AYEA 1R8HA 4LR8A 3KLHA 4HVZA 3T3FA 1C0UB 3AD9C 1B0PA 3M8PB 1SIWB 2J9CA 3M6VA 5GADI 1X60A 4MTPA 5HQLA 4HKQA 3MF5A 2CFXA 2DB1A 1FD2A 4KSEB 1RHUB 4I1TA 2HRTA 5E5NA 2I6WA 1S12A 3CJQA 4J9PA 4DR7J 2J6UA 2DNKA 2BW7A 4DEZA 2V4RA 3R2CJ 4K4VA 1PAUB 1HA1A 2MYFA 3AJ2A 1RWOB 1GEHA 5H9EJ 4AFFA 3LUYA 3SV3A 4ILLA 2FYXA 2UV8A 3QGGA 3JAMU 2QTWA 3MUTP 5B0FA 3UQSA 4CQ1A 4ZN1A 1TL1A 4KO0B 4CH0S 1T03A 1FNXH 4Q2MA 3M32B 2VQFJ 3HD2A 5DGAA 1YJVA 1CS4A 4ZPAA 3WHIA 3Q22A 4LQ3A 4RWXA 2A1BA 3R9LA 1Q8KA 2YTCA 3JAMY 1PKUA 2IJRA 2IM0A 2KB2A 1GFWB 3C6TA 2KL8A 5IOLA 2ASJA 5EHHA 5KFQA 2EFPA 3QAUA 4WYWA 2XWYA 5AXLA 2W9CA 1FRMA 1XTZA 1VQKS 1OY8A 3GJQB 4EZ9A 5I4MA 3MMBA 4IOCQ 5GAGI 3VZIA 3HT0A 1E6YA 1PIEA 4YHHJ 2XG8A 3T5KA 1URNA 1IBLJ 1RT4B 1RT7B 4C6AA 4FPIA 2ZFHA 3AY0A 4DN9A 2RF2B 1X5SA 3V2UC 3GWCA 2Z2MA 3BREA 3OD2A 3OXGA 3QIDA 4ECWA 2HEKA 1K1QA 2AJ4A 2YKAA 4CT9A 1FDDA 1XIQA 3KHLA 5JVGQ 1YITS 4PXCA 1S6QB 1DLOA 3V6DA 2RSQA 5LJ3Y 2I1RA 2LXUA 2ZBPA 5J2PA 4ER8A 1MROA 2OTJS 3CNQP 1U1KA 2HQ3A 3D0IE 1FE4A 1R43A 4KR0B 5C5JA 2KH9A 3FSYA 3GIJA 5J2PB 2NXUA 3ADAC 4FPRA 4Q2LA 3DLJA 4B3SJ 4F3MA 4LREA 1AFIA 1HHSA 3MR3A 1F9HA 3J81j 2ROPA 2H1YA 4LUBA 2V8VA 3FEZA 4DV2F 3M7VA 2IBKA 4H54A 2FLPA 2W9BB 1LW2B 5F8NA 4B3RF 3BSOA 4DFKA 1TR0A 2DT9A 2A10A 4KKOA 2MEWA 3OR2B 4UUWA 2QA4G 1X9SA 2B4UA 1L3KA 5IS2A 2GGPA 3CC7S 4QU7A 3EGWB 2PO4A 4PRFA 4OI1A 5EN1A 2NCKL 2W4CA 3G86A 1JIHA 2NUHA 1HNZJ 2FVQA 4XDCA 2E1PA 2XHWA 5KT4A 3P96A 3IG1B 2J8AA 3K8WA 5IM0A 4U7CA 3ILIA 2W9CB 1VQ7S 2M2BA 4Q5VA 1Z4UA 3ETOA 4B3TJ 2LYVA 2XYHB 2UUBF 4JI7J 3PVXA 3KTQA 1S76D 1S6PA 2QL5B 2BE2A 1NB2A 3D0HE 2RD5C 1CC8A 3OQ2A 1VBKA 5DGBA 3TRGA 2RQMA 3OHAA 3FCWA 1NZAA 4LFBJ 3RTVA 2KVIA 4GC7A 4RUHA 4OYWA 2I38A 3C6UA 3SBMA 4F0MA 3ILOA 1RWNB 1T9WA 2YKMB 4CLZA 2I8EA 3ET6B 4WTYA 3TZWA 5HJYA 1YHQS 4HDGA 2M8DB 5T7LB 1U1PA 2QLBB 5D0HA 5J2MB 2HKEA 3PJWA 5KAKA 2CJBA 4I6AA 2YNGA 1N54B 7AT1B 3A1YG 2QMWA 1UKUA 4ENOA 4WKYA 3EZ5A 2XMWA 4J37A 2V4JA 4KBIA 4D3HA 2RHSB 2ZJRQ 3BDPA 1VR6A 4ZVOB 4ZJLA 3BQ1A 1FKOB 2WW8A 2HLUA 4YQWA 2W7OA 3O8WA 4DR4F 4MMOA 3T19A 4C0HA 3L4BC 3GMGA 1Q5VA 1S57A 4NLTA 2M7SA 2LQ8A 1HNXJ 3C16A 4EWTA 3B4MA 4KH1B 4TYBA 3G2XA 4N5SA 4J9MA 2FHJD 3PR5B 4M8LA 3PW7A 4NA1A 2QLJB 4ZPTR 2C28A 2SXLA 3J7YI 3H5UA 1S0OA 2HNDB 4NMXA 1SUQB 3W5ZA 2HHPA 3GE9A 4UT4A 2KFZA 5I3PA 1AXQA 3R1LA 4DJBA 2N4CA 4S0MA 4DV3F 3NKYA 3PJXA 4NL5A 3KOAA 3LP1B 2H3EB 2KHDA 3HD1A 2YKPA 1WC5A 1NDPA 2F40A 2CDRB 1N36F 2KKHA 3KJFB 2CQCA 3IWXA 1T94A 4IKAA 1IJFB 2BKNA 3EUNA 3NY0A 2YWFA 2QMXA 2Y9HA 2VG5B 1WOOA 3EPGA 4NLUA 4BWJA 2CPEA 1ZAXA 1CULA 3CJ5A 3P49B 3DRSA 3JYTB 2GIQA 3OTCA 1VRUB 2EBGA 3MMCB 1F0XA 1FDBA 2HBZB 4ECSA 1VBXA 2XS2A 3MCNA 2POKA 2MKHA 4P2FA 4NA3A 4QW8A 4B3RJ 1OPIA 3PYDA 5ADZA 5KFEA 4ECTA 3E2EA 5FDLB 5IC4B 1WF0A 4EBEA 1JJ2R 2LA4A 3JTNA 3PRDA 4FKXA 3K89A 4LSZB 4OX7A 4KPCA 3J7ZT 3KK3B 3NGTA 1ZTWA 1S9EA 2HBRB 1RTHB 2UVVA 2A3JA 3MPYA 4F4AA 4FYVB 3K8VA 4LF7F 1ICEB 2HHTA 3G6VA 3CCRS 1UW4A 1YJTA 3HHKA 1ZZNA 2HQDA 2PT0A 1A0OB 2W2PP 4CWBA 1S1VB 4YN3B 2HNYB 1UETA 4F26A 1ZA1B 2V2QA 1DRZA 2IFXA 1MMNA 3CT9A 1VFJA 4QIGA 2BV3A 3FDSA 1HYSB 1B70B 2KZMA 2VB6A 5RUBA 1RCXB 1H98A 4RNOA 4USWA 3DMJA 2HRYA 3NGDA 4CLLA 4GMKA 5HMZA 3RR8A 2GJ2A 2MJUA 4X4TA 1T9TA 3NBPA 3VF0B 1FD8A 2H9ZA 2EK1A 2Z58B 3MMAA 2HK2A 3A4TA 2RDIA 5JUMA 1C2PA 4F3QA 4PQUB 2EC0A 1ZPVA 2JEIA 1HARA 3LA0A 2NPFA 2DNRA 2GVZA 3V81B 2ZVSA 5KG2A 2YX1A 4G1QB 1NHKL 2KG0A 5A8RA 3RBXA 4K50A 5IV4A 