5C42B

Crystal structure of hiv-1 reverse transcriptase (k101p) variant in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
424
structure length
424
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Potent Inhibitors Active against HIV Reverse Transcriptase with K101P, a Mutation Conferring Rilpivirine Resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 100
structure length 424
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c42B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c42B03
2HNZA 4ED6A 5I42B 3V81A 1U09A 3PJWA 4ZP7A 1EETB 4NCGA 3CJ3A 2R8JA 3BREA 3CO9A 4JV0A 2YNFA 3N6LA 2W7PA 5J2NB 4XPEA 4H4MA 2QE5A 1S0NA 2JEFA 2VG5A 3KNAA 1RT7A 1S1TA 5I42A 4FBTA 1S9EA 2J6UA 2ASDA 3T5HA 3ISNC 1T05A 3Q8PB 5KG0A 4K4XA 3D28A 3H5UA 1JLGA 4RNOA 2I5JB 4MIAA 2W8LA 1XR7A 2CKWA 2IM1A 4TXSA 3OLAA 5DG8A 5L9XA 4Q0BA 2BQRA 4KSEB 3KLHA 2F8EX 1SUQA 3TQ1A 5DQIA 2E9TA 5KT5A 2ASJA 4Q8FA 1S1XB 3MEDB 1HMVB 3FRZA 1LWCB 5HROA 4GC6A 2YNHA 3FSIA 3KHGA 4MKBA 3MR5A 3DRSA 1TVRA 2ZD1B 4FBUA 5KT4A 4WZQA 2WOMB 3V6JA 3QO9B 5KFIA 1RT1A 1C1CA 5F8MA 4EEYA 2FVQA 4TYBA 3CWJA 3C6UB 4K4YA 1JX4A 1BQMA 1TL3B 3BSAA 3LAKA 4F4XA 4XO0A 2FJWA 3FDSA 4NZ0A 2WONB 4RU9A 4ED8A 4J9MA 2B5JA 5KG3A 3H5YA 3KOAA 1RTHB 4I2QB 5KFHA 4ECWA 2UVWA 5KFVA 3TVKA 4Q8EA 2W9AA 3DMJA 4ED0A 2R8HA 4IRDA 1S1WB 2YNGA 4IH5A 3DM2B 4RUAA 1RAJA 4RW4B 3DLEA 3GIIA 1RTHA 4I2QA 5DQHA 4LSLA 4ZVEA 3M8QB 4K4TA 1D1UA 2RKIB 1C0TA 2I1RA 3BJYA 3KLGA 1VRTA 3QZ8A 4DL4A 4LQ9A 2FLNA 2YKNA 3MEGA 2FVSA 2HNYA 1HYSB 3SI8A 1GX6A 3MFHA 4IH7A 1SH0A 2FVPA 5L1LA 4K50A 4GC7A 2VA2A 4NLGA 2W9BB 3IGNA 2C22A 2BRKA 3BR9A 2IJFA 4ZPCA 4DG1A 2BANB 4RW7B 3SFUA 2FLLA 1N6QA 4O3OA 1HNVA 3KLEB 2R8IA 4U6PA 3RBDA 2E9ZA 3H59A 4TQSA 1LW2A 5J2PB 3GIMA 4I7FB 3SFGA 5C25A 3DDKA 4MFBA 2BRLA 2IM2A 3E01A 4RW7A 2WK4A 3IRXA 1RT4A 5EDWA 4ECZA 4JV1A 3IG1B 3KLEA 2RDIA 1DTQA 1S6QB 3BSOA 4G3IA 4F50A 1JLCA 3BQ1A 4NLWA 1KLMA 3H5XA 4K4UA 1HNIB 5J1EA 3V6HA 3QIPA 3NAHA 4XPCA 4Y34A 2XI2A 1S6QA 4G1QA 3H4DA 3BQ2A 3DOKA 4YR2A 4ECUA 1BQNB 1HNIA 3NAIA 3MR2A 2UVUA 4PWDB 3LP2B 3PW2A 1SV5B 1T94A 1S9GB 4O44B 2AU0A 1RTIA 2OPPB 4ZPBA 2B43A 3RBEA 4KFBB 3M8PB 1JKHB 2V0NA 2VG7B 4WYLA 4ECQA 3V4IA 5KFZA 5KFQA 4MK8A 1C2PA 1S9GA 5F9LA 4O44A 5KT2A 3KK3B 3DYAB 1ZTWA 1JLAB 2IAJB 1J5OB 2JEGA 1JLFB 2HAIA 4IRCA 1LWEB 4IDKB 1JXLA 3DLGB 5KFUA 3PJXA 4NLOA 3OL8A 4ZMMA 3EPGA 4TLRA 1QE1B 1JLQA 2WHOA 3DYAA 3ITHB 4R5PB 1J5OA 3GIJA 2WRMA 4KHMA 3LANA 1JLFA 2GIRA 5K14A 5KT7A 1LWEA 5C5JA 2WTFA 3KJVB 2FVCA 3DOLB 2W9CA 2AX1A 3TAMB 4ZP8A 3KHLA 3BSNA 4TN2A 4EBEA 1REVA 4YQWA 2ALZA 2HNZB 1RA7A 1TKTA 4FS1A 3RB6A 2V4RA 5KG7A 3KJVA 2R2SA 3I0SB 2QV6A 1VRUA 3IS9A 4RW8B 1S1VA 2YNFB 4M95A 2VG5B 2GC8A 1RT7B 1S1TB 3QLHB 1S9EB 1S4FA 1UWBA 2ILYA 5F8HA 4ECXA 3N6MA 1T05B 3I0SA 1R0AB 2D7SA 3BGRA 3KHRA 4RW8A 2FLPA 1JLGB 4QWDA 4MH8A 1C1BA 3CDUA 3PZPA 4MK9A 3QLHA 3V6KA 3HVTA 4Q0BB 2R8GA 3HHKA 3KLHB 1R0AA 1SUQB 4ED2A 5FDLB 4ZHRA 4K4ZA 2RF2B 5HROB 2YNHB 2HMIA 2ASLA 4QWCA 5D3GA 3QIDA 1S97A 4I2PB 2YNIA 1TVRB 3DRSB 4NRUA 5HBMA 2OPQB 1LWFA 2D3UA 4M94A 5FDLA 2XWYA 4QW8A 2RF2A 3RB3A 5EWGA 1RT1B 1C1CB 1I6JA 4ID5B 4I2PA 4PQUB 3CJ2A 1TKZB 1OS5A 2OPQA 4O4RA 1BQMB 3KLIA 4X2BA 4IKAA 1FKPB 4EO6A 2OH2A 1IKWB 2B5JB 1GX5A 4H4OB 3G86A 2ILZA 4ID5A 4PQUA 4YR0A 1TKZA 2J6TA 2J6SA 3DMJB 5F8IA 4RW9A 2YNGB 4O3NA 3LAMA 3MF5A 1FKPA 4O3SA 3HVAA 1IKWA 3T5LA 3DLEB 4H4OA 2RDJA 4EYHB 4LSLB 1D0EA 3T5JA 2WCXA 5KFTA 2DPIA 3IN5A 1C0TB 1LW0B 4IFYA 3KLGB 4KBIA 1VRTB 3KK2B 3KMSA 1S9FA 2YKNB 3MEGB 2HNYB 3GILA 4TQRA 5CYMA 3RAXA 2IMWP 5KFCA 1LW0A 4IH6A 2UVVA 2CJQA 2HNDA 3KK2A 4NLQA 5KFXA 5DLFA 4IFVA 5I3UB 1JLEA 5T14A 4RNHA 3NKYA 4DG1B 1JLBA 3QGIA 2R8KA 1RT5A 1N6QB 2HWIA 3MR6A 1HNVB 3PHEA 4R8UA 1TQLA 1LW2B 2OPRA 5HP1A 5I3UA 4NLDA 4QW9A 2AGPA 5C25B 4DL3A 3Q8SB 5L1IA 4MFBB 3MTKA 1Z4UA 3E01B 3NL0A 3IRXB 1RT4B 2VG6A 2XCAA 4NLYA 1DTQB 1JLCB 1KLMB 2D3ZA 4KO0B 3V6DA 2IBKA 4K4SA 5J1EB 1IM4A 3DRRB 3QIPB 3KK1B 4RNMA 3DI6A 3OSNA 1HQUB 5KFKA 5DGAA 3FQKA 4G1QB 3PR5B 3PR4A 3DOKB 5KFMA 4KO0A 1MU2A 4FS2A 4O4GA 3JYTA 4IG3A 3I5BA 2XI3A 4H54A 3DRRA 1RDRA 4DL5A 3KK1A 1DTTA 1RTIB 2IC3B 1C0UB 1HQUA 3LP0A 5JUMA 3V4IB 5DG9A 5DGBA 1HQEB 4O3PA 4NRTA 4YMEA 4IR1A 5EWFA 2AGOA 3T5KA 2JC1A 2IC3A 1C0UA 3I5AA 4F4YA 1FKOB 5J2QB 2E9RX 4KV8A 5KG6A 4NLTA 3FFIA 1XR6A 1HQEA 4KAIA 2IA6A 2BE2A 4K4WA 5KG4A 1JLQB 4PUOA 3LP1B 2XGPA 1FKOA 5L1JA 1N4LA 1IKYA 2FJVA 2WB4A 3QYYA 5J2QA 4J9PA 3PW7A 5K14B 1RYSA 3CDWA 2W9CB 5KG1A 2W7OA 3PVXA 3QGHA 1T03B 3BSCA 4KHRA 3LP1A 4IOBA 1REVB 2V4QA 5C42A 4J9OA 1TKTB 4J9KA 5KFOA 5KFDA 2YKMB 1TP7A 2W8KA 1KHWA 1VRUB 3IS9B 3EPIA 1QAIA 1S1VB 4OL8A 1T03A 4JUZA 1T3NA 3H5SA 4NLUA 2UUWA 3PW5A 4ZVGA 1QUVA 4TY9A 3KLVA 1S49A 1W25A 4KKOA 1N5YB 2EC0A 1WNEA 1UWBB 4Y3CA 4ZP9A 3FQLA 5KFYA 2YKMA 4JV2A 3BGRB 4TY8A 3RAQA 4Q43A 4ECVA 1C1BB 1FK9B 2JC0A 3Q8QB 3C6TA 3I0RA 1CSJA 4LSNA 1IKXB 1N5YA 3LALA 1EP4B 3HVTB 3MECB 4B3OB 4WFXA 1ZETA 1S10A 3NMAA 4Y2CA 5DLGA 4ZHRB 2C2EA 4QWEA 5DQGA 1FK9A 4MKAA 4URGA 3M9NB 2UUTA 2HMIB 5HLFA 1IKXA 1RT2B 4QWBA 5D3GB 1EP4A 2OPSA 2YNIB 3MECA 4B3OA 