5C42B

Crystal structure of hiv-1 reverse transcriptase (k101p) variant in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
424
structure length
424
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent Inhibitors Active against HIV Reverse Transcriptase with K101P, a Mutation Conferring Rilpivirine Resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 100
structure length 424
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c42B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B03
3NAHA 3G6YA 4GC7A 4IH5A 4EYIB 2C28A 1IKWA 2OPQA 2YNFB 5CYQA 1N5YA 4TY8A 4ECQA 5HLFA 3DLKA 1T3NA 3MTKA 3H5XA 5I42B 1TL3A 1BQNA 5J2QA 3ICLA 1RT3B 2V0NA 3KK1B 3KK2A 2VG6B 4NLYA 3H2LA 3UPFA 1R0AA 1QE1A 4ZMMA 1XR7A 3PVXA 2R8HA 1MMLA 4WFZA 3MFHA 5KFJA 4KV8A 4ED7A 1RTJB 3DDKA 1VRUB 3TQ1A 3IG1A 3KLFA 5KG4A 3FSIA 4RNFA 5F9LA 3CJ3A 2IMWP 5T14A 3DM2B 4Q45A 5F8LA 4H54A 1RT3A 3V6JA 5K14A 5J2MA 4IKAA 4ZVHA 3H5UA 5KFKA 3HKWA 4M95A 3NL0A 2I5JA 3CWJA 3G6VA 4WE1A 3CIZA 3DRRA 3QZ7A 1EP4B 3TAMA 4ZP7A 3IG1B 1JLFA 5EWEA 2WB4A 1S9GB 4O3NA 1RAJA 1C2PA 1RT5B 1JIHA 3GV7B 4ED2A 2OPRB 3DI6A 4U6PA 4K4VA 1WNEA 1TP7A 3DOLA 2WCXA 2FVQA 2BRKA 4O4RA 3MR2A 3V6HA 4IG0A 3N6LA 4YMEA 4J9OA 4URQU 3DOKB 2AX1A 4XO0A 5EWFA 3H4DA 3KK2B 3QGGA 1RT7A 5HBMA 3MR6A 4Y34A 3DRSB 4RW6B 4QPXA 3H4BA 2UUTA 2C2RA 1RT2A 4ICLB 1ZETA 2YNIB 2AQ4A 5EUHA 1JLBB 4MK9A 3MR5A 4YR2A 1RT5A 2WTFA 2JC0A 1BQMB 4MIBA 2OPSA 3HHKA 3FDSA 5KT4A 3GIMA 3RBDA 3KMSA 5KG1A 2IBKA 3KLHB 5F8JA 3DLGA 5C25B 2HAIA 1LWEA 2JEGA 4TY9A 3DYAA 5J2MB 1S1UA 3D5MA 4ED8A 3JSMA 3CJ4A 4ZPDA 1RT7B 5HBMB 1KLMA 1RT6A 1HNIB 3QLHB 5C24B 1T94A 2IM2A 4MIAA 4R8UA 3V4IB 1EETB 3NAIA 4DG1B 3QIPA 2HMIB 3M9MB 2AGPA 3T5HA 3OLAA 4Q8EA 4KKOB 4KV8B 2WONB 4NLSA 5KT7A 4NLDA 5KFQA 5C42A 4PQUB 4RU9A 4YR3A 1S9EA 3GIIA 3I0RA 4R5PA 3BSAA 1FK9A 3LP2B 1T03B 3GIKA 4F50A 4O3QA 1RTHA 2WK4A 4EEYA 1TL3B 3T19A 4DL7A 5DGAA 4Q44A 4ED1A 5DLGA 5KFTA 3CDWA 3GILA 2HNYB 4LSNA 5EDWA 4IFYB 4I2PA 2XCPA 4Y3CA 1S1WA 3BGRA 1JLCB 3QO9B 3RBEA 5KFAA 1CSJA 2FJVA 5KFFA 4JUZA 2O5DA 4IDKB 1SH0A 2ILZA 2WRMA 1DLOA 2B5JB 2IC3B 1N6QB 1S9FA 4TQRA 3M8PA 3MEGB 4O4GA 2AWZA 2IJFA 4IH7A 4RNMA 4NLGA 4PWDB 2VG6A 2HWHA 1JLEB 4QWDA 4WZQA 3NBPB 4RZRA 1C1CA 4Y2AA 4XPEA 3QGHA 4YQWA 1IKXB 4IG3A 4FBTA 2XCAA 4NYZA 3RB4A 2BR0A 4IH6A 5DG9A 1S0MA 3OSNA 4ZVEA 4J9PA 3I5CA 4ZPBA 4KBIA 4TYBA 5D3GA 4EO8A 1S6PB 3EZUA 4ECWA 4O44B 2UVRA 4IRDA 5HROB 3SFUA 3MEDA 3DRPA 1HMVB 2RDIA 5DLFA 3KLIA 1T03A 3HVAA 1HQUB 4G1QA 1UWBA 3H5YA 3Q8PB 3BQ2A 4ECTA 1U09A 2GC8A 4Q43A 1RT6B 4R8UB 5FDLA 5F8NA 3CJ0A 1S0NA 4XPCA 5J2QB 5DG8A 1EETA 3QIPB 2HMIA 2AGOA 2UVVA 4NRTA 5K14B 1S6QA 2ZD1B 3PW5A 4IRKA 4ZHRB 2XC9A 4MFBA 3Q8SB 2D41A 4URSA 5C25A 1LW2A 1ZTTA 3H59A 4O44A 3LP1A 4ZP9A 5F8IA 3DM2A 2R8GA 3E01A 5J2PB 4TLRA 1LWFB 4KO0A 1RT2B 1HQUA 2IAJA 4G1QB 4ICLA 1IM4A 5KT5A 3QZ8A 4J9QA 2JEIA 2OPPB 1RTDA 2BANB 3NKYA 4H4OB 1QE1B 2QE5A 1FKPB 1S1WB 4WYLA 5KFPA 4U7CA 2R8IA 4G3IA 1YVFA 3ISND 3MF5A 3FRZA 4KE5A 3PR4A 2R8JA 1NNDA 2FJXA 4WFYA 1ZTWA 4ECRA 2C22A 1LWEB 2UVWA 4KFBB 3V81B 3VQSA 2BRLA 3HVTB 3N6MA 4NLRA 1IKWB 2C2EA 4IG0B 3MEGA 4ECZA 2BQ3A 1S1TB 2OPPA 1RTDB 3FFIA 3DOLB 1IKYB 1S1VA 2F8EX 1IKVB 1C0TB 2IAJB 4ZPAA 4Q0BB 1S1XB 2QV6A 2FLLA 3LANA 3BGRB 3DMJB 4H4MB 1HQEA 2R2SA 1MU2B 4RNHA 2C2DA 4FS1A 4MFBB 1S4FA 1JLQA 1TQLA 5KG0A 3KK3A 1S6QB 3UQSA 4ECYA 5HP1B 3JSMB 3KLEA 1LW0B 1S10A 2CKWA 4B3OB 2YNHB 3OL9A 3T1AA 1RTIB 4NLOA 3CDEA 2R2UA 1XR5A 3RB0A 4I7FA 1R0AB 1UWBB 1IKVA 3PHEA 2W9BA 3OL8A 4QWEA 4NCGA 3OL6A 3BJYA 3H5SA 4DG1A 4MKBA 3LALA 3I0RB 5DG7A 1S97A 5HP1A 3KLEB 2ZKUA 2ASDA 3PW7A 1RTIA 2UUWA 5I42A 1BQNB 2JLEA 4QWBA 1D0EA 5L9XA 1LW0A 4RNNA 4IFVA 2IA6A 4LSLA 5KFMA 4IR9A 4J9LA 2B43A 1C0TA 2J6TA 2ASLA 2XGPA 4NLQA 4KHMA 1IKYA 1S1VB 4H4MA 3DMJA 3M9OB 4DL2A 1N56A 2WOMB 1LWCA 4NLXA 1S1XA 1JLCA 1N6QA 4URGA 4DEZA 3KHGA 3GV8B 3PW2A 4ZPCA 5KFEA 3GIJA 3KOAA 3RAXA 4F4YA 5L1IA 3QO9A 3BSOA 2EC0A 4ECVA 4F4ZA 3OL7A 3IS9B 3DLEB 2W8KA 1C0UB 4DL4A 1HYSA 1XR6A 5JXSA 4GC6A 4ID5A 2ATLA 1DTQA 3D28A 4K4TA 4K4ZA 3M8QB 4NLWA 4TYAA 2XGQA 4IOBA 2W9BB 2BQUA 4QW9A 5J2NB 3BSCA 4JV0A 1JX4A 4JV2A 3LP1B 2FVCA 5DQIA 5L1KA 4IFVB 5KFIA 5KT2A 5KG5A 1DTTB 1TKXA 2YKMB 4RW4B 1T05A 3CJ2A 4DL3A 2JEJA 2ALZA 1K1SA 4NLUA 5CYQB 1N5YB 5C5JA 5F8GA 3NGDA 1HNIA 3G6XA 1KLMB 3QLHA 2W7PA 5C24A 4Q0BA 1RT4B 3LP0A 4NRUA 4Q8FA 2VG7B 3RB3A 4IQXA 3KLIB 1NHUA 3IN5A 1DTQB 4K50A 1RA6A 2OPSB 5C42B 4PQUA 2IM1A 2W7OA 4PUOA 3JYTA 4NZ0A 2BQRA 1VRUA 1JLGA 5KG6A 2J6SA 2W9CA 3GYNA 2FLNA 4I2QA 4O3RA 1S1TA 4LQ9A 3KHRA 2RKIB 1REVA 2YNFA 5HLFB 4R0EA 4TY8B 5KT6A 3KHLA 3KMQA 2YNIA 1HNVA 2BANA 3IGNA 3T5KA 2XI2A 4NLPA 2VA2A 3V6DA 4O3SA 3GV5B 3ITHA 1Z4UA 4IG3B 4NLTA 4O3PA 2E9RX 2WOMA 2W9CB 3EPGA 2ASJA 4I2QB 2IJNA 2DPIA 3HVWA 1FK9B 3MECA 1S49A 4PUOB 4QWAA 3MFIA 2OPRA 1FKOA 4K4YA 3DI6B 4ED0A 3M8PB 1TKTA 4O4GB 5CYMB 5KFDA 4HYKA 1JLAB 2IM3A 1SUQB 3C6TB 4MKAA 3PJXA 2J6UA 3MR3A 4Y2CA 2HNDA 5KFRA 3Q8RB 2HNZA 4EBEA 3KNAA 1HPZA 4RUAA 4M94A 3OLBA 1SV5B 3UR0A 1RTJA 2RDJA 3LP2A 1TKTB 5CYMA 3JYTB 3V6KA 3OHAA 5J2NA 3MECB 2GIRA 4KKOA 