3I5BA 3MDFA 5E3QA 4C4WA 4J9QA 3NBPB 4DQQA 2J0XA 3QIPA 1N5YB 4MH8A 1ACMB 5L8RC 2PIIA 3W2VA 2MMYA 2AEMA 2UU9J 3UVJB 4ZLNA 4LRDA 1CLFA 2OPSA 3RZAA 2X1AA 3ZTPA 1M5OC 1NCLA 2L9WA 3CJ8A 3T5HA 2FGCA 2E5JA 1KOHA 3D66A 4RNHA 4X84A 3Q89A 1VBZA 4IUFA 4RBUA 2IMOA 3KLGB 4R8UA 4ELUA 1CQMA 4DHVA 4OYAA 4OJ1A 3W60A 2C1EB 4FYDA 5I42A 1SC6A 4MKBA 1QTMA 4DX6A 2ZBQA 1DY3A 1TQLA 1TUGB 2BOAA 3LP0A 1Q8BA 2HGLA 4PPZA 4O23A 1S9EB 3TX0A 3OSNA 5D4OA 4N76A 2MQMA 3M4XA 2LVWA 3ZZUA 1LQ9A 5KFMA 3M9NB 5F8GA 4TU7A 3EDRB 4NZ6A 4L75A 3NNHA 4WTOB 6FDRA 4UZBA 2K7JA 2UP1A 1RB0A 1RHKB 4B9UA 2XM3A 1UVJA 5D4NA 3CCJS 1HD1A 3TYTA 3AXMA 5ETTA 1H0HB 3OR2A 2R42A 5SUHA 1NJYA 3QT8A 4G3IA 1T03B 4C98A 2HHSA 2PFDA 3M2VB 2NZCA 3I4PA 4DI6A 1FRXA 3DRSB 1T9UA 1FRLA 2DO4A 1ULRA 2GQQA 2Z30B 3R8YA 4F4WA 2G0CA 4F4ZA 1NK0A 4CDIA 3L3CA 4DR6J 4IQXA 2WONB 4QPXA 2B9XA 2LFVA 2B56A 1TK8A 4OL8A 5IV3A 2W4PA 2AJ1A 2A18A 1SL2A 1KVIA 2V69A 4IH7A 5KFJA 3LGMA 3BKUA 4AYBD 5L46A 5GMKa 3M2RA 2OUGA 1VC0A 4JYAF 4H4OA 2V68A 2QA1A 4DR3F 2VQFF 4DFPA 1S0NA 2C2OB 1U0SA 3K5LA 4J9NA 2AD9A 4OHZA 2ADCA 4OIXA 1G1XA 3IP0A 1XMOJ 1KLNA 4JI6J 3W61A 3FK4A 3ZTOA 1U0HA 1VK8A 1Y5LB 2DY9A 1NH8A 1U6ZA 4OZJA 2XLJA 2Y8WA 1U8SA 1VYAA 2OTLS 3HSGA 1VOMA 1ZPWX 4EU0A 3DRPA 2DNZA 1RWKB 2ZNZA 3GR0A 2RHQB 4ZA1A 1TKDA 2E1RA 3BH6B 1RT4A 1RT7A 3LTOA 1S1UB 1N4LA 4LT6A 4OZ5A 4CLPA 3UNGC 1DZ5A 4Y2KA 4A8KA 3BQ0A 1HNIA 3MUMP 3JXOA 3OFHA 1FJGJ 3L7OA 2W2NP 4MIBA 4AL6A 1TL5A 1JK9B 3HKZD 5E2QA 2CQ1A 3C66A 5KFWA 1RHJB 5AE1A 4QJVA 2BA9A 4NLQA 4ID5B 5DG8A 5HVGA 5D4LA 1YTYA 2VPXB 2NXCA 2XMUA 2A2DA 3JB9k 1H6KX 3DDNA 3UDVA 5KFTA 3AQOA 1CJTB 5KT5A 2GVDA 1TFWA 1VISA 4NCAA 1E6VA 1UVKA 2Y1RI 4JI0J 2DCUB 1TZ0A 1S1TB 3HM9A 4X4OA 4ID8A 4O4RA 1CJUA 4P2SA 4KTQA 1JJCB 4DR4J 4DCPB 4J5OA 2R3VA 1PJ5A 4RW7B 2EWHA 4V1Ak 2XMAA 4RBVA 1Y3JA 1TU0B 4A8OA 1BUXA 2HS3A 4C9DA 1WOPA 4EK2A 5HMWA 2J0QD 2DISA 2GMHA 3OTEA 1Y4ZB 2DK2A 3CJKA 3R27A 1X4EA 2MQNA 5AE3A 3VAGA 3CJRA 4DUZJ 2BM1A 4F02A 1VCTA 1YDLA 1M1HA 2BJEA 1J27A 1PAEX 2PA3A 4ELVA 5KOWA 2YNFA 4FBUA 2CPFA 3EXYA 4KPYA 1MWZA 4LSLB 2I2YA 2ILYA 1C0TB 1NPKA 2WVCA 3MR7A 1H2TZ 4PG5A 4NYOA 1UCNA 2LXFA 4O44A 1UZHA 3R6GB 4OZ3A 1Q0NA 3RUBL 4FXWA 4EYIB 1B7YB 3AHPA 1VQPS 1W7WA 4DPWA 3T9NA 3B8HA 2VA3A 4YDXA 1FHTA 1KQSR 1GNKA 2MZTA 3SQGA 3JYTA 3A3NB 2BQRA 2KFNA 2XMMA 3G82B 2W4DA 4DR1F 4ECZA 2Y1JA 2J7WA 1HBMB 2MQPA 2JVOA 1ZM2A 2OLWA 2P6SA 1E6VB 2PEHA 1KEKA 1RT1B 1S9GB 2XZTB 1O0PA 1UPPA 3BH7B 3LGNA 5A2QU 3MGJA 4OLPA 3CVKA 4E8UA 1GXLA 1RHRB 3LW5C 1SKWA 4OI0A 4IO1A 2GMLA 2PGCA 3GYGA 3W1YC 2AHOB 5LMUJ 2QLFB 3CD0A 3V6KA 2R8KA 2Q1LA 4W92B 1BQNB 3BSCA 2IRXA 5F0UA 2BJ3A 2F4VJ 5DJBA 4PQAA 3DOLB 1LWCA 2MKSA 3ZZRA 4DUYF 3NS5A 1SUQA 4PABA 5C2GA 4RW6B 2JSXA 3QGIA 4NLYA 3PG9A 4JI8J 1K73T 1ZETA 4YB1P 2RRAA 2W9AA 4FXDA 2BQUA 1XK8A 1TKTB 3HX9A 3QGHA 4O44B 2ASDA 1S48A 1RWWB 2XMVA 2P8IA 2BJ7A 3TVZA 1QVFR 1RTJB 4KFBA 4ZHRA 4K59A 5KFLA 3VQTA 2ZM6J 4DPOA 1IBKF 1FERA 3C6TB 4MAKA 4P2XA 4CM0A 5L1JA 3RB0A 1JKHA 5ETPA 2V5HG 4DXLA 4DV2J 4DS5A 1JLEA 2WBRA 5J2MA 1WTFA 3BSNA 1FEEA 4GVBB 4I2QB 3RRHA 1NB7A 4B3SF 3IBCB 4KC5A 3ZC4A 2HZAA 3ENVA 1U1RA 3KK2A 3DOKA 1YK9A 1NSQA 2DXFA 4LBIA 4PWWA 3CMES 2D9PA 2FJXA 4UTGA 3TQEA 1I5OB 5ETMA 5HVFA 1QLNA 2C3UA 2WTFA 5E33A 1JLGA 4Y65A 1DQAA 3D6TB 4IG3A 1FRJA 2VPYB 3ULHA 1S7IA 3VAKA 2AGOA 2NREA 1L5UA 2VHGA 5B0CA 2G0JA 3I56S 4M5KA 3EVWA 4OYMA 4TQSA 3J7Z5 1HNVB 3MZIA 3M2UB 4KKOB 2DGUA 3LANA 5IT9U 2KFYA 3CCES 