3RB0A 3M9MB 5HBMB 4ED3A 4DL6A 1LWFB 4J9SA 2B6AB 4DL2A 4F4ZA 4ED7A 3T1AA 4Q44A 3G6VA 3MFIA 4YP3A 2XGQA 1RT2A 5F8LA 1IKVA 1NHVA 1HARA 2B6AA 3Q8RB 3DRPA 3KLIB 1K1QA 2FVRA 5KFAA 2IM3A 4MIBA 3NBPA 1XR5A 3D5MA 4R0EA 1RTDA 5KG5A 2BR0A 4RW9B 4ZVHA 5KFRA 3OSPA 2AQ4A 4ECYA 4IQXA 1NHUA 3GIKA 1EETA 4J9NA 4F4WA 3PW4A 5JXSA 5J2NA 5KFSA 4RNNA 4IFYB 5KFBA 1RT6B 1S0OA 3OHAA 1DLOB 5CYQB 5KFPA 2I5JA 5CYMB 3N6NA 4IG0B 3CDEA 5KFWA 3H4BA 2HNDB 1RT6A 1ZTTA 4WFZA 5KFEA 2JLEA 5F9NA 3OLBA 4IFVB 1DLOA 1JLEB 5CYQA 1S1XA 3MEDA 4DEZA 1HMVA 1JLBB 1LWCA 3E51A 1RT5B 5C24B 1TL1B 4IG0A 1MMLA 5KG2A 2XC9A 4NYZA 1N56A 4J9RA 2ZD1A 4R8UB 2BQUA 2OPRB 5HP1B 2AX0A 2WOMA 3GV8B 3QO9A 2AWZA 5KFJA 5KFGA 4ECSA 5C24A 4K4VA 1TL1A 2VG6B 3HVWA 3MR3A 3OHBA 1QAJA 4HYKA 3C6UA 3CJ5A 1RTJB 1TL3A 3V6DB 1KHVA 2WONA 3RB4A 1SH2A 2HWHA 3DI6B 3G6XA 3T19A 4IR9A 3H2LA 2C2DA 4HKQA 4NLVA 3H98A 1MU2B 1RTJA 4O4GB 3JYTB 4IG3B 3EZUA 1S1WA 4WFYA 3OL7A 3DM2A 5EWEA 4ECTA 4ED1A 4KB7A 4RW4A 1DTTB 3QGGA 3LP0B 3GV7B 2XCPA 3CVKA 1TKXB 5EUHA 3M8QA 5L1KA 2RKIA 3MEEB 4EBCA 5DG7A 4ZPAA 1HYSA 1TKXA 1SH3A 4ICLB 4KV8B 2VA3A 4KE5A 4QPXA 3FFIB 3MEEA 2V9WA 4WE1B 2W9BA 4ZVFA 2R2TA 2BE2B 4WYWA 1S6PB 4RZRA 3VQSA 5KT6A 4PUOB 3ICLA 3IGVA 3GV5B 4J9QA 1IKYB 2BANA 4ICLA 4J9LA 2UVRA 4NLPA 2IJNA 3JSMB 4WE1A 4IRKA 1S1UB 1HPZB 4RNFA 1S6PA 5J2MB 2O5DA 5J2PA 1RYRA 4I7FA 3UPFA 5C42B 2JEJA 2R2UA 5KFLA 5KFFA 3GYNA 3JSMA 3IG1A 4DL7A 1S1UA 3CJ0A 1HPZA 3KLFB 3PW0A 5J2MA 5KT3A 4ZP6A 3UQSA 1K1SA 4KKOB 4URSA 5F8NA 4Y2AA 3M9OB 3KLFA 2R2RA 3I5CA 4TY8B 1NNDA 4ZPDA 4Q45A 2JEIA 1BQNA 4EO8A 2D41A 1TV6B 3C6TB 3I0RB 4NLRA 1N48A 4LSNB 4PWDA 2ZE2B 3LP2A 4WXOA 4RUCA 1SV5A 2ATLA 3GQCA 2OPPA 4ECRA 2FJXA 3G6YA 1S0MA 4EBDA 4KFBA 3M8PA 1JKHA 1RT3B 2VG7A 4LQ3A 4WZMA 1YVFA 4RW6B 3CJ4A 4O3RA 1TV6A 3DLKB 5HLFB 2ZE2A 4U7CA 5F8GA 3ISND 2OPSB 4O3QA 1RA6A 2C2RA 3KK3A 1JLAA 2IAJA 4NLXA 4YR3A 2C28A 3OL9A 1RT3A 2ZKUA 4WXWA 3KHHA 4TYAA 4IDKA 4RW6A 4NLSA 2BQ3A 3DLKA 2DPJA 3DLGA 3BQ0A 4MK7A 1IKVB 2IM0A 2AGQA 4URQU 3HKWA 3CIZA 1QE1A 3ITHA 4R5PA 5KFNA 3H40A 3NGDA 3DRPB 3V81B 4EYIB 3UR0A 3OL6A 3DOLA 4NCGB 3UDLA 2GIQA 4QWAA 5F8JA 3TAMA 3NBPB 3QZ7A 3KMQA 1S48A 1RTDB 4H4MB 1JIHA
chains in the Genus database with same CATH superfamily
1HFEL 1H72C 2LA4A 5I42A 5K8NA 4CT8A 3OW2R 3FCVA 4TNOA 1HMVB 1LWCB 2K2PA 4V19X 3MR5A 3WIUA 3QO9B 1FDBA 5F8MA 3PYGA 5DO2A 4PXDA 1FXRA 1YWXA 2XULA 3MCOA 2BXJA 1QY7A 3OXFA 4ED0A 5F41A 5DQHA 2PT0A 1OSCA 2XNRA 3TNVA 3MFHA 4DR1J 2UZAA 1Q0NA 1H2TZ 1WSRA 2GMHA 3MMJA 3R5JB 1HD0A 2Z2MA 2DXEA 5G4DA 2IM2A 2PFDA 2UUBJ 4B3TF 4CT9A 5A6WA 4E98A 1T9TA 1XQIA 2BZ2A 3H5XA 1HHQA 5AJ3J 4Y2MA 4OIXA 3PG9A 4DQSA 2RMLA 4QYRA 3DOKA 1YJ9S 1S9GB 1DY3A 1FRLA 2J8AA 3H8YA 2YQ1A 3KK3B 3OFFA 2HAIA 5LT5A 3DLBA 3NP5A 3OL8A 3WIVA 3T1HJ 3GFYA 4EK2A 2AX1A 4FZVA 2DNKA 2EC2A 2L9NA 3W3SA 2GO9A 3B4MA 1WC4A 3D4JA 3J80Y 1UWBA 4QOTA 1R0AB 3HHDA 1DZ5A 3K58A 2ERRA 3CDUA 4DR5J 2H9ZA 2EBGA 3DDNA 4M5KA 4DFJA 4HT7A 1PAEX 2VFTA 4EGLA 1SL2A 5FDLA 4OI3A 4W4MA 4OV1A 4RBTA 3CW2C 3ZZUA 1WACA 2NPFA 7FDRA 1DBDA 2F4FA 2RQ4A 1G7CB 3Q83A 5DM7Q 3POTA 3UVJB 1PBUA 5F8IA 4RW9A 2YNGB 4IOAQ 4B3RJ 4P6QA 3KG1A 1D0EA 1VQ6S 2RRAA 1NO8A 3EVMA 4P74A 1W7WA 2J9DA 4OZ1A 2AYBA 2IMWP 4ZPWR 1EQMA 5CH7B 1GMUA 2UVVA 5B0CA 1KRPA 2CWXA 3ZNJ1 4HHHA 2C3UA 1TFYA 3WC0A 4ZKAA 1UAWA 1N36F 1L3SA 3HM9A 4IR1A 2JC1A 2HBRB 1U4BA 1SBRA 4UQTA 3ELHA 1H2VZ 3LP1A 4WP8A 4PKDB 2RUGA 2EI5A 1S1VB 1T3NA 1HBUB 1QUVA 2F4VJ 1W25A 1HR0F 2DY9A 3RRGA 3VAFA 5JVGQ 1C1BB 3OVAA 3NMAA 4X4RA 2FHJD 3MECA 2UXCJ 4Q44A 4YP3A 1XC9A 2ZBIA 2UUAF 1R7IA 3QT6A 1UEKA 5CABA 3OSPA 4ECYA 3W66A 5A8KA 4DV5F 3VGVA 2KI2A 1IR0A 2KHDA 4HLBA 1H74A 1HA1A 2LEBA 2KN4A 2Z58B 1MMLA 4FKXA 1IBLF 5B0FA 2NQPA 3BO2A 3CD7A 2ZHAA 4HYKA 4U96A 2WONA 2C2OB 3MXHP 2OD4A 4WFYA 4O4GB 3L7UA 1S1WA 2JJ4D 1Q8LA 2Z0GA 2XCPA 2G0JA 3KTQA 1HLWA 3DOMA 4KV8B 3FFIB 1S6PB 4NEZA 1PCAA 4USHA 4J9LA 4P10A 1SIWB 2N3OA 2DGQA 3CJQA 4LF1A 1RYRA 4I7FA 2W4PA 3JSMA 2VKZG 5H1SV 4PG7A 4B3MJ 3C8YA 1ITPA 3CCQS 2ZE2B 4OYXA 5LSLA 4BWMA 2VG7A 1YVFA 3CJ4A 5HLFB 1FXDA 3N0VA 4DR4J 1GQEA 2BQ3A 4RW6A 2CG8A 3FZBA 3HX9A 2DIUA 3CJKA 3H42A 2EK6A 3N9UC 1S48A 1RTDB 1JIHA 4ED6A 4HACA 2F8HA 1PSDA 4OZ0A 2W7PA 2OEKA 3Q8PB 2QRRA 1CEZA 1P1TA 3RU0A 2VBZA 1TKDA 2KRBA 3L4BC 4KSEB 5DQIA 2FHMA 4CO1A 2YWWA 2DH9A 4TU9A 1WOSA 3N28A 3V5RA 1I1GA 5FJ4A 4EEYA 3C15B 2Y3YA 5IM0B 1TL3B 5KG3A 2Q6BA 2JLFA 1FDNA 3GZ7A 5HMZA 1OY8A 1HBMA 3OUYA 3SI8A 2DBBA 5HMXA 3WZ0A 3QFHA 2BJ8A 2B4PA 3HHEA 4X4VA 4O3OA 1F9EB 5IS2A 2QFJA 2VH7A 5C25A 1F1BB 4JV1A 5EDWA 3IRXA 5IWAF 2DISA 4G3IA 2OSRA 3H2VE 4N77A 5J1EA 4Y34A 4V19J 4ERDA 1YBUA 2KVIA 2P9GA 2VFVA 2QLXA 4PWDB 4L6V3 2AYEA 4DS5A 3M8PB 1WHVA 4QYZK 4W92B 1VIOA 4QIEA 4PYAA 4JB8B 2IAJB 4KH1B 3RAMA 4PPDA 4AUKA 2RB7A 4TLRA 1Y4ZB 5K14A 1M5KC 2CQ4A 2J0QD 1VRUA 2ZH4A 3O5TB 1J2VA 4M5DA 2CAJA 3O1LA 2EKNA 4GKJF 1XIQA 2HIQA 1F5BA 1SJRA 2GVDB 4WKRA 4OYAA 3RR8A 1VJQA 5CAAA 4M5MA 1CG2A 2XMMA 3MWBA 4XK8C 1BD6A 1LV5A 3ZC4A 3ILIA 4LREA 2ATCB 1WEYA 2RDJA 3S6EA 3T5JA 2E5IA 3IN5A 1VQ4S 3I9ZA 3MEGB 4JOUA 1HI1A 1SJ3P 4C0HA 4K7QA 4RNHA 4NLDA 