3KLGB 4ZP8A 5KFLA 3MEDB 1I6JA 5HROA 1HMVA 4KHRA 4WXWA 4B3OA 3IS9A 5KFVA 2YNHA 3BR9A 2BE2B 3UDLA 4EYHB 1HPZB 1S0OA 1S9EB 4WFXA 4WZMA 3HVTA 3KK3B 4WE1B 1D1UA 2W8LA 1C0UA 1RA7A 2HNDB 3BSNA 3DYAB 3DRSA 5KFCA 2RF2A 4F4XA 3Q8QB 1SV5A 2YNGB 1TVRB 4RW9A 2FVSA 2XWYA 3MEEB 1J5OA 4TN2A 4QWCA 2OPQB 2R2RA 5I3UA 2FVRA 4FBUA 4EO6A 5L1LA 1N4LA 2D3UA 5KG7A 1BQMA 1JLEA 2FJWA 2HWIA 3DRPB 3PW4A 3IRXA 1C1BB 5KFGA 1TV6B 4ECUA 3RAQA 2W9AA 3OHBA 4LSLB 4FS2A 2UVUA 4DL5A 1N48A 4F4WA 3KK1A 1JLFB 3ISNC 4J9KA 3LP0B 1KHVA 5I3UB 1TKZB 3BREA 1RT1A 4H4OA 2ZD1A 4J9MA 2ILYA 5F8HA 4IFYA 1RYRA 3G86A 3C6UA 2IM0A 4WXOA 2RKIA 3KLFB 5J1EB 2BE2A 1C1BA 4ZP6A 3T5JA 5KT3A 3RB6A 1DLOB 1RTHB 2B5JA 2IC3A 2AX0A 3QYYA 3KLGA 4ID5B 1RT4A 5KFBA 4NLVA 3SI8A 1EP4A 4K4SA 4MH8A 4J9NA 5KFZA 1JKHA 1QUVA 3C6UB 2YNGA 2I5JB 3DLEA 4I2PB 1HQEB 1NHVA 3LAMA 3BQ1A 3KLVA 3TAMB 4K4WA 1QAIA 2YKNA 4KSEB 5FDLB 3I5BA 3NMAA 1JLQB 4HKQA 1FKOB 3LAKA 4ZVGA 5F8MA 3PW0A 5DGBA 5KFYA 1GX5A 4RNOA 1JLAA 3FFIB 3M9NB 1S48A 3KHHA 5J1EA 1JKHB 4YP3A 2R2TA 4RW8B 1SH2A 4I7FB 3BQ0A 5F9NA 2AU0A 3V6DB 4TXSA 4KAIA 4QW8A 3I5AA 1QAJA 2D3ZA 5KFXA 4RW7A 4OL8A 5KFSA 3T5LA 2VA3A 1RDRA 4KFBA 1TVRA 3V81A 1RT1B 4RW6A 1RYSA 2B6AB 3I0SA 5KFWA 2CJQA 3QGIA 1HNVB 1VRTA 1SUQA 3C6TA 1FKPA 4KB7A 3DLGB 4J9RA 2GIQA 3CJ5A 1TV6A 1REVB 4WYWA 4X2BA 4K4UA 1GX6A 4RW7B 1LW2B 1JLGB 3NBPA 4ZVFA 2DPJA 3TVKA 3KJVB 2XI3A 1K1QA 3E01B 3DRRB 5J2PA 4KO0B 1LWFA 1LWCB 2FVPA 4RW9B 3FQLA 3MEEA 1J5OB 3CDUA 1S9GA 2VG7A 4IDKA 4RUCA 3H98A 2B6AA 3IGVA 4EBCA 3E51A 4ZHRA 5L1JA 2AGQA 2I1RA 4MK8A 2YKNB 5DQGA 3GQCA 3CO9A 2ZE2B 3SFGA 1MU2A 2HNYA 1DTTA 4LSNB 1T05B 2V4QA 4J9SA 1TL1A 4NCGB 4ED6A 3H40A 2V4RA 4ECSA 3OSPA 4R5PB 3EPIA 4ED3A 2OH2A 2E9ZA 1HYSB 4ECXA 4RW8A 5KFHA 1HARA 4YR0A 3M8QA 1SH3A 1JXLA 3V4IA 5D3GB 2HNZB 1W25A 4O3OA 2JEFA 1VRTB 2WONA 3PZPA 1TL1B 4JV1A 1KHWA 5KG2A 3I0SB 1TKXB 2YKMA 4RW4A 2VG5B 3DLKB 4TQSA 2ZE2A 4K4XA 3DOKA 3KLHA 5KFUA 2FLPA 1IKXA 2R8KA 5EWGA 3PJWA 4EBDA 4LQ3A 1TKZA 3KJVA 4IRCA 1C1CB 1S1UB 4DL6A 4IR1A 5KFNA 4MK7A 2D7SA 4PWDA 3PR5B 1JLBA 2JC1A 3N6NA 5DQHA 5JUMA 3ITHB 1S6PA 2WHOA 2V9WA 3IRXB 5KFOA 3FQKA 1OS5A 2VG5A 3QIDA 5KG3A 2E9TA 2RF2B 3CVKA
chains in the Genus database with same CATH superfamily
3CCSS 1N54B 2B4VA 4NWBA 4USWA 1IKWA 2YTCA 2YNFB 5CYQA 1O6XA 4J90A 4LREA 4NZ7A 3DLKA 4CLUA 1T3NA 1PBUA 1X4FA 1TL3A 3BO2A 3H5XA 1F3FA 5J2QA 1Z1ZA 2MZTA 1WDTA 3IP0A 4UZBA 1UFWA 2K3IA 2Z2LA 2YWFA 4OX9F 2DBBA 1HI0P 3VAMA 3UPFA 4L75A 4ZMMA 3MM6B 2PD1A 4MYTA 5IM0B 1GTEA 2C42A 4I6WA 4DV0J 5E0OA 5LXYA 4NA1A 2EW9A 4XIUA 2HQFA 3ENVA 2IMWP 5T14A 5B7WA 4DQSA 2A1BA 2FY1A 1RT3A 3D0GE 3DFEA 1WG5A 3H5UA 4LR8A 5KOXA 5CH7B 3BV8A 4OJ1A 1XEZA 3G6VA 2W2PP 1RHUB 3AJ1A 5IC6B 1Z2ZA 3CIZA 3DRRA 5GMDA 1EP4B 3TAMA 1OYEA 4ZP7A 3J7YU 3QZ7A 2VOOA 1VQ9S 3L7UA 4LF4F 1S9GB 4O3NA 1S6UA 1C2PA 1HLWA 4CLWA 1RT5B 1HFEL 2HVZA 3TZXA 3D9BA 2B4UA 2V68A 3HD1A 4EZ9A 4ZKAA 3DKDA 2QLFB 1FE0A 2VB6A 3DOMA 4DWIA 1TP7A 2HIYA 4CH7A 1GT8A 4RWWA 2CPXA 3LGMA 1U2CA 2KL8A 2B9YA 1FRIA 1HKAA 2LLZA 2QLWA 2MKSA 5BR8J 2BA9A 4URQU 3TA2A 1EIYB 2YWWA 3QGGA 3DN9A 3W2WB 4PABA 1WEZA 3DRSB 3R1LA 3K8VA 4X4TA 3W8PA 3D6FB 1WC4A 4ZK7M 1VQ4S 2LA4A 1U6FA 1ZETA 4RUHA 4Q2MA 2AQ4A 2JSXA 4M5LA 5EUHA 2HHQA 3MR5A 1LK5A 1MWYA 3CJKA 3AA9A 3MM7A 4I69A 3GJSB 1D9DA 3M32B 2LYVA 1FJ7A 2OPSA 1BHNA 1H7WA 2ZBPA 3FDSA 2HWTA 2I38A 4J91A 4LF2A 4AQYF 2HW3A 1F9HA 2YX4A 2HKEA 2JRSA 2XYPB 1A0OB 2U1AA 2Y1IA 4ZITA 1WTBA 4ED8A 1S1UA 2LP4A 4OX9J 1KLMA 4XAKA 1HNIB 3D67A 3EVMA 5IQQA 4MMOA 4R8UA 3WZ0A 2CQ4A 2RDDA 4B02A 2MKCA 1EETB 3M9MB 1OO0B 3IR6B 2MKIA 3T5HA 4ZPWR 1WC1A 1TL5A 2WONB 1X0PA 5KT7A 2CVIA 3GFXA 5B0AA 5LMUF 2OEJA 4WFAQ 4RU9A 3BGUA 2RQKA 3MPWA 1RBAA 5A0YB 2HS4A 4F50A 3OBIA 1VQYA 3PRVA 4OV1A 3G82A 1UJ4A 5LM7E 4C8ZA 3LH2S 4K2JA 3K5LA 3BPSP 2J76E 4KH1B 4ED1A 3NXZA 2HGLA 3QT6A 4P2XA 3OTDA 4CI0B 5BYSA 4LSNA 1TK0A 1W26A 4NXNF 4IFYB 1Y3KA 2XCPA 3CJ8A 4ZPVR 3K17A 2KM8B 3POTA 4U8VA 5IT9U 2HHTA 2YXLA 5D4NA 3CMAS 2YKOA 5KFFA 2MDAA 2JZ5A 4FXDA 1S7IA 3DLBA 5GAEI 2ILZA 3SZ2A 1U7LA 1DLOA 2IC3B 3PCOB 3EGZA 1S9FA 2MXYA 5CHCB 3A8IA 4RNMA 1RSCA 4K0KF 2RH3A 4NLGA 2HWHA 4TNOA 4DFMA 4LIWA 4QWDA 4JP8A 4RZRA 2XWXA 2LMIA 3LUYA 4XPEA 4U67Q 4YQWA 2J5AA 2YQ1A 3TYTA 4DR3F 3RB4A 4IH6A 4LIRA 5AXLA 1SKWA 1S0MA 3R8YA 1IN0A 3A12A 4J9PA 3J81Y 3KUEA 2CPZA 2IMOA 3HDSA 2MZJA 4P7TA 1VIOA 2WSFC 2XZWA 3GFZA 5JMNA 5D3GA 2BOAA 1RHRB 2IHR1 2JL9A 3W9HA 5GADI 4N56A 3PX4A 4HDHA 4O44B 3M05A 3SFUA 1YJ7A 2X3GA 3RJMB 1SL1A 1HMVB 1YX2A 3T6JA 2C3YA 5DLFA 1FDNA 1V5IB 1DARA 5ETRA 1U49A 1HBUB 3H5YA 4AL5A 1UWBA 3DGVA 4ILMA 4ECTA 4WK3A 2ATCB 2GVZB 5FDLA 1JJ2R 4KIAA 4ZLJA 2BDPA 4NCBA 1I3OB 1SBRA 2AGOA 1IJFB 1D09B 2ZZTA 4OHYA 1S6QA 2ZD1B 3TX8A 3P8BB 3VVUA 5B0CA 2X1BA 4DQPA 2LU1A 1LEOA 2XC9A 1ZOTA 2OIHA 2V94A 4RBUA 2CNKB 5C25A 1XNQJ 4P72A 1ZYQA 1VISA 3DM2A 3CNQP 5J2PB 2E44A 4KO0A 3G8TA 1IM4A 4C8NA 4DV7J 2QTWA 1VLYA 2VASA 2EKNA 2X1GA 3OFHA 1ZM9A 2BANB 4PAAA 5HI7A 3SBMA 3K59A 3B54A 2W01A 4H4OB 1FKPB 3M6WA 1G6BA 4DR5J 1CJVA 1NNDA 3HULA 3PIPQ 1I1GA 4KC5A 1ZTWA 3LGHA 4FVMA 3JSRA 2UVWA 3VQSA 1JJ4A 