2IA0A 4RW8B 2G4BA 2AWZA 3UNYA 4PR6A 1WDDA 4WFZA 2OFGX 1NSPA 5K14B 2FHJA 1Q78A 1U1NA 1ZAWA 2IAJB 2DXDA 2KT3A 2E9RX 2WVEA 1REVA 4JI1J 4LRCA 3CMQA 1WDTA 3HDSA 5DZ6A 3SZ2A 2KJWA 2MZSA 5E7OB 2EC2A 2CJXB 4ES3A 3RAXA 2IM2A 4WP9A 4B17A 1NKCA 2EPIA 4UOFA 2MB0B 3H5XA 2OI2A 2K1RB 3MTJA 3LALA 3K5PA 5BXIA 2AX0A 4TY8B 3KHHA 1JXVA 4K4UA 2BANB 2ZNYA 1YJNS 3C2PA 1S49A 1HNWJ 4NZ0A 3DOMA 4DUTA 4ERDA 3E3XA 1HBMA 5FLXY 4HH1A 2LECA 4GKJJ 5T7LA 2BR0A 4OZ0A 3UWTA 1YKWA 2C42A 4N47A 3IRXB 2MY7A 2XEXA 3BGLA 3PHTA 3IN5A 4A8QA 2VPZB 2PMHA 1JWWA 2WOMB 4YS2A 4ZP8A 3GYXB 3TI0A 3MM5B 4CZCA 2VQEF 4DN0A 4AD6A 1GX5A 2JC0A 3A8IA 3CW2C 4UUXA 4OZNA 2A6MA 5LSLA 4QR1A 1WHWA 3OJSA 2ALYB 2GQCA 4UZCA 4ZDNA 2KG1A 2ZH9A 3V6JA 1HI0P 2EI5A 3IG1A 1H38A 2JLGA 2C2ZB 4K4SA 1UVMA 1WKJA 1P1TA 2F3JA 3OXFA 4PG4A 3U27A 5DDQC 2PA8D 3C15B 2YH1A 4UY85 3PYGA 2Q66A 3NWGA 1LNQA 3T1HF 2BE9B 2DNLA 2CQDA 3MXHP 3MM5A 2HS4A 3TAPA 1PC5A 3KLGA 4RW7A 5D3GB 1HHQA 4R5PB 2M3DA 1JLBB 2M0GB 1LKZA 2RNEA 3BGUA 5CYQB 4TXSA 5KT3A 2GAGC 2Y8YA 3RW7A 3EPIA 5JJBA 3OT9A 2CNKB 2YBVA 1ZYQA 1YJRA 2Q79A 3HVRA 2B8PA 1SH2A 1VLYA 4UQGA 2VODA 1LWCB 1V5IB 2FLOA 2X1GA 4DF8A 3IWLA 4K4ZA 5KT7A 3NGKA 1EZZB 1FKPA 2DH7A 2ZITA 1VIOA 4NXMF 3J81U 4C8ZA 3CIZA 3I0RA 3MD1A 1B7FA 2PDAA 3TUPA 3NOGA 1RUSA 4O3PA 4FYWB 2QFIA 1KLMA 1HBNB 1C0UA 3G8SA 3L7UA 4HTIA 3QFWA 5B08A 2XHCA 7FDRA 3SI8A 2GHVC 2OJ3A 3OR1A 2R2SA 3SFGA 5IWAF 3KJNB 1YRXA 3G82A 3WX8A 4HDHA 3DRPB 1S4EA 1IKVA 1LWFA 1IQZA 1I51B 2EG2A 3DU5A 4OLOA 4G1PA 2G9OA 4K8RA 4QR0A 3T6JA 3TVYA 2Z2ZA 1WG1A 4IG0A 1U02A 4GRSA 3R5DA 3AB2B 5DDPC 1B4SA 1VQYA 4GVLA 3TX8A 3PX0A 1N34F 3FUYA 3TUJC 4IO9Q 3Q23A 2MHNA 5SZTA 3OUYA 3MCSA 4NE9C 3MM9A 1HBOA 4ZPWR 1X4GA 5KTQA 1FT8A 4K4XA 3VTIA 1OWXA 1TV6B 3CD7A 3M9OB 4O3RA 3DLBA 2ZWOA 1PJ6A 1S1VA 3MAHA 1RT6A 3L7PA 1R7IA 2VD3A 1J5OB 3HHEA 2HHXA 2MSSA 4M5DB 1HWUA 3CCZA 3MEDA 4XO0A 1U26A 4LFAJ 2PFFB 2J0SD 3U1MA 3PNIA 3PHEA 1SKUB 1ZM9A 3ITHA 1UWBB 2W2MP 2R7RA 3HZEA 4W4MA 3MECB 2ZOGA 3TZYA 2V9WA 1F5AA 2CQ3A 3KDOA 1D09B 4QR2A 2J7UA 3SCIE 4YUDA 4OZ1A 5L9XA 2DR7A 4RBTA 1BY9A 5HBMA 3FZBA 4YB5A 4TY9A 2JLFA 4NXNJ 3BEGB 4RWWA 4NI2A 3GILA 3A13A 1VQ5S 1EHWA 4PAAA 2YWKA 1NHUA 2BW2A 1HQEB 2ZBRA 1NNDA 1RT5A 1Y11A 2JHEA 2ZOMA 2FY8A 1CQNA 3NGUA 1LWEA 4RUCA 1SKSA 3PEHA 4MK9A 1SJ3P 5IT0A 2HMIA 2KYXA 2IM3A 4DL4A 4KHMA 1REGX 2AJFE 4ZLLA 1B3TA 1KQGB 1S1TA 3GV8B 1GMUA 1R3NA 1FI4A 1RGVA 4BC9A 1FDAA 2CZ4A 1MU2A 1UA0A 3SMZA 3PO5A 1M5PC 3DI6B 4CCHA 4IG0B 3WZ0A 4CYUB 3HVWA 3OFFA 3CJ4A 4QBUA 2RS8A 3P4UB 1CJVA 2DNOA 3R5JB 4UW2A 2Y1LB 3BGRB 5T14A 1FESA 2HMIB 3NCPA 4X66J 1DBDA 1FE0A 3WIVA 3JSRA 3K17A 2GVZB 3C16B 4ANCA 3M8SA 1IBKJ 2RQ4A 1LXJA 4A8YA 5J2NA 5LXYA 2OD4A 2C3PA 1R0CB 5IFMA 3K2YA 1FA0A 2JNJA 2V50A 2BJ8A 2UUTA 1SQFA 4PYAA 4OHXA 3RBZA 3UE2A 4CYUA 4D3GA 4YR2A 1T8EA 2W8LA 1D8YA 4XPEA 4ZVTB 4J9VA 4L76A 2CJAA 2YQ1A 3H2UB 4I0WA 1F3FA 4Y2MA 2RIJA 1RJJA 3D7SB 5A6WA 1GXUA 3Q8RB 2IBOA 5F3ZA 2WK4A 4LF4J 3AA9A 3ITHB 4ALZA 3GIMA 4HL9A 1X7VA 3TEHB 3FQLA 3QZ8A 1RAFB 2XSJB 2J9EA 2XI2A 4CH1A 2LKZA 2DY1A 2VASA 2MDAA 4C8MA 4ECXA 3QLHA 4DF4A 1RYRA 2V8HA 1KWMA 5M2RA 4A47A 4LF7J 1NO8A 1XC9A 2FJAB 2MQ8A 1V5VA 5F41A 1RT3B 3DLEB 2ZUAA 1S6PB 3JQKA 4YB6A 4ZP9A 3S7RA 3G6ES 4BCAA 3TJAA 2U2FA 3CCUS 3D2WA 1N5VA 1U48A 1QUPA 3MTKA 1QSSA 2Z57B 1HL6A 2HYIB 3F41A 1RBOB 3FSXA 2HZVA 3V4IB 1HI1A 5HP1A 2WCXA 3TQ1A 2DIUA 2F1FA 1IR0A 1YRTA 4LVOP 3CJKB 3OLBA 2O67A 4AQYF 3K5OA 3NXZA 2CQHA 2J9DA 3DXBA 