2OPRA 3HCXA 4E2FB 4F67A 5LMNJ 3E01B 1RT4B 2IRUA 3TYTA 1RWVB 3VVUA 2KB2A 2XZWA 5H9EJ 1T9XA 5DGAA 4YEAA 2ZVSA 2Y1LB 3PR4A 2AT1B 1U48A 2XI3A 4DV7F 3M6VA 5D8HB 1C0UB 3RR7A 3SMZA 4JV5J 4EZ9A 1FKOB 2BYCA 3D0IE 3AXMA 2E5HA 5KG4A 4FYWB 1M5OC 3PVXA 4IOBA 4DFPA 2QN6B 4DSKA 1N54B 3T1YF 4OLOA 4TY8A 3RAQA 5IXUA 1ULRA 1TZ0A 2CJ9A 2MKKA 1RAOA 4ED7A 1UCNA 2QA4G 3OD2A 2FJEB 2E5JA 1JJ2R 2DJWA 3MMAA 4YY3F 2V4JB 9ATCB 1F9HA 1NEEA 3QBCA 1AFJA 1SQFA 1YIJS 3GCXP 2A6MA 4WPAA 5JXSA 3TAQA 2FLOA 1S0OA 1DLOB 2HURA 3F56A 4WFZA 2PSZA 1JLEB 5BYSA 4A8KA 1YRUA 1AROP 3TR5A 1YG0A 1RABB 1GMWD 1UKUA 1YRXA 2ZM6F 3FEXB 3V6DB 1LFPA 1VFJA 1KHVA 1ZAXA 1SH2A 2RKIA 4USIA 3NGRA 4DQQA 4BBYA 2Z30B 4KE5A 3MEEA 1VJWA 3BH7B 3VR1A 3NEKA 3GV5B 3CJTA 4RNFA 4DV2J 5E41A 2FHJA 2GJ2A 3U1NA 2LECA 2R7UA 3BBFA 4LF8F 3I5CA 3LPEA 1BQNA 3LPYA 2D3OR 2HHQA 4ECRA 4KFBA 3JSBA 2FGCA 2DCUB 4I6YA 4P72A 3OTCA 5BR8F 2PI5A 2OPSB 3W8PA 3L95X 4YR3A 2DPJA 3DLGA 2G1DA 4Y2KA 2AGQA 1QE1A 3UN3A 3ETMA 2OHDA 3BN4A 2N7YA 5L9XA 2Z2LA 4E0DA 3HSJA 2R8JA 1NDCA 3VZHA 4OX9J 2GMJA 4FBTA 3I4HX 2J6UA 3BN7A 2B4UA 2BE9B 4NMLA 2NREA 1QSLA 3JAMY 2WW8A 1P8GA 2BQRA 3UDEA 3HMJG 1TVRA 2IYGA 3CDAA 3V6JA 1KS2A 5B08A 1BQMA 2Q1LA 2XO7A 4JI6F 3ILJA 3KDNA 3IA0A 2MQOA 2YKPA 4IH5A 3DLEA 4ZVEA 3N01A 1BY9A 1D1UA 2KFZA 1WC1A 4RWXA 2FVSA 1U2FA 2ZH1A 2Q43A 2H4WB 1K0TA 1CJTA 1Q1KA 2AW0A 3T6BA 2NR0A 4LVOP 3DGPA 4RX6A 2FD2A 1NPKA 1P27B 3G96A 4NPOA 5AE3A 1BE4A 2QMWA 2V8GA 3PJ9A 2GW8A 5HJYA 1RP5A 3MOJB 2OEJA 3B4DA 1IXKA 5CD4H 3QT8A 4ZPBA 2B43A 5F9LA 4A8XA 4CLTA 3CCUS 1JNZB 3DHXA 4B02A 4C8OA 1YKWA 3QWUA 2HNZB 2R2SA 3SDEB 2VQFF 5MAOA 1Q78A 3M7VA 2CG4A 3BO3A 3C66A 3EZ5A 1YBTA 3HHKA 3FSYA 3HSZA 3AJ2A 4K4ZA 1CJVB 1IBKF 2VFSA 4ETZA 1WTFA 1RKIA 5AXLA 2BABA 3AT1B 3GG1A 1S57A 3A3PB 2J6TA 1NSKL 4O3NA 4IOCQ 4UQGA 4N5SA 4LSLB 2OMLA 4LBHA 2FC8A 4BC7A 1NSAA 1NJYA 4IFVA 3UDVA 3PEHA 1JLBA 4EI2A 3THVA 1RT5A 1D3WA 3D3BJ 1VQOS 2DNHA 2BJ1A 4JI4F 3NMRA 4MYTA 3TWZA 2ADCA 2BMBA 1TUVA 2J7UA 2K7JA 4H54A 2XLIA 3LP0A 5IZHA 1NKBA 3D68A 4BHQA 3I55S 5E3QA 2KKHA 3GSIA 2R7XA 3OJUA 2PMHA 4PUOA 1VLOA 4YHHJ 1OYEA 1YZ6A 2CQPA 3QGHA 5HMWA 1REVB 1Q5VA 1S4EA 1HW9A 2ZC4A 5KFDA 3EPIA 2B3TB 4PCQA 1M0SA 3D1QA 4OZ2A 2LYVA 4ES2A 2V69A 1UA1A 2QSFA 2YPZA 1EP4B 1ZETA 5IFMA 3HKZD 4MKAA 2UUTA 3DHWC 1X9WA 1EARA 4JI2J 3R9LA 1FX2A 1PJ7A 1O51A 2MZ1A 5KFAA 3F44A 5KFRA 3VAGA 4KR0B 1TMMA 2GS8A 1K73T 3J81Y 1RT6B 1W2BR 2I8EA 2HGMA 4DR2F 4RJVA 1HQ2A 2OELA 4KIAA 2MSTA 1TL1B 4NYZA 3BV8A 2CRLA 2BKPA 3GV8B 2AWZA 1ZZNA 4CLZA 3LW5C 4ES1A 3RB4A 4TVAB 4HKQA 2QFIA 3IR7B 2OO4A 4C7QA 1NSQA 3R5DA 4ZPVR 1U6FA 4CLKA 3VCDA 1OYDA 1U25A 4DU8A 2IYIA 5KT6A 1RBLA 1S1UB 3M2RA 1FJGF 3RBZA 2XYHB 4Y6IA 2QC3A 3AY0A 2ZJQQ 4JI7F 4Y2AA 1GXUA 1KR4A 1TV6B 1VDHA 2MZTA 3W60A 3NCPA 2ATLA 4QIVA 2VQEJ 3DLKB 5CCMA 2EPIA 5ETQA 2XBPA 1UETA 3PXGa 3RRKA 3W9HA 3PX4A 3DRPB 4LIRA 2WVFA 4AT1B 5KOXA 4C8YA 5HVHA 4KT0C 5I42B 1U09A 2J7KA 4ZDNA 4ZJQA 3IFEA 1GMWA 1T05A 5KG0A 4RNOA 4TXSA 2C2ZB 3AOBA 4JBCA 3CDBA 3KLHA 1SC6A 2D9PA 1FNXH 3T9NA 3A1YG 4Q8FA 1UFLA 1RAFB 3M6WA 2HHVA 3P6YC 3K8VA 1SQEA 3FZ2A 2JFDA 3QWPA 2YX4A 1AYEA 4C8KA 4Y00A 2EFNA 1JX4A 2B0GA 4KQZA 1YJTA 3H5YA 4CTAA 1SJ4P 4DUZJ 1RB0A 4RUAA 2BOAA 3HT0A 4PG4A 4LF9F 3M8QB 1C0TA 2I1RA 4DV4F 1VRTA 4A8FA 4YDDB 1T0TV 4ZLNA 3OPKA 2XMJA 4UT4A 4AFFA 1VLYA 1TL7B 2BANB 4JI8F 2E1RA 5J2PB 3KUGA 3MGJA 2UUCF 4FF2A 4MFBA 2I2YA 2AYGA 4K4UA 2V67A 3QIPA 3TI0A 1NH7A 2AYMA 2HQFA 4PYDA 4WIQA 3BO4A 2DHXA 3G8QA 1WKLA 3VAJA 4NOHA 3GIJA 1D09B 3DOLB 4ZVPB 5H9EK 3VAKA 4TN2A 4FS1A 2VOOA 3M4XA 1RT7B 1OO0B 1WD6A 4RLEA 4MH8A 1FE0A 5BR8J 3HVTA 1CBKA 4OLPA 3SQGB 5FDLB 2MMYA 1TK8A 1PC4A 1R8CA 2MLXA 4JI0J 2YNIA 4NRUA 1X8DA 4X65F 3AFGA 5GAEI 2QEXS 2XS5A 4MTPA 1U1OA 2EBEA 2XO6A 3R97A 3EGZA 1IKWA 4RR5A 5D0HA 5BXIA 1MNEA 3PRBA 1WC0A 2HNYB 1L3UA 1XNQF 2RILA 4KJIA 4NLQA 4DL0C 3K2YA 2KH9A 4DG1B 1WELA 3WDOA 5HANA 2RSQA 4WTYA 1LW2B 3FBBA 1SKRA 3ZZ0A 4OMFG 1Q95G 2IBKA 2UV8G 3M8WA 4G6VB 1C4CA 1F0XA 2CPYA 2HHHF 2YKQA 1UTAA 2W2PP 1TAUA 2QYGA 4F4YA 2DIVA 2GGPB 1R6VA 4LT6A 3QNWB 1PGZA 1ZA2B 3LP1B 2KM8B 5KG1A 3UO0A 2HRYA 3BSCA 1U0SA 4F3QA 4J9KA 4JI3F 3TJAA 3E2EA 4C48A 2NZ4A 3MI7X 4F36A 3CSKA 3C6TA 2CJYB 3MECB 4QWEA 4K0KJ 2UXDJ 2HAFA 2LDYA 4B3OA 4DX7A 3M9MB 2H5IB 2DO0A 3MPYA 1KTVA 2B6AA 2DNRA 1N5TA 2AHOB 2BR0A 4FF1A 2MZQA 4DX6A 2VDIA 3AJ1A 3GIKA 2HLTA 4RNNA 3W62A 2HHWA 4BWJA 5KFEA 4WJBA 5EGYA 5D4LA 1HMVA 1LWCA 1WWHA 3D6HB 3QO9A 1KVKA 4K4VA 4P71A 3US5A 4A8SA 3MR7A 3TARA 4AQYF 4W98A 3RRHA 3T19A 1X60A 3TW0A 4DSLA 4ECZA 3JYTB 3G87A 3OL7A 4ECTA 3DOMB 3UD4P 3ZZOA 1FDDA 3GV7B 3EXYA 1Z1ZA 1WF1A 4U7UD 5DG7A 3GMGA 2DB1A 1VQ9S 4OV6A 3VQSA 1IKYB 4D3GA 4ITSA 3GWCA 3TOQA 3JSMB 1D8YA 3Q2TC 3DLJA 3BZQA 3SCIE 3TUZC 1RWKB 1R27B 1WDTA 3UQSA 1IR1A 4ZPDA 4CLWA 4LSNB 4RUCA 3CNQP 3TVYA 3X3UA 1ROFA 1IM6A 4RW6B 3NWGA 3ISND 3KK3A 1NDPA 1T9UA 2C28A 4URQU 3MUTP 2QA1A 4EYIB 4DJBA 4LFCJ 4HACB 4DR7F 3H5SA 1IWAA 1A6LA 4JV0A 2KJVA 2CQ1A 1Z2LA 3T5HA 3HFVA 2EWHA 3OLAA 3ISZA 1Q79A 1TFWA 2ACMA 3NGTA 2M4MA 2V34A 5B0DA 4KPCA 3GB0A 1D9AA 1U6BA 4TYBA 4CRJA 2PEBA 3LAKA 3J7Z5 