2BRLA 4B3MJ 4NA3A 1IKWB 1HHQA 3NLCA 4LRDA 4KPYA 1O5JA 2BQ3A 1S1TB 3A4TA 1FXRA 2FY8A 1RAFB 3DOLB 1IKYB 4HVZA 3OQ2A 2F8EX 1VC6A 1FJGJ 4ZPAA 2OTJS 3GJRB 1XMQJ 5E5NA 2AV5A 4CRJA 3LANA 4N47A 3N01A 1ZZFA 1EB0A 1HIYA 1YI2S 3DMJB 3L7OA 5E7OB 4DFJA 1KVJA 2ZWOA 2R2SA 4DPTA 2RS2A 2C2DA 5E41A 1WELA 4MFBB 3MPUB 1HR0J 2B7BB 3CJQA 1TQLA 3ILJA 1S6QB 1QTNB 3PIOQ 4ECYA 4JI8J 1AW0A 2MZ1A 1RAAB 2YX7A 3QSYB 1M90T 1FDDA 2KT3A 2BE9B 4X66J 5BXIA 4P2SA 1NDLA 2KT2A 1OMSA 3X1LB 4G1IA 4CIOA 1PCAA 2UU9J 1EZZB 3D1HA 4HHHA 2LDYA 3QNWB 3RB0A 1RHKB 1R0AB 2FC8A 2JDJA 2KXFA 3CTRA 1IKVA 1NDKA 2J9DA 1NK8A 3F44A 3SDEB 4QYRA 3SSSA 3JAMU 3BJYA 3H5SA 1WKLA 1F2HA 5IS2A 4JOUA 3CCRS 5DG7A 1IWGA 2DGUA 3KLEB 5E3AA 3RRHA 2FPHX 1QD1A 2ZKUA 2GVDA 2CQ2A 4PQAA 2UUWA 2GW8A 5LL6d 2CZ9A 5HMZA 1FRJA 2JLEA 3PRBA 5L9XA 4RNNA 1FJGF 2YH0A 2A2CA 3GSIA 2WVDA 4I68A 3DGPB 4DPYA 1HW9A 4IR9A 1LWXA 1X8DA 1KS2A 1FVQA 2BW2A 2EG1A 2KKHA 2EKYA 2VPYB 3OTBA 1PC5A 4O0NA 4NLQA 3OJSA 1IKYA 1KVKA 1VQNS 3M9OB 3C16B 2MY8A 2EFQA 2GHWA 3ZZRA 4NLXA 1TAUA 2Y0SD 1N6QA 2VQFF 1XBWA 2LEPA 2D1CA 1F9EB 1WJ9A 1SB6A 2F9JA 4QJVA 1VS3A 2DNRA 3C66A 2KT5A 2XSJB 5J1NA 3RAXA 1EAYC 3ZTOA 3GWCA 4UUXA 2EC0A 1AB8A 3FZBA 4CCHA 4DLGA 5L8RC 1X31C 2A3JA 2B9XA 5L38A 4JI5J 3NNHA 2CJXB 4A8QA 4B9VA 1WDDA 1XR6A 5JXSA 5FLXU 4GC6A 4A46A 4PYAA 3QT8A 3WIVA 3D28A 1GFWB 1ZM2A 3M8QB 2DR6A 2RNEA 3ENWA 4HR2A 5HJXA 3UR3C 2XGQA 3SDEA 1N32J 4QIEA 4F4KA 4P75A 5K8OA 1LFWA 1A6LA 1NUEA 5J2NB 2M9KA 4QIFA 4QW9A 2X1AA 3Q0AA 2MJNA 4JV0A 4KYZA 1NU4A 1RAEB 2VHGA 5B0FA 3CJ2A 5A8WB 3A13A 4JI0F 2MGZA 3E8OA 1BQXA 1N5YB 1LXJA 1RP5A 4FVCA 4BWMA 4AT1B 5LOQA 3PDNA 4CM2A 2W7PA 5C24A 4WIIA 1UEVA 4JI5F 3HSGA 1C4AA 1PYOB 4NRUA 2CQ0A 5LSLA 4FN5A 4N76A 3BKFA 5B0BA 3CJRA 1YZ6A 2CWKA 2FJEB 2N3LA 3Q83A 1QDUB 1RADB 4E8UA 4QQBA 2ZHOA 4G6VB 4E0DA 2FYXA 4K50A 2IM1A 2W7OA 4YB6A 4HI1A 4NZ0A 4PKDB 1U1OA 3RTVA 3PY8A 1JLGA 4QU6A 1E6VB 4NASA 3FSYA 1S1TA 1I94J 2RKIB 2YNFA 2MQMA 2WBMA 3PJ9A 1RWVB 3T5KA 1VQ5S 2XI2A 2QFJA 2DEJA 2DHAA 2MPUA 2CUYA 4NXMF 1P8GA 1CJTA 2N4CA 2W25A 5IT0A 2ZH3A 4DS4A 3EICA 1EX8A 2WOMA 4K8RA 2W9CB 3EPGA 1UETA 4I2QB 1CS4B 2IJNA 3TX0A 2ASJA 1HD1A 4C0BA 4DBQA 3MECA 3P5TL 3MFIA 1SJFA 1KTQA 2F4VF 3KJQB 2AJ2A 2CPYA 4RX6A 2W2OP 4O4GB 1FHTA 4PPDA 3M30A 2IM3A 2MHEA 1TAQA 3GONA 2MQOA 3K5PA 3PJXA 2DR7A 3K8WA 2YKAA 2HNZA 3AT1B 4B3RF 1D8YA 1HPZA 1GEHA 2HQIA 4RUAA 1SV5B 4DZ6A 3OLBA 3KNAA 3N79A 5C7PA 2RDJA 2CQHA 4YHHF 1R8CA 4Y2IA 1AROP 2R7RA 2R7XA 1WWHA 2LXIA 2CQPA 2Q3PA 1MROB 2GJ2A 1Q16B 2GIRA 4CTAA 2BBEA 4J5OA 5KFLA 5HVHA 1T9TA 4WXWA 5HROA 2M5YA 1RB0A 4KHRA 3UDLA 1A9NB 3BR9A 2BE2B 3VALA 1S9EB 3CCWA 3L4BC 2NPFA 3O44A 1OYDA 4E2FB 2BKNA 1D1UA 5CCMA 3PACA 1TKDA 1L3TA 4LF6J 3DRSA 3HM9A 2J0WA 4F4XA 3DNCA 3F56A 1OQ6A 2YNGB 4PG7A 4RW9A 4TN2A 1VQ6S 4ZJLA 4ITSA 2OPQB 1O8BA 4AFFA 2R2RA 2ZBIA 2XSJA 4RPFA 2C2KB 1ZA1B 4WKYA 3ZNJ1 8AT1B 5ETNA 4A4JA 4YFUA 2BZ2A 3MM7B 1AFJA 2ZHBA 2FC9A 3BYRA 1CS4A 1R8HA 1SIWB 4X62J 3K58A 5E3RA 3PW4A 5KFGA 1C1BB 1TV6B 3B8HA 3RAQA 2AJFE 2XY5A 1FWPA 3Q8VA 4FS2A 4DSLA 2KN4A 1N48A 1H0HB 3KK1A 4F4WA 3GR0A 2XO6A 4CWBA 1U24A 3DXSX 3ILOA 1R27B 4J9MA 3IO1A 2J9DE 4DZDA 3ZC4A 2VODA 1U2RA 2FHOB 4QOTA 1N5SA 2VKZG 4OYWA 4OQJA 1TK8A 1RU1A 3A8KA 2XTJP 3R97A 5GAGU 3DU6A 1HBMB 3I4HX 4WF9Q 4FYYB 3EGVA 5FJ4A 3TR5A 2PMWA 1X9MA 5J1EB 3MTJA 5IQ6A 1AYEA 4X4SA 3BH6B 2ZH7A 3E2EA 2AX0A 3G82B 3QYYA 5KFBA 1G4CA 1N32F 4JYAF 3SI8A 2MSTA 2LFVA 1FX2A 3AH6A 1QUVA 3WDOA 1CVJA 3G2XA 4Y0FA 1IBLF 2MZSA 3DLEA 1RHQB 3US5A 3LAMA 3D0IE 4K4WA 3CC7S 3TAMB 4ED4A 4NYPA 1RI7A 1FJEB 2YKNA 1WKKA 1KQFB 4F0HA 2RD5C 3VF0B 3GP9A 1SKRA 1JLQB 4Z7YA 2DT9A 3PFOA 3PW0A 2C3UA 4F2RA 3NMAA 2ZDPA 2QSWA 1JLAA 1T11A 3M9NB 4CNYA 4V19X 3D2WA 2CQ1A 2NXEA 2UUBF 4AYBD 4YP3A 1SH2A 1SC6A 3K5OA 4KGMA 3CCVS 2CJ9A 3AOAA 2AJQA 2X3DA 4P10A 4KAIA 2EFGA 3O1LA 2MY7A 4X4VA 3RYLA 4ENOA 4HTIA 4W98A 1T0TV 2M3DA 1NKEA 2RB7A 2C3MA 1NZAA 1R6VA 4K2XA 5DZ7A 4PXCA 1L5UA 5HMXA 2XQCA 4PG6A 1PJ5A 4DCPB 2F8HA 1RYSA 1RLDA 5KFWA 3CIMA 3KG0A 1QAYA 1ZBTA 2EBEA 3QGIA 1NKCA 2L9NA 1XJWB 4KB7A 3UN5A 2M7SA 3CULA 4J9RA 2ROGA 3CJ5A 2PC6A 2HBQB 4RR5A 5DDPC 3W65A 1VQPS 1OJ4A 1GX6A 4RW7B 1Q78A 2OELA 3NBPA 3BBCA 3ONQA 4ZVFA 4C48A 4ZJOA 3KJVB 3KYLA 2POKA 4JI7J 2VH7A 1LWFA 4B9LA 1LWCB 2FVPA 1RWUA 3FQLA 3TUZC 3CDUA 2XYHB 3OJUA 1IM6A 4DR3J 1MMNA 1BD6A 4LF4J 1YJTA 2KO1A 2E1MC 4NA2A 3VZIA 5H9EJ 2UU9F 2B6AA 1HBNA 1X4BA 1NJXA 5L1JA 2F7VA 3FMWA 4MK8A 2YKNB 1V3ZA 4R25A 2Z2ZA 4JI6F 2ZE2B 1S4EA 1V6HA 5K8PA 5DQGA 3GQCA 2W2NP 1NK9A 2DR5A 2BJ3A 3TEHB 4FKYA 4C11A 4EUVA 5A8WA 4M5DB 3H8YA 1WTFA 2CJYB 2MQQA 4X4OA 3ET6A 3BGLA 3MM9A 1HARA 2L9DA 3KDOA 2EFNA 3WX8A 3R5GA 2L08A 1H2UX 3LPEA 1U1MA 2EWHA 5LXRA 4DUYF 3PZPA 3HFZB 1T9VA 3DU5A 1SJQA 1X4EA 3OVSA 4OYBA 2U2FA 3DLKB 2WBRA 1R0CB 2E5LF 3BPDA 3KLHA 1RZMA 4C98A 1TUGB 4C4WA 3UVJA 4LQ3A 1QAXA 4EBDA 3A8EA 1C1CB 4CO3A 2IY5B 4DL6A 4G65A 2ZC4A 5KFNA 3IMQJ 3CW2C 1FEEA 5DS7A 3JSYA 2JC1A 5ETSA 1S6PA 3A3OB 3IRXB 4FPIA 3FQKA 1OS5A 4NE9C 2E9TA 1UPMB 3W62A 2AZ1A 2DNHA 2NUUG 2BEFA 3OTEA 3CCES 1UVIA 1OWXA 4LJMA 3H2UB 4GC7A 3VAFA 4EYIB 3IXQA 