5J2QA 1U47A 4JI3F 2DGSA 4IRKA 1K0TA 2QN6B 1JXEA 2K2PA 1CBKA 5MAOA 2XLIA 2OKQA 1RK8A 5CHCB 1QSYA 1YQHA 1I94F 4F50A 1IKWB 3EE3A 3QFHA 4KE5A 4J9OA 4LF9J 4QYZJ 2CQPA 1R31A 3EXCX 1CULB 2H4WB 5L39A 2BYCA 4X64J 1KQFB 2MLYA 4LBPA 1SCJB 2ZE2A 1RT6B 2D41A 4Z2XA 5K20B 2MKJA 2DGQA 5F9LA 5D4PA 2UXBJ 5H9FJ 2DRDA 2W2QP 3D1HA 5HK4A 1MMDA 2BMBA 2NLWA 4OJ3A 1EX8A 2QJ3A 5G0RA 3AFGA 4OHYA 1HFEL 5LMNJ 3UD3P 2VFRA 2J6SA 2YNHA 3D3BJ 4ZP7A 2DH9A 4B3TF 3I96A 1VI7A 5BR8F 4QU6A 3PRBA 2ZH4A 2B7BB 4MFBA 2HQFA 2OEKA 1RI7A 2HBQB 3V5RA 3D0GE 4OHWA 2AZ3A 1S4FA 3WBZA 4TVAB 3AJ1A 5J1EB 1UEUA 1K8AT 4LMZA 2VG6B 2HBYB 1HNXF 4LRFA 1RT5B 2COLA 3LWMA 4F3OA 3BBBA 3R1HA 1HBNA 1KTVA 1FXDA 3C19A 5EWFA 2HVZA 2NPIA 3I0RB 4HACB 4ZVGA 3GLJA 2X7IA 3H4BA 1AFJA 1ZTTA 1TK0A 3KMSA 4F8RA 5J2QB 2E9ZA 1RWPB 1ZM3A 3JQJA 3DYAB 3OTBA 4CO3A 2N3OA 1HQUB 3BB5A 4URSA 5HL7Q 1DJ0A 3D1QA 2R7OA 3N28A 3CTRA 5GADU 3N9UC 5HROB 4NEYA 1S0VA 3N01A 2V8GA 5CCMA 4EO6A 4X4RA 1U2RA 1D0EA 3N4WA 4K4TA 3BBCA 5M2PA 3DLKB 2HQIA 3G87A 3KLIB 2CNOB 3HPOA 2VDIA 3CDEA 1RTDB 2I5JA 3BF4A 2BE2B 3MR6A 2UUCF 4KHPF 3U7JA 1WEXA 2BANA 2A2CA 2KJVA 2YKNB 2DGXA 2L9NA 3HFKA 4KGXB 2ZH8A 2R7SA 3FSIA 3S01A 2CPYA 2DEIA 2UXDF 2QG9B 1TKXB 4J91A 1D3WA 3W9JA 4QWCA 1PJ7A 2VJVA 1NK7A 3VZHA 3WQPA 2I0XA 3MUVP 2WOMA 4FDFA 1WKLA 1A7GE 4ES2A 1XNRJ 4ZIVA 4RW9B 4JI3J 4J7CA 1Y00A 3D1OA 4JBCA 5ETRA 4H4KC 1UTAA 2XBPA 3P5TL 4OI4A 3KFWX 3VHQA 2OPSB 2D9OA 4UOCA 2R2RA 1MWYA 1JLFA 4I6YA 4DR5J 1GMWD 3NCRA 4NX9A 4JV0A 4USJC 4GKKJ 1T05B 1O6XA 4PUOA 1S59A 3MPDA 4I6WA 4P9SA 1HQ2A 1O51A 3DCAA 1NK4A 2V63A 1KKHA 1WORA 1XMBA 4X4PA 2VDHA 2WBMA 3LO3A 4LFCF 1M1GA 3CC2S 3OFEA 3DI6A 2CPHA 4NZ7A 5C25A 1G6BA 3RB6A 4EZ6A 4KGVB 2KVQE 1NJXA 2CDQA 1UFLA 2QZ8A 4LFCJ 1AB8A 1JLFB 2GW8A 4NCGB 2ZVIA 4QYZK 1S1XA 1PBAA 5ETVA 2HZCA 4L6V3 4QWAA 2FY1A 4URGA 2CADA 2HVDA 1HBUB 5D6GA 2KM8C 5J1PA 3GIKA 2R8IA 1G3OA 4GVBA 2CPIA 2B6AA 3ZZYA 2YWEA 4I64A 4CP5A 1GAOA 3DMJB 1P1LA 1VJQA 2DCLA 3DLEA 4CIOA 5LMUF 1DFDA 3TEGA 1L3VA 3PR4A 4WYLA 4DV5F 3AOBA 1RTHA 5F8JA 1FKOA 4MT1A 3V4IA 1Q53A 1VQLS 2VG7A 5DLFA 4ED8A 2EVZA 1JLGB 4AT1B 1FEHA 3NRBA 4O3SA 1HNZF 2QA2A 2RS2A 2QGFB 2YNIB 2MZQA 4OI3A 4C2MA 3PEJA 1XQIA 4HYKA 1N36J 4PYDA 2QYGA 2CVEA 2R8JA 1RAEB 3I31A 2CQ0A 4LRAA 2D3OR 1W2IA 3JS9A 2ZHAA 1XBWA 5CYJA 2RQKA 3GYNA 5M2UA 1RWVB 5CAAA 3CCSS 1JJ4A 1MNEA 3HF5A 3ELHA 5CCLA 1JNRB 3K5MA 3BKTA 4C8NA 2A6OA 4X62F 3W62A 4MJKA 4CO2A 5E41A 2RUGA 2Z2YB 3GFHA 2ATCB 2IHR1 3K58A 3M8QA 5K8NA 4USIA 4Q45A 3HT3A 4V19X 2DNMA 2NS1B 1MLAA 3EICA 2DEJA 2EG1A 4IH5A 1RHQB 2KRRA 2D3ZA 2GGPB 4BLGA 2E5IA 4W98A 5HANA 1DTQA 3MCMA 4I2PA 1GQEA 3EDQB 2V2VA 1GH8A 3UDCA 3ZZPA 3ENAA 2FUG9 4B9SA 2ZD1A 4LSNA 2D74B 2ZDPA 3DC2A 4NLPA 1X31C 3X3UA 4YY3F 4PWDA 3G8QA 1RTIA 1VQ6S 1U1LA 5F0WA 2HFNA 5KG0A 2FC8A 3DHWC 2BEFA 2MJNA 4ZVEA 3HFZB 4H4MA 4DR2F 1C0TA 2N7CA 2OMOA 4PXDA 2LP4A 4WE1B 1PILA 1SI9A 4OX8A 4TN2A 1EIYB 3QSIA 1AUDA 1F6TA 3M05A 1WI8A 1R8AA 3W3SA 4F04B 2LDYA 3T1YJ 2NYIA 5L9NA 2KI2A 2CUYA 2CXEA 2B3TB 3U02A 2VOOA 2CZVC 2UUAF 1YZ6A 1NSKL 2ABYA 2ZDOA 1EQMA 3J81Y 3CUNA 4AL7A 4QYRA 2D69A 1LEOA 3H4DA 2XS7A 3E01B 3ET6A 1TKZB 2DGVA 2E7WA 4N77A 2AJ2A 1PBUA 1NSAA 3R5AA 3RB4A 4B3OB 1NKEA 3M8YA 2O3DA 1CJUB 4ZITA 1TKZA 3E51A 2FJBB 4TKTA 2DRBA 3C46A 4DSFA 5B0DA 1HIYA 2PD1A 4C0BA 4NA2A 4JI5F 1H3DA 1LXNA 1MW7A 1R8CA 2K3IA 3IRWP 4N41A 2CNLB 4JYAJ 1N33J 2R9LA 3Q83A 4B9NA 4IOBA 4ZKAA 5KFDA 3H2VE 1JX4A 6FD1A 2VQEJ 1Q4RA 2PE8A 