4RU9A 2EW9A 1G2EA 1HBMB 1FJ7A 5KFHA 3M8ZA 3UVJA 4X4PA 1ZM3A 3KJFB 2YNGA 2YKAA 1FCAA 3PYDA 2DXFA 3J7ZT 3GJQB 1NJIT 2HPUA 3QZ8A 4DR3J 4ZVUB 1HYSB 3HI9A 2LU2A 2QYCA 4AD6A 3IGNA 3TA0A 1U26A 3IO1A 3VAMA 5E33A 1VMBA 5ETLA 4RW7A 2WK4A 5GAGU 1ZM4A 1Q86T 3SSSA 2XI2A 4ZVRB 2E5LJ 4K5RA 3KYLA 5THWA 2LXFA 2WB1D 3R1HA 2I6WA 2VOPA 2FZKB 4MAKA 1J5EJ 2YVSA 4IDKB 1OMSA 2M8HA 1HNXJ 4IYQA 3PEJA 1V3SA 4J9UE 4L74A 5C2CA 1FJGJ 1VQPS 3V2UC 5LSOA 1FRXA 3MDFA 2CJXB 1U1KA 1S1VA 4DX5A 1JJ4A 4TU8A 1U47A 1HBUA 3O2IA 3D6TB 1M5SA 3ZZRA 2JNJA 1C1BA 4NXMJ 1PYOB 2DHSA 4ED2A 2P9CA 3QSIA 3TJ8A 4X4UA 4FYDA 2D3UA 1XERA 2V2ZA 2RF2A 3RB3A 1SC3B 1IBMF 1OY6A 3CJ2A 2OPQA 4IKAA 3GR0A 2ILZA 1KD1T 2YPYA 4F0KA 1FO1A 1QAXA 4O3SA 2W25A 2FZGB 1SKWA 1RU2A 3FEYB 3HD2A 4KRWA 4IQMA 3DLLQ 2PMZD 1QVFR 4LF7F 3H90A 4YUDA 1TQLA 1HNZF 1DTQB 3IP0A 4A8QA 2D3ZA 4K4SA 3HHNB 2DGXA 2B9XA 5KFKA 2NCKL 4KO0A 4LF9J 4O4GA 2MSSA 2Z8QA 2MKCA 4F2SA 4O3PA 4M5JA 3R7SB 3T5KA 3I5AA 5A0YA 4KV8A 4N47A 3FFIA 1VYAA 2QO3A 3SCLE 3P8BB 2VJVA 4Q2MA 1PJ6A 3D1OA 3PW7A 2JHEA 4ES3A 3QMQA 2W7OA 1NM2A 2ZHBA 4N76A 2UXBJ 4FYVB 4HI2A 1QAIA 1T03A 3Q8QB 1LXNA 1N5YA 1NU4A 2CJAA 4HL9A 5K8MA 2MEWA 2L3MA 3L7OA 3V4MA 5HLFA 1IKXA 4U9RA 4J9SA 3WHIA 3MUMP 3JSRA 1UZHA 1VQ5S 2QX0A 2YBVA 2G2YA 3LUYA 5IT9U 1EJ7L 2Z2YB 3IBWA 1UW9A 3DXBA 2GQQA 3Q2SC 3D5MA 1RTDA 2DR6A 4RUBA 3MCMA 1EB0A 4KH0B 4F4WA 3D0GE 3HJFA 3P45B 3PDNA 1HWLA 1Q5YA 4OX6A 2VPZB 4P2MA 2JLEA 1N56A 2VG6B 3KUHA 3ENQA 3C15A 5IM0A 1TL3A 3UW1A 1Q4RA 1RTJA 3KDOA 5DJBA 1R31A 4AE5A 4ED1A 3TUIC 1QTMA 1Y3JA 3MEEB 2XLKA 4ZPAA 2GAHC 3IMQJ 2NXJA 4KGXB 1UVNA 4QPXA 5L46A 3ICLA 5CHCB 4ICLA 1LEOA 2EFOA 4DQIA 4ZJOA 2PGCA 1L3KA 4KKOB 4NWBA 3M9OB 1FRIA 1HHTP 4PWDA 3M8PA 2P6SA 3TRGA 1N33J 4U7CA 1EKRA 2IAJA 4DV0J 4UUWA 1ZH5A 4TYAA 2IM0A 4ANCA 3CIZA 2AEMA 4C8LA 4OI4A 3CMAS 2Y1RI 2XWXA 3X1LB 1NK5A 2K1RB 1GTHA 2QE5A 5AXKA 1AZSB 1UVLA 4DMZA 2ZH5A 1RE1B 2NS1B 2GVDA 3FSIA 4DX8H 2ZD1B 3QT7A 1WG1A 3TA2A 3EYZA 3FK4A 1REGX 1NLKL 4ECWA 3EVOA 4IRDA 4CO3A 3GIIA 5CZVA 1JK9B 4B17A 2FLNA 3MEGA 4IH7A 5DS7A 4K8RA 3BDPA 3H0PA 1JB0C 5C7PA 5HQ8A 3ZTOA 2CXEA 4GRSA 4P52A 4PG5A 2FLLA 2CNNB 2R8IA 2GAGC 4A8YA 3E01A 1RT4A 3KLEA 2HZVA 1T9VA 2OLWA 4C3MA 3N79A 3BQ2A 3PFEA 2K3IA 5LL6d 2AU0A 2SXLA 3D0HE 1JKHB 4WYLA 2BJDA 5FLXY 4MK8A 1M1GA 2HFVA 3DYAA 2V5HG 3K5MA 2WTFA 2ZH9A 4FKYA 4X4TA 5KG7A 1GK8A 2YNFB 3MTJA 1FEEA 3KHRA 2EXUA 3FBFA 4UUXA 1Y10A 3M30B 2XY6A 3OBIA 2FJBB 4ZA1A 1F3FA 2XWYA 4C11B 2FY1A 2O66A 3DKDA 3CXCR 5IQQA 3CCZA 4O4RA 2NPIA 3EX7B 4EO6A 2XTJP 2KT5A 3MMBB 1NK0A 4QR0A 4PR6A 1ZPWX 1NDKA 3JQKA 4DR1F 4DV6J 2Y8YA 2GFFA 1PJ5A 4NZ7A 4BS2A 1YJWS 1JLEA 1Q8BA 2MY7A 4D3HA 5I3UA 2VU5A 2FTRA 3NL0A 2UUBF 3WX8A 3MPDA 1T02A 2XCAA 1UPMB 4GVLA 2MZSA 1FERA 3W7BA 3V6DA 3BBBA 5AJ3F 2MZRA 4Q2LA 3LQVA 2IHR1 1QDUB 1KQGB 2ROGA 4DL5A 3HVRA 3W5YA 1HQUA 2MHNA 4F2RA 2G0CA 1PG5B 2MQMA 1FNOA 2Z56B 3UR3C 4CM0A 1FRKA 2RNEA 1DQAA 1JNRB 2KZZA 3R1LA 3T1HF 2V50A 2HWTA 2F3JA 1IJFB 1VGYA 4M5NA 3SZ2A 4TY9A 1VC5A 1UPPA 1AUDA 4ZP9A 2LQJA 5KFYA 4USUA 4DR5F 2GIFA 2C2EA 2NXCA 2J76E 1WEZA 2DHGA 2OPSA 4PXCA 4DL2A 4L3NA 1CS4B 1NB2A 1WKKA 1NAQA 4DPWA 2AJ0A 1BGXT 3SCJE 2GJIA 2VPYB 2MQPA 1VQLS 1X5SA 4ZVHA 2AQ4A 4B3RF 3PW4A 2XB2D 2LDIA 2VKRA 4LRDA 5CZXA 5I3PA 4DUYF 2BJ7A 2Z4PA 3O8WA 5KG2A 1RJJA 2E29A 4UZCA 2ZBCA 3JB9k 3M6UA 1KDNA 3SCKE 3BGOP 1KOHA 3G8SA 2HVHA 2ZWOA 5FLXU 3AODA 3C16B 4LF6J 4ZIVA 4XAKA 1RBOB 1DQ8A 2G4BA 2YWFA 2ADBA 3UCGA 1B0TA 1M5VC 2CQIA 2J0WA 3NGKA 3CEDA 3SV4A 1UZDA 4PXEA 2ZVIA 2BV3A 5A8RB 2E44A 2R2UA 1Y3KA 1IN0A 4DN9A 3W8GA 2MKIA 2F4VF 3CD5A 1NNDA 1N48A 3PIOQ 3MAQA 1NZAA 4J91A 4NZ6A 4O3RA 5F0UA 3ZTRA 2C2RA 2X1AA 2CPEA 1FFSB 2LU1A 2VPXB 3ZZTA 1X5TA 3BQ0A 3ZNUA 3G8TA 2HVZA 1XJWB 3GONA 3OR2B 4B9VA 3QZ7A 3VTIA 1HI0P 2XGQA 2HNZA 2OUGA 5L39A 3PY8A 4CNZA 2L9DA 3SDEA 3VAHA 1S0NA 4JI1J 3PNIA 2F40A 4PPZA 1CVJA 2PI4A 4JI5J 5KT5A 4GVBB 1CJVA 4BCAA 4ZVQB 2ZKTA 3GJTB 2H54B 3W9JA 1Q53A 4XTTA 4F7VA 4CDIA 1FRHA 3CIMA 1CC7A 3VZIA 4XO0A 3VVTA 5GADI 3AA8A 4OQJA 5HN0A 4LSLA 4CI0B 3M2UB 4C8ZA 1RAIB 3E8OA 1SB6A 2CQCA 1VCTA 2HBQB 5HVGA 2HFOA 2VA2A 3UNYA 2C22A 3MM8A 2CQGA 4DN0A 3AJDA 3RBDA 2XNQA 3BPSP 1UJ4A 2DEIA 4NLWA 3CCES 3GCWP 4B3MF 2IVMA 2VF3A 3PW2A 2OPPB 4X4OA 3I9V9 4ECQA 3PRVA 4DR4F 4O0NA 4K2XA 2HGNA 3LANA 1JLFA 3G9CA 4Q7AA 1REVA 4HVZA 2V4RA 1X4GA 3KJVA 5CQGA 2QV6A 1JQGA 4FNIA 4LJMA 2AKWB 2OP5A 2K7KA 4KC5A 2A18A 1S9EB 2D7SA 1N52B 2M8DB 2LVWA 1WG4A 3GP9A 1SUQB 4DSFA 1K44A 2BA9A 1ZOTA 3K5NA 2DY1A 3CF5Q 2BACA 2OSQA 3HD1A 2YWHA 2Y9HA 4DQPA 1IKWB 3TVZA 3ENVA 3DMJB 4DLGA 3LAMA 2QL9B 1KBRA 5EX3A 5KFTA 2XS2A 4KBIA 3UCUP 3W61A 2YKNB 1HBOB 1M90T 5JMNA 2EG1A 2HS4A 1XMOJ 1NK4A 3W2WA 3MD3A 3AH6A 1HNWJ 3MR6A 3MTKA 2VIHA 1TL5A 3OTOJ 3MPUB 2AEJA 1SQGA 5J1NA 4OJ3A 1SC4B 1NK8A 1JWWA 1RAEB 4F4AA 3EMTA 1RKJA 1MWQA 2GMLA 2DT9A 3BKUA 3HZGA 4HDGA 1CQMA 1RWOB 4PAAA 3TQ1A 2WB4A 2CNOB 2WVDA 3CDWA 3LGHA 1YJRA 4J9OA 4WBFA 2VPWB 2PDAA 1XEZA 4ZVTB 3IM9A 1RLCL 4ZVGA 1S49A 5EX0A 5HO4A 4CZCA 2P8IA 1T9YA 4B3OB 1S10A 3U1LA 5DLGA 5DQGA 1KQFB 2HMIB 3M8SA 2IRYA 4ED3A 2V2QA 3CCVS 1XNRJ 2B6AB 