4Y6IA 2C28A 4LF7F 4TY8A 4Z7CA 5HLFA 2AZ3A 2YWKA 3MTKA 5I42B 5EX3A 3PO5A 1BQNA 2IA0A 3F73A 3SQGA 3W5YA 3KK1B 1XTZA 4JI7F 6FD1A 1GXUA 5GMEA 4WCEQ 4NLYA 4RU2A 3H2LA 1SXLA 1R0AA 4Q2LA 1XR7A 4ZN1A 3TP2A 2I8EA 1MMLA 5HSPA 4ED7A 1N8RT 1M5PC 4YOEA 2VUGA 2CZVC 4NMXA 2CZ4A 1PYTA 3J7Z5 3OPKA 1U1RA 2VC1A 2NYIA 1FFWB 4DQQA 1CG2A 1QVGR 4FF2A 1WD6A 3MMBA 2XMAA 3V6JA 1EJ7L 2E1AA 2ZWPA 3QAEA 4JB8B 1NRKA 4ZVHA 3RUBL 4KQZA 1W2BR 4ALZA 1HWKA 5KFKA 1KOHA 2AHOB 3CWJA 3UWTA 4Z37A 2LDIA 2YQ3A 5HMYA 3GG1A 3ZZZA 1QJHA 3C15A 3IG1B 2XLKA 1JLFA 3MZIA 4J37A 2GJIA 3M1VA 3CJKB 1KSPA 1T9WA 4CO5A 1VQLS 3UN3A 5E3CA 2OPRB 3VGSA 3W3SA 4CDIA 2KJWA 4X66F 5ETPA 4X65J 2HIQA 1FE4A 1Q8IA 2MSSA 2LCWA 3FUYA 2WCXA 9RUBA 3N6LA 4JI2F 2KXNB 5IOLA 1H98A 3NWRA 7FDRA 3M6VA 2LA6A 4GMKA 3KK2B 4JI4F 4L76A 1NLKL 4N8NA 4RUBA 2BJ1A 4HACA 4Y34A 1RAIB 4RW6B 1U25A 2NPIA 4RO0A 2XZDB 2C2RA 2CG4A 5ETQA 3CC4S 4ZLPA 1JLBB 4MK9A 2WTFA 3N0VA 2IJRA 4A8FA 2JC0A 4G1PA 1FO1A 1BQMB 1PG5B 3FBBA 1FNOA 2DTJA 3GIMA 2PA8D 1SC4B 3RBDA 4V1Ak 4KPCA 1NMEB 2IBKA 3HZGA 3HHNB 4FXWA 2HRUA 3BGOP 4M5JA 2MKYA 3M8ZA 2ERRA 2GO8A 3J81j 2JEGA 1HBOB 4TY9A 3D5MA 3UDVA 5KFVA 2AJ0A 5HBMB 1T94A 3QLHB 2CIMA 2HFSA 5DGBA 3AAWB 2NREA 4KT0C 3H90A 2UXCJ 4DG1B 3WIUA 3M6UA 2AGPA 3PKMA 4FF3A 4A8SA 3OR2B 2E7VA 2F63A 3R7BB 1YBUA 2HURA 5KFQA 4PQUB 4F26A 4X4UA 1S9EA 2GQQA 5U47A 3BSAA 2CVEA 1FK9A 3QGPA 2P5VA 4OMFG 4AQYJ 1NJZA 4PEOA 4Q44A 1D9FA 2KH9A 3HFKA 3UCUP 2D9OA 3I6PA 2PFFB 4Y65A 3ULHA 5K8MA 1W2IA 1YGYA 1PIEA 3CDWA 1QSYA 1GMWA 3F41A 3GILA 2HHVA 3R7SB 5HO4A 2CYYA 3OTCA 3BGRA 1T8EA 1U45A 3RBEA 2G2YA 2V8VA 3G71S 2FJVA 1H73A 2GZOA 4USTA 2O5DA 5CAAA 1YBTA 3FVYA 4IDKB 5F41A 2Z58B 1N6QB 4YB1P 3ADAC 2XNQA 1TL7A 3M8PA 4IH7A 1PKUA 4DCJB 2ZUAA 4TQRA 1DZ5A 3CD5A 4PWDB 3DCAA 2UV8G 3Q2TC 3NBPB 2HRTA 1C1CA 2OJ3A 4IUFA 4Y2AA 1XMBA 3QGHA 2C2OB 1IKXB 1H2VZ 4DCOB 2EFPA 3DC2A 4U96A 5DG9A 1IBKJ 3GCWP 4ZVEA 3U1LA 1R31A 2R9LA 2B4OA 2V4JB 2IYIA 1B0PA 3I5CA 4ZPBA 4KBIA 3K89A 1TR0A 3TNVA 5LSRA 2AJ1A 2H5JB 3BM7A 2NXUA 5BR8F 2XNRA 4QCLA 1UJ5A 1U4BA 2XM3A 2QN6B 3EGWB 1DY3A 1UEKA 2MTLA 2WVCA 1L3KA 2RDIA 3HFVA 3OT9A 3C15B 2CDQA 2D3O1 4K0KJ 2Y3YA 4HT5A 2R7TA 1FJCA 3ET6B 4F7VA 5CCLA 1RT6B 2KZMA 2IRYA 3ILIA 1P9YA 3LWLA 1S0NA 1QSSA 1RWMB 1UVJA 2HMIA 2R8IA 4NRTA 5K14B 1YSJA 2HFUA 5KOWA 5RUBA 2GVDB 4P71A 3PW5A 1KLNA 1CEZA 4CLTA 5H1SV 4IRKA 4B9TA 2DIUA 5ETMA 4UZCA 3T1HF 2RHSB 3BZQA 3H59A 3BN7A 1FD2A 3CT9A 3ILLA 3BGFA 3ISZA 3MCMA 2IPOB 3QJJA 4ZP9A 1R0BG 4BS2A 2K7KA 3E01A 2ZITA 2UXCF 5KT5A 1HQUA 4G1QB 2NSBA 2QMXA 4JI1F 4UY85 3HO1A 2JEIA 4A8XA 3T1YJ 1EHWA 2OPPB 1RTDA 1NAQA 1FRKA 4WKRA 3JSBA 3NY0A 2H3EB 1FRXA 1NBEB 5KFPA 1S1WB 1FF2A 3I32A 2QL5B 4WYLA 4E98A 3TA1A 4U7CA 2ZH5A 3FRZA 1JK9B 2FJXA 4W4MA 5EX0A 1XQIA 4ECRA 3MM8A 2C22A 3V81B 4ID8A 2ZVSA 1H72C 2C3OA 3HVTB 3N6MA 4IQMA 2JX2A 5M2RA 3S01A 3K57A 2C2EA 2E1CA 4JV5F 3MEGA 2UXBF 3RG6A 5HQ8A 2E1PA 1UAWA 5AXMA 3FFIA 2GX8A 1S1VA 2KG0A 4F3OA 3CMES 4A8MP 2QG9B 1IKVB 1C0TB 2IAJB 1VRQC 4OI4A 2LEAA 3FKBA 3TUJC 3VZHA 2V69A 1YJ9S 4H4MB 3TARA 2Y1JA 3C14A 2SXLA 1FXLA 4RNHA 2DRAA 4DN0A 4FS1A 2L3MA 3MI7X 4DQIA 3J7A1 1PO6A 3Q86A 5HL7Q 3KK3A 3D68A 5HP1B 3JSMB 3J7AN 2J9EA 1S10A 4B3OB 4ETXA 1JNRB 3TJ9A 3NNCA 2VOPA 2M2BA 2BJDA 5E3PA 1WSRA 3I31A 4F0MA 4BC9A 2IDEA 2V9KA 1YRTA 5A8KA 1RWKB 3OL8A 4NCGA 1HWIA 4QR1A 2YPYA 3TQEA 4ILRA 3QQCD 4DG1A 4GO5X 4MKBA 3LALA 4EK2A 2RU3A 2AYEA 1X4GA 3BDEA 1S97A 3DDNA 4DX6A 3W5ZA 1SC1B 1RK8A 3EJMA 2K1RB 2ASDA 3PW7A 1F3VA 1WUUA 1RTIA 2WSEC 3TVZA 2XMJA 1Y5IB 2OSRA 3EGNA 2YWHA 4OYXA 2O67A 4OZJA 3SSRA 4AD6A 4IFVA 4C0OC 1SJ4P 1JWWA 4B08A 3HJVA 2XULA 2ZBCA 2B43A 5H9EK 1W7WA 1R6YA 4PWWA 4LFAJ 3OXFA 2J6TA 4C8LA 3ZXWA 4KHPF 2XGPA 1A7GE 2Q6BA 2GV1A 4KHMA 1S1VB 3D3CJ 2CQCA 5K5MA 1N56A 4DL2A 4DV3F 1NKBA 1ZAVA 2WOMB 1LWCA 3B6BA 3D7SB 3IFEA 1AZSB 1NK6A 4B3SJ 2AYMA 4DEZA 3KG1A 2ZFHA 3MOZA 4Y2KA 4F36A 2V67A 1UA1A 1F0XA 2LKZA 3KOAA 2JHEA 1SCJB 1H6KX 3SYZA 3VTIA 3QO9A 1QTMA 3HK2A 1N5TA 3IWNC 3OL7A 3THPA 2JOQA 3OFGA 9ATCB 2DO4A 4HT7A 4X4RA 3EMTA 2V6AA 2I0XA 3AB2B 5B0GA 1C0UB 1SQEA 4X4NA 1GTHA 1TUWA 2PMZD 2ATLA 2DISA 4K4TA 4NLWA 4TYAA 1PILA 2OAUA 2NCKL 4Z2XA 2CA9A 4HH0A 4OI6A 4NXNJ 2XO7A 3UD4P 4L72B 3BSCA 2XYGB 3FNNA 5LMNJ 2M4MA 3IAS9 3OD2A 5DQIA 5L1KA 2D74B 4USMA 1DTTB 2GS8A 2LQJA 1SL0A 1QM9A 1OQ3A 3JS9A 1K73T 5C5JA 4ZVUB 3G6XA 2H4WB 4GKJF 4DR6J 2FB0A 4Q0BA 4DR1F 4V19J 3LP0A 1TELA 1DFDA 4LF9F 2ZZMA 2GQCA 2W4DA 2GQ2A 3KLIB 1WHWA 1NHUA 3O8WA 1XERA 1DTQB 3HHLB 3OUYB 1RA6A 2OPSB 4JI3J 4OX7A 5C42B 1NPKA 3R2DJ 3JYTA 1U0HB 2BQRA 1VRUA 1NK4A 1HI8A 2ZC3A 2E1RA 3CCJS 4WTYA 1REVA 3V2UC 4TY8B 4R0EA 4OHVA 3KHLA 1G7CB 1WI8A 1FDAA 4WU2A 2DGVA 2KFZA 1RHMB 2A6MA 1RTZA 4LRFA 3SCJE 4XK8C 2EG2A 2L48A 3GE9A 3GV5B 5JVGQ 2COLA 2AT1B 3HSZA 3T5JA 1HNXJ 1JQGA 3HVWA 3MCSA 4TLQA 5AT1B 2LECA 4CO4A 1S49A 3DI6B 1ZAWA 4ANDA 4CYUA 1PC4A 1PJ7A 1UKUA 1L3UA 5CYMB 3HXMA 1YLXA 5KFDA 4USJC 2ZM6F 1ULRA 4DV4F 3HSJA 7FD1A 1L3VA 3HHDA 5G0RB 2FHJD 3BH7B 4CP5A 2O3DA 3MURP 2J6UA 3MR3A 1Y7PA 2EK6A 5KFRA 3RGIA 1NH8A 3AXKA 1WC3A 2AJ4A 2B8PA 3R3TA 4CLFA 2V5HG 4ZCIA 3UR0A 