5GMDA 4ANDA 4WBFA 4C11A 4ECUA 4C8YA 2ZC3A 2AP6A 2BRKA 5THWA 3MAAA 2G2OA 2HNZB 2LA6A 1TTHB 3A8KA 3N6MA 3O44A 2W01A 3OLAA 1FK9B 4Q44A 2XY5A 1TVRB 2JH3A 2N4DA 3HSJA 1ZOTA 3M32A 5HQMA 4P71A 4DV6F 2D3O1 2AEFA 2OFHX 2HHHF 5IC6B 1ITPA 3GCXP 3WC0A 5HQ8A 1BMQB 1YI2S 1EETB 4XAKA 5KFXA 4QOTA 4DR5F 3HJFA 1PGZA 4WFNQ 2F9DA 4X4QA 7FD1A 2KYZA 1MN9A 3KLEB 2M8HA 3GR1A 3NGSA 4P2MA 4RLEA 3NWRA 4Y2CA 3B6BA 3R5CA 4NLRA 2MKYA 3VALA 5E3CA 1U7LA 2NSCA 3KLEA 2HLTA 4CNYA 1N52B 2F63A 4CH7A 5F8MA 2QEXS 4M63A 4RNMA 2IVMA 1M5KC 1YJWS 4JI4F 3H8YA 3MEGA 1IKYB 1CPZA 4JV2A 3LF0A 3PYEA 1EETA 2F7VA 3S8SA 4B9TA 1UVNA 2HHWA 1N32F 3JTPA 3LAKA 2V2KA 3Q0AA 4QWBA 1KVKA 4N56A 1BGXT 1I6JA 1GT8A 2HFVA 3H0PA 4DX8H 2ZBCA 2N82B 3OVBA 2V34A 1Z2ZA 3DLLQ 4M5HA 1HPZB 4HH0A 4UF4A 2BJDA 1RBLA 2Y3YA 2XQCA 3LP2A 4HI1A 3CD6S 1DAXA 1JB0C 4JI2J 4X64F 2J5AA 4Q0BA 3W7BA 1R6YA 2ZKUA 2K7KA 2HS0A 3IR6B 2DPJA 1JLBA 3L95X 1OSDA 2DVIA 1WC3A 4N8NA 4NYPA 1NDCA 3UD4P 2R7UA 4KRWA 3PO4A 4X4UA 2HNZA 4HHJA 1IR1A 2LCWA 3ENWA 4P73A 2AIRB 3G8TA 1HQEA 5L1KA 4O3OA 1SJRA 4C8KA 2B6AB 1G2EA 1BWVA 4ED3A 4NLSA 3VR1A 4YOEA 1RTZA 2CJQA 2OPRB 2ZKTA 1BC6A 5F3TA 4I2QA 2WRMA 4GO7X 4WK1A 1QDUB 3KXDA 2FVRA 4RJVA 4BWMA 2MGZB 3CCQS 1M1KT 4RNNA 4NPOA 4HTJA 5DDRC 1RWMB 3KNAA 3DOMB 2DGTA 4KB7A 1VGYA 5GAHU 5KG5A 1R0BG 4MIWA 3TJ9A 8AT1B 5KFUA 4ED1A 2DKOB 3MI7X 4B08A 1RAHB 4ZN3A 5A0YB 1WTBA 2DH8A 3QPIA 4Y6IA 4U95A 2V8DA 2MQLA 3W9IA 4GO5X 4ETXA 3E01A 2E44A 3D67A 4A8SA 5D0RA 2AU0A 1SBRA 1Q16B 4M5DA 1JLAB 4U96A 1FWLA 2EFNA 5CD4A 3MAQA 2E5GA 2O1PA 2OEMA 3MEGB 4QW9A 4IFYA 3KG4A 4I7FA 2C22A 3DN9A 3HXMA 5GAGU 2ZWPA 5FD1A 4FVCA 4K5SA 3HZGA 5DM6Q 4ECQA 1A9NB 1WSRA 4J9RA 1EB0A 4RW8A 2FD2A 3DFEA 1VC6A 5F8LA 4ZCLA 1XNRF 2QMUB 1TUWA 3UVJA 1RAIB 1N6QB 1N34J 4DUZF 1NK6A 3TZZA 3QT5A 1LW0A 1U2FA 1URRA 1WHXA 5KFFA 1YG0A 2QA4S 2EKNA 2LQ9A 3H7HB 2FLNA 1VQ9S 3LAMA 2CJYB 1CG2A 2ROEA 2H65B 3CF5Q 1WEZA 1QAJA 1YRUA 4XIUA 2FIUA 2KXHA 3L09A 2J76E 2QL7B 3U1NA 4EBDA 3GSIA 1Q8IA 3QRPA 2DXEA 5BYSA 3CC4S 2YKOA 1S97A 2Q3PA 3D4JA 3W66A 5KFKA 1GTHA 5C24B 4R0JA 4DU8A 2GV1A 3BR8A 5FIIA 3M30B 4DR2J 4LF8F 2V67A 4C11B 5HMXA 4BBYA 1FWKA 2W24A 2LEPA 2V6AA 4OMFG 1JLCB 3W65A 2FVPA 2RVJA 2VH7A 4Q43A 3MM6B 1JXLA 2K06A 1EQ0A 5A8WB 4RL1A 4DDFA 3HJVA 3PW5A 1J2VA 2L9DA 1WELA 3FMBA 2RKIB 3DOKB 3SIPB 2HIYA 3GFZA 2H4YB 1BWEA 4Y2AA 2M4MA 4WJBA 4RNFA 4JI1F 3EZUA 1Z1ZA 2DR6A 3IC1A 5D0GA 3QAEA 2C2DA 3DLGA 3AB4B 3M30A 4NLGA 3RYLA 1SJ4P 4KT0C 3UN3A 1IN0A 1QVGR 4EO8A 1J5OA 3IMQJ 2QT7A 4QIVA 2B0GA 1LFPA 1OIAA 1YX2A 3CGIA 4K4WA 3KHGA 4JI0F 5KFCA 4USHA 1KHWA 3DGPB 8RUCA 1KOOA 4DV6J 2ZZTA 1VHIA 3NAHA 1XR7A 2HFZA 4A46A 5F9NA 1UAWA 3Q8PB 4Q0BB 2WHOA 3DHXA 1U25A 5BYRA 1L3UA 5I3UA 3MWBA 2RU9A 4O3QA 5HI7A 1U1MA 4KV8B 1R8BA 2UU9F 2RE1A 3DLHA 4UQTA 2JOQA 1HPZA 3GQCA 4P6QA 3FCVA 2U1AA 5LMNF 1OYEA 5AXMA 3MM8A 2Z4PA 1PG5B 3HKWA 3QMQA 1LFWA 1T95A 4FKYA 4ID5A 2RQCA 3HI9A 1D9DA 2NR0A 5CH7B 3RG6A 1AZSB 1IR2A 3KHRA 1PYTA 2BJ9A 1S7HA 3AT1B 4DFMA 1YBAA 3R7SB 1NPRA 4JI4J 3UR0A 1XERA 3B78A 2ASLA 3EWGA 1HW8A 1KDNA 4JI6F 3WX4A 4FF1A 3ISZA 1CEZA 2HVHA 5K9FA 1DURA 4MKAA 3PIOQ 1NHVA 2XULA 2QV6A 1WOSA 3QWUA 2QSFA 5CZXA 3I32A 1ZA2B 4PUOB 3GTYX 1DLOB 3V6DB 1FKAF 1MU2B 2MPUA 1HKAA 3GIIA 2AYBA 3OTDA 2J6TA 1X8DA 2ILZA 4C8OA 2XB2D 2IJFA 4RUAA 4LIWA 3V6HA 2LEAA 4NXNF 4TLQA 3HMJG 3AAWB 1GK8A 3HP6A 2Z56B 4EEYA 3SSQA 3RBDA 4QIFA 4CLSA 2FDNA 3ZTSA 4FXVA 4WPAA 4EI2A 3OVAA 2PN6A 1RXOB 2XMTA 3I87A 3UN2A 