4F4ZA 4OX7A 2I38A 1FRJA 4KGKA 2DH7A 2GVZB 3GE9A 1NHVA 3TZXA 3PX6A 4DCPB 2F7VA 3DRPA 1KEKA 2IM3A 3B6BA 3G2XA 4OZ3A 4WK3A 4YFUA 2NUHA 3EVWA 3H7HB 1FE4A 2PA8D 5KFBA 1U1NA 4KGVB 1B0VA 5CYMB 3PX0A 2CWKA 3RW6A 5KFWA 4A8OA 3W5ZA 2M7SA 3NG8A 4FPIA 5HP1B 4PZVA 2QLBB 5LMNF 2RU9A 1NZ8A 2EKYA 3P5BP 2R9LA 5E0OA 4KY3A 1QVGR 3CCWA 3DI6B 1XTZA 3R7NB 4UZBA 4EWTA 1M1KT 4IG3B 3EE3A 3ADAC 4FVCA 3M8QA 2VC1A 1JJCB 4JV5F 4B9UA 1AW0A 4LF4J 5LXYA 4LR9A 1EZZB 3NRBA 1RCXB 5E3AA 1TL7A 2BANA 2A1BA 3DU5A 5HL7Q 3AD7C 5J2PA 1YX2A 3UPFA 5C42B 1R0CB 3QPIA 2M5YA 3GYNA 1S6OA 1HPZA 4DPYA 4URSA 1NJWA 3MM9B 3I0RB 3BB5A 4MKVA 3OTBA 4L75A 1XMQJ 2ZOMA 5FIIA 1HIYA 4S0MA 4NLXA 4WXWA 3RYLA 2ACYA 2U2FA 2HLUA 5DDPC 3GU0A 2C1EB 1IR2A 2MXYA 3DOLA 2Q79A 1RBAA 4NCGA 3PO5A 1RT7A 4OI6A 3D28A 2OI2A 4AL5A 2I5JB 4MJKA 4PRFA 2CKWA 2HHTA 4IUFA 3SQGA 2E9TA 3MEDB 3I96A 1B0PA 2WOMB 5IV3A 1F5CA 2QTWA 4K4YA 4FF3A 3KWMA 2DKOB 3CB4A 4NA2A 7FD1A 3D67A 1OQ6A 3FUYA 1N32J 1RAJA 1RTHA 2IVYA 2FPHX 4LQ9A 2R7SA 2HNYA 4G1PA 4DUYJ 4HTJA 4DG1A 4RW7B 4DV2F 4TQSA 4M1KA 1LW2A 3GIMA 3EDQB 1H7WA 4AYBD 2ZBRA 3IG1B 2IBOA 4H4KA 1MN9A 4YB1P 4B9MA 3BF4A 2L08A 2HHUA 1T94A 5DZ6A 1S99A 4RPFA 2JFKA 3W1YC 2PC6A 1UVMA 2GQCA 4CM2A 3CJRA 4LRBA 4ED4A 4HHJA 2JEGA 2GGPA 1JXLA 2M3DA 1B4SA 3M32A 4NLOA 4RO0A 1FESA 1J5OA 1NJXA 2MQNA 2CJBA 4ED5A 2L9WA 1ZS6A 4Z2XA 4OX9F 4DSIA 3NNCA 1S1TB 1TK5A 1KKHA 5F8HA 2NYIA 4ZN1A 1R43A 1S12A 3W2VB 1N34F 3OFEA 2Z57B 1NSPA 2MGZB 4Q0BB 1E6VA 2IRXA 2RF2B 5HROB 1SL0A 4P75A 1WC3A 2C2MB 2JL9A 2P2CB 2OPQB 2AZ1A 2AZ3A 1VK3A 2QGFB 3TAPA 4QIFA 1YRTA 5DDOC 4X2BA 1PC5A 2A3JA 2B5JB 2XSFA 4I6AA 1VI7A 2ABYA 3B82A 3OXLA 2CQBA 3MF5A 1TAQA 1X4FA 2MDAA 2CDQA 2VZ9A 4NI2A 2WAQD 3R7BB 1BXNA 2LEPA 4F0MA 4Q5VA 1WOOA 3IWLA 3GYGA 4A4JA 3FRYA 4LF5J 2DNQA 3OQ2A 4CCHA 4FF4A 2R8KA 3QJPA 3QQCD 1N6QB 4OJGA 2XYPB 3SQOP 2HHSA 3ZFVA 1RUSA 2CUYA 4KO0B 2RDDA 1X4HA 2C3PA 2HVIA 4UOHA 2CA9A 4AL6A 3GYXB 4FS2A 3JYTA 4DLEA 1VQ8S 1EHWA 2MJUA 5A0YB 4ZCIA 3ZO7A 2QL5B 4PWUA 5KG6A 2WBMA 4KAIA 1KVJA 3IBCB 1JLQB 1G1XA 5EHHA 1IKYA 4DV3J 3CUNA 1T03B 4KHRA 4W90B 1LWXA 3M6XA 4KGMA 1N5YB 1WHXA 4LSNA 1IKXB 2L41A 3BYRA 4Y2CA 8RUCA 1FK9A 5D3GB 2X51A 1TU0B 3MFIA 1RT2A 3EJMA 3KLIB 3NS7B 4WU2A 5U47A 4CP5A 4DR6J 2C3YA 3FKBA 2RUSA 2P9EA 2KG0A 2RRNA 2XYGB 3N6NA 1UWAA 5LOQA 2HW3A 3H4BA 1Q82T 2IMOA 2AJ1A 5GAEU 2CYYA 4ECSA 2WZ1A 1S79A 3FVYA 4B3SJ 1RTJB 4L3KA 2CIMA 2DD8S 3H2LA 1PYTA 2AEFA 1DTTB 1FTCA 3CMQA 4LRFA 5EUHA 2DR5A 1VQNS 1HYSA 2KL8A 4MIWA 4ICLB 2VA3A 4ZITA 2BE2B 4WTOB 2AP6A 2JH3A 2OKQA 4YHHF 2IJNA 4FVMA 1K47A 5ETPA 2ZDOA 3KFWX 4ZP6A 1H7XA 1OIAA 2V68A 3WC2A 3UDCA 2ZZTA 3KG0A 1VQ7S 5D15A 3R5BA 1GAOA 4O3QA 2WW4A 3QATA 4I64A 4IDKA 1U45A 4JI2F 2JVOA 4HT5A 3HKWA 1XWLA 5LJ5Y 2PIIA 4FN5A 4C8MA 4GO5X 3EGVA 4QWAA 5ADZA 3FNNA 3V81A 4J5OA 1X9MA 2DGTA 1BHNA 3KNAA 5T41A 2ASDA 2B8QA 2MY8A 2W8LA 4ZCMA 2W24A 4I4BA 5ETOA 2W2QP 3QJJA 1ELOA 1R3NA 1SJQA 2LP4A 1ZYQA 1HBNA 4F4XA 1MWYA 5HSPA 2I0XA 3HJVA 2W9AA 2A2CA 2R8HA 2E5GA 3OTDA 4K4TA 3TEGA 2CPXA 3QT5A 4DL4A 3LH2S 1ACMB 1GX6A 2FVPA 3S1TA 1VBYA 4I67A 3TZYA 2M52A 2PMWA 2FUG9 2RHQB 4FXDA 3KLEB 2M9KA 2G1HA 4OHYA 3CULA 2CPZA 3O6QA 5KOWA 1DTQA 3NNHA 1HL6A 2RIJA 4X4NA 1S6QA 2XLJA 3MM6B 2VQEF 1GXLA 3TUJC 5KFQA 3WX4A 3DYAB 1H2UX 2HFNA 3EUNA 1U8WA 2LXUA 4USJC 2W4DA 1YJ7A 1LWEA 3AXKA 2VICA 3TAMB 1WDDA 1DJ0A 1YDLA 2BEFA 3I0SA 2DGWA 4NYPA 1ZM2A 3OFGA 4MK9A 3DRYA 3UNGC 2NYHA 1VK8A 3MM7B 4K5SA 3QIDA 1S5ZA 5EN1A 3DRSB 2IFXA 2J9DE 3W5XA 1C1CB 1MROA 4R0JA 5LMUJ 5K8OA 3R3TA 2OH2A 3DGVA 1TKZA 4DUZF 2J6SA 2BJEA 1VHIA 1FKPA 5A76A 4NASA 1TK0A 1YLXA 1N5SA 2MLYA 3KLGB 4CIOA 4FPRA 2D69A 2OFHX 2CJQA 4ENOA 3UI3A 5I3UB 3D6FB 3IXQA 4WF9Q 5IT4A 3MURP 4QW9A 5K5MA 1U0HB 3K57A 2VG6A 1RU1A 1XK8A 3P49B 2XY7A 2D1CA 3K59A 3SIPB 1NK6A 1HQUB 1PILA 3PR5B 1I94J 3DRRA 2B4OA 2JSXA 5A8WB 1KFDA 2AJQA 3GIRA 4LRCA 2BM0A 2VL1A 2XGPA 3MM5B 1BUXA 2RT3A 3RBXA 1X4AA 4KGZB 4QIGA 3CPWR 1TKTB 5KFOA 3PW5A 4HR2A 4KKOA 2EC0A 1UJ6A 5B0AA 1NUEA 2BDPA 6FDRA 1D9FA 2JC0A 5K8PA 1X9SA 2AIRB 4YB6A 4QJVA 4JI0F 4P7TA 3TA1A 1LWFB 2HZAA 3IR5B 1FI4A 5JJBA 4FXWA 2MLZA 3CCJS 4USTA 4RU2A 2K1RA 5E3PA 4J9NA 1PO6A 1AZSA 1N34J 3JTPA 3KUEA 4YDXA 4HI1A 2HNDB 5ETSA 4OHVA 1WSVA 1FX4A 2P5VA 4J9RA 2ZD1A 2EFQA 5B0EA 3GSDA 2GHWA 2KFYA 1YK9A 4B9SA 2C2DA 3K5PA 3QGGA 3BPDA 1GEHA 5SZTA 2DNNA 2M0GB 1NB7A 4OZNA 1B7YB 3HHLD 4WWSA 1SH3A 1T8EA 4HTIA 4RZRA 3T41A 3IGVA 2PN6A 4IRKA 5T7LB 5CA5A 3VAIA 2O5DA 2HRUA 5KFLA 3M1VB 2WVBA 1JJHA 2DR7A 3PYEA 2LEAA 2VFUA 4AXIA 3Q8YA 3LOUA 2IIHA 2BKOA 3KJNB 3GTYX 2HQDA 2KDOA 2G2OA 4ZJLA 2XMKA 2UP1A 1JKHA 4K0KF 5I3QA 2FC9A 4LQ3A 2UXDF 1WI6A 3P4UB 4DPUA 3IBFB 1KN6A 1RT3A 4NX9A 4K2JA 1KP6A 3VV2B 3PCOB 3IC1A 3MCSA 1T11A 2MKJA 3OL6A 2LA6A 3L09A 3KMQA 1VBZA 2EK1A 3A3NB 2FJDB 2YNFA 4XPEA 5HAOA 1ZAWA 2E1PA 2H65B 2RQKA 1U1LA 3UWTA 1NK9A 2X7IA 1X4BA 2M70A 6AT1B 3M30A 5IC4B 1ZBTA 3KHGA 1Q8IA 2F9JA 4FBUA 4ANEA 3F41A 4C11A 2B7BB 5HI7A 5DDRC 5HK4A 1YBAA 4X84A 4C0BA 1BWVA 2B4VA 3C6UB 1P6TA 5A2QU 3BSAA 1OY9A 3BH6B 2NZCA 4J9MA 2JRSA 3MMBA 4UOGA 2GX8A 3PTWA 3R5GA 4QIWD 2J9EA 2OAUA 3MM8B 