4RKUC 1V3RA 2F1FA 2KFNA 1EKSA 2AYGA 1TKTB 3EZ5A 2HZCA 1N0UA 3MM9B 3MM5B 4DLEA 1UVLA 2ZZNA 3R5BA 2FHMA 2RRNA 4WP9A 1Y3JA 1WOPA 3OHAA 5IT9Y 1R43A 1UW4A 2HRYA 4KKOA 4DXLA 1GAOA 3D6TB 4IYQA 1I6JA 2DPIA 2Z8QA 2VA2A 4B3OA 3IS9A 4G3IA 2G2ZA 4EYHB 1S0OA 4WZMA 2Q43A 1RLCL 3SIPB 2ROPA 4WE1B 2W8LA 1G3OA 4DUYJ 2HNDB 3BSNA 3DYAB 4HACB 1KFDA 1WI6A 2FTRA 5KFCA 2C1EB 4AL6A 5DZ6A 2GNKA 2P2CB 1B3TA 2DNOA 3QJLA 2I9SA 2FVSA 1J5OA 1UVKA 3GPAA 5I3UA 1TL7B 2MQNA 3LTOA 4EO6A 1Y10A 2C2MB 4MAKA 5L1LA 2V63A 1N4LA 1J27A 3QAUA 4LRAA 1BQMA 5KG7A 2FJWA 4ZIWA 4ZOSA 4FNHA 3HZEA 2RHQB 3IRXA 2GHPA 5T41A 2EEYA 1F9FA 2GHVC 5IV4A 3HT0A 3CUNA 3W63A 2HGMA 2UVUA 3ISNC 1XMOJ 1X9SA 2HS0A 2Z0GA 3N5FA 1U1LA 1KHVA 1CJUA 2CNOB 4H4KC 4DR4J 3BREA 4FXVA 1N34F 2ZD1A 2JWNA 3GG0A 3H42A 5F8HA 3H20A 3R9LA 4L74A 1NDCA 3KJNB 3F0NA 3T3FA 3MMJA 2PE8A 4OX6A 3C6UA 3S8SA 2XLJA 4PCQA 3HLUA 4F2SA 2YH1A 1MG7A 1QVFR 3PYDA 3EVWA 4UW2A 4WXOA 2LEBA 3RB6A 2HYIB 1DQ9A 1NSKL 3KXDA 4PYDA 4M5DA 2RE1A 2B5JA 3W5XA 3U02A 3ZZTA 4OYMA 3CCTA 4GO7X 4ERDA 1Q0NA 2O66A 2Z57B 4TVAB 5MAOA 3PXGa 4MH8A 5MLCV 4B3RJ 1ACMB 2QRRA 5KFZA 4B9SA 3VAJA 2YY3A 3JTNA 1HW8A 1VI7A 5A2QY 1HQEB 1NHVA 2DITA 2GAHC 3FK4A 1QAIA 2VKRA 3Q23A 1X5SA 2UUCJ 3T9ZA 4HKQA 4ZVOB 1FKOB 2VDHA 2UZAA 4LUBA 4ZVGA 2QA4G 2HK3A 1YJWS 1R8PA 3N5BA 4WP3A 4YY3F 3NMRA 2D69A 2CPEA 4DJBA 4H4KA 1GK8A 5GAHI 3OTOJ 3KHHA 1JKHB 1IVZA 2PMHA 2R2TA 1PAEX 2M0GB 3QFWA 4I64A 4I7FB 1N88A 1VQSA 4F0KA 2D9PA 4USKA 4O0IA 3BQ0A 2H4YB 2DHSA 2HG4A 1DAXA 3EDRB 4LR7A 3AOCA 1DBDA 5KFXA 1YTYA 2HFNA 4L3KA 3MUTP 3MM6A 2PT0A 2DGSA 2VA3A 2HHSA 4C9DA 5AE3A 3V81A 1TVRA 4CNZA 2WSCC 1SL2A 1GH8A 4RW6A 5B09A 1PYSB 2B6AB 3I0SA 1WEYA 1HNVB 2IDLA 3BR8A 3BO3A 4LF7J 2ZDOA 4LBIA 1REVB 3G87A 3W66A 3UCZP 2LXFA 2HBRB 4WTOB 1LW2B 2H1YA 2OP5A 4CO1A 5AXNA 4AE5A 1U47A 1KQGB 5FD1A 3TVKA 4ZCMA 3WHIA 3DRRB 2Q6CA 1TFYA 4N41A 3VCDA 3MEEA 3U1MA 1S9GA 3PEJA 3IWXA 4RJVA 4X4PA 5D0RA 3OV7A 2ZHAA 1XIQA 2RRAA 2AEJA 3W64A 4EBCA 3MMBB 1NSQA 4KJIA 2CG8A 3J80U 7AT1B 5DRKA 3UD3P 1GNKA 3SFGA 5AJ3J 5B08A 3R6LB 1K0VA 4LSNB 1DTTA 5CZVA 2B8QA 3DHXA 1S5ZA 1TL1A 4NCGB 4J9SA 1FVSA 3OSPA 1QY7A 3M2RA 3EPIA 2RQ4A 3GLJA 2VQEF 2VICA 4B3MF 1HYSB 2ACYA 2YVSA 1APSA 2MKKA 4YR0A 1I5OB 1SH3A 3FSXA 2KXHA 1KR4A 3V4IA 1UL3A 1CJTB 4O3OA 3IBWA 5HJYA 1VRTB 1IJEB 3FGVA 4YB7A 1REGX 4C3KA 3OTOF 3I0SB 2YKMA 4RW4A 1Y9OA 2KYXA 3I4PA 2XBPA 2KTQA 2MB0B 2F65A 1CJUB 1KWMA 2IIHA 4IRCA 2DNYA 1S1UB 2BW7A 4IR1A 4QU7A 2HZAA 1FRMA 1M5HA 1FFGB 1UP1A 2D7SA 4PWDA 2B51A 2W2QP 1JLBA 3CSKA 3EWGA 1SKSA 5JUMA 4BDPA 2V9WA 5JVHQ 4EMDA 5KTQA 4FDFA 2VG5A 2PN6A 2DNGA 2RF2B 5KAKA 5IWAF 3CVKA 2VIHA 1N36J 4LF5J 4P6QA 3G6YA 2H48B 2A2DA 3EXYA 3UO0A 2JNJA 5CZXA 2KB2A 2E5JA 4OLPA 4CT9A 2J6SA 1N5YA 3NS6A 1CBKA 2QZ8A 1VMBA 2VQFJ 3NEKA 4P2MA 2GGPA 3ICLA 4UOCA 3HHLD 1RT3B 3TAPA 1ZA2B 3Q89A 1YJUA 2NR0A 5J1PA 5HQMA 1U6ZA 2CFXA 4OYIA 1QE1A 1CULA 2VPZB 2PO4A 3CE8A 3C8YA 5HQLA 4JI3F 2A10A 2M70A 3BKUA 3M1VB 1IR2A 4WFZA 3OR2A 5KFJA 3MFHA 2XS7A 1RXOB 5KG4A 1ITPA 5A2QU 5F9LA 1DHMA 1WEXA 2ZH6A 3CJ3A 4OZ5A 3MM5A 2PDAA 3DM2B 1VJWA 4DR6F 4FYXB 4Q45A 4GKJJ 5F8LA 2HVHA 4H54A 5K14A 5J2MA 4IKAA 1KOOA 2MJUA 5D77A 2RQCA 1HNZJ 2P9GA 2LXUA 2DNPA 3QT5A 4M95A 4WPAA 5FLXY 3NL0A 2G0CA 1VBYA 2R7SA 4WE1A 1V5VA 4PG5A 4ES2A 2CWXA 3E3XA 1IQZA 1HWUA 5GMKa 2E5HA 5DDRC 3THTA 1GQEA 4NEZA 2CPIA 4CO2A 4ED2A 5DM6Q 2HVDA 4K4VA 4RL1A 4XTTA 4M5KA 1WNEA 1X5PA 2DB1A 1S57A 3DOLA 1RGVA 2H5EA 1PGZA 1RHJB 1VCTA 4O4RA 1BGXT 1H74A 1FESA 1RE1B 2CPHA 4IG0A 1VDHA 1M1GA 5IFMA 3G96A 3CEDA 4DV5J 4X64J 4J9OA 5EWFA 3DOKB 3VWSA 1AA1B 2PFDA 3LW5C 4WU3A 3LF0A 5G4DA 3MM8B 5HBMA 5DO2A 4FYVB 4ZCLA 4UOFA 4ICLB 3KDNA 2EC2A 2NSCA 1Q95G 3OFEA 4UTGA 4OI1A 3VV2B 3AB4B 3IM9A 1Q86T 4CTAB 1N5VA 2OD4A 3BKTA 3PEHA 2W2MP 4X4QA 1CC7A 1VJQA 3KFWX 3KMSA 1G2EA 3AXMA 2HLUA 4A48A 5F8JA 5C25B 1O51A 1LWEA 3BB5A 2MGZB 2ACMA 5J2MB 3JSMA 1AXQA 2GJFA 1RT7B 2ZBQA 2IM2A 1RT6A 1FRHA 5C24B 3CJ4A 4P52A 4ZPDA 3CMQA 4QBUA 3J7YI 2QA4S 1EQ0A 3MXHP 2XSFA 1HWLA 3B4MA 3V4IB 3NAIA 4ER8A 4JI6J 2HMIB 1RKIA 2RJZA 2RQMA 4Q8EA 1WKJA 4KKOB 4KV8B 2AW0A 4NLDA 4DHVA 4OYZA 2Y1RI 2FJDB 3CXCR 3GIIA 5GADU 3FJ2A 3ZTSA 2I6WA 1B64A 2QLBB 2BVZA 1T03B 3GIKA 2D3OR 1OY9A 3TJ8A 3TVYA 1RTHA 1FTCA 4CO0A 5D6GA 1TL3B 3T19A 4DL7A 5DGAA 3HHEA 4MTPA 2IFXA 3QJPA 1Y4ZB 3O6QA 3UD5A 5DLGA 3ETOA 3M2RB 5KFTA 3VR1A 4F67A 3PYEA 2ZM6J 2RAQA 4NI2A 4AL7A 2HNYB 1B0VA 4NEYA 5EDWA 4I2PA 1S1WA 4QIVA 3G6ES 5E3QA 2M8DB 1VFJA 2B56A 1WG1A 1WHXA 1XNRJ 1CSJA 1H3DA 2LQ5A 2OEMA 2RRBA 3M32A 1RWOB 4YEAA 4JUZA 4DR2F 1PJ6A 2JLGA 2HFZA 4FF4A 4I0WA 1NK5A 5BYRA 4DR4F 4X64F 2DYAA 4O4GA 3MEGB 3U27A 4HH1A 2M8HA 1EARA 4JV5J 2BX6A 4ZJQA 2J8SA 3FRYA 3OR1B 4WBFA 2LVWA 2R4FA 3W9JA 4QR0A 2KJVA 4PXBA 4DFPA 2FZCB 3HT3A 3BN4A 2CJKA 4FBTA 1YZ7A 1UMJA 3OSNA 2OGUA 2EI5A 4EFAC 2FIUA 1CJKB 1HR0F 3H0PA 2NYHA 5H9FK 1CQMA 1MROA 2QYGA 3QMQA 1TMMA 4HI2A 3I9ZA 5DETA 2ZNZA 2WW4A 4ECWA 1ZM4A 2UVRA 5HROB 2DR9A 2HAFA 3DRPA 1ROFA 3HX9A 4ZLLA 5CYJA 1T03A 3M8RA 4DV7F 3RW7A 1HQUB 4G1QA 1KN6A 3Q8PB 3LQVA 5A8KB 1QSLA 1U09A 4RBTA 4Q43A 3W2VB 1NK0A 5F8NA 3IM8A 