3ZZTA 3W63A 1O8BA 4N7TA 3SSSA 1Y5IB 4ZLPA 4ZPCA 2CJ9A 4KQZA 1HWIA 3UW1A 4ZVRB 3MAAB 2YNIA 2O5DA 2QIFA 3V4MA 1C1CA 1XJWB 1TKXA 1NK9A 1VQ4S 2UXCF 4P7VA 4WWSA 1GXTA 4EUVA 3PKMA 2R7QA 1OY6A 1FDNA 3MM7B 4Z7YA 3ZTQA 2FLLA 2NYHA 3BPSP 2P2CB 3DRRA 5KFIA 5DETA 4IRDA 3TJ8A 3CSKA 4ZK7M 5KT2A 2AGPA 1N56A 3R2DJ 2BABA 2OSRA 1IBCB 4Q8EA 3FRYA 3FZ2A 2HVIA 2AW0A 4ZPBA 5KG4A 1SQEA 3W2WB 4HHUA 4M5IA 3M9MB 3SXLA 1SH3A 1CJTA 1RHMB 1IBLF 5DS7A 3DXSX 1LWXA 1D1UA 4B3OA 1NBEB 4K5RA 4DR6F 1LOUA 3FRZA 5ETOA 5I3QA 4KYZA 5CQGA 3PY8A 1KBRA 1RU2A 1UW9A 2VUGA 5JXSA 3A12A 1IWGA 1X4CA 1UFWA 2IC3A 3KK1B 3JSMB 1P27B 5HLFA 2IPOB 3I0SB 2C2RA 4O4GA 3IAM9 5C25B 4OJHA 3F0NA 4ECRA 4OYBA 2ERRA 4CLTA 3ZTRA 2RB7A 2B4VA 2K1RA 4N8OA 3J7A1 4KH0B 3QJLA 4A4JA 1IM6A 1V9OA 5IQQA 3FC9A 3O5TB 3MMJA 4F0HA 3R7NB 1SJQA 3T5LA 4C97A 1F9EB 4E98A 3IGNA 1RTIB 3ZXWA 1WHYA 1F5BA 2VPWB 3TO8A 4OX9F 3HSZA 2EFQA 1V3SA 2H5JB 3EVMA 3ZZZA 1LW2A 3P5BP 2RJZA 2L3MA 8ATCB 2QL9B 1VRTB 4TYAA 2OPQA 1Y3KA 2DHAA 2Q6BA 1AW0A 1IKYA 2UVWA 3LOUA 4I67A 1WEYA 2F4VF 1OJ4A 1T11A 5C2CA 3WIUA 1D8ZA 1QM9A 1TMJA 3MR5A 1N48A 3Q8QB 1RQ0A 4IDKB 1QJHA 5KG6A 2HK3A 5GMEA 1D9FA 3JSBA 1RKIA 3R6LB 5AJ3F 1RACB 2HURA 3M1VA 4DPUA 2FJDB 1S6QA 3EM1A 2OEJA 4CT8A 1SL1A 4RR5A 3W2WA 4PPDA 3W5YA 2E5LJ 3DLKA 3VAIA 3UCGA 1QAYA 4F4XA 5J1NA 2H5EA 1W2BR 4ZVFA 2RU3A 2JRSA 1X9WA 2XC9A 2HNYA 1WWHA 2DGOA 2YWGA 3I9V9 2H5IB 2JDJA 2KT5A 1VQSA 4PG8A 1IQTA 1FFGB 2BDPA 4ELTA 1WJ9A 4PZVA 2BKPA 4ZPDA 2DD8S 5C42A 4J9UE 5EX3A 4WFBQ 1NK5A 1HMVA 2AYEA 3KK3A 3D9BA 3KDNA 1YZ7A 4WP8A 2AJQA 1T9VA 2BZ2A 3ENQA 3ILJA 4XTTA 3TA1A 3A3PB 4DSEA 3LP0B 1RSCA 3GPAA 1HHTP 3C14B 2CG4A 1CS4B 5A8KA 1I94J 4LF9F 1CJKA 3UD5A 4HR2A 2HVEA 3TW0A 4DCOB 5F8HA 1OMSA 2XSJA 5DG9A 1FFWB 1N8RT 2DR8A 1VIXA 5ETKA 4G6VB 4YDDB 1C4CA 4DQSA 1NUEA 1KONA 4J9KA 2HWTA 2H48B 2H51B 1JJHA 3Q86A 3OR1B 4CLFA 2C2MB 3TAMB 3NAIA 3D6FB 1TP7A 3OV7A 3GV5B 2PMWA 4PWUA 4Y28C 4EBCA 2X1BA 2ZZMA 2D7SA 4PQUA 3CPWR 1JNZB 2HGNA 4H4MB 1UWAA 4OYIA 1IM4A 2FHOB 5J2NB 1HW9A 1OS5A 4LVNP 4NYZA 4U8VA 2BRLA 5ETLA 4RU2A 2QO3A 3G9CA 1T9XA 1FRIA 3EGNA 4USKA 3TP2A 1KVJA 4MYUA 2W2OP 1T0TV 2IRUA 1VRTA 1U24A 5I3UB 2GMJA 2M9KA 2YXLA 3TARA 4LF4F 1IKWA 2WSCC 3H59A 3K5NA 1U09A 2BXJA 3RU0A 4Y0FA 4DWIA 3NP5A 1Q5YA 2YY3A 3CCVS 4OX9J 2R8HA 2DHHA 4DQRA 5A8KB 4KV8A 2E1CA 4KGKA 4Z7CA 4C3MA 2VKZG 2ZH5A 4H4OB 1HYSA 3SCLE 2C2KB 5DZ7A 1FTRA 1XNQJ 4NI2B 3CMAS 4X4VA 3DRRB 2XNQA 1A6LA 4QPTA 3DRXA 4DFJA 3TNVA 3EJMA 1LWEB 3RAQA 5HLFB 1RLDA 3QNWB 4K2JA 2AQ4A 4IRCA 1MMLA 3G6XA 1OY9A 1QAXA 2R2TA 3QT7A 2B9EA 1Q82T 1QSLA 3OSPA 4DQIA 2G2YA 3DKDA 1BE4A 5HROA 5B0AA 3B54A 4C8LA 4Q8FA 1DARA 2PSZA 4CI0B 4GKJF 4RW4B 1H2UX 1M0SA 1VHFA 3GG0A 2LLZA 2KM8B 3A8JA 1F9FA 1JQGA 3F44A 1UWBA 2FGOA 3POTA 1KRPA 1RYSA 1H72C 3A8EA 1NJIT 1P9YA 2PEBA 2VG7B 5BYQA 5DLGA 4DV4J 4OZLA 3VVTA 3MPWA 4AL5A 5C24A 3Q8YA 2JEFA 2X1FA 3IA0A 4ZS6A 1EKSA 5L1LA 3RW6A 3RBEA 4IR9A 2K8GA 2YH0A 2HFUA 3MEEA 2CQ2A 2X3GA 4JB8B 5LJ5Y 3CB4A 1FRKA 2BX6A 3IM9A 3PV8A 3BGRA 3AQPA 3IBFB 1Y7PA 2ALZA 4DOZA 2UXDJ 3H98A 2X51A 1NLKL 1SC1B 2MXYA 3CDUA 3HHLC 4NCGA 4PG7A 1KFDA 3QGPA 3VQSA 2AMCB 1BQMB 4DPTA 3ZO7A 1R27B 2CJKA 3FBEA 2ZH2A 5GVQA 1EP4A 2NXNA 1QE1B 4QQBA 1VQOS 1ZZFA 2BQ3A 4F4KA 1RWXB 3C8YA 5B7WA 3NCQA 2J0WA 3OPKA 2JFDA 4YP3A 3HLUA 2IYIA 5DDOC 1F1BB 2B4PA 2WSFC 1G7CB 1NM2A 1NPPA 2FHKA 2ZBIA 3DGPA 5KFSA 3CCMS 4JI7F 1CVJA 1FJCA 1WC4A 1U6BA 4DL3A 3BYRA 3VWSA 3UFCX 3FBCA 2FHMA 1FVSA 2V0NA 