4UY8T 3ENAA 1Y5LB 5IOLA 2KRRA 3PKMA 3H59A 4NA3A 3SFGA 2ZJPQ 2DGSA 1CC8A 4CNYA 4EFAC 2V8VA 3HSGA 4ZIWA 3H4DA 4ECUA 1N8RT 1XBWA 2UVUA 2RJZA 1H98A 3RBEA 2MZJA 1UFKA 2D9OA 1VISA 1JLFB 4NE9C 4GO7X 2WRMA 1V9OA 4LFCF 5KT7A 4OYMA 2QA4S 3KJVB 1IWGA 2AJ2A 4WKYA 3VWSA 1RHRB 3BSNA 4EBEA 4A48A 4YS2A 2RS8A 2MHEA 4B9LA 4DCJB 1SL1A 5D0GA 1B3TA 4OFZA 2GC8A 1N0VC 4DZDA 2ILYA 4KHPF 2E1MC 3SEOA 4QWDA 2DNLA 1RZMA 2D74B 3Q8VA 2WVCA 2FJAB 1SXLA 1LQ9A 4BLGA 1CS4A 3KKFA 1RT1B 4I2PA 2W2NP 5ETNA 4C9DA 1OS5A 2CFXA 2QJ3A 5DETA 4P9SA 3PO4A 1QUPA 4ID5A 4PQUA 4YR0A 1SCJB 1KTQA 3ULHA 3T5LA 4PG8A 1IQZA 1UL3A 3P5TL 4DR3F 3W2WB 3I6PA 5MLCV 4MKYA 4TQRA 5CXTA 4B9TA 3D2WA 2MB0B 5T14A 2IVFB 4F0HA 4OI2A 4DXLA 1KLMB 3IM8A 2JVRA 4RNMA 3HZEA 3C16A 4CLYA 4G1QB 2E5LF 4ZLPA 1RHQB 5F3ZA 2GHVC 2X1BA 3H20A 1NBEB 2HSEB 3KK1A 1QM9A 2A10A 4OYOA 4U8VA 4YMEA 3U02A 1VRQC 4C0OC 2KG1A 1N88A 1J5EF 2C2KB 1HNXF 1HQEA 1WHYA 3QYYA 5J2QA 4CO2A 2W9CB 4DV1J 2CQ3A 5A8RA 4F25A 2ZHOA 3PHTA 5L9NA 2FYXA 3K17A 4LR8A 4CH0S 2KFNA 4NXMF 3IRWP 1X5OA 4NCAA 4ZHRB 4DBQA 3UD5A 2L48A 5K9FA 2Y1JA 5F8LA 2NXUA 2FVRA 3OR2A 4DWIA 4MIBA 2BBEA 5M2RA 4X4QA 2FHOB 1C4AA 1NMEB 4M5LA 1X7VA 2HHXA 1URNA 3T9ZA 4GVBA 4U8YA 2LXIA 1NKEA 1HWIA 2AX0A 3EGNA 5C24A 3CJ5A 1CJUB 3IR6B 2QZ8A 4IR9A 5EWEA 4CYUB 3RG6A 3M2UA 2HGLA 4C2MA 1VBKA 2HBZB 1TELA 4C4WA 1TKXA 5L38A 1F5AA 4J9QA 3CCLS 5HVFA 2CZVC 1HPZB 2UXBF 1FFWB 4X66J 1NHKL 3BGLA 2AF6A 3KLFA 2JEIA 1O8BA 4EO8A 2D41A 4NLRA 1Y0HA 2OPPA 2KJWA 2HFSA 2QLWA 4V1Ak 2LQ9A 2ZKUA 5E2QA 2NSCA 3KJQB 1RACB 3AB2B 1A9NB 1QLNA 4NCGB 1RHKB 1HWJA 3IAM9 3TQEA 2HQ3A 2V2VA 3BREA 2MKSA 4H4MA 2JEFA 1S9EA 4ELUA 3FJ2A 4K4XA 4Y2IA 5GAHI 5BYRA 5DG8A 2DHHA 2F8EX 1SUQA 2HBYB 2I9SA 3DCAA 2OTJS 2JZ5A 2APOA 3HHLA 2P6TA 5M2PA 4CLPA 1RTHB 3DMJA 2MQQA 2M88A 4RW4B 1L5UA 3BJYA 3GPAA 1RWXB 2YKNA 3D9BA 1UA0A 1HBOA 5L1LA 3AB4B 3NOCA 4I6WA 3FMWA 3UD3P 1FTRA 2BRKA 4A46A 2MTLA 2DXDA 2NXNA 3J81j 5ETRA 1HWUA 3J80U 2BRLA 2K8GA 3BSOA 3BQ1A 2Q66A 1NRKA 2POKA 4OI1A 3VGTA 1B70B 3JS9A 1SI9A 1BQXA 1SV5B 1N33F 1DAXA 1KONA 2UU9J 4O44A 1MMNA 2O1PA 3M32B 1R89A 4DV0F 1J5OB 3I82A 2RD5C 4UOCA 2E9ZA 2EFGA 4BDPA 1SVDA 1T3OA 4OHZA 4YQWA 3LA0A 2X3GA 1E6VB 4WIIA 4RW8A 1JLGB 3A8EA 3QLHA 3PV8A 3TUPA 3UE2A 3FCHA 2HMIA 2ASLA 4H4KC 1S97A 1RQ0A 4M94A 4DUTA 3BGFA 4LFAF 2GVZA 2V6AA 2YH0A 3VHQA 3BM7A 2VODA 1R0BG 4NI2B 4UOFA 4X62J 1V5IB 3J7YI 3THTA 1YHQS 2WSFC 2KM8C 5CYMA 4ZS6A 5B09A 5KFXA 5DLFA 2V8HA 5AT1B 1KQKA 1HNVB 1X5PA 5GADU 1CQNA 5HP1A 3DN9A 2FIUA 1U2CA 3G6ES 1JLCB 3OR1B 3MD1A 4MT1A 3DI6A 5KAKA 3C3LA 2A2DA 5KFMA 4IG3A 4F02A 1I3OB 1RTIB 4CLSA 3FGVA 5EWFA 2YX7A 1GFWB 3SYZA 2E9RX 1YI2S 4NLTA 2NXEA 5L1JA 4UW2A 5E3CA 2QG9B 5GMDA 5C42A 3MPVA 4YB7A 3S01A 3LF0A 1JXEA 4NLUA 3ZTSA 4Y3CA 3FQLA 2YKMA 1B99A 3DC2A 1FK9B 3MM9A 3I0RA 1O6XA 3LALA 4LFBJ 4HDHA 3JTOA 3RZAA 4L76A 4FNHA 1RT2B 4Z7YA 1U1MA 5D78A 1QAYA 4OHXA 3R2DJ 3RGIA 1FKAF 3PFOA 2JDJA 1IBCB 2ZWPA 5LJ3Y 3C14A 2VBWA 4KHPJ 5B0BA 3AA9A 4DV6F 4LBPA 2G2ZA 2I5JA 4EU0A 1YJVA 3CCMS 2W7AA 1IJEB 4R25A 1P1LA 4DEZA 1U2RA 3MEDA 3WBZA 5BJRA 4RBVA 2F63A 4ILMA 2HQIA 7AT1B 2WOMA 5KFGA 3CE8A 1E6YB 2R7TA 5IT9Y 3G6XA 1FVQA 4NLVA 1MU2B 4ID8A 2VDHA 3GFXA 2GV1A 3CVKA 4PEOA 3GG0A 3HK2A 1W26A 4DZ6A 4ETXA 3VF0B 1SKUB 2CDRB 5IT0A 3MAAB 3OVBA 2W2MP 2OTLS 2VASA 2HZCA 3IG1A 4DL7A 4B3TJ 2C2NA 5KT3A 1DHMA 1RHMB 4ZVSB 3A3OB 4CH7A 4ELTA 2R2RA 1AA1B 1N0UA 1EAYC 5K20B 1FWPA 1X0PA 2BE7D 1PKUA 3D1HA 4WZMA 3TEHB 5F8GA 3T6JA 3G82A 2XQCA 3ZTPA 1R6YA 1FEHA 3V81B 1FNMA 3UR0A 3ENWA 3UDLA 1Q7LB 2W2OP 2AD9A 2VV5A 1BWEA 3NBPB 1EETB 5J2NB 3FEZA 3TJ9A 1S1TA 1W2IA 4LSZB 3NOGA 3VALA 1XR7A 3W2VA 2MGZA 4Q0BA 1D9DA 3FRZA 5HROA 9RUBA 3GFHA 4WZQA 1HBNB 1EIYB 2FVQA 2DGOA 2OFGX 2VB6A 3FDSA 2FJWA 4RKUC 2B5JA 2LLZA 4LF6F 3KOAA 5KFVA 2FZCB 3MHYA 4I2QA 4F04B 1M5HA 3A8JA 2KHCA 1MG7A 2Z2ZA 3A8KA 2JOQA 4GC7A 3R27A 4DSJA 2IJRA 1OQ3A 1N6QA 1RWWB 2ZUAA 5D0EA 1S6QB 3HO1A 3HFKA 3M2VA 1T95A 1MLAA 1OPIA 1KNZA 1HNIA 3NAIA 1RCOB 2AJ4A 3LP2B 1N36J 4DF4A 1FJEB 1C2PA 3N4WA 5ETVA 1LWEB 1JLQA 2WHOA 3ITHB 4R5PB 4O23A 2GIRA 2H3EB 1SIZA 2HHPA 2Y1IA 3KHLA 1RA7A 1JMTA 4AL7A 1QD1A 3I0SB 2ZZMA 3RW7A 2ZJRQ 3BS9A 4JI1F 2VG5B 3GJSB 3UFCX 1S4FA 5M2UA 1HR0J 3N6MA 2ZOFA 4USWA 3PZPA 4JI5F 5G0RB 2YNHB 1EKSA 5D3GA 2R7WA 1MROB 2VC0A 3QSYB 5IQ6A 3AD8C 1TKZB 2JLGA 4DFMA 3KLIA 2UUAJ 3ET6A 1FKPB 3G86A 3BEGB 2HIYA 4DV5J 4EYHB 2Y0BB 2WCXA 3RJMB 3KG4A 3GILA 2DITA 3RAXA 3R5AA 4WFBQ 1LW0A 3KK2A 2XMAA 3QGIA 1IBLJ 3QFWA 2ROPA 3AHPA 4A8WA 4UTGA 2G0IA 5D4OA 1U8SA 3DRRB 3OSNA 3OV7A 3AOAA 2E7XA 4PABA 1DTTA 1S7HA 1WOPA 3V4IB 4NYOA 4Z37A 2IC3A 3SBMA 1NJZA 4C3LA 1CPZA 2AJFE 1XR6A 2IA6A 2BE2A 1VQSA 2FY8A 2R3VA 4J9PA 2KZMA 1RYSA 3JQMA 5KTQA 2XZDB 3K5LA 4XIUA 1I51B 4J7CA 3U27A 2HVDA 4F26A 1UVJA 2W8KA 1BLUA 3IS9B 4JUZA 3LWMA 1YZ7A 3LO3A 1QTNB 1WNEA 3BGRB 4OYBA 4OZLA 5IC6B 2CQHA 8AT1B 4WFNQ 3B8HA 3M9NB 1CULB 6FD1A 5HBMB 2RAQA 3T1AA 4DPXA 1QSYA 1L3TA 1KWMA 2YQ0A 1K1QA 3P96A 4IQXA 3UCZP 2GJFA 5L8RC 1AT1B 1K8AT 4IFYB 3CCSS 2LFVA 1NPRA 1XMOF 4GMKA 1FA0A 1H38A 1HNWF 4IG0A 1CJKB 4LFAJ 1PYSB 3N5FA 2V2KA 4R8UB 1HHSA 