4XPCA 5J2QB 1LQ9A 1NB2A 3QIPB 2BM0A 3QSIA 4LBHA 5AE1A 2AYBA 1S0VA 1U8SA 4PPZA 2UP1A 4ZHRB 5A8RA 2BJEA 2MZRA 4MFBA 3P5BP 1KONA 3Q8SB 3Q24A 4ANEA 1HBUA 1WOOA 5AXKA 1ZTTA 3LP1A 2EPIA 2GVZA 2UV8A 2G4BA 2F8MA 4NMLA 1R8BA 1LWFB 2QA2A 4ICLA 2IAJA 1BWVA 2UUAF 1MSWD 5L46A 1HI1A 4QIGA 5L39A 1VC5A 1P27B 1M1HA 4DPWA 6FDRA 4LT6A 1LFPA 2MQ8A 3NKYA 1K47A 2F5GA 4K59A 4DDFA 3G9CA 3WX4A 3P6YC 3IWLA 4KE5A 3PR4A 2BXJA 1RQ0A 2WW8A 1RABB 4P7VA 4RWXA 1OY6A 2JFKA 1LWEB 1K44A 4KFBB 3MAHA 4X62F 1FEHA 1LNQA 4QYZK 3CC2S 4IG0B 2BJ9A 2WB1D 5D0EA 5D0GA 4ECZA 2QIFA 4DX8H 3KKFA 4YY3J 5DDOC 2J0XA 3NS5A 2F3JA 4AXIA 3TAQA 2QV6A 3EM1A 3IAM9 2G2OA 3POTB 2Y1LB 3QFHA 3UNYA 1TUVA 1XWLA 4OHZA 1VBKA 1VHIA 2NXCA 5CABA 2A6OA 4U95A 1EKRA 4DV1F 4DPXA 1RBLA 1JLQA 1IXKA 1UFLA 4MT1A 5KG0A 4DU8A 3MOJB 3D6MB 3KLEA 1VQ7S 2CQBA 4LBPA 4QIWD 2HSEB 2YNHB 1UWAA 1X7VA 3OL9A 4MYUA 5DM7Q 1HHTP 4ZVTB 2XMUA 4MKVA 3CDEA 4ES3A 2R2UA 4NYOA 1YG0A 4LSZB 3QRRA 2OI2A 5ETKA 4I7FA 2UXBJ 3MR7A 4OI2A 4P73A 2W9BA 1TL4A 4OZLA 4TKTA 4C3LA 3MMCA 2R42A 5IM0A 3OL6A 1P9QC 2MZQA 2OO4A 4DPOA 3I0RB 1V9OA 4P9SA 4DFKA 2E5LJ 2FZGB 2VZ9A 4A8KA 4P74A 2RVJA 2VD3A 3SQOP 5I42A 1RCOB 2HBZB 1BQNB 4XDDA 5CQGA 4QWBA 1M5KC 1LW0A 1YKWA 2HPUA 4LSLA 1VOMA 3M30B 2ZH1A 4M63A 4J9LA 2QMWA 1S76D 3HI9A 2GO9A 3MPYA 3AOBA 2DH7A 1H7XA 1SJ3P 4DR2J 4NXMJ 3DMJA 2RSQA 4WFNQ 1HQ2A 2GIFA 1RAGB 2EBGA 3I96A 4KGXB 4MKYA 4URGA 5HN0A 4NPOA 3GV8B 4ELVA 1SKUB 4ZPCA 1Y5NB 3GFHA 4ZVRB 2OD6A 5IZHA 2V34A 1WC5A 1U1PA 2GGPB 2VL1A 4CLYA 4DUZF 3CJTA 4F4AA 4KTQA 2J7WA 3FBEA 4F4YA 5EN1A 1DQ8A 2QJ3A 1HHSA 1NSAA 3L7PA 2FJAB 3NGUA 4F4ZA 5D15A 1YWXA 1WHVA 4PXDA 4ILLA 3DLEB 3AD7C 5BYQA 3W2VA 2W8KA 1BXNA 1PAUB 2DXFA 1JMTA 2V2KA 4XDCA 4DL4A 4ZS6A 2UXDF 5HVGA 2H5IB 4KHPJ 3L09A 2OEKA 2YWGA 1NB7A 1DTQA 1MN9A 2HFOA 2ZVIA 3HHLA 3N9UC 3L9ZA 4BLGA 4CT8A 2W9BB 4LF8F 2VFTA 4F3MA 3IR7B 3TOQA 1RWPB 3L95X 5ETVA 1UVNA 3RW6A 2HBYB 2VFUA 1JX4A 2OFHX 3LP1B 3DRYA 5SZTA 3DLHA 4JV2A 5DJBA 5KT2A 3KG4A 1KP6A 2MMYA 2YKMB 4RW4B 1B7YB 3GJQB 4DL3A 1M5OC 1H38A 1U6BA 1K1SA 5CYQB 3NGDA 4DSEA 4LFBJ 4C6AA 1KLMB 4I6YA 1U2FA 4IOAQ 4YDDB 2AEFA 1RT4B 4A8OA 4DX5A 2RUGA 2VG7B 5GVQA 2ZJRQ 3RB3A 1HWJA 4YUDA 3J81U 4Y00A 1HNXF 3RR7A 2UUBJ 3EVOA 1UZDA 3IN5A 1IBMF 4L6V3 3D4JA 3CGIA 3GB0A 2ZUGA 4EWTA 2Y8YA 3S1TA 4C7QA 1O0PA 1WORA 2OKQA 2P6TA 2W9CA 4I2QA 3BBFA 3LPYA 2DCLA 4LQ9A 3VGVA 5HLFB 3NRBA 1RWWB 2W4CA 2DGWA 5LT5A 2ADBA 2AKWB 2FUG9 1HNVA 2X7IA 1RUSA 2BV3A 3IGNA 4GVBB 5A6WA 4A8YA 1HNWJ 4F04B 4OZ1A 2DH8A 2YWEA 1XMOF 3D3BJ 1VQOS 3V6DA 3KNGA 5HK4A 4ETZA 2G1DA 2KFYA 1VIXA 3ITHA 4NLTA 1BUXA 3W61A 3C2PA 3TZYA 1GMWD 1CLFA 4HHUA 1RWXB 4N8OA 4CH0S 4CQ1A 3FC9A 2R7WA 2WZ1A 1FK9B 4FYWB 5CA5A 2DKOB 4PUOB 4TU8A 4QWAA 1FXDA 4ED0A 2DRBA 2OTLS 5HATA 1WC0A 1YITS 1JLAB 3C6TB 1XK8A 4ES1A 2XS2A 4OI3A 4ZPTR 2EFOA 4MKAA 2DGQA 5LJ5Y 2HQ3A 4Y2CA 5JJBA 2HNDA 3Q8RB 5ADZA 4EBEA 2IYGA 5AJ3F 3HJFA 4RLEA 1SJRA 4JBCA 4M5IA 2J8AA 1MW7A 4PXEA 3U1NA 3G4SS 1FCAA 2YX1A 1RTJA 2PIIA 2V8GA 2NXJA 1S79A 3O3LA 3QATA 1XC9A 1KD1T 4CLZA 5C2CA 1T7PA 2QEXS 3V6KA 5GAGI 1YJRA 2R3VA 4CM0A 1HBMA 2BKOA 1KKHA 3KLGB 3FZ2A 3MEDB 2Z4PA 1BE4A 3S7RA 4B3TJ 1G1XA 3GJTB 3V4MA 2YNHA 1P6TA 1HPZB 4WFXA 3HVTA 2HFVA 3JTPA 2K06A 3PG9A 1R89A 3QRPA 4DR7J 4HDGA 4KY3A 4GVBA 4J9VA 4FF1A 3Q8QB 1F5AA 4DI6A 2Q79A 2Z30B 1TVRB 1F5CA 2XWYA 3N28A 4QWCA 3AD8C 4FPRA 1UJ6A 4NZ6A 4ZLNA 2FVRA 1AT1B 3M8WA 1L3SA 1DURA 3D54A 4FBUA 1KNZA 1NPPA 2AMCB 2DY1A 2P8IA 3CO0P 4I67A 3C14B 2PEHA 4Q5VA 2EVZA 1VQMS 2XZTB 3CDAA 4ECUA 1NCLA 4FYDA 2R7UA 2CJBA 2GMLA 3R5JB 1XNQF 4LSLB 2HHXA 5HANA 5CD4A 1Q8KA 2DH9A 1IBKF 2O1PA 2CQIA 4ELUA 1RWNB 2H9ZA 4D3HA 4J9KA 1X4AA 1ZH5A 2PA3A 4C8MA 1TKZB 4EI2A 2MQPA 1KC8T 1RT1A 4ZIVA 1RAOA 2H54B 2ILYA 4N5SA 4IFYA 2QGFB 2QA1A 2V8PA 1CJVB 3G86A 3LGNA 3I55S 5ETLA 4USVA 2VU5A 2IM0A 4M5HA 1IQTA 4BCAA 2RKIA 3UDEA 4ZP6A 1OY8A 2BE2A 2KVIA 4OLOA 5F0WA 5KT3A 4OFZA 1DLOB 1RTHB 2IC3A 5E2QA 1URRA 4U7UK 4B17A 3KLGA 2DXEA 4ID5B 1RT4A 3OFFA 4UOGA 2P9CA 4OJHA 2YQ0A 2KG1A 4NLVA 4K4SA 1OPZA 3SCKE 1X4CA 1ZS6A 4J9NA 3NCRA 3PM9A 2CQ3A 2YNGA 2HK2A 2QLXA 3OXLA 2I2YA 2VDIA 2VPWB 2XLIA 4FP9A 2KHDA 3K5MA 4KSEB 1K8AT 2NUHA 3JQKA 3I5BA 3KJFB 1T9UA 4KGZB 5F8MA 2KRRA 3H25A 3WC0A 2QL7B 1X0FA 4LVNP 1GX5A 2APOA 4RNOA 4W92B 3FFIB 4F02A 1S48A 4ED5A 3EXCX 4I56A 8ATCB 1XN9A 1WHYA 4CLLA 1M5SA 2QL9B 2CAJA 2V2ZA 1VQKS 4KH0B 3V6DB 2DNMA 2VBYA 2AU0A 3SQGB 4QW8A 4ZDNA 2KM8C 3I5AA 1LKZA 2CPDA 2D3ZA 1ZPWX 4OX8A 4RW7A 4CH1A 4B3SF 2Q66A 3T5LA 2FJBB 4GVLA 1RDRA 3K0JA 4KFBA 3MWBA 3NCPA 1GMVA 3AD9C 1RT1B 2ROEA 4C3MA 3JQJA 1F2GA 3EUNA 1AFIA 1D9AA 2CJQA 1XNRF 1FERA 1S72S 3ENQA 3CCMS 3C6TA 2Y9HA 3UN2A 3DLGB 4EGLA 2XMWA 3TW0A 2GIQA 3R5CA 2BABA 3IC1A 3TA0A 3P96A 3HF5A 3P49B 4L3NA 1JLGB 4K4UA 3VAGA 2DPJA 1NPRA 4LF1A 5DDQC 1HL6A 1Q5YA 2XI3A 3HPOA 2GMHA 5J2PA 4KO0B 1OPIA 2DGXA 3MEKA 1VLOA 2KU7A 3PFEA 4WK1A 3ZNUA 4RW9B 2L41A 4EU0A 1HA1A 1RISA 3H2VE 2CPJA 1VK3A 2LQBA 2P9EA 4N77A 3RZAA 3RBZA 2DVIA 2I1RA 1IWAA 2OLWA 4ATNA 4OYPA 3CO9A 3ZZPA 4X65F 3PTWA 1MU2A 4JI0J 1NO8A 4WP8A 3SMZA 1FX4A 1FDBA 4L73A 2V4QA 5LMUJ 4ED6A 4LFBF 