1NJWA 3HVTA 4ICLA 2HPUA 1R0AA 2OMLA 3O2IA 4NOHA 2KZZA 4Y00A 1NXIA 1RT2B 4LF2A 2EXUA 3HHLA 4NRUA 2Q6CA 1WG4A 2MHEA 5LL6d 3PTWA 1VQNS 2AT1B 2GJFA 2VFUA 1F2HA 2GO8A 3VGSA 1SQGA 3ZZOA 3CJTA 2L08A 3CCWA 4YR3A 3KG1A 3FEXB 5HP1B 1JLCA 3LPEA 1RA7A 4V19J 1RAJA 2OPRA 2CPXA 3GB0A 1Q8LA 3CE8A 4HT5A 1YJ9S 3HCXA 1IBMF 2M5YA 4P10A 4C7QA 4CLYA 5CABA 1RTJA 2DHSA 2R2UA 2HFSA 3BKFA 2WB4A 4IYQA 1OYDA 4LIRA 2ADBA 2FPHX 2VFVA 2IDEA 3VCDA 2L41A 1HBUA 1YGYA 3S6EA 1X0PA 2R8GA 1YBUA 2XTJP 1WD6A 2E66A 3LQVA 5B0GA 4EGLA 4DR7F 5H9FK 3PW2A 4IOAQ 4FF2A 1HWLA 5IXUA 3SV4A 3OL6A 1F3VA 2KT2A 1N0UA 2M88A 5EDWA 4DR3J 1NJZA 1UVLA 3CO9A 4DL2A 3GV7B 4F2SA 4I56A 4B9MA 3GFXA 5KG7A 4MK8A 2ZH7A 2YPYA 3PDNA 3R97A 1IWAA 3DM2B 1V3ZA 2DHGA 4OQJA 1IXKA 3ETMA 2R7WA 4IFYB 3RB3A 2RDJA 1KR4A 4ZMMA 1TFYA 2R7XA 3AH6A 3AXKA 2EBEA 1KLMB 4LFAF 3BQ2A 1G4CA 4CO4A 1KTQA 2OELA 3BV8A 4G1IA 5LOQA 3C3LA 4RW9A 1JLQA 2VC1A 2KXFA 2XMKA 2YVSA 3CJ2A 4ZVSB 3ZZ0A 1IKXA 3PRVA 2J8SA 4UY8T 1HLWA 2GAHC 2JLEA 1N6QA 3CD5A 2E29A 1XR5A 4RZRA 2VICA 3BO4A 2GA7A 2B5JB 1PYOB 3CDWA 4ED0A 2OIHA 5ETQA 3H5SA 4TQRA 4DV7F 3FCHA 3LPYA 3PFOA 3KKFA 1EKRA 2VBXA 5EWGA 2B4OA 1R8PA 5K8OA 5E0OA 3UDLA 4OHVA 4DSKA 2XGQA 3KUHA 5EGYA 1S72S 3HSDA 1K0VA 1KS2A 3MEKA 4IQMA 4NWBA 2AYMA 5AT1B 2UVUA 2APOA 2FB0A 1VQ8S 5AXKA 3JTOA 3WC2A 4IG3B 4OYZA 2KO1A 2F8EX 3MOJB 4YMEA 4IFVA 5EWEA 4YY3J 2DTJA 2P9GA 2V94A 5GAEU 3KLFB 1F2GA 2GCFA 3DRYA 3H25A 3LP2B 1PSDA 2V2ZA 4Y3CA 4X62J 4ZPVR 4DG1B 1X5PA 2G1HA 4CRJA 3VAJA 4DV7J 3EVOA 2UXCJ 2NZ4A 2CNNB 1VRUA 3EGZA 1FNOA 1UEVA 1S77D 5JMNA 2DRAA 3HVTB 4ICLB 3FKBA 4U7UK 5KFYA 3K57A 1C1CB 4CM2A 3MOZA 2ZHOA 3K7RA 3QWPA 5I42B 3PJ9A 2VG6A 3O1LA 3QLHB 2H54B 4RPFA 1XN9A 3UDEA 4OJGA 4QWEA 4TNOA 3SFUA 2UXBF 1WI6A 4MK7A 3TA2A 4G65A 1U2CA 2HRUA 1NMEB 4LF6F 4K0KJ 3H42A 2FC9A 2DGWA 2FVSA 5D0EA 5DO2A 4CO1A 2IYGA 1HNWF 1MN7A 4EFAC 3VGVA 5B09A 5LXRA 1RABB 1EP4B 2R7TA 3O6QA 3IFEA 5GAEI 2CG8A 4WIIA 3IM8A 5HMYA 4PWDB 3HHDA 5IT9Y 1YJ7A 2KDOA 5G0RB 1M5SA 4WF9Q 4Z37A 3P6YC 2HIQA 3BN4A 2QYCA 2DNQA 1Q79A 3DGVA 5AE2A 4ZJQA 4NEZA 1S1WB 4FP9A 4I2PB 2CIMA 1C4AA 5EUHA 1BQXA 2OD6A 3UCUP 2OPPB 4O4GB 1HWKA 3M6XA 4XPCA 3MPUB 5AXNA 2NQPA 1S99A 2WONA 3H20A 4B9VA 4JOUA 4LQ9A 4X65F 4DV3J 1C1BB 4U6PA 1S6UA 4KGMA 4A8MP 5L38A 2LQ5A 4LF5F 1FKPB 2XYPB 1RT1A 1S9GA 2DPIA 3BO3A 2XZWA 2YNGB 2HHUA 1PC4A 4DSJA 4QCLA 2ROGA 1QTNB 4GKKF 4DV4F 2XO7A 4DUYJ 1SB6A 4IFVB 1P6TA 1SXLA 2KHCA 4ECVA 3RJMB 3CCLS 4ZCMA 2OO4A 2EKYA 3GFYA 1YBTA 1ZBTA 2IVYA 1WUUA 2JL9A 4K7QA 4OX6A 4PG6A 4WP3A 2AX1A 2VFTA 1RAGB 2HQGA 1ZM4A 2BM0A 2G13A 3IAS9 4UOHA 4DG1A 1HBOB 4DLEA 4KGZB 4O3NA 3KYLA 2BJ1A 5A8WA 4LF8J 3I5AA 1IJEB 5ETSA 2ZM6F 1K9MT 4DX5A 4F2RA 1RT2A 2MKKA 4PXBA 4P52A 1K1SA 4O0IA 1JLQB 4R0EA 2UUBJ 1KP6A 1X5TA 2QC3A 1IKVB 1LWFB 3JSYA 5KFAA 3PYFA 4DX7A 2X3DA 1PYSB 1R6VA 4YB7A 2Z2LA 1TL7B 1GMVA 2B51A 2YX4A 4KIAA 1TK5A 2UUAJ 3T6BA 3OL9A 1RBAA 2BBEA 1N5QA 2G2ZA 3CJ0A 3G71S 4DS4A 1N33F 1W25A 1S1WA 3I6PA 5FLXU 4DV5J 2XY6A 2D1CA 1U1OA 3D3CJ 3CJ3A 2XI3A 1RLCL 3FVYA 4JV1A 2RT3A 1S79A 4IDKA 3MMAB 1WACA 5CA5A 1WC0A 1YIJS 1RAOA 1W26A 2DNYA 1KD1T 3IO1A 1Q95G 5CZVA 3W9HA 1P9QC 4H4KA 1H74A 3FJ2A 3IBWA 1S1UA 4NASA 4P74A 4R25A 5KFVA 3QSYB 2Y1IA 5E3PA 1XMQJ 2XLKA 3NMAA 3X1LB 1FO1A 5F8IA 3PKYA 3G6YA 2DO0A 4USUA 4OYOA 2A0FB 3AODA 2B9WA 2BUNA 3CCTA 3W8GA 5D3GA 1Y5NB 3HULA 3KJVA 3NS6A 3THTA 2WW4A 1TL3A 3FNNA 4DR1J 1KSPA 2VKRA 3GJSB 2ZUGA 4WCEQ 2BKOA 4WXOA 2XCAA 4JI8F 