4DPOA 1KQSR 5KFJA 3OTOF 4TU7A 5B7WA 1NH8A 3MMCB 1O0PA 3EZUA 3HT3A 2CQ2A 4KB7A 1FD8A 1YSJA 2HFUA 4M5IA 2DR9A 1HW8A 2CVIA 2V63A 1FXLA 4WYWA 2LKZA 2CQ0A 4DDFA 3EZOA 2UVRA 4NLPA 3Q89A 4J9VA 2H5JB 5IWAJ 3CJ0A 1AUSL 5J2MA 2UV8A 2J9CA 1K1SA 5C2GA 1FDAA 3TX0A 3JAMU 4U95A 2XHCA 2ZNZA 2V8PA 3MM6A 3GQCA 1S0MA 2DRBA 2DNOA 1RT3B 2CPDA 3BBCA 4C97A 2HFZA 3OVSA 1NK7A 1RA6A 2ZDPA 3FMBA 1XNRF 1UMJA 1IKVB 2XSJB 3CC7S 2VJUA 2GZOA 3IAS9 4OJHA 2YTCA 5F8JA 3TAMA 1RAHB 3SV3A 4N7TA 1WF2A 3KNGA 2A6OA 5H9FJ 3NGSA 4MMOA 4MIAA 4GKJJ 4ZLJA 2XMTA 4CO4A 3CC4S 1S1XB 4GC6A 3MM7A 3DRSA 2KYZA 4P73A 3M8RA 2ZH7A 3THPA 1C1CA 3CWJA 5LM7E 3PACA 4NZ0A 2GNKA 1Q81T 4CWBA 3DM2B 4M5GA 2EFPA 2K06A 1Q16B 3L7PA 3KLGA 4DU7A 4B08A 1TR0A 1Y7PA 4LF4F 2FGOA 4DFKA 2W9BB 3D6MB 4BC9A 3I56S 1Y11A 2BKNA 3SFUA 3HPOA 2COLA 3G4SS 1U0HA 1BC6A 1RAAB 4XPCA 2EFVA 4YR2A 1RWNB 3MR2A 2DNPA 5JVHQ 4JP8A 4DV7J 2RHSB 3ZXWA 1XMQF 1S77D 4OHWA 3U1MA 3B54A 5KFZA 3L9ZA 5A8WA 3T3FA 3R8YA 4C6AA 1JLAB 2CJKA 4WFAQ 5KFUA 2J5AA 3EGWB 1UW4A 3MM5A 4KHMA 1T9WA 4IO9Q 1VQMS 2IDEA 5FD1A 2RS2A 3RB6A 1TKTA 2O67A 3T1YJ 2KXFA 4HH1A 3DRXA 4WU3A 4PQAA 4M8LA 2QL7B 2OMOA 2FLPA 3L3CA 1WHWA 2HG4A 3FBEA 1G6BA 3C19A 4QWCA 4I2PB 3Q22A 3CCRS 3NNAA 1LWFA 2Y8WA 1ICEB 1WORA 4ID5B 4PQUB 2M2BA 4PXBA 4YY3J 2XEXA 3AD9C 1N32F 4H4OA 1RWPB 3VQTA 1GH8A 3A12A 1S9FA 1H3DA 5KFCA 2PA3A 2HNDA 1LK5A 3CD0A 5J1PA 2OD6A 4C3KA 2GHPA 4QCLA 3QAEA 3VGSA 4P2SA 2ZM6J 4YOEA 4K59A 1IM4A 4DCOB 3KK1B 4U67Q 4OJ1A 3FQKA 3DOKB 1F6TA 3I5BA 1GT8A 3LWLA 4OZ5A 1RDRA 2CQDA 1S76D 1FHTA 1BMQB 5DG9A 3CJSA 5DGBA 1HQEB 5B0GA 3JSYA 2CNKB 3NY0A 5J2QB 1U1PA 3VGUA 5AXMA 3W9IA 2O01C 4K4WA 3QRRA 2ASYA 5T7LA 1MMDA 3M1VA 3J81U 1SC1B 3CD6S 1UWBB 4LF8J 3C2PA 4ECVA 3NWRA 1U7LA 1XMBA 3DXSX 2ZNYA 2CPIA 3RB0A 5E3RA 4CO0A 3G6VA 4X4SA 2F1FA 2OIHA 2WVEA 2CPJA 1RHJB 1R8PA 1Y9OA 3POTB 1XR5A 4RW9B 2IPOB 1DFDA 2HS0A 1NXIA 4OI0A 4WP9A 5KFSA 2DYAA 1G4CA 2DRAA 2J8SA 3JTNA 4LF5F 1UEUA 4RBUA 5CYQA 4WK1A 5C24B 2EEYA 5DDQC 3H2UB 4TLQA 2PE8A 1GNKA 1Q7YT 4I1TA 3Q8UA 2ROEA 3OTEA 2YWGA 3HVWA 3OHBA 3MR3A 3GFZA 2QMXA 3C6UA 1YTYA 2ZEJA 3FSXA 2HWHA 4JI6J 1PBAA 3H98A 4XDCA 4DQRA 1DURA 4GKKF 1FWKA 1TKXB 3LTOA 1KFSA 4ELVA 4WCEQ 1LNQA 4G1IA 2W1BA 2AMCB 4EMDA 3GLJA 1WTBA 2B7CB 2LQ5A 4DV3F 1URRA 2E7WA 4WE1A 2HK3A 1ZZFA 2XG8A 1U02A 2RVJA 3K8WA 5KFFA 4U7UK 3K5OA 3KLFB 3OFHA 3CGIA 4WP3A 2DGUA 3Q23A 1R8HA 1RLDA 4WXOA 3UN2A 1J27A 1VQYA 3HDSA 2HYIB 3DDIA 2W01A 4LRAA 1WUUA 1Y5NB 4MK7A 3BKFA 2HK2A 4DR6F 1Y00A 4H4MB 4DOZA 5A8KB 2WBRA 2VQFJ 2MKHA 2HVEA 4PG6A 2CZ9A 2MJNA 2VONA 3GR1A 2DNMA 4F3MA 4ILRA 3IWNC 3HFZB 2VBXA 1VBXA 1VC6A 3EM1A 1IBKJ 3HHLB 5KT4A 5KFIA 2XS7A 1YJNS 1RT1A 3GJRB 3RUBL 1VR6A 4B3SF 1HD1A 2WONB 4ED8A 1U6ZA 2NLWA 2B9WA 2OGUA 3PKYA 1S1WB 4C8NA 4C98A 2RQMA 3HULA 2OEMA 2DH8A 1MW7A 3ZZYA 1WI8A 3D7SB 4DHVA 3I87A 5AE2A 1RWUA 4I69A 2V94A 3BR9A 2IJFA 1SJFA 2JX2A 4I7FB 2KXHA 4N8NA 3MEKA 2CADA 2RDIA 4JI4J 2ZH2A 4F50A 1KLMA 4FYXB 5ETTA 4I0WA 3RTVA 3V6HA 4ATNA 4G1QA 2MQLA 4UF4A 1VC0A 4O44B 2V0NA 2VG7B 3HHLC 2ZH3A 4X64F 1S9GA 1Z2ZA 4NMXA 2BJ9A 3CJKB 2W9CA 1IVZA 3R6GB 3EXCX 1OSDA 2R42A 5BYQA 1VS3A 4RW8B 2XMVA 3R5CA 4N56A 5ETMA 1YGYA 3QLHB 2NSBA 3HP6A 2R8GA 1R0AA 2BW7A 4ZHRA 4QU6A 1NPPA 4USMA 2PO4A 5EWGA 4NA1A 4JYAF 1H73A 3UN5A 2QLFB 4ZCKA 2DK2A 4Y0FA 2RQCA 1GX5A 1FRMA 5D6GA 1QSSA 3OUYB 4CQ1A 2DPIA 2XMWA 3ILLA 3KMSA 5GMEA 2AV5A 1UVIA 3OT9A 4DR2J 2YWEA 4B9NA 2H51B 1TUGB 2ZZNA 2KT2A 4OYWA 5C25B 4DL3A 3Q8SB 5L1IA 3K7RA 3IRXB 4NLYA 5LXRA 4LVNP 5AE1A 1CJUA 1SKSA 5J1EB 3BDEA 1DARA 2ZBQA 4CYUA 3K0JA 3MAHA 2CVEA 4IO1A 2AGOA 4M63A 3ZZPA 2QT7A 4ZK7M 5ITHA 5K14B 5E7OB 1OWXA 2DEJA 2YKMB 1TP7A 1VRUB 4OL8A 1N5QA 2UUWA 4M5DB 4JI7J 1PAUB 5DM6Q 2KU7A 3P3DA 1CSJA 4URGA 1Q8KA 4QWBA 2CPHA 1YJUA 3C14B 5LMUF 1SPBP 3DNCA 3NXZA 2B51A 2YKOA 4QZVB 2DCLA 5CD4A 4TKTA 1GMVA 3OHAA 2RU3A 2DRDA 2R7QA 5LSRA 3G71S 1HI8A 2H5EA 1FFGB 5F9NA 3E51A 3TP2A 2BQUA 2OPRB 4J90A 2F5GA 2DNGA 1V3ZA 1V3RA 2HQCA 5D0RA 5D77A 2MKYA 2DTJA 5H9FK 2VD3A 2E1AA 4NL5A 2FQQB 3B78A 1I94F 3S8SA 4RW4A 4NXNF 2BJ3A 1TMJA 2YX1A 4DV4J 4EBCA 4FP9A 2WSEC 2QIFA 3M05A 2V9WA 2N3LA 4ILLA 1X31C 4JI8J 1NDLA 1S6PA 3QGPA 2UUCJ 2X1GA 2FB0A 4QQBA 1FJCA 1X0FA 2E1CA 1S59A 4RWWA 4TY8B 5HATA 2DHAA 3LGNA 1NKCA 1SV5A 2FJXA 4OYPA 2ZE2A 3G82B 1OJ4A 1MN7A 3S7RA 3PIPQ 2HS3A 4LMZA 4N41A 4LR7A 4QU7A 3MMAB 3D3CJ 1F9FA 4KYZA 4F8RA 4P2FA 2QMUB 2XM3A 3CJ3A 3N6LA 4USVA 2QLJB 1TUWA 3PM9A 2ZC3A 1JLGA 2ASJA 1APSA 4AXJA 4X65J 1VQKS 1YITS 4A8MP 1U1QA 4I2QB 3QAUA 3W64A 4L72B 1HWKA 1F3VA 4ZPTR 5HMYA 4N8OA 1MWZA 2RKIB 1K9MT 4KTQA 5CCLA 4K50A 2GO8A 1XNQJ 4NLGA 5CYJA 4ZPCA 2Y0SD 3HF5A 4DSEA 1RHUB 3JQJA 2DO4A 2B56A 1HNVA 1FD2A 4U6PA 3NCRA 3M2VB 3F0NA 1M1HA 3EWGA 3MUVP 4M5HA 1JLCA 4J37A 3OR1A 1HNIB 1AB8A 3NAHA 4GKKJ 1DRZA 2B9EA 1BQNB 2E66A 2DVIA 2HHHJ 1RTIA 2YWKA 2CZ4A 3MOZA 1AFIA 4KFBB 2RH3A 1WC5A 4MYUA 2FDNA 2VHGA 3TANA 1U1RA 5KT2A 1ZTWA 4NEYA 4IRCA 3CMES 3DLGB 4ZMMA 1QE1B 2N4DA 5C5JA 1KSPA 1B64A 3CTRA 4XDDA 2ALZA 4L73A 4JI3J 4ALZA 4M95A 4ECXA 1UP1A 1RADB 1N5VA 3FCWA 2ZH6A 3V6KA 1FT8A 3NCQA 4NCBA 3AQPA 4Y65A 1TVRB 2DNYA 