2K8GA 4ECSA 2HLTA 4HEA9 1VC0A 1PSDA 3OXGA 4USIA 5ETOA 1M0SA 1TZ0A 4GKKJ 4ZCKA 3M8QA 3CPWR 4TU7A 1JXLA 2DHHA 3U7JA 5D3GB 3Q8YA 2HNZB 1W25A 4I4BA 2PI4A 2HHWA 3A8JA 1VGYA 4M1KA 4K7QA 4UT4A 2CQDA 2IBOA 3CCZA 4QPTA 1KHWA 2QLJB 3UCGA 3KTQA 2E66A 4JV1A 4K4XA 1TKXB 3DOKA 2VC0A 1IKXA 4CLKA 1TKZA 3KJVA 1DQAA 1WSVA 2KVQE 4F3QA 2ZJQQ 4LFCF 3B4DA 5IV3A 4UF4A 1JNZB 3MMAB 1SI9A 3ITHB 2WHOA 2YPZA 2DNKA 2GCFA 3MCNA 3GYGA 1R3NA 3MPDA 3FBFA 3QIDA 5KG3A 5KFOA 2DHGA 3NAHA 3ZZUA 3IBCB 3RAMA 3UVJB 4IH5A 3RRGA 4CLSA 2CXEA 2OPQA 2UUAJ 2ZEJA 4ECQA 1Q7LB 2C3PA 3DXBA 3M2VB 2H65B 1I51B 2K2PA 3Q8UA 1U1KA 2V0NA 1TTHB 4PG4A 3KK2A 2VG6B 4M5MA 8RUCA 3FEZA 3BBBA 3OUYA 3PVXA 1KFSA 1TU0B 2F9DA 3GZ7A 2R8HA 3T6BA 4KV8A 3MMCB 3IRWP 1VBZA 1RTJB 3DDKA 1J5EF 1VRUB 3TQ1A 3IG1A 3KLFA 2DEIA 4IO1A 3FSIA 4M8LA 4RNFA 2EK1A 2ZH2A 5F0UA 1CQNA 3C19A 3MAQA 1NJYA 2E5GA 2CDRB 4U8YA 3PX6A 2DNQA 2AIRB 3ELHA 4F25A 3JAMY 5C2GA 4YS2A 4F8RA 5IXUA 3HKWA 3SEOA 2I5JA 3N4WA 3WBZA 3CCQS 2CPFA 3X3UA 1KEKA 3AODA 3R7NB 5H9FJ 1C4CA 2XMMA 4LRCA 2QYCA 5EWEA 2JH3A 2QFIA 2WB4A 1RAJA 3M8YA 1JIHA 3GV7B 1R8AA 3TRGA 3THVA 4YN3B 3DI6A 2FHKA 4CYUB 4U6PA 1FTRA 2XG8A 1SQFA 3L3CA 3H4DA 1J5EJ 2FDNA 2JLFA 2IRXA 2FVQA 2BRKA 2DXDA 4I6AA 3VGUA 3AA8A 4USHA 3MR2A 3V6HA 1Q81T 1Z2LA 2DIVA 2WVFA 4YMEA 2YKPA 4DUTA 3CF5Q 5AE2A 2AX1A 4XO0A 1KTVA 3PHTA 2XEXA 4MIWA 3DLLQ 1RT7A 1IUJA 4C8KA 3MR6A 2V8DA 4YHHJ 3W8GA 3PYFA 2OHDA 1YQHA 2L9WA 4MJKA 4PR6A 4QPXA 3H4BA 2UUTA 2ZH8A 1RT2A 2YNIB 3CDBA 3M2UA 2EXUA 2QMUB 3M6XA 1RT5A 4YR2A 2FQQB 5IWAJ 1N36F 4LF5F 3V5RA 4MIBA 2HHUA 5F3TA 3DOMB 2V2VA 5T7LA 2QC3A 2W24A 3HHKA 2EFVA 5KT4A 5D4OA 3DGPA 3JXOA 5KG1A 4AUKA 3SXLA 3KLHB 3DLGA 1IR0A 2HAIA 1KDNA 4LFCJ 1U8WA 3A3PB 3DHWC 5E33A 2V8HA 3DYAA 2ASLA 4JI2J 3BYPA 1VQ8S 5L1IA 3VVTA 1S99A 1RJJA 4MIAA 1NJIT 2E7WA 2BJ8A 1Q7YT 1N33F 4YB5A 1P1LA 1JB0C 3QIPA 1S6OA 1BMQB 2K7JA 1HNWF 4B3TF 3OLAA 2NLWA 2PSZA 3CJSA 4NLSA 5A6PA 3HCXA 4BWJA 4NOHA 3TO8A 5C42A 1JJCB 2G1HA 4YR3A 2VQEJ 4BC7A 3ETMA 1K0TA 3I0RA 4R5PA 1IR1A 3MD1A 3LP2B 4O23A 3VAKA 3JB9k 4O3QA 4DSKA 2WK4A 4EEYA 3IBFB 2DY9A 2RUSA 3CCUS 3IA0A 2N3OA 5F8GA 3MUMP 1FWKA 5EGYA 4OHWA 4Y2MA 1FD8A 2HHPA 2MKJA 3FCHA 4C11B 4UQGA 3AY0A 4J7CA 1WF2A 2BUNA 4UOHA 4Y3CA 1EQMA 1JLCB 3ZZOA 5I3QA 3QO9B 1BLUA 5KFAA 2CNNB 3W1YC 2ZNYA 3IR5B 2BJ7A 4DU7A 4DR5F 1S12A 1SH0A 2WRMA 3ZTQA 2B5JB 3GTYX 2VONA 2N4DA 4PWUA 1AUSL 4KR0B 2AWZA 1Q8LA 2IJFA 2J9CA 4B9UA 2VG6A 2E29A 1JLEB 2N7YA 3UDCA 2Y8WA 1S77D 1WOSA 4WZQA 5I3PA 2XS5A 1UCNA 2AP6A 4IG3A 3UW1A 5CXTA 2XCAA 4NYZA 2PI5A 2BR0A 4LF6F 2R7VA 4OZ0A 1UFKA 2IVFB 3B78A 3TI0A 3LA0A 1E6VA 1YBAA 3RBXA 4DL0C 4TYBA 3HMJG 3I56S 1X4HA 4DF4A 2J7UA 2K1RA 4EO8A 4DV5F 2VF3A 4K5RA 1S6PB 1ZM3A 4DV6F 3EZUA 1YRUA 3OW2R 1AUDA 3D0HE 2ZH4A 4DOZA 4IRDA 3MEDA 2AEMA 3KLIA 2B7CB 3HVAA 5IC4B 3BQ2A 3UE2A 1U1NA 4B9MA 2V50A 4FZVA 3KUGA 2GC8A 3R1HA 2Z2YB 4LRBA 3GFYA 1TMJA 4R8UB 3VAHA 3A1YG 3CJ0A 2OMOA 1Q53A 2ASYA 5DG8A 1EETA 2FGCA 4RBVA 2UVVA 3AQOA 4DV4J 1N5QA 3QRQA 4A8WA 2K3KA 1HBNB 1MN7A 4GRSA 4M5GA 4M5NA 2PEBA 1X4DA 3PO4A 2CNLB 4OYAA 1B70B 1N52B 2XMVA 1FFSB 2B9WA 2D41A 3FCWA 4URSA 5M2PA 1LW2A 1IBMJ 3WC2A 4O44A 4I1TA 2BOPA 3A3NB 3NGKA 2Q1LA 2NS1B 5F8IA 2R8GA 2WVBA 2LU2A 1ELOA 4TLRA 1OIAA 2GFFA 1RT2B 5FIIA 5HAOA 3QZ8A 4J9QA 3SV3A 4QR2A 3BEGB 1HD0A 4C97A 3W60A 1FRLA 3KUHA 3QWPA 1NHKL 1QE1B 1CULB 2QE5A 4N7TA 2JFDA 4U9RA 2XY6A 5ETTA 2UXDJ 1YVFA 3ISND 3MF5A 2MHNA 4Q7AA 1NK7A 2R8JA 3BDPA 4A47A 1F60B 5LJ3Y 2G0IA 3AFGA 4WFYA 3W2WA 5CD4H 2FZKB 4WFBQ 4DV0F 4NLRA 5B0DA 5D4LA 2B0GA 5LSOA 3R6GB 4OIXA 2OPPA 1RTDB 2DHXA 4BBYA 2ALYB 3TANA 1Q79A 1X5OA 2VBXA 1VYAA 1YHQS 4Q0BB 1S1XB 3ZTPA 3R5DA 3LOUA 2LQ9A 5F3ZA 1K9MT 2FLLA 1MLAA 3BGRB 1WG4A 3HKZD 5D8HB 1T3OA 1HQEA 3W7BA 5A76A 1MU2B 2DNNA 2MLZA 4OJGA 2BE7D 4S0MA 1YK9A 2J7KA 2DD8S 1S4FA 4BHQA 2HHHJ 4U7UD 1FI4A 5GAEU 3AHPA 3UQSA 1U1QA 3PNIA 1LW0B 1NXIA 2CKWA 3JQMA 2N7CA 4LR9A 3NGSA 1ZZNA 3T1AA 1RTIB 4NLOA 1XR5A 2XHWA 3D1OA 2ZBRA 3MCOA 3DLJA 3PRDA 1UWBB 1RU2A 3NS7B 4PRFA 3TUPA 3PHEA 3MD3A 1KQSR 4QWEA 2XMKA 5IT4A 3O2IA 1FT8A 1Y00A 2GAGC 1XMQF 5HP1A 1B99A 3PKYA 3C3LA 1SJ1A 5HVFA 3T41A 2HQGA 3D66A 3OVBA 2KRBA 3J80Y 4UUWA 4OYOA 3EDQB 1KVIA 2JJ4D 4JYAJ 2IA6A 1D0EA 2MLYA 1QLNA 1GMUA 2FD2A 1ZPVA 2AF6A 3CB4A 1OSCA 3ENAA 5KFMA 3MMAA 4C8YA 1C0TA 3HD2A 2OMLA 2BKPA 4UY8T 2QT7A 2RIJA 1JXVA 4OZ3A 3J7ZT 2RS8A 4H4MA 4TU9A 1M5VC 1U26A 3CD0A 3T9NA 3EZOA 3M2UB 1S1XA 1JLCA 3RRKA 2YBVA 3WQPA 3KHGA 3PW2A 4OV6A 5KFEA 1N33J 1CPZA 1SVDA 1V3SA 3MGJA 5SUHA 3GIJA 2CJAA 2KDOA 2VFRA 3S6EA 3R27A 4W90B 5K9FA 3ZO7A 3BSOA 3OVAA 3H7HB 4ECVA 2Y0BB 3GU0A 1UPPA 5K20B 3MDFA 3IS9B 3UI3A 4DR1J 4C8OA 2FGOA 1U02A 1NM2A 4WJBA 1ZAXA 3D1QA 1BY9A 1HYSA 2NXNA 2M88A 1F5BA 2IVMA 4D3GA 4LFAF 3TWZA 2KI2A 4ID5A 1MWZA 2CRLA 3ZZ0A 4K4ZA 1F1BB 2N82B 4IOBA 1NEEA 1T9YA 2BQUA 2DK2A 3RU0A 4DV1J 3HVRA 5EHHA 1FNXH 3CD6S 3R5AA 1RBOB 4WWSA 4JI8F 2ZJPQ 1MMDA 2RMLA 2JVOA 2FVCA 3MAAA 3K5NA 4IFVB 2OUGA 3NOGA 5KFIA 5KG5A 2LQ8A 1T05A 1TKXA 3JTOA 3O5TB 2JEJA 4ZVPB 2YKQA 1FWLA 2ALZA 4NLUA 4EZ6A 2R7QA 2UUCF 1HNIA 3QLHA 2MYFA 4NX9A 3C46A 1B4SA 3GYXB 3CCLS 3CD7A 2VJVA 4DF8A 1P1TA 4HHJA 3TEGA 2HZVA 4Q8FA 1T9XA 4IQXA 4OZ2A 5M2UA 4J9UE 2VV5A 2AD9A 2VJUA 1YDLA 3KWMA 4DSJA 1UZHA 5THWA 2F4VJ 4PQUA 2HEKA 1YIJS 4PUOA 4OZNA 3W9IA 3D6HB 1LXNA 5KG6A 2A0FB 4DS5A 4LF8J 1Y5LB 1TK5A 2FLNA 3GYNA 1IBCB 1FKAF 3G8SA 2J0QD 4O3RA 3KHRA 4ZN3A 3UNGC 5KT6A 3KMQA 2YNIA 1X60A 1VHFA 2BANA 2E5IA 2B4PA 4DN9A 3I87A 1Y0HA 1U48A 1NH7A 1BC6A 5D78A 1Y11A 4NLPA 3PYGA 5G0RA 3SSQA 4O3SA 4Y28C 1H2TZ 3NNAA 2GA7A 1DRZA 1DJ0A 1RAHB 1Z4UA 4IG3B 2X51A 3I82A 4O3PA 3C16A 1N34J 2E9RX 6AT1B 4HLBA 3HP6A 2KHCA 2RT3A 4JI4J 2KZZA 4K4YA 2OPRA 1FKOA 1Q82T 3FBCA 3TJAA 3EYZA 3M8PB 1TKTA 3EE3A 2B9EA 4HYKA 1PBAA 1KRPA 1SUQB 1E6YB 1WC6A 2NZCA 4DV2J 1B7FA 4OHXA 2X1FA 3GMGA 4NI2B 2DJWA 2RU9A 4C2MA 1LOUA 1I94F 4DSIA 2WAQD 2WVEA 1B0TA 4ANCA 4QYZJ 3TZWA 4NCAA 4M94A 2VPXB 1LK7A 2C2NA 3TUIC 1D3WA 3VGTA 2DGTA 3LP2A 2HQDA 2ZOGA 1F6TA 1FA0A 1VR6A 3NWGA 5CYMA 3JYTB 2M52A 2OSQA 1Q8BA 4QZVB 1KQKA 5L9NA 2ABYA 1NJWA 3NGTA 4USUA 3T1HJ 3LWMA 5J2NA 2BYCA 3MECB 1FNMA 4CLPA 1X9WA 4ZP8A 1UEUA 1HMVA 1T95A 2BACA 3ZTRA 2MLXA 2F4FA 1MWQA 1HNZF 3GCXP 5A0YA 4B9NA 2MEWA 3KK3B 1C0UA 1URNA 1RA7A 3NCQA 3MUVP 1SC3B 2RF2A 4IO9Q 2ZOFA 3M7VA 4WIQA 1SV5A 4OJ3A 3MEEB 2ADCA 2H51B 3FEYB 1QUPA 2VFVA 2XB2D 2J0SD 1JXEA 2D3UA 2HWIA 1JLEA 3QWUA 2NQPA 3DRPB 2RILA 1MNEA 2HS3A 1TFWA 1RACB 2W9AA 3OHBA 2XMTA 1ICEB 2DO0A 3TZZA 1SPBP 4DL5A 2QX0A 2QO3A 1JLFB 4FNIA 3LP0B 2C2ZB 5I3UB 3AJ2A 3M2VA 4DUZJ 4DR7F 4DV6J 4H4OA 4DX7A 5I4MA 1RCXB 1RYRA 4GKKF 1U0HA 3MAAB 4NL5A 3NG8A 2MKHA 1SQGA 1AZSA 3ZZYA 1T02A 2DCUB 3KLFB 3HSDA 3PV8A 1X5TA 1YJVA 1C1BA 1J2VA 1NSPA 2ZH9A 4DSFA 4P2FA 5B0EA 3AQPA 4KGKA 4KRWA 3UFCX 4AXJA 2VBZA 3AJDA 3P4UB 4HL9A 1EP4A 2R7OA 3K2YA 4IOCQ 1JKHA 3SCLE 2VFSA 3C6UB 5LMNF 2I5JB 4PG8A 2DRDA 4I2PB 3Q2SC 2G13A 2DNZA 2MQLA 3KLVA 3BQ1A 5FDLB 3DDIA 2BMBA 3B82A 3M4XA 3LAKA 1UA0A 4JI1J 1WF0A 1KBRA 2IVYA 2E7XA 5KFYA 4ZA1A 4DV2F 1HBOA 3FCVA 5J1EA 1CC8A 3MPVA 4ZVQB 2G9OA 4RW8B 4LVOP 2V2QA 1Q5VA 5F9NA 1Q1KA 3SV4A 4TXSA 3VQTA 1QAJA 4DV3J 2HGNA 3VAIA 2OFGX 4OL8A 3SCIE 5KFSA 3BS9A 1R7IA 3QT7A 5K8NA 1S59A 2O01C 2ZOMA 3HHLC 1CJKA 2W1BA 1VRTA 2W7AA 3K7RA 1SUQA 1E6YA 1FKPA 1S7HA 2BM1A 3P45B 2F40A 1TV6A 1GXLA 4WYWA 4X2BA 3NP5A 1N0VC 1UTAA 2A18A 5T7LB 3FMBA 2NZ4A 2DNLA 2ZKTA 1WACA 2G0JA 1K1QA 3E01B 3PX0A 2JVRA 2DR8A 3ZFVA 1D8ZA 1J5OB 1JJHA 1VK8A 3LO3A 3NGRA 2HVEA 4PZVA 2PGCA 4LMZA 2VG7A 2CQGA 4IDKA 5D4PA 1YJNS 2FLOA 4C0HA 4RUCA 5HMWA 3DRXA 1UW9A 3H98A 3IGVA 3EX7B 1Q4RA 3E51A 4ZHRA 4DMZA 3P3DA 5A8RB 4KGVB 2AGQA 3GIRA 3NOCA 5GAHU 2P6SA 4R0JA 2HHHF 1YRXA 2HNYA 1T05B 3QPIA 3M8SA 1NZ8A 3H40A 4X84A 2V4RA 4K5SA 4R5PB 4DPUA 4ED3A 2XY7A 2OH2A 1OSDA 2E9ZA 4CZCA 2KYZA 3MHYA 4RW8A 4ECXA 4LF9J 3FEXB 5KFHA 1IBLJ 3GSDA 4DQRA 2V4JA 2W4PA 1LV5A 2GMJA 1NDPA 1U0SA 2IRUA 1GXTA 2B3TB 2JEFA 3QBCA 3BF4A 2CADA 2WONA 1SIZA 1TL1B 2QSFA 3OR1A 5D0HA 5KG2A 4OI0A 4TQSA 2VG5B 2ZE2A 3RR8A 2Z56B 4ELTA 5KFUA 2FLPA 3Q22A 3BO4A 2HQCA 1VBXA 2R8KA 4YDXA 3PJWA 5EWGA 2DGOA 4ZVSB 1WF1A 3G8QA 4HTJA 5ITHA 1BWEA 1RKJA 3GR1A 4MK7A 5BJRA 2VBWA 2Z2MA 3PR5B 5DQHA 3N6NA 3T1YF 3VHQA 4FKXA 4UQTA 2HVIA 3R2CJ 3I9V9 1UVMA 2FHJA 2XHCA 1M1KT
chains in the Genus database with same CATH topology
3CCSS 1N54B 2B4VA 4NWBA 1IKWA 2YTCA 2YNFB 5CYQA 4NZ7A 1T3NA 3DLKA 3H5XA 1X4FA 1TL3A 3BO2A 1Z1ZA 5J2QA 2MZTA 1UFWA 2K3IA 2Z2LA 2YWFA 4OX9F 2DBBA 1HI0P 3VAMA 3UPFA 4ZMMA 3MM6B 2PD1A 4MYTA 5IM0B 1GTEA 2C42A 4I6WA 5E0OA 5LXYA 4NA1A 2EW9A 4XIUA 3ENVA 2IMWP 5T14A 5B7WA 4DQSA 2A1BA 2FY1A 1RT3A 3D0GE 3DFEA 1WG5A 3H5UA 5KOXA 5CH7B 4OJ1A 3G6VA 1XEZA 3AJ1A 1Z2ZA 3CIZA 3DRRA 3QZ7A 1EP4B 3TAMA 4ZP7A 3J7YU 2VOOA 1VQ9S 4LF4F 1S9GB 4O3NA 1S6UA 1C2PA 1RT5B 1HFEL 2HVZA 4EZ9A 2B4UA 4ZKAA 1FE0A 2VB6A 3DOMA 4DWIA 1TP7A 4CH7A 1GT8A 4RWWA 2CPXA 3LGMA 2B9YA 1FRIA 2LLZA 2QLWA 2MKSA 2BA9A 4URQU 3TA2A 3QGGA 3DN9A 3W2WB 1WEZA 3DRSB 3R1LA 3K8VA 4X4TA 4ZK7M 1VQ4S 2LA4A 1U6FA 1ZETA 4RUHA 4Q2MA 2AQ4A 2JSXA 2HHQA 5EUHA 3MR5A 1LK5A 1MWYA 3CJKA 3AA9A 3MM7A 4I69A 1D9DA 3M32B 2LYVA 1FJ7A 2OPSA 1H7WA 3FDSA 4AQYF 2HWTA 2I38A 2HW3A 2YX4A 2JRSA 2U1AA 2Y1IA 1WTBA 4ED8A 1S1UA 1KLMA 4XAKA 1HNIB 5IQQA 4R8UA 3WZ0A 4MMOA 4DLEA 2CQ4A 4B02A 2MKCA 1EETB 3M9MB 1OO0B 3IR6B 2MKIA 3T5HA 4ZPWR 1TL5A 2WONB 1X0PA 5KT7A 2CVIA 3GFXA 5B0AA 5LMUF 4WFAQ 4RU9A 3BGUA 2RQKA 3MPWA 5A0YB 2HS4A 4F50A 3OBIA 1VQYA 4OV1A 1UJ4A 4C8ZA 3LH2S 3K5LA 2J76E 4ED1A 2HGLA 4CI0B 3OTDA 5BYSA 4LSNA 1TK0A 4NXNF 4IFYB 1Y3KA 2XCPA 4ZPVR 2KM8B 3POTA 2HHTA 5D4NA 3CMAS 2YKOA 5KFFA 2MDAA 2JZ5A 4FXDA 3DLBA 5GAEI 2ILZA 3SZ2A 1U7LA 1DLOA 2IC3B 3EGZA 1S9FA 2MXYA 5CHCB 4RNMA 4K0KF 2RH3A 4NLGA 2HWHA 4TNOA 4DFMA 4LIWA 4QWDA 4RZRA 2XWXA 2LMIA 3LUYA 4XPEA 4U67Q 4YQWA 2J5AA 3TYTA 3RB4A 4DR3F 1SKWA 4IH6A 4LIRA 5AXLA 1S0MA 1IN0A 4J9PA 2CPZA 2IMOA 3HDSA 2MZJA 4P7TA 1VIOA 2WSFC 2XZWA 3GFZA 5GADI 5D3GA 2JL9A 2IHR1 4N56A 3PX4A 4HDHA 4O44B 3M05A 3SFUA 2X3GA 1SL1A 1HMVB 3T6JA 2C3YA 5DLFA 1FDNA 1U49A 1DARA 1HBUB 3H5YA 1UWBA 4ILMA 4ECTA 4WK3A 5FDLA 1JJ2R 4KIAA 2BDPA 4NCBA 1SBRA 2AGOA 1IJFB 4OHYA 1S6QA 2ZD1B 3TX8A 5B0CA 2X1BA 4DQPA 2LU1A 2OIHA 2XC9A