3ONQA 2ASYA 2FZCB 3C15A 3KUGA 4LSLA 2CWKA 4QIWD 4USTA 3QRRA 1T7PA 3OJUA 2MQQA 4USVA 3M8QB 3VAHA 1SL0A 2V9KA 4NLDA 3IWNC 4LFBF 2WB1D 4M95A 2OGUA 5K5MA 4C0OC 5MLCV 1PCAA 4M5JA 1TELA 3OHBA 2XZDB 2FTRA 3GJRB 2I5JB 4QIEA 4DV0J 3MECA 3UCZP 3M8ZA 3MM6A 3Q2SC 3Q8SB 1AROP 2HAIA 5BR8J 2HW3A 2YKMA 1RAAB 1HWJA 4ILRA 1XNQF 2QE5A 1FJEB 4L74A 1X4FA 3KWMA 3M8WA 3OL8A 1L3SA 4DV1J 1RZMA 1HQUA 2JZ5A 2LXIA 3CJSA 2BOPA 1JLEB 2GQ2A 1SIZA 3QQCD 3ISND 5ETNA 4PCQA 4ZCKA 2AKWB 1U1QA 1Q81T 4DSLA 3VAMA 2GFFA 4OZ2A 5LT5A 2ZH1A 2NUUG 4WE1A 5K8PA 2OH2A 2BVZA 2QSWA 3BSAA 1V6HA 2AV5A 3MM9B 4DV1F 2HSEB 3HVAA 3OBIA 2VFSA 1J5EF 3TWZA 3MPVA 1N32J 2F8MA 2PI5A 3HHLB 2IAJA 4FZVA 4DBQA 2D3UA 3KMQA 3T41A 5BJRA 4A8FA 2NXJA 1N5TA 2CPJA 2FZGB 2OHDA 3K0JA 2OP5A 2FZKB 1FJGF 5HAOA 3GJTB 2RRBA 1U0HB 3ZNJ1 3CXCR 4L3NA 4NLOA 4ZLJA 3KLVA 3ZFVA 2ZE2B 3UPFA 4Y2IA 3SYZA 3AA8A 4KHPJ 1SC3B 1X4AA 3ZNUA 1K47A 4HI2A 4Y34A 3GG1A 4JI5J 4ED2A 2MKIA 2YQ0A 3KJQB 3MFHA 2ZHBA 1FX4A 1Y0HA 4CLWA 1QAIA 2HQCA 5HVHA 2YKNA 3Q8VA 1XMOF 5A8RB 3RR7A 2YWWA 2DIVA 5HATA 1IBMJ 4BDPA 3ISNC 1REVB 3PCOB 3PFEA 2E9TA 1TL7A 3KLIA 5E3AA 1QUVA 5A2QY 2VA2A 5LM7E 4DMZA 3AD8C 4KHRA 4U67Q 3TUZC 3BBFA 2MGZA 2B43A 5KFBA 3OL7A 2HG4A 3HK2A 2J9DE 4P72A 4RO0A 4FVMA 1NU4A 4R5PA 1BD6A 4LR7A 4X2BA 3R5GA 1P8GA 1FJ7A 1FXLA 3ICLA 3NEKA 2C3YA 3GZ7A 1QY7A 1V3RA 3THPA 1S0MA 4WFAQ 2MLZA 2GIFA 1NRKA 1X5OA 4W90B 4HACA 1RU1A 3AD7C 3R3TA 1HMVB 4LJMA 5B0BA 5C7PA 1WF2A 1SKRA 1OQ3A 4X66F 3Q8UA 4A8WA 2GZOA 5LSOA 1RT3A 1RTDA 1KFSA
chains in the Genus database with same CATH topology
4DSIA 1WNEA 4GC6A 1TL3B 1SV5B 1TAQA 2XS5A 3NNCA 4FF4A 1GX6A 2GC8A 2ZJPQ 2F8HA 3RAMA 2IRYA 3T1YF 3IRXA 2IVFB 2FJEB 1XR6A 3NMRA 4FNIA 2E5LF 1F60B 4BS2A 1FTCA 1WHVA 1D9AA 3QJPA 4NMLA 2Z8QA 4Q7AA 3EYZA 3CDAA 2P9CA 3R5BA 4HEA9 2XWXA 4CTAA 4TY8A 2VBZA 5U47A 2RRNA 2GHWA 3PX6A 4NLVA 3PM9A 1NAQA 3T1AA 2JWNA 3N5BA 3TAQA 3THVA 2EFGA 4ITSA 1X9MA 2MKCA 4URQU 4FS2A 1R89A 4WKRA 2JEJA 5DQHA 1LV5A 3SDEB 2YQ3A 3QZ7A 3FQKA 3D54A 1ROFA 3MHYA 4OI2A 3EX7B 2E7XA 5H1SV 3I5CA 4XK8C 2N7YA 3UI3A 2FJVA 4BHQA 1DTQB 2DNNA 2VL1A 4AE5A 1B0VA 3QO9B 2XSFA 2XY7A 1BQNA 1T02A 2JFKA 2RH3A 2DHXA 2VONA 1F5CA 1OPZA 1FF2A 3KG0A 1DQ8A 2HWHA 5DQIA 3OW2R 2V4JB 3QJJA 5HBMB 2Q43A 5CYMA 3D28A 3MEEB 3POTB 4OI6A 3HHLD 1UVIA 3LH2S 3T5JA 3TAMA 3MR2A 2FJWA 2KTQA 2WAQD 2B9YA 2O01C 4M1KA 2DNHA 4RW4A 5D78A 4DLGA 2LDIA 2MQOA 1DHMA 3CIMA 1GTEA 2GIRA 1JMTA 3SQGB 2CPDA 5KFNA 4X4SA 1HI8A 4B3MF 4RU9A 3TANA 5L1IA 1RP5A 4ED7A 1SV5A 1VBYA 1FVQA 5FDLA 1H7WA 3DYAA 2AYGA 3BO2A 2VOPA 4I69A 5KOXA 5KFOA 4OFZA 2CYYA 2VC0A 1FCAA 2HFOA 1X4BA 2CRLA 1NEEA 2VV5A 4WU2A 2W7PA 3C6UB 3NG8A 4RKUC 1TV6A 3MM7A 2AJ0A 2L48A 4WU3A 1OO0B 1MSWD 1I1GA 3S1TA 3FFIB 2FVCA 3QO9A 3SEOA 3OFGA 4MIAA 1U4BA 4YR0A 2ZH3A 5G4DA 1FRHA 1O5JA 1Q7YT 1Z2LA 3IR7B 2AF6A 2R4FA 2B5JA 4QZVB 4MFBB 3CWJA 4Q8FA 4FN5A 3OUYB 2GNKA 1XMQF 1LW0B 3DOLA 2M70A 3KNGA 5KFZA 3W2VB 2HHQA 1TAUA 2YNHB 3BZQA 1VQMS 5KT6A 1U6FA 4NLWA 2GO9A 1C1BA 3J7YU 4NCBA 2W9BA 4NLXA 2IM1A 4CO0A 1T05A 2EK6A 2XGPA 4NRTA 4ZOSA 2W25A 1UMJA 4AUKA 2G1DA 1DTTA 3JSMA 2YWHA 2J7KA 2P5VA 1H2VZ 1T3NA 3E2EA 1JLAA 2E1AA 2W7AA 5DRKA 1Q86T 2WSEC 2VBYA 1RKJA 2UZAA 3BJYA 5IZHA 4ES1A 3IS9A 2PI4A 3M2VA 2BACA 3N79A 3PZPA 4RX6A 2DNPA 4WXWA 1Y9OA 1VK3A 3MURP 5DM7Q 3SCJE 5JVHQ 1RISA 2EW9A 1KN6A 5HO4A 2B7CB 3IGVA 4A48A 2F9JA 3RRGA 5A6PA 3M6WA 3NLCA 4X4NA 1YWXA 2IJNA 2O66A 2LEBA 3MEDB 5C42B 3BM7A 3I0SA 4TLRA