1VIXA 3ET6B 1VHFA 3AQOA 1I6JA 3BYPA 2Q3PA 4DF8A 1BQMB 1ZAVA 5HQMA 4Z7CA 1YQHA 2R7VA 1KOOA 5GAHU 3CJ8A 4QBUA 2HRTA 5A6PA 3DLEB 1LW0B 3KK2B 1PIEA 3TZWA 1F2GA 1CJTB 1RXOB 4EZ6A 2B8PA 3NKYA 3DGPB 4KPYA 3PHEA 5F3TA 2ALYB 4OYIA 2J0SD 2XY5A 3H25A 2BVZA 2B9YA 2RE1A 1LK7A 1E6YA 4AQYJ 2R7RA 3DFEA 2V9KA 1MU2A 2X1FA 2IC3B 3KXDA 2EVZA 5JUMA 4LUBA 1H0HB 1C0UA 4HHUA 3TZZA 3R6LB 1LFWA 1R8AA 4A47A 4ZCLA 1FKOA 1N4LA 2FJVA 2CPFA 3MAAA 4RL1A 2V4QA 3AOCA 3FBCA 3SSRA 2KXNB 2MYFA 2BX6A 2DR8A 2HEKA 2IA0A 3KLVA 2FHKA 2XHWA 4X64J 4WFXA 3DLHA 4ZVOB 1L3VA 3CO0P 1O5JA 3TO8A 4DL6A 3A13A 1A0OB 2DGVA 2LQBA 4FYYB 1X4DA 3Q86A 1RK8A 2QA2A 3NBPA 4DR7J 3J7A1 1NHUA 2YXLA 1EETA 2V4JA 5J2NA 2R7OA 1GTEA 2GQ2A 2LMIA 2H4YB 5HJXA 2ZH8A 4IG0B 3CDEA 3JXOA 2ZOGA 4IFVB 1DLOA 1JLBB 2ZBPA 2KT3A 1RT5B 1Y5IB 2E7VA 4JYAJ 3I4PA 4YB5A 3NLCA 2R4FA 3J7YU 1GXTA 2J0XA 3WQPA 2H1YA 4P7VA 3DU6A 1U24A 1EQ0A 3LP0B 5L1KA 2BW2A 3I32A 1AXQA 3PRDA 1EX8A 2U1AA 1X4EA 4FDFA 2WSCC 4PUOB 2ZFHA 3ILOA 3CT9A 4I68A 4DV1F 2N4CA 5J2MB 3NGUA 2JEJA 4LIWA 3HLUA 2W4CA 3BR8A 2DNZA 5F8NA 5IV4A 4Q45A 2YY3A 1S6UA 3LP2A 2LCWA 2OJ3A 5E5NA 3W65A 3PYFA 1HKAA 2VBYA 3FC9A 1RI7A 3OL9A 4QPTA 2V8DA 4NLSA 1WKJA 3EICA 3ITHA 4R5PA 5KFNA 3QJLA 3NGDA 4YN3B 3E3XA 1TL4A 1P9YA 3PJWA 4ZP7A 4CLLA 3MZIA 3CO9A 1WF0A 2VG5A 1RWMB 3ISNC 4CLUA 3H5UA 2IM1A 3R2CJ 5G0RA 1MSWD 1ZM9A 3HXMA 2YNHA 4MKBA 2PFFB 2ZITA 3OXGA 1UVKA 3CC2S 4O0IA 1IBMJ 4I56A 2F65A 4CH1A 2UVWA 3TVKA 4Q8EA 4EUVA 2KO1A 3ZZZA 2HQGA 1JXVA 4HEA9 1SH0A 3EDRB 2NUUG 4LF7J 1TTHB 3M2RB 1S72S 1T7PA 3MPWA 1CLFA 3DDKA 2VUGA 1HNZJ 1P9QC 1ZA1B 2G13A 1F2HA 4X66F 3Q0AA 2EG2A 4F4KA 1S0VA 3AAWB 1RSCA 2BOPA 4NXNJ 2GCFA 5A2QY 2YQ3A 2G9OA 3V4IA 3BKTA 3PJXA 4DPTA 3EPGA 3ETOA 2K3KA 2UXCF 4PWWA 5AXNA 2IY5B 1UFWA 3O44A 3U7JA 2FVCA 4ZP8A 2MPUA 1KVIA 3I31A 3W63A 4ZLLA 2J7WA 3IS9A 4ANDA 3LGMA 4LBIA 5RUBA 1T05B 3NS6A 3BGRA 4OZJA 3QRQA 4ZOSA 1DQ9A 3KLHB 4HH0A 3J7AN 4P2XA 1CULA 3ZTQA 1RGVA 5HBMA 2PEHA 1H6KX 4QW8A 2C3MA 3N5BA 3D66A 2KYXA 4H4OB 4CTAB 2F9DA 2ZUGA 5GVQA 3HVAA 2MQ8A 1C0TB 4IFYA 1FF2A 1VRTB 2PD1A 1QJHA 5D4PA 4IH6A 1RISA 4QYZJ 3OJSA 2XMUA 1CJKA 2HWIA 4R8UA 4MFBB 1Z4UA 1XN9A 2BM1A 1NCLA 5DZ7A 4USKA 1I5OB 3QIPB 2N7CA 3MMCA 4FXVA 1D8ZA 4CLFA 2X3DA 2GA7A 2Q6CA 4QR1A 3BGUA 2UU9F 4NRTA 1F60B 3A8IA 2JWNA 1ZPVA 2H48B 1V6HA 5SUHA 3HSDA 1LKZA 4E8UA 2F8MA 4DI6A 1KHWA 4DS4A 2RRBA 1FVSA 1IUJA 4JV2A 4OYZA 4Q43A 3F73A 1LOUA 3HVTB 3K89A 1X4CA 4Y28C 1EP4A 2YNIB 5I4MA 1VOMA 1IKVA 2XSJA 1HARA 1R8BA 3Q8RB 3ONQA 1U49A 4X62F 4R0EA 5KG5A 1G3OA 3TX8A 3O3LA 1RAGB 3D54A 3SSQA 2N82B 2KTQA 1LXJA 1OPZA 2A0FB 2C42A 3SXLA 5CYQB 5KFPA 4ZN3A 5D4NA 4QR2A 2KVQE 1RT6A 1ZTTA 2QSWA 3OLBA 1S1XA 1IQTA 2YH1A 2HKEA 2XC9A 4LF2A 1TL1A 1FWLA 1B7FA 1WG5A 1QAJA 2CNLB 2LQ8A 5GMKa 3Q24A 4UY85 5HQLA 1M5PC 5F0WA 5ETKA 4RUHA 3DM2A 3M8YA 1A7GE 5GAGI 1SJ1A 2IDLA 4WE1B 2W9BA 4ZVFA 5DRKA 2R2TA 2C3OA 1V5VA 1WJ9A 1KC8T 3QRPA 2VFRA 1KLNA 1K0VA 1WC6A 1S1UA 1UEVA 3NS5A 3PW0A 4F3OA 2D3O1 1WEXA 4ER8A 1S7IA 3C6TB 3A4TA 1RTZA 4G65A 4LFBF 1UJ5A 3G6YA 4EBDA 1TV6A 3MCNA 2O3DA 3C46A 1JLAA 3IWXA 3KHHA 3DLKA 4OX8A 3CCTA 3H40A 2GIQA 8ATCB 4CO5A 2AGPA 2BUNA 2XZTB
chains in the Genus database with same CATH topology
3V81A 1WF2A 1A6LA 3KNGA 1HFEL 4J5OA 1X9MA 4JV0A 2DGTA 2KJVA 2LA4A 3KNAA 5I42A 5T41A 2CQ1A 1Z2LA 5H9FJ 3T5HA 2ASDA 5K8NA 4CT8A 2MY8A 4MMOA 4MIAA 2W8LA 2EWHA 3OW2R 4ZCMA 3OLAA 2XMTA 3ISZA 1Q79A 1TFWA 4CO4A 2W24A 4TNOA 3CC4S 1S1XB 1HMVB 4GC6A 1LWCB 3MM7A 4I4BA 2M4MA 2K2PA 4V19X 3MR5A 3DRSA 2KYZA 5B0DA 3M8RA 3QO9B 1FDBA 3QJJA 2ZH7A 1ELOA 3GB0A 1D9AA 1U6BA 3THPA 1C1CA 5F8MA 1R3NA 1SJQA 4TYBA 3CWJA 5DO2A 4PXDA 1FXRA 1ZYQA 1YWXA 2XULA 3PACA 1HBNA 3LAKA 4F4XA 3J7Z5 4NZ0A 4RU9A 2EW9A 1G2EA 1MWYA 2BXJA 1HBMB 1FJ7A 1QY7A 2I0XA 5KFHA 2W9AA 2A2CA 2GNKA 3OXFA 5F41A 4X4PA 1ZM3A 2R8HA 4ED0A 2YNGA 1Q81T 3DM2B 2YKAA 1FCAA 2E5GA 2EFPA 5DQHA 3J7ZT 3OTDA 1NJIT 4K4TA 1Q16B 2CPXA 3KLGA 2PT0A 3L7PA 1OSCA 2HPUA 3QZ8A 3LH2S 4DL4A 4B08A 1TR0A 1HYSB 1Y7PA 4LF4F 2FGOA 2XNRA 4DFKA 1GX6A 3TNVA 3MFHA 2FVPA 3HI9A 3S1TA 2UZAA 2LU2A 2QYCA 1VBYA 4I67A 2W9BB 3IGNA 2M52A 1H2TZ 3TA0A 4BC9A 3I56S 2FUG9 1U26A 2GMHA 3IO1A 3SFUA 3HPOA 4FXDA 3MMJA 2COLA 3KLEB 3VAMA 5E33A 1VMBA 2M9KA 1HD0A 2Z2MA 3G4SS 4OHYA 3CULA 5G4DA 1BC6A 2CPZA 2IM2A 4RW7A 2WK4A 3O6QA 4B3TF 4CT9A 5KOWA 5A6WA 4E98A 1DTQA 3NNHA 2BZ2A 3H5XA 5GAGU 1ZM4A 1Q86T 4Y2MA 4XPCA 1HL6A 2RIJA 3SSSA 4OIXA 4X4NA 2XI2A 1S6QA 2EFVA 4DQSA 2RMLA 4QYRA 3DOKA 4YR2A 2XLJA 1YJ9S 4K5RA 3MM6B 3MR2A 3KYLA 5THWA 2DNPA 5JVHQ 1S9GB 2LXFA 1XMQF 2VQEF 1S77D 1FRLA 4OHWA 1GXLA 2WB1D 3U1MA 3R1HA 2J8AA 3TUJC 5KFZA 5KFQA 3H8YA 5A8WA 3T3FA 2VOPA 3KK3B 3DYAB 3OFFA 1JLAB 1H2UX 3WX4A 2CJKA 4WFAQ 2HFNA 2HAIA 4MAKA 2YVSA 4IDKB 5LT5A 2M8HA 5KFUA 3NP5A 3DLBA 3OL8A 4IYQA 3EUNA 3PEJA 1V3SA 2J5AA 3EGWB 1UW4A 2LXUA 3MM5A 4KHMA 4USJC 3GFYA 1VQPS 2W4DA 3V2UC 1LWEA 4IO9Q 5LSOA 1VQMS 2AX1A 4FZVA 3TAMB 1FRXA 2DNKA 5FD1A 2RS2A 2L9NA 3RB6A 1TKTA 3MDFA 3W3SA 2O67A 1DJ0A 2KXFA 2GO9A 1U1KA 3B4MA 4HH1A 1S1VA 1JJ4A 3DRXA 4TU8A 1U47A 1HBUA 3O2IA 3J80Y 4WU